US20110212447A1 - Method of Using FOXO3A Polymorphisms and Haplotypes to Predict and Promote Healthy Aging and Longevity - Google Patents

Method of Using FOXO3A Polymorphisms and Haplotypes to Predict and Promote Healthy Aging and Longevity Download PDF

Info

Publication number
US20110212447A1
US20110212447A1 US13/058,179 US200913058179A US2011212447A1 US 20110212447 A1 US20110212447 A1 US 20110212447A1 US 200913058179 A US200913058179 A US 200913058179A US 2011212447 A1 US2011212447 A1 US 2011212447A1
Authority
US
United States
Prior art keywords
longevity
foxo3a
subject
gene
allele
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US13/058,179
Inventor
Timothy Atchison Donlon
Bradley John Willcox
J. David Curb
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
KUAKINI MEDICAL CENTER
Original Assignee
KUAKINI MEDICAL CENTER
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=41669598&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=US20110212447(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Application filed by KUAKINI MEDICAL CENTER filed Critical KUAKINI MEDICAL CENTER
Priority to US13/058,179 priority Critical patent/US20110212447A1/en
Assigned to KUAKINI MEDICAL CENTER reassignment KUAKINI MEDICAL CENTER ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: CURB, J. DAVID, DONLON, TIMOTHY ATCHISON, WILLCOX, BRADLEY JOHN
Assigned to KUAKINI MEDICAL CENTER reassignment KUAKINI MEDICAL CENTER ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: WILLCOX, BRADLEY JOHN, CURB, J. DAVID, DONLON, TIMOTHY ATCHISON
Publication of US20110212447A1 publication Critical patent/US20110212447A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6883Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/15Medicinal preparations ; Physical properties thereof, e.g. dissolubility
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2535/00Reactions characterised by the assay type for determining the identity of a nucleotide base or a sequence of oligonucleotides
    • C12Q2535/125Allele specific primer extension
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/106Pharmacogenomics, i.e. genetic variability in individual responses to drugs and drug metabolism
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/156Polymorphic or mutational markers
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/158Expression markers
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/172Haplotypes

Definitions

  • the invention relates to a method of using FOXO3A polymorphisms and haplotypes in diagnostics to predict or in planning treatments and interventions to promote healthy aging and longevity.
  • the FOXO3A gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed.
  • the FOXO3A gene is one of the human homologs of DAF-16, a gene that has been described to extend lifespan in the model organisms C. elegans (Murphy C T (2006) The search for DAF-16/FOXO transcriptional targets: approaches and discoveries. Exp Gcrontol 41:910-921) and D. melanogaster . (Giannakou M E et al. (2007) Dynamics of the action of dFOXO on adult mortality in Drosophila . Aging Cell 6:429-438).
  • the FOXO3A gene is located on human chromosome 6q21, from position 108,987,719 to 109112664 (NCBI ver. 36), is composed of four (4) exons that can be alternately expressed, which results in the same protein (variant #1 is described by file NM — 001455.3; variant #2 is described by file NM — 201559.2.
  • the FOXO3A protein is composed of 673 amino acids and is 71,277 Da in size.
  • the amino acid sequence of FOXO3A, as defined by the file “NP — 963853” at the NCBI is identified as SEQ ID No. 1 and is the following:
  • FOXO3A interacts with YWHAB/14-3-3-beta and YWHAZ/14-3-3-zeta, UniProt: the Universal Protein Resource (www.uniprot.org), which is required for cytosolic sequestration.
  • STK4 the Universal Protein Resource
  • the subcellular location of FOXO3A is in the cytoplasm, and cytosol. It translocates to the nucleus upon oxidative stress and in the absence of survival factors.
  • survival factors such as IGF-1
  • FOXO3A is phosphorylated on Thr-32 and Ser-253 by AKT1/PKB.
  • This phosphorylated form then interacts with 14-3-3 proteins and is retained in the cytoplasm. Survival factor withdrawal induces dephosphorylation and promotes translocation to the nucleus where the dephosphorylated protein induces transcription of target genes and triggers apoptosis.
  • AKT1/PKB doesn't appear to phosphorylate Ser-315 directly, it may activate other kinases that trigger phosphorylation at this residue.
  • FOXO3A is phosphorylated by STK4 on Ser-209 upon oxidative stress, which leads to dissociation from YWHAB/14-3-3-beta and nuclear translocation.
  • SIRT1 a Sir2 homolog “SIRT1,” influences several downstream transcription events affecting lifespan, including the cellular response to stress. SIRT1 accomplishes this by regulating the FOXO (Forkhead box transcription) factors, a family of proteins that function as sensors in the IIS pathway and are also regulators of longevity in several mammals. 17
  • mice with a fat-specific insulin receptor knockout have reduced fat mass, protection against age-related obesity and have extended longevity.
  • FIRKO fat-specific insulin receptor knockout
  • 21 Many other mutations in the HS pathway appear to impact longevity in mice. These include mutations in the IGF-1 receptor, 22 IRS-1, 22 IRS-2, 23 PAPP-A, 24 and the Ames Dwarf mouse mutation. 22
  • DAF-16 abnormal DAuer Formation-16
  • the stress responsive Sun-N-K terminal Kinase (INK) pathway appears to require FOXO to prolong lifespan in Drosophila 31 and when flies over express dFOXO, the DAF-16 ortholog, it can markedly increase lifespan.
  • INK Sun-N-K terminal Kinase
  • the human homologue of DAF-16 includes four FOXOs: FOXO1, FOXO3A, FOXO4 and FOXO6. Therefore, it is plausible to hypothesize that common, natural variation in the form of single nucleotide polymorphisms (SNPs) in FOXO and related genes might influence human longevity.
  • FOXO3 is synonymous with “FOXO3A” since FOXO3B is a pseudo-gene on chromosome 17.
  • FOXO may provide a potential branch-point or bridge between insulin signaling, free radicals and human aging/longevity.
  • the invention provides compositions and methods for detecting the FOXO3A “GCC” haplotype (e.g. a FOXO3A haplotype associated with an increased longevity, defined herein as the likelihood of a human subject living an additional 15 or more years).
  • the detected FOXO3A haplotypes are associated with either an increased likelihood or a decreased likelihood of living longer, however the invention necessarily encompasses materials and methods for detecting a FOXO3A haplotype associated with neither an increased nor a decreased likelihood of living longer and/or minimizing risk for age-associated diseases (e.g. a “normal” or “wt” genotype).
  • Age-associated diseases refers to coronary heart disease (CHD), also known as coronary artery diseases, stroke, cancer, chronic obstructive pulmonary disease (COPD) or other chronic lung disease, Parkinson's disease, diabetes, obesity, dementia (and general cognitive function), frailty (ability to walk) or other age -related disease or physical and or cognitive impairment. There may also be an association with obesity in humans.
  • CHD coronary heart disease
  • COPD chronic obstructive pulmonary disease
  • Parkinson's disease diabetes
  • obesity dementia (and general cognitive function)
  • frailty ability to walk
  • age -related disease or physical and or cognitive impairment.
  • the “GCC” haplotype encompasses tens of kilobases of DNA. Other SNPs in this region demonstrate linkage disequilibrium with the three SNPs described herein. It is anticipated that additional SNPs will be identified within this GCC haplotype that also have an association with longevity and healthy aging, and may be useful of predicting age-associated diseases.
  • the “GCC haplotype” can serve as a surrogate for other types of alteration of DNA, either within or adjacent to the FOXO3A gene, that is ultimately found to be the “functional variant” that leads to the prediction of exceptional longevity and/or healthy aging.
  • LOC100130966 is similar to SMT3 suppressor of mif two 3 homolog 2 has been identified to lie within exon 2 of the FOXO3A gene, which is within the “GCC” haplotype.
  • the DNA sequence for LOC100130966 is described by the GenBank accession ID# “XM — 001725519” and the predicted amino acid sequence of LOC100130966 is described by GenBank file “XP — 001725571”.
  • Haplotype analysis may be used to potentially predict which patients would benefit by aggressive wellness or disease prevention/treatment interventions. Haplotype analysis may be provided in a kit form. Risk calculators could use such information for purposes of assessing likelihood of disease, disability or death or determining how many years of survival or disease-free survival a person has. Such information would be important to patients, health insurance companies, long term care insurance companies and physicians or other health care providers in order to provide some guidance as to the patient's long-term needs. Pharmaceuticals could be developed that modify the action of the FOXO3A gene, modify the cellular location of the FOXO3A protein and/or its interactions with other proteins, or modify the amount or type of protein produced by the gene in order to impact health or diseases related to aging.
  • mice Homologous sequences in mice may be associated with premature ovarian failure.
  • FIG. 1 shows the results of an ARMS-PCR assay to detect the FOXO3A G/T variants using the primers and conditions described in Table 10.
  • FIG. 2 illustrates the schematic outline of the ARMS-PCR assay to detect the FOXO3A G/T variants using the primers described in Table 10.
  • HHP Honolulu Heart Program
  • HAS Honolulu Asia Aging Study
  • HHP cohort recruitment, design, and procedures have been outlined in detail elsewhere. 62 Briefly, at the time of study enrollment (1965-1968), participants were aged 45 to 68 years (mean age, 54 years). From the commencement of the HHP, information on the development of incident coronary heart disease and stroke, as well as mortality from all causes, has been obtained by monitoring obituaries in local newspapers (English and Japanese) and through surveillance of hospital discharge records. 61 A follow-up survey in the 1991-1993 examination found that only 5 men could not be traced for mortality information. 63
  • cases longevity phenotype
  • “cases” longevity phenotype) were defined as all HHP participants who had survived to at least the upper 1% of the 1910 U.S. birth cohort specific survival (minimum 95 years of age) from the time of recruitment. 65,66 A total of 213 individuals who had survived to at least 95 years of age, as of August 2007, were studied. 176 of these individuals had died (mean death age 97.5; SD 2.1; range of 95-106 years) and 37 individuals were still alive (mean age 98.7, SD 2.1; range 97-106 years).
  • the controls consisted of 402 individuals from the HHP/HAAS cohort who died near the mean death age for the 1910 U.S. birth cohort specific survival for middle-aged men (approximately 77 years of age). In order to achieve a case:control ratio of approximately 1:2, we sampled the HHP/HAAS study population for controls who died up to the age of 81 years. The mean age at death for our control population was 78.5 years (SD 1.8, range 73-81 years). This is slightly higher that of the U.S. male population, but consistent with the high average life expectancy of Japanese-American men in Hawaii, which was 3.5 years longer than white males at last report. 67 All cases and controls were ethnic Japanese whose families came mainly from Central-West Japan. 61,62
  • SNPs were chosen from each of five candidate genes. We chose genes that have well-described influences on aging pathways in model organisms. All genes were chosen based on hypothetical links to the HS pathway and potential links to energy homeostasis, glucose and/or lipid metabolism, see FIG. 1 . SNPs were chosen based on their minor allele frequencies reported in the HapMap or JSNP database (snp.ims.u-tokyo.ac.jp).
  • Total cellular DNA was isolated using the PureGene system (Gentra Systems, Inc.) quantified using PicoGreen staining (Molecular Probes, Eugene, Oreg.) and SNPs from candidate genes genotyped using allelic discrimination assays.
  • PicoGreen staining Molecular Probes, Eugene, Oreg.
  • SNPs SNPs from candidate genes genotyped using allelic discrimination assays.
  • Taq Man® Applied Biosystems, Inc.
  • SNPs were purchased from ABI and SNPs were chosen with a frequency ⁇ ⁇ 0.1 in the Japanese population (http://www.ncbi.nlm.nih.gov/projects/SNP/).
  • PCR was amplified under standard conditions using Taq Gold (Perkin-Elmer, Corp) and detection of PCR products with Taq Man® assay, using a 6-FAM-labeled FRET probe for one allele and a VIC-labeled probe for the other allele, using minor groove binding (MGB) quenchers to enhance detection of assays.
  • PCR products were measured with the ABI Prism 7000 Sequence Detection System.
  • Genotype data were managed through an integrated database system (MS Excel, Microsoft, Inc). All positive controls on each genotyping plate were also evaluated for consistency. Positive markers were tested for deviation from Hardy-Weinberg equilibrium. Call rates exceeded 98%.
  • the baseline characteristics of the HHP/HAAS study population at the 1991-1993 examination are presented in Table 1.
  • the mean age was 77.9 years and 100% of the population was male and of Japanese ethnicity.
  • Biological characteristics, general health status, disease prevalence and functional status are presented.
  • rs2764264 has previously been referred to as “rs12524491”.
  • the DNA Sequence of SNP rs2764264 (“FOXO3A1”) identified as SEQ ID No. 2 is:
  • SEQ ID No. 3 The DNA Sequence of SNP rs13217795 (“FOXO3A2”) is identified as SEQ ID No. 3 is:
  • SEQ ID No. 4 The DNA Sequence of SNP rs2802292 (“FOXO3A3”) identified as SEQ ID No. 4 is:
  • GCC haplotype can be described using SNPs rs2764264, rs13217795, and rs2802292 and is the allele that contains the following combination of genotypes:
  • the “GCC haplotype” can be described using SNPs rs2802292, rs2764264, and rs13217795 according to NCBI nomenclature, and is the allele that contains the following combination of genotypes:
  • dbSNP Single Nucleotide Polymorphisms
  • FOXO3A genotype was significantly associated with plasma insulin levels as well as CHD, cancer and Type 2 diabetes prevalence. This is consistent with a known role for FOXO as a mediator of the effects of insulin and insulin-like growth factors on diverse physiological functions, including cell proliferation, apoptosis and metabolism. 17,54 Genetic studies in C. elegans and Drosophila have shown that FOXO proteins are ancient targets of insulin-like signaling that regulate metabolism and longevity. Additional work in mammalian cells has shown that FOXO proteins are the targets of protein kinases, influence cell cycle progression, and regulate resistance to oxidative stress in vitro. 54 In vivo studies have shown that FOXO modifies hepatic glucose output in response to insulin and mediates other metabolic actions. 54 This strengthens the evidence that FOXO proteins may mediate insulin effects on metabolism and influence longevity in humans.
  • FOXO3A a potential role of FOXO3A in human health, aging and longevity.
  • An important downstream mechanism whereby FOXO3A might influence human aging is through modification of oxidative stress—a long held theory of how we age, 33 although we have no direct evidence for this in the current study.
  • FOXO genes are the closest human homologues of C. elegans DAF-16, which protects cells from oxidative stress, this is a plausible mechanism of action for modification of human aging. 17 In C.
  • DAF-16 increases the expression of manganese superoxide dismutase (SOD2), which converts superoxide to less damaging hydrogen peroxide and is a potent endogenous protector against free radicals, 55 among other “anti-aging” effects.
  • SOD2 manganese superoxide dismutase
  • In vivo studies show that oxidative lesions in DNA, proteins and other tissues accumulate with age and feeding calorically restricted diets (a potent insulin sensitizer) to rodents 56 and humans 57 mitigates this damage.
  • the candidate genes selected for analysis were chosen a priori based on hypothesis-driven criteria. That is, studies of models organisms of aging employing various methods, particularly knockouts, have shown that the IIS pathway is important for aging and longevity. And many functions appear to be evolutionarily conserved.
  • the findings are strong, highly significant, and include several adjacent SNPs in the FOXO3A gene.
  • the findings are biologically plausible and support the prior findings in animal models of aging and also support the limited prior human studies.
  • the case-control associations with longevity were detected using a nested case-control analysis with a high event rate (deaths) during a long period of follow-up.
  • the HHP cohort is a highly homogenous cohort and there was no population stratification detected in our study participants.
  • a possible drawback is that since the cases and controls had an average age difference of 11 years we cannot exclude birth cohort as a confounder. But this is unlikely since there was a maximum 19-year difference in birth years between participants. Also, sub analyses revealed no differences in education and occupation (data not shown) between cases and controls. Moreover, it was the participants who were older at baseline who were more likely to have lived to 95-plus years and thus obtain the longevity phenotype. Most cohort effects show health advantages for younger cohorts. Another possible drawback is that this study was conducted in only one population and thus should be replicated in other populations in order to assess its generalizability.
  • SNPs single nucleotide polymorphisms
  • SNPs single nucleotide polymorphisms
  • SNPs are major contributors to genetic variation, comprising some 80% of all known polymorphisms, and their density in the human genome is estimated to be on average 1 per 1,000 base pairs. SNPs are most frequently biallelic—occurring in only two different forms (although up to four different forms of an SNP, corresponding to the four different nucleotide bases occurring in DNA, are theoretically possible).
  • SNPs are mutationally more stable than other polymorphisms, making them suitable for association studies in which linkage disequilibrium between markers and an unknown variant is used to map disease-causing mutations.
  • SNPs typically have only two alleles, they can be genotyped by a simple plus/minus assay rather than a length measurement, making them more amenable to automation.
  • the single base polymorphism can be detected by using a specialized exonuclease-resistant nucleotide, as disclosed, e.g., in Mundy, C. R. (U.S. Pat. No. 4,656,127).
  • a primer complementary to the allelic sequence immediately 3′ to the polymorphic site is permitted to hybridize to a target molecule obtained from a particular animal or human. If the polymorphic site on the target molecule contains a nucleotide that is complementary to the particular exonuclease-resistant nucleotide derivative present, then that derivative will be incorporated onto the end of the hybridized primer.
  • a solution-based method is used for determining the identity of the nucleotide of a polymorphic site.
  • Cohen, D. et al. (French Patent 2,650,840; PCT Appln. No. WO91/02087).
  • a primer is employed that is complementary to allelic sequences immediately 3′ to a polymorphic site. The method determines the identity of the nucleotide of that site using labeled dideoxynucleotide derivatives, which, if complementary to the nucleotide of the polymorphic site will become incorporated onto the terminus of the primer.
  • Goelet, P. et al. An alternative method, known as Genetic Bit Analysis or GBATM is described by Goelet, P. et al. (PCT Appln. No. 92/15712).
  • the method of Goelet, P. et al. uses mixtures of labeled terminators and a primer that is complementary to the sequence 3′ to a polymorphic site.
  • the labeled terminator that is incorporated is thus determined by, and complementary to, the nucleotide present in the polymorphic site of the target molecule being evaluated.
  • the method of Goelet, P. et al. is preferably a heterogeneous phase assay, in which the primer or the target molecule is immobilized to a solid phase.
  • RNA is initially isolated from available tissue and reverse-transcribed, and the segment of interest is amplified by PCR. The products of reverse transcription PCR are then used as a template for nested PCR amplification with a primer that contains an RNA polymerase promoter and a sequence for initiating eukaryotic translation.
  • the unique motifs incorporated into the primer permit sequential in vitro transcription and translation of the PCR products.
  • the appearance of truncated polypeptides signals the presence of a mutation that causes premature termination of translation.
  • DNA as opposed to RNA is used as a PCR template when the target region of interest is derived from a single exon.
  • the DNA sample is obtained from a bodily fluid, e.g. blood, obtained by known techniques (e.g. venipuncture) or saliva.
  • nucleic acid tests can be performed on dry samples (e.g. hair or skin).
  • the cells or tissues that may be utilized must express an FOXO3A gene.
  • Diagnostic procedures may also be performed in situ directly upon tissue sections (fixed and/or frozen) of patient tissue obtained from biopsies or resections, such that no nucleic acid purification is necessary.
  • Nucleic acid reagents may be used as probes and/or primers for such in situ procedures (see, for example, Nuovo, G. J., 1992, PCR in situ hybridization: protocols and applications, Raven Press, N.Y.).
  • Fingerprint profiles may be generated, for example, by utilizing a differential display procedure, Northern analysis and/or RT-PCR.
  • a preferred detection method is allele specific hybridization using probes overlapping a region of at least one allele of an FOXO3A haplotype and having about 5, 10, 20, 25, or 30 nucleotides around the mutation or polymorphic region.
  • several probes capable of hybridizing specifically to other allelic variants are attached to a solid phase support, e.g., a “chip” (which can hold up to about 250,000 oligonucleotides).
  • Oligonucleotides can be bound to a solid support by a variety of processes, including lithography. Mutation detection analysis using these chips comprising oligonucleotides, also termed “DNA probe arrays” is described e.g., in Cronin et al.
  • a chip comprises all the allelic variants of at least one polymorphic region of a gene.
  • the solid phase support is then contacted with a test nucleic acid and hybridization to the specific probes is detected. Accordingly, the identity of numerous allelic variants of one or more genes can be identified in a simple hybridization experiment.
  • Amplification techniques are known to those of skill in the art and include, but are not limited to cloning, polymerase chain reaction (PCR), polymerase chain reaction of specific alleles (ASA), ligase chain reaction (LCR), nested polymerase chain reaction, self sustained sequence replication (Guatelli, J. C. et al., 1990, Proc. Natl. Acad. Sci. USA 87:1874-1878), transcriptional amplification system (Kwoh, D. Y. et al., 1989, Proc. Natl. Acad. Sci. USA 86:1173-1177), and Q-Beta Replicase (Lizardi, P. M. et al., 1988, Bio/Technology 6:1197).
  • Amplification products may be assayed in a variety of ways, including size analysis, restriction digestion followed by size analysis, detecting specific tagged oligonucleotide primers in the reaction products, allele-specific oligonucleotide (ASO) hybridization, allele specific 5′ exonuclease detection, sequencing, hybridization, and the like.
  • ASO allele-specific oligonucleotide
  • PCR based detection means can include multiplex amplification of a plurality of markers simultaneously. For example, it is well known in the art to select PCR primers to generate PCR products that do not overlap in size and can be analyzed simultaneously. Alternatively, it is possible to amplify different markers with primers that are differentially labeled and thus can each be differentially detected. Of course, hybridization based detection means allow the differential detection of multiple PCR products in a sample. Other techniques are known in the art to allow multiplex analyses of a plurality of markers.
  • the method includes the steps of (i) collecting a sample of cells from a patient (from saliva, cheek swab, blood or other body fluid or component), (ii) isolating nucleic acid (e.g., genomic, mRNA or both) from the cells of the sample, (iii) contacting the nucleic acid sample with one or more primers which specifically hybridize 5′ and 3′ to at least one allele of an FOXO3A haplotype under conditions such that hybridization and amplification of the allele occurs, and (iv) detecting the amplification product.
  • nucleic acid e.g., genomic, mRNA or both
  • the allele of an FOXO3A haplotype is identified by alterations in restriction enzyme cleavage patterns.
  • sample and control DNA is isolated, amplified (optionally), digested with one or more restriction endonucleases, and fragment length sizes are determined by gel electrophoresis.
  • any of a variety of sequencing reactions known in the art can be used to directly sequence the allele.
  • Exemplary sequencing reactions include those based on techniques developed by Maxim and Gilbert ((1977) Proc. Natl. Acad Sci USA 74:560) or Sanger (Sanger et al (1977) Proc. Nat. Acad. Sci. USA 74:5463).
  • any of a variety of automated sequencing procedures may be utilized when performing the subject assays (see, for example Biotechniques (1995) 19:448), including sequencing by mass spectrometry (see, for example PCT publication WO 94/16101; Cohen et al. (1996) Adv Chromatogr 36:127-162; and Griffin et al.
  • protection from cleavage agents can be used to detect mismatched bases in RNA/RNA or RNA/DNA or DNA/DNA heteroduplexes (Myers, et al. (1985) Science 230:1242).
  • cleavage agents such as a nuclease, hydroxylamine or osmium tetroxide and with piperidine
  • cleavage agents such as a nuclease, hydroxylamine or osmium tetroxide and with piperidine
  • mismatched bases in RNA/RNA or RNA/DNA or DNA/DNA heteroduplexes (Myers, et al. (1985) Science 230:1242).
  • mismatch cleavage starts by providing heteroduplexes formed by hybridizing (labeled) RNA or DNA containing the wild-type allele with the sample.
  • the double-stranded duplexes are treated with an agent which cleaves single-stranded regions of the duplex such as which will exist due to base pair mismatches between
  • RNA/DNA duplexes can be treated with RNase and DNA/DNA hybrids treated with S1 nuclease to enzymatically digest the mismatched regions.
  • either DNA/DNA or RNA/DNA duplexes can be treated with hydroxylamine or osmium tetroxide and with piperidine in order to digest mismatched regions. After digestion of the mismatched regions, the resulting material is then separated by size on denaturing polyacrylamide gels to determine the site of mutation. See, for example, Cotton et al (1988) Proc. Natl. Acad Sci USA 85:4397; and Saleeba et al (1992) Methods Enzymol. 217:286-295.
  • the control DNA or RNA can be labeled for detection.
  • the mismatch cleavage reaction employs one or more proteins that recognize mismatched base pairs in double-stranded DNA (so called “DNA mismatch repair” enzymes).
  • DNA mismatch repair enzymes
  • the mutt enzyme of E. coli cleaves A at G/A mismatches and the thymidine DNA glycosylase from HeLa cells cleaves T at G/T mismatches (Hsu et al. (1994) Carcinogenesis 15:1657-1662).
  • a probe based on an allele of an FOXO3A locus haplotype is hybridized to a cDNA or other DNA product from a test cell(s).
  • duplex is treated with a DNA mismatch repair enzyme, and the cleavage products, if any, can be detected from electrophoresis protocols or the like See, for example, U.S. Pat. No. 5,459,039, which is incorporated by reference herein in its entirety.
  • alterations in electrophoretic mobility will be used to identify an FOXO3A locus allele.
  • single strand conformation polymorphism SSCP
  • SSCP single strand conformation polymorphism
  • Single-stranded DNA fragments of sample and control FOXO3A locus alleles would be denatured and allowed to renature.
  • the secondary structure of single-stranded nucleic acids varies according to sequence, the resulting alteration in electrophoretic mobility enables the detection of even a single base change.
  • the DNA fragments may be labeled or detected with labeled probes.
  • the sensitivity of the assay may be enhanced by using RNA (rather than DNA), in which the secondary structure is more sensitive to a change in sequence.
  • the subject method utilizes heteroduplex analysis to separate double stranded heteroduplex molecules on the basis of changes in electrophoretic mobility (Keen et al. (1991) Trends Genet. 7:5).
  • the movement of alleles in polyacrylamide gels containing a gradient of denaturant is assayed using denaturing gradient gel electrophoresis (DGGE) (Myers et al. (1985) Nature 313:495).
  • DGGE denaturing gradient gel electrophoresis
  • DNA will be modified to insure that it does not completely denature, for example by adding a GC clamp of approximately 40 bp of high-melting GC-rich DNA by PCR.
  • a temperature gradient is used in place of a denaturing agent gradient to identify differences in the mobility of control and sample DNA (Rosenbaum and Reissner (1987) Biophys Chem 265:12753).
  • oligonucleotide primers may be prepared in which the known mutation or nucleotide difference (e.g., in allelic variants) is placed centrally and then hybridized to target DNA under conditions which permit hybridization only if a perfect match is found (Saiki et al. (1986) Nature 324:163); Saiki et al (1989) Proc. Natl. Acad. Sci. USA 86:6230).
  • Such allele specific oligonucleotide hybridization techniques may be used to test one mutation or polymorphic region per reaction when oligonucleotides are hybridized to PCR amplified target DNA or a number of different mutations or polymorphic regions when the oligonucleotides are attached to the hybridizing membrane and hybridized with labelled target DNA.
  • the allele specific amplification technology which depends on selective PCR amplification, may be used in conjunction with the instant invention.
  • Oligonucleotides used as primers for specific amplification may carry the mutation or polymorphic region of interest in the center of the molecule (so that amplification depends on differential hybridization) (Gibbs et al (1989) Nucleic Acids Res. 17:2437-2448) or at the extreme 3′ end of one primer where, under appropriate conditions, mismatch can prevent, or reduce polymerase extension (Prossner (1993) Tibtech 11:238.
  • amplification may also be performed using Taq ligase for amplification (Barany (1991) Proc. Natl. Acad. Sci USA 88:189). In such cases, ligation will occur only if there is a perfect match at the 3′ end of the 5′ sequence making it possible to detect the presence of a known mutation at a specific site by looking for the presence or absence of amplification.
  • identification of the allelic variant is carried out using an oligonucleotide ligation assay (OLA), as described, e.g., in U.S. Pat. No. 4,998,617 and in Landegren, U. et al. ((1988) Science 241:1077-1080).
  • OLA oligonucleotide ligation assay
  • the OLA protocol uses two oligonucleotides which are designed to be capable of hybridizing to abutting sequences of a single strand of a target.
  • One of the oligonucleotides is linked to a separation marker, e.g., biotinylated, and the other is detectably labeled.
  • oligonucleotides will hybridize such that their termini abut, and create a ligation substrate. Ligation then permits the labeled oligonucleotide to be recovered using avidin, or another biotin ligand.
  • Nickerson, D. A. et al. have described a nucleic acid detection assay that combines attributes of PCR and OLA (Nickerson, D. A. et al. (1990) Proc. Natl. Acad. Sci. USA 87:8923-27). In this method, PCR is used to achieve the exponential amplification of target DNA, which is then detected using OLA.
  • U.S. Pat. No. 5,593,826 discloses an OLA using an oligonucleotide having 3′-amino group and a 5′-phosphorylated oligonucleotide to form a conjugate having a phosphoramidate linkage.
  • OLA OLA combined with PCR permits typing of two alleles in a single microtiter well. By marking each of the allele-specific primers with a unique hapten, i.e.
  • each OLA reaction can be detected by using hapten specific antibodies that are labeled with different enzyme reporters, alkaline phosphatase or horseradish peroxidase.
  • This system permits the detection of the two alleles using a high throughput format that leads to the production of two different colors.
  • kits for detecting a likelihood for long life or the need for wellness or diagnostic intervention in the near future may contain one or more oligonucleotides, including 5′ and 3′ oligonucleotides that hybridize 5′ and 3′ to at least one allele of a FOXO3A locus haplotype.
  • PCR amplification oligonucleotides should hybridize between 25 and 2500 base pairs apart, preferably between about 100 and about 500 bases apart, in order to produce a PCR product of convenient size for subsequent analysis.
  • Particularly preferred primers include nucleotide sequences described in SEQ IDs Nos. 2-9. Suitable primers for the detection of a human polymorphism in these genes can be readily designed using this sequence information and standard techniques known in the art for the design and optimization of primers sequences. Optimal design of such primer sequences can be achieved, for example, by the use of commercially available primer selection programs such as Primer 2.1, Primer 3 or GeneFisher.
  • An example of a simple method for the detection of the “GCC haplotype” involves the use of allele-specific primers that amplify the specific nucleotide of interest, similar to that described in paragraph [0067].
  • This method exploits the fact that oligonucleotide primers must be perfectly annealed at their 3′ ends for a DNA polymerase to extend these primers during PCR.
  • oligonucleotide primers that match only a specific DNA point difference, such as that found in the rs2802292 polymorphisms—primers that do not bind the T-type allele—such primers can distinguish between polymorphic alleles.
  • Oligonucleotides used for this purpose included forward outer (“rs2802292_FO”), 5′-GAAACTGAGGCTAACAGCTGGGTCTGGCCC-3′ identified as SEQ ID No. 5; reverse outer (“rs2802292_RO”), 5′-AGCTGATGCTCCTCAACGAAACCACCTTAC-3′ identified as SEQ ID No.
  • the G-type primers When amplicons generated in this way are resolved in an agarose gel, the G-type primers can be shown to have generated a 186-bp product, whereas the T-type primers give a 132-bp product.
  • the outside primers generate a 288-bp product that must be present in every reaction in order to guarantee the reaction has proceeded accurately.
  • FIG. 1 gives the results of an ARMS-PCR assay to detect the FOXO3A G/T variants using the primers and conditions described above.
  • Track 1 shows a subject homozygous for the “T” allele (132 bp); tracks 2 and 3 show subjects who are homozygous for the “G” allele (186 bp); and tracks 4 and 5 show subjects who are heterozygous for the “T” and “G” alleles (132+186 bp) and M is the 100 bp DNA ladder (Invitrogen, Paisley, United Kingdom).
  • FIG. 2 shows a schematic outline of the assay.
  • Primers “rs2802292_FO” and “rs2802292_RO” flank the polymorphic locus rs2802292 and should generate a control 288-bp band in all cases.
  • Primers “rs2802292_OF” and “rs2802292_RG” generate a 186-bp G-specific product and primers “rs2802292_FT” and “rs2802292_OR” generate a 132-bp T-specific product.
  • oligonucleotides may be any of a variety of natural and/or synthetic compositions such as synthetic oligonucleotides, restriction fragments, cDNAs, synthetic peptide nucleic acids (PNAs), and the like.
  • the assay kit and method may also employ labeled oligonucleotides to allow ease of identification in the assays. Examples of labels which may be employed include radio-labels, enzymes, fluorescent compounds, streptavidin, avidin, biotin, magnetic moieties, metal binding moieties, antigen or antibody moieties, and the like.
  • the kit may, optionally, also include DNA sampling means.
  • DNA sampling means are well known to one of skill in the art and can include, but not be limited to substrates, such as filter papers, the AmpliCardTM (University of Sheffield, Sheffield, England S10 2J F; Tarlow, J W, et al., J of Invest. Dermatol.
  • DNA purification reagents such as NucleonTM kits, lysis buffers, proteinase solutions and the like
  • PCR reagents such as reaction buffers, thermostable polymerase, dNTPs, and the like
  • allele detection means such as the HinfI restriction enzyme, allele specific oligonucleotides, degenerate oligonucleotide primers for nested PCR from dried blood.
  • Knowledge of the particular alleles described in this invention can be used to examine differences in cell behavior in cell cultures and tissue systems and measure the response of the cells to chemicals or biological agents that are added to the cell or tissue culture systems. Differences in cell behavior and responses can be compared between the genotypes in order to identify drugs or other pharmacologic agents that may be implemented in the desire to improve health or extend lifespan or to test new compounds for toxicity or potential effects on genes or gene expression.
  • the ability to target populations expected to show the highest clinical benefit, based on genetic profile can enable: 1) the repositioning of already marketed drugs; 2) the rescue of drug candidates whose clinical development has been discontinued as a result of safety or efficacy limitations, which are patient subgroup-specific; and 3) an accelerated and less costly development for candidate therapeutics and more optimal drug labeling (e.g. since measuring the effect of various doses of an agent on the causative mutation is useful for optimizing effective dose).
  • the treatment of an individual with a particular therapeutic agent can be monitored by measuring the level of expression for a gene associated with longevity.
  • the level of expression can be measured by determining protein (e.g. FOXO3A), mRNA and/or transcriptional level.
  • the therapeutic regimen can then be maintained or adjusted (increased or decreased in dose).
  • the effectiveness of treating a subject with an agent comprises the steps of: (i) obtaining a pre-administration sample from a subject prior to administration of the agent; (ii) detecting the level or amount of a protein, mRNA or genomic DNA in the pre-administration sample; (iii) obtaining one or more post-administration samples from the subject after administration of the therapeutic agent; (iv) detecting the level of expression or activity of the protein, mRNA or genomic DNA in the post-administration sample; (v) comparing the level of expression or activity of the protein, mRNA or genomic DNA in the pre-administration sample with the corresponding protein, mRNA or genomic DNA in the post-administration sample, respectively; and (vi) altering the administration of the agent to the subject accordingly.
  • Cells of a subject may also be obtained before and after administration of a therapeutic to detect the level of expression of genes other than a FOXO3A gene to verify that the therapeutic does not increase or decrease the expression of genes which could be deleterious. This can be done, e.g., by using the method of transcriptional profiling.
  • mRNA from cells exposed in vivo to a therapeutic and mRNA from the same type of cells that were not exposed to the therapeutic could be reverse transcribed and hybridized to a chip containing DNA from numerous genes, to thereby compare the expression of genes in cells treated and not treated with the therapeutic.
  • the “GCC” haplotype can be used in risk calculators to aid in the prediction of death and age-associated diseases (heart disease, stroke, cancer, COPD or other chronic lung disease, Parkinson disease, and diabetes and dementia) and future physical function (ability to walk, cognitive function). This information is of interest to the public, physicians, health care companies and insurance companies. Examples of known risk calculators include the system and method disclosed in Perls, U.S. Patent Application Publication No. US 2007/0118398 A1, published on May 24, 2007, which is incorporated by reference herein in its entirety. Risk calculators can be provided in for example, a physician's office, as a handheld or online.
  • An individual, health-care professional, insurance company, health care organization interested in predicting how long someone will live may enter his/her genotype into a computer and obtains a risk score for aging-related disease, number of healthy years of life left, and number of total remaining years of life.
  • a physician or health professional may advise the patient on healthy living or risk reduction for the above diseases and death, particularly for persons with the less protective versions of the FOXO3A gene.
  • Some exemplary options include: advice concerning food choices (e.g. red wine, soy products, and other foods that contain compounds that may affect the activity of the FOXO3A gene) or intensive risk factor modification such as weight loss or increased physical activity.
  • FOXO3A and in particular the GCC haplotype as predictors of healthy aging and longevity provides a probable source of useful biologics and targets for pharmaceutical screens and testing.
  • Means of taking the gene product may include ingestion, injection, transdermal administration and other methods well known in the pharmaceutical arts.
  • Compounds can be screened to find those that affect the type, activity, or the amount of the gene product produced by FOXO3A, in particular, the GCC haplotype.
  • the invention includes methods of modulating FOXO3A to prevent or treat age-related diseases.
  • the invention also includes methods for treating or preventing a disease or condition in which FOXO3A is implicated, e.g. age-related diseases or enhancing longevity in a subject.
  • Subject refers to human and non-human animals.
  • non-human animals includes all vertebrates, e.g., mammals, such as non-human primates (particularly higher primates), farm mammals such as horses, cows, bison, buffalo, goats, pigs and sheep, chicken, ducks and geese, companion animals such as dogs, cats, rabbits, guinea pigs, rodents, and reptiles, and laboratory animals.
  • the subject is human.
  • the subject is an experimental animal or transgenic animal suitable as a disease model.
  • Methods of modulating and treatment are well known to those skilled in the art as set forth in Geesaman et al., U.S. Patent Application Publication No. US 2007/0105109 A1, published on May 10, 2007, which is incorporated by reference herein in its entirety.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Engineering & Computer Science (AREA)
  • Analytical Chemistry (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Genetics & Genomics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Pathology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Food Science & Technology (AREA)
  • Medicinal Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)

Abstract

The invention provides methods and compositions relating to identification and use of genetic information from the FOXO3A gene that can be used for determining and increasing an individual's likelihood of longevity and of retaining physical and cognitive function during aging, and for determining and decreasing an individual's likelihood of developing a cardiovascular-, metabolic- or age-related disease, including coronary artery (heart) disease, stroke, cancer, chronic pulmonary disease, diabetes, Parkinson's disease and dementia.

Description

    CROSS-REFERENCE TO RELATED APPLICATION
  • This application is in part based on, and claims the benefit of U.S. Provisional Patent Application No. 61/087,722, filed Aug. 10, 2008, which is incorporated herein by reference.
  • STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH OR DEVELOPMENT
  • This invention was made with government support under grant 1 R01 AG027060-01 (Defining the Healthy Aging Phenotype) from the National Institute on Aging. Additional funding was provided by U.S. government support under contract N01-HC-05102 from the National Heart, Lung, and Blood Institute, contract N01-AG-4-2149 and grants 5 U01 AG019349-05 and K08 AG22788-02 from the National Institute on Aging. The U.S. government has certain rights in the invention. Additional support came under grant 2004-0463 from the Hawaii Community Foundation.
  • FIELD OF INVENTION
  • The invention relates to a method of using FOXO3A polymorphisms and haplotypes in diagnostics to predict or in planning treatments and interventions to promote healthy aging and longevity.
  • BACKGROUND OF THE INVENTION
  • The FOXO3A gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed.
  • The FOXO3A gene is one of the human homologs of DAF-16, a gene that has been described to extend lifespan in the model organisms C. elegans (Murphy C T (2006) The search for DAF-16/FOXO transcriptional targets: approaches and discoveries. Exp Gcrontol 41:910-921) and D. melanogaster. (Giannakou M E et al. (2007) Dynamics of the action of dFOXO on adult mortality in Drosophila. Aging Cell 6:429-438).
  • The FOXO3A gene is located on human chromosome 6q21, from position 108,987,719 to 109112664 (NCBI ver. 36), is composed of four (4) exons that can be alternately expressed, which results in the same protein (variant #1 is described by file NM001455.3; variant #2 is described by file NM201559.2. The FOXO3A protein is composed of 673 amino acids and is 71,277 Da in size. The amino acid sequence of FOXO3A, as defined by the file “NP963853” at the NCBI is identified as SEQ ID No. 1 and is the following:
  • MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGE
    TAADSMIPEEEDDEDDEDGGGRAGSAMAIGGGGGSGTLGSGLLLEDSARV
    LAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGAAGGSGQPRKC
    SSRRNAWGNLSYADLITRAIESSPDKRLTLSQTYEWMVRCVPYFKDKGDS
    NSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRR
    AVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSS
    DELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSS
    SASLSPSVSKPCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQ
    PSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQT
    IQENKPATFSSMSHYGNQTLQDLLTSDSLSHSDVMMTQSDPLMSQASTAV
    SAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQGALGGSRAL
    SNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLP
    VMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQN
    VVGLNVGNFTGAKQASSQSWVPG
  • FOXO3A interacts with YWHAB/14-3-3-beta and YWHAZ/14-3-3-zeta, UniProt: the Universal Protein Resource (www.uniprot.org), which is required for cytosolic sequestration. Upon oxidative stress, interacts with STK4, which disrupts interaction with YWHAB/14-3-3-beta and leads to nuclear translocation. The subcellular location of FOXO3A is in the cytoplasm, and cytosol. It translocates to the nucleus upon oxidative stress and in the absence of survival factors. In the presence of survival factors such as IGF-1, FOXO3A is phosphorylated on Thr-32 and Ser-253 by AKT1/PKB. This phosphorylated form then interacts with 14-3-3 proteins and is retained in the cytoplasm. Survival factor withdrawal induces dephosphorylation and promotes translocation to the nucleus where the dephosphorylated protein induces transcription of target genes and triggers apoptosis. Although AKT1/PKB doesn't appear to phosphorylate Ser-315 directly, it may activate other kinases that trigger phosphorylation at this residue. FOXO3A is phosphorylated by STK4 on Ser-209 upon oxidative stress, which leads to dissociation from YWHAB/14-3-3-beta and nuclear translocation.
  • Human longevity is a complex phenotype with multiple determinants While non-genetic factors, including diet, physical activity, health habits and psychosocial factors are important, up to 50% of the variation in human lifespan might be explained by genetic differences.1-5 Several studies suggest that about 25% of the variation in human lifespan in average-lived populations can be explained by genetic factors but in populations with larger numbers of exceptional survivors the genetic contribution to lifespan may be much higher. For example, family studies of nonagenarians and centenarians show that sibling relative risk, a common method for assessing potential genetic contribution to a complex phenotype,6 is particularly high and grows with increasing age of the proband.7-10 However, studies of candidate “longevity-associated” genes in humans, hereafter referred to as “longevity genes,” have generally been disappointing. Few replications have been observed across populations, with the exception of the ApoE gene.3
  • In contrast, there have been several robust genetic findings in model organisms of aging.11-13 For example, variation in single genes can result in substantial differences in lifespan in model organisms, particularly with genes that are considered part of the insulin/IGF-1 (IIS) signaling pathway.14-18
  • Mutations that increase SIR-2 activity or that decrease insulin/IGF-1 signaling both increase the lifespan of C. elegans by activating the DAF-16/FOXO protein.19,20 In mammalian cells, a Sir2 homolog “SIRT1,” influences several downstream transcription events affecting lifespan, including the cellular response to stress. SIRT1 accomplishes this by regulating the FOXO (Forkhead box transcription) factors, a family of proteins that function as sensors in the IIS pathway and are also regulators of longevity in several mammals.17
  • Genetic knock-out models in mammals (and other species) have also supported the HS hypothesis. For example, mice with a fat-specific insulin receptor knockout (FIRKO) have reduced fat mass, protection against age-related obesity and have extended longevity.21 Many other mutations in the HS pathway appear to impact longevity in mice. These include mutations in the IGF-1 receptor,22 IRS-1,22 IRS-2,23 PAPP-A,24 and the Ames Dwarf mouse mutation.22
  • The basic molecular pathway of insulin signaling is conserved through evolution, evidence of which can be seen in yeast, flies, worms, rodents and humans.25 A key regulator of this pathway in worms is the transcription factor DAF-16 (abnormal DAuer Formation-16), which is required for the large lifespan extension produced in C. elegans by inhibiting insulin/IGF-1 signaling.16 A number of factors appear to extend lifespan in C. elegans in a daf-16 dependent manner, such as AMP kinase,26 14-3-3 proteins,27 the lin-4 microRNA,28 and heat shock factor.29 Homologues of DAF-16 in several species have been linked to aging phenotypes and longevity.30 For example, the stress responsive Sun-N-K terminal Kinase (INK) pathway appears to require FOXO to prolong lifespan in Drosophila 31 and when flies over express dFOXO, the DAF-16 ortholog, it can markedly increase lifespan.32 The remarkable convergence of such a diverse array of signals on DAF-16/FOXO suggests that this protein may be an important, evolutionarily conserved “node” in a signaling network that impacts aging and longevity.
  • The human homologue of DAF-16 includes four FOXOs: FOXO1, FOXO3A, FOXO4 and FOXO6. Therefore, it is tempting to hypothesize that common, natural variation in the form of single nucleotide polymorphisms (SNPs) in FOXO and related genes might influence human longevity. “FOXO3” is synonymous with “FOXO3A” since FOXO3B is a pseudo-gene on chromosome 17.
  • This is an appealing hypothesis. A connection between insulin, FOXO, oxidative stress and human longevity would be particularly interesting since oxidative stress has long been a favorite putative mechanism of aging. Since 1956, the free radical theory of aging has hypothesized that aging results partly from damage to DNA, cells and tissues from cumulative exposure to reactive oxygen molecules33 and although not yet universally accepted, supportive evidence has accumulated over the years.34,35 Thus, FOXO may provide a potential branch-point or bridge between insulin signaling, free radicals and human aging/longevity.
  • There has been some prior work linking genes in the IIS pathway to human longevity,36,37 including an interesting recent report by Suh et al,38 which links functionally significant IGF-1 receptor mutations to exceptional longevity, but we have not found any published reports of association between FOXO genes and human longevity. Prior studies have found links between FOXO genes and other aging phenotypes, including 4-year survival and stroke risk39 as well as premature menopause.40
  • Human longevity, however, is a complex phenotype that encompasses disease-specific risks as well as the individual rate of aging. The study of its genetic antecedents is challenging. The study of longevity may be affected by small genetic effect sizes, population stratification artifact, population heterogeneity, lack of sufficient numbers of long-lived study participants, and other problems.3,4,41 Therefore, in order to assess potential genetic contributions to human longevity from genes linked to IIS signaling, we chose a large, homogeneous, long-lived population of men well characterized for aging phenotypes and we performed a nested-case control study of 5 candidate longevity genes with links to the IIS pathway. These genes were chosen based on prior associations with aging phenotypes principally from gene knockout, transgenic, mutant and other model organisms of aging.3,4,14-17,36,42 Priority was given to genes that are involved in insulin sensitivity and glucose (energy) homeostasis.
  • The rapid aging of the population will place unprecedented challenges on society due to increased prevalence of chronic disease and disability.45 Better understanding of mechanisms of aging, including biological pathways that may have widespread influence on how we age, could have important implications for lowering our risk for age-related disease and disability. There are many biologically plausible candidate genes for human longevity but only one finding has so far been widely replicated in multiple populations, that of the ApoE gene.3 This gene has widespread effects on aging phenotypes, particularly cardiovascular disease and dementia, and as such influences the ability to achieve a long and healthy life.
  • SUMMARY OF THE INVENTION
  • The challenge in finding genes that have widespread effects on human aging phenotypes and longevity suggests that it may be helpful to use model organisms to identify a priori potential candidates before conducting human studies. Therefore, we chose to study several candidate genes within the human insulin/IGF-1 signaling pathway and/or oxidative stress response system on the basis of sequence and/or functional homology with model organisms of aging or prior human studies. We constructed a list of human candidate genes from these signaling pathways and assessed variations in these candidate genes occurring at a frequency of approximately 10% or greater in the Japanese population. Due to limited resources, only three SNPs were chosen from each gene for analysis. SNPs were selected from regions with linkage disequilibrium (LD), when possible, in order to provide maximal coverage of each gene.
  • In general the invention provides compositions and methods for detecting the FOXO3A “GCC” haplotype (e.g. a FOXO3A haplotype associated with an increased longevity, defined herein as the likelihood of a human subject living an additional 15 or more years). In preferred embodiments, the detected FOXO3A haplotypes are associated with either an increased likelihood or a decreased likelihood of living longer, however the invention necessarily encompasses materials and methods for detecting a FOXO3A haplotype associated with neither an increased nor a decreased likelihood of living longer and/or minimizing risk for age-associated diseases (e.g. a “normal” or “wt” genotype). Age-associated diseases refers to coronary heart disease (CHD), also known as coronary artery diseases, stroke, cancer, chronic obstructive pulmonary disease (COPD) or other chronic lung disease, Parkinson's disease, diabetes, obesity, dementia (and general cognitive function), frailty (ability to walk) or other age -related disease or physical and or cognitive impairment. There may also be an association with obesity in humans.
  • The “GCC” haplotype encompasses tens of kilobases of DNA. Other SNPs in this region demonstrate linkage disequilibrium with the three SNPs described herein. It is anticipated that additional SNPs will be identified within this GCC haplotype that also have an association with longevity and healthy aging, and may be useful of predicting age-associated diseases. The “GCC haplotype” can serve as a surrogate for other types of alteration of DNA, either within or adjacent to the FOXO3A gene, that is ultimately found to be the “functional variant” that leads to the prediction of exceptional longevity and/or healthy aging. These other alterations may be in the form of inversions, duplications, deletions, and may include other genes or transcripts that were previously unknown, for example, the gene “LOC100130966”. LOC100130966 is similar to SMT3 suppressor of mif two 3 homolog 2 has been identified to lie within exon 2 of the FOXO3A gene, which is within the “GCC” haplotype. The DNA sequence for LOC100130966 is described by the GenBank accession ID# “XM001725519” and the predicted amino acid sequence of LOC100130966 is described by GenBank file “XP001725571”.
  • Haplotype analysis may be used to potentially predict which patients would benefit by aggressive wellness or disease prevention/treatment interventions. Haplotype analysis may be provided in a kit form. Risk calculators could use such information for purposes of assessing likelihood of disease, disability or death or determining how many years of survival or disease-free survival a person has. Such information would be important to patients, health insurance companies, long term care insurance companies and physicians or other health care providers in order to provide some guidance as to the patient's long-term needs. Pharmaceuticals could be developed that modify the action of the FOXO3A gene, modify the cellular location of the FOXO3A protein and/or its interactions with other proteins, or modify the amount or type of protein produced by the gene in order to impact health or diseases related to aging.
  • Homologous sequences in mice may be associated with premature ovarian failure. Castrillon D H, Miao L, Kollipara R, Horner J W, DePinho R A. Suppression of ovarian follicle activation in mice by the transcription factor Foxo3a. Science. 2003 Jul. 11; 301(5630):215-8. Consequently, similar haplotype analysis can be useful in veterinary applications.
  • Further features of the invention will now become apparent from the following description, by way of example only, with reference to the accompanying Figures and Tables.
  • BRIEF DESCRIPTION OF THE FIGURES
  • FIG. 1 shows the results of an ARMS-PCR assay to detect the FOXO3A G/T variants using the primers and conditions described in Table 10.
  • FIG. 2 illustrates the schematic outline of the ARMS-PCR assay to detect the FOXO3A G/T variants using the primers described in Table 10.
  • The following tables are part of the description:
  • Table 1. Baseline Characteristics of the HHP/HAAS Cohort in 1991-93 (n=3,741)
  • Table 2. Baseline Characteristics by Case-Control Status Table 3. Candidate Genes for Human Longevity and the MAF in Cases and Controls Table 4. FOXO 3A3 Genotype by Case-Control Status
  • Table 5. Difference in Health Status between Genotype Groups at Baseline
  • Table 6. Insulin Sensitivity Phenotypes According to FOXO3A Genotype Table 7. Prevalence of Aging-related Phenotypes in Relation to FOXO3A3 Genotype Table 8. Genotype Distribution by Maximum Attained Age
  • Table 9. Primers for Identification of the rs2802292 G-T Polymorphism
    Table 10. PCR Conditions for Identification of rs2802292 G-T Polymorphism
  • DETAILED DESCRIPTION OF THE INVENTION A. Hawaii Lifespan Study Study Population
  • This nested-case control study was conducted as part of the Hawaii Lifespan Study, an embedded cohort study of healthy aging drawn from the original population of the Honolulu Heart Program (HHP) and Honolulu Asia Aging Study (HAAS). The HHP is a population-based, prospective study of cardiovascular disease among 8,006 Japanese American men that began in 1965. The HHP participants were recruited from 9,877 men with valid contact information who were born between 1900 and 1919 and lived on the island of Oahu in 1965.61
  • Study participants had both parents from Japan, usually the west and southern parts of Japan (94% from the central region or further west and south); 49% of them had parental origins from the adjacent prefectures of Hiroshima and Yamaguchi.61,62 Although the most participants were born in Hawaii (88%), there is a theoretical possibility of confounding of case control status with allele frequencies due to geographic origin. Therefore, for certain analyses, cases and controls were stratified by parental prefecture of origin using conditional logistic regression models. Analyses showed no evidence for population stratification in the dataset (data not shown).
  • The HHP cohort recruitment, design, and procedures have been outlined in detail elsewhere.62 Briefly, at the time of study enrollment (1965-1968), participants were aged 45 to 68 years (mean age, 54 years). From the commencement of the HHP, information on the development of incident coronary heart disease and stroke, as well as mortality from all causes, has been obtained by monitoring obituaries in local newspapers (English and Japanese) and through surveillance of hospital discharge records.61 A follow-up survey in the 1991-1993 examination found that only 5 men could not be traced for mortality information.63
  • All participants for the current study were drawn from records of study participants updated to August, 2007. Archived phenotypic data and blood samples from Exam 4 of the HHP (1991-1993), which coincided with the commencement of the Honolulu Asia Aging Study (HAAS), was used as the baseline exam for this nested case-control study. The HAAS was begun as an expansion of the HHP for the study of neurodegenerative diseases, cognitive function and other aging phenotypes in elderly persons.64 Participants included 3,741 men aged 71 to 93 at Exam 4 (mean age 77.9±4.7 years), approximately half the number of the original HHP.64
  • For the purposes of the current nested case-control study, “cases” (longevity phenotype) were defined as all HHP participants who had survived to at least the upper 1% of the 1910 U.S. birth cohort specific survival (minimum 95 years of age) from the time of recruitment.65,66 A total of 213 individuals who had survived to at least 95 years of age, as of August 2007, were studied. 176 of these individuals had died (mean death age 97.5; SD 2.1; range of 95-106 years) and 37 individuals were still alive (mean age 98.7, SD 2.1; range 97-106 years).
  • The controls consisted of 402 individuals from the HHP/HAAS cohort who died near the mean death age for the 1910 U.S. birth cohort specific survival for middle-aged men (approximately 77 years of age). In order to achieve a case:control ratio of approximately 1:2, we sampled the HHP/HAAS study population for controls who died up to the age of 81 years. The mean age at death for our control population was 78.5 years (SD 1.8, range 73-81 years). This is slightly higher that of the U.S. male population, but consistent with the high average life expectancy of Japanese-American men in Hawaii, which was 3.5 years longer than white males at last report.67 All cases and controls were ethnic Japanese whose families came mainly from Central-West Japan.61,62
  • Procedures were performed according to institutional guidelines and approved by the Institutional Review Board of Kuakini Medical Center. Written informed consent was obtained from all study participants or from family representatives, if participants could not provide consent.
  • Genotyping
  • We chose three SNPs from each of five candidate genes. We chose genes that have well-described influences on aging pathways in model organisms. All genes were chosen based on hypothetical links to the HS pathway and potential links to energy homeostasis, glucose and/or lipid metabolism, see FIG. 1. SNPs were chosen based on their minor allele frequencies reported in the HapMap or JSNP database (snp.ims.u-tokyo.ac.jp).
  • Total cellular DNA was isolated using the PureGene system (Gentra Systems, Inc.) quantified using PicoGreen staining (Molecular Probes, Eugene, Oreg.) and SNPs from candidate genes genotyped using allelic discrimination assays. Taq Man® (Applied Biosystems, Inc.) reagents were purchased from ABI and SNPs were chosen with a frequency ≧˜0.1 in the Japanese population (http://www.ncbi.nlm.nih.gov/projects/SNP/). PCR was amplified under standard conditions using Taq Gold (Perkin-Elmer, Corp) and detection of PCR products with Taq Man® assay, using a 6-FAM-labeled FRET probe for one allele and a VIC-labeled probe for the other allele, using minor groove binding (MGB) quenchers to enhance detection of assays. PCR products were measured with the ABI Prism 7000 Sequence Detection System.
  • Genotype data were managed through an integrated database system (MS Excel, Microsoft, Inc). All positive controls on each genotyping plate were also evaluated for consistency. Positive markers were tested for deviation from Hardy-Weinberg equilibrium. Call rates exceeded 98%.
  • Statistical Analysis
  • SNPs were evaluated for deviation from Hardy-Weinberg equilibrium. The Pearson chi-square test was used to compare the cases and controls for equal genotype frequencies using the software program StatXact.68 For estimates of strength of association, odds ratios were estimated using logistic regression models from SAS.69 General linear model (GLM) and analysis of covariance (ANCOVA) were further used to compare proportion of healthy study participants by FOXO3A genotype. For the analysis of aging phenotypes in case and controls, Student's t test for comparing distribution of continuous variables and Chi square for proportional variables.
  • Results
  • The baseline characteristics of the HHP/HAAS study population at the 1991-1993 examination are presented in Table 1. The mean age was 77.9 years and 100% of the population was male and of Japanese ethnicity. Biological characteristics, general health status, disease prevalence and functional status are presented.
  • TABLE 1
    Baseline Characteristics of the HHP/HAAS
    Cohort in 1991-93 (n = 3,741)
    Variables at Baseline Exam (1991-93) Mean ± SD Min-Max
    Biological Characteristics
    Age (y) 77.88 ± 4.69 71 93
    Body Mass Index (BMI) kg/m2 23.43 ± 3.16 12.25-39.34 
    Waist/Hip Ratio  0.94 ± 0.06 0.73-1.27 
    Total Cholesterol (mg/dl)* 189.73 ± 33.16 81-382
    Triglyceride level (mg/dl)* 148.96 ± 93.85  32-1369
    HDL (mg/dl)*  50.94 ± 13.36 20-129
    Glucose (mg/dl)* 113.03 ± 29.4  44-399
    Insulin (mIU/L)*  16.82 ± 32.48  1.5-1164
    General Health Status
    Self-Reported “Poor” Health (%) 32.88
    Disease Prevalence
    CHD (%) 19.38
    Stroke (%)  4.73
    Cancer (%) 13.84
    Diabetes (%) 58.11
    Physical and Cognitive Function
    Lower Body (Difficulty Walking) (%) 20.47
    Upper Body (Grip Strength in kg) 30.09 ± 6.88 0 55
    Cognitive Score (CASI)  82.24 ± 16.37  0-100
    *Fasting values
  • From this 1991-93 baseline population, we selected all participants who, by 2007, had survived to age 95 years or more as “longevity” cases (n=213). We then selected all participants who died before the age of 81 years as “average” lived controls (n=402). Baseline characteristics of the cases and controls are presented in Table 2. In terms of biological characteristics, the long-lived cases were older, leaner (lower waist:hip ratio), had lower triglycerides (borderline), lower glucose, lower insulin levels and higher prevalence of the FOXO3A3 allele at the baseline exam. The cases also had better self rated health and lower prevalence of cardiovascular disease (CHD and stroke) and cancer. Functionally they appeared better able to walk but had lower grip strength. There was no significant difference in cognitive score.
  • TABLE 2
    Baseline Characteristics by Case-Control Status
    Average Lived Phenotype Longevity Phenotype
    Variables at Baseline (Mean Attained Age 78.5 y) (Mean Attained Age 97.9 y)*
    Examination (1991-93) Mean ± SD Min-Max Mean ± SD Min-Max P†
    Biological‡
    Age at Baseline Exam (y) 74.63 ± 2.05  71-79 85.62 ± 3.12  80-93 <.0001
    Body Mass Index (BMI) kg/m2 23.4 ± 3.17 15.89-32.33 23.0 ± 2.91 15.4-31.1 0.1272
    Waist/Hip Ratio 0.95 ± 0.06 0.78-1.15 0.93 ± 0.06 0.73-1.07 0.0008
    Total Cholesterol (mg/dl) 187.96 ± 34.6   98-303 185.36 ± 32.16   95-304 0.3680
    HDL (mg/dl) 50.82 ± 14.17  21-129 51.29 ± 13.54  27-100 0.6911
    Triglycerides (mg/dl) 154.72 ± 118.72  46-1369 140.32 ± 82.23   38-649 0.1178
    Log Triglycerides§ 4.88 ± 0.51 3.83-7.22 4.81 ± 0.50 3.64-6.48 0.0965
    Glucose (mg/dl) 117.83 ± 35.9   69-323 108.98 ± 22.55   77-298 0.0012
    Insulin (mIU/L) 25.54 ± 82.89   3.3-1164  13.8 ± 11.39  1.5-104 0.0421
    Log Insulin§ 2.69 ± 0.74 1.19-7.06 2.44 ± 0.58 0.41-4.64 <0.0001
    FOXO3A3 MAP (rs2802292) 0.255 0.371 <0.0001
    General Health Status
    Self-rated “Poor” Health (%) 41.92 31.07 0.0163
    Disease Prevalence
    CHD (%) 26.37 7.55 <0.0001
    Stroke (%) 7.46 3.3 0.0394
    Cancer (%) 20.15 13.68 0.0468
    Diabetes (%) 60.55 59.81 0.8587
    Physical/Cognitive Function
    Lower Body (Difficulty Walk 30.59 16.83 0.0002
    Upper Body (Grip Strength in 29.85 ± 7.54   0-47 26.37 ± 5.53   8-45 <0.0001
    Cognitive Score (CASI)¶ 80.96 ± 19.48  0-100 78.54 ± 13.85 12-98 0.1088
    *Cases (longevity phenotype) consisted of all HHP/HAAS participants with DNA samples (living and dead) who had reached the age of 95 years by August 2007: Gp 1: Alive, n = 37, mean age 98.7, range 97-106 years; Gp 2: Dead, n = 166, mean death age 97.5, range 95-106 y);
    †p value from Students t test for continuous variables and Chi Square for categorical variables;
    ‡Fasting values;
    §Log transformation performed for variables not normally distributed;
    ¶CASI (Cognitive Abilities Screening Instrument)43
  • Five genes were investigated (ADIPOQ, FOXO1A, FOXO3A, SIRT1, and COQ7). Minor allele frequencies and other related genetic information for the cases and controls are presented in the Table 3. However, only FOXO3A genotype was associated with longevity using an initial cut-off value of p<0.05.
  • TABLE 3
    Candidate Genes for Human Longevity and the MAF in Cases and Controls
    Minor allele freq. (MAF)
    Gene Name Symbol SNP ID# Variable Name Cases Controls P*
    †Adipo, C1Q, CDC ADIPOQ rs1063539 ADIPOQ_1 0.297 0.263 0.20
    rs182052 ADIPOQ_2 0.455 0.493 0.22
    rs266729 ADIPOQ_3 0.195 0.239 0.08
    Forkhead Box O1A FOXO1A rs2755209 FOXO1A1 0.272 0.291 0.48
    rs2721069 FOXO1A2 0.293 0.307 0.62
    rs2755213 FOXO1A3 0.350 0.358 0.77
    Forkhead Box O3A FOXO3A rs2764264 FOXO3A1 0.347 0.248 0.0002
    rs13217795 FOXO3A2 0.340 0.248 0.0006
    rs2802292 FOXO3A3 0.371 0.255 <0.0001
    Sirtuin 1 SIRT1 rs7069102 SIRT1_1 0.185 0.181 0.84
    rs10823112 SIRT1_2 0.337 0.360 0.44
    rs1885472 SIRT1_3 0.188 0.179 0.71
    Coenzyme Q7 COQ7 rs8051232 COQ7_1 0.147 0.150 0.90
    rs11074359 COQ7_2 0.153 0.171 0.43
    rs7192898 COQ7_3 0.162 0.170 0.73
    *Comparing MAF between cases and controls with Chi-square test; †Adipocyte, C1Q, and Collagen Domain Containing.
  • Variant “rs2764264” has previously been referred to as “rs12524491”. The DNA Sequence of SNP rs2764264 (“FOXO3A1”) identified as SEQ ID No. 2 is:
  • TATTTCACTGGCCAGGACCTCCAATACATTGTTGAATAGCAGTGGTGAAA
    GCAGAGATCCTTACCATTTTTCTCATCTTAAGGGGAAAGCATTCAGTCTT
    TCACTGTTAAGTATCATGTTAGGTGTAAGTTTGTCACATATTTCCTTTAT
    CAGGCTGAGGTAGTTTTCTCTATTCCTATGTGTTGAGTAGTTTTTGTTTT
    TTAAATTATGAGTGGATATTGAATTTTGTCAGATGCTTTTTCCTCACCTG
    TTGAGAAGATCAGATGGTTTTTCTTTTTCAGTCTTTTAATATGATGAAAT
    ACATTGACTGATTTGCAATGTTAAACCAACCTTACATTCCTGGGATAAAT
    CCCACCTGGTCTTGATATGTTACCATGAGATTCAAGTAGCTAAAATTTTG
    TTAAGGATTTTTGTGTCTGTCTTCATGAGGAATATTGATCTATACATTTC
    TTATAATATCTTTGCCTGTTTTTGGTACCAGGGTAATGGTGGTCTTATAA
    (C/T)
    ATGAGTTGGA AAGTGTTCCC TGTTCTGCTC TGGTAGCACT
    GTAGTATCTC
    TTCCTTAAATGTTTGGTAGAATTCAACGGCAGTTAAGCCATCAGAGCCTG
    GAGTTTTTTTGTGTGTGAGGAAATGTTTAACTGCTAATTCAATTTATTTC
    ATAGATACAATGCTGTTGGCTTGTCTGTTTCTTCTTGAATGAGTTTTGGT
    AGTCTGTGTCTTTTAAGGAATTTGCCCATTTTATTTAAGTTGTCTAATTT
    ATGGGCATAAAGTCATTTATAATGTTCTCTTATTATCCTTTTAATAGATA
    TATCATCTGTAGTGATTTCATTTTCATTCCTGATGTTGATAATTTGTCTT
    AACTCCCTTTCCCCCTCATTCCTTATCTGTTTAGTGCCTTGCAATTTCAT
    TGATCTTTTAAACGAATTAACATTTGCTTCCACTGACTTTTCCCCCGTTA
    CTTTTATGTTTTTACTTCCATTGATTTTTTTTTTCTCTTTTAATCTTTTA
  • The DNA Sequence of SNP rs13217795 (“FOXO3A2”) is identified as SEQ ID No. 3 is:
  • CACCACCACCCACTAGACAAATTGCTTAACCTTTCTGCACCTCAGTTTCC
    TCCTGACAGGCTTGTTTAGAAAATAAAATGAGATCAAATTTGTCAAGCAC
    AGAGCATTGGCCCTGGTAGGCACCACATACATGAATTTCCTTCAGATTGT
    AGGTGAAGTAGACTTGATTTGGGATTTCTCTTGTTACCTAGGTGCTTGTG
    TAGAGGAGACTTTAGAACCAGAATGTGTTATTTGTGGTTTTGAGTGTGCC
    TGGGACTCTGAGCCAACTGAATTACCAAGTAATGGGGGCCCCATGGCATC
    (C/T)
    CATGACAGGTGGAGAGCCGGCTCTTCACCCTGGATGGACCTGAAATGCCT
    GCTAAGGCCTTGCTCCACCGAGTAGCACACACCCTATCAGTTTGCCCTTC
    TTTCCATCTCTTATTCTAGAGACCTTAAAGCCTACTTGTTGGTATATATT
    TTCAGGTTTTTGGAAATTGGGCTGTTTAATTGAAGTTAATACCAGTGATG
    AGACTTTTCAACCTGAGAACAACCTAGATGCTACTTCACATTTTGCAGTG
    GAAGCTTACTTCCATCTTCACTCATGTAGGACATTCTTTGGTCTCAATGT
  • The DNA Sequence of SNP rs2802292 (“FOXO3A3”) identified as SEQ ID No. 4 is:
  • TGAAGCAGGGCATCAGGGAATGGGAGTTGGTGAGGAAATTACATTAACAT
    TTATTGAGCACCATTCTCACTATAAACCTGAACGTAAATATTATTATTAT
    TATTATTATTATTATTATTATTATTATTATTATTATTATTTTAGTAGAGA
    TGAGGCCTTGCTGTGTTGCCTAGACTGGTCTTGAACTCCTGGGCTCAAGC
    AATCCTCTCACCTTGGCCTCTCAAAGTGCCTCTCAAAGGTGTGAGCCACC
    ATGCCCAGCCTATTCGTTTTTAATTTCTGAAGAAACTGAGGCTAACAGCT
    GGGTCTGGCCCATGACTGGTTCAGTTGGTATTTGGTGGACCAAGTTGACC
    AAGCTCACCCAGCTTCTGAGTGACAGAGTGAATATAAACCCAGCCTGCTC
    ACTCCATTTCCTAGTTTTCTCACCTCTACCAGGGTCTCTGTTGCTCACAA
    GAGCTCAGGGCTGGGA
    (G/T)
    AAGCCTCTGTGTGACAGATGAAGGGGTCCTGCTGCTCTCTAGGGAAGAAT
    CGGTCCCAAATTGCTCAAGGGAGTAAGGTGGTTTCGTTGAGGAGCATCAG
    CTAGGGGGATTGATGGGAATAGGTGTCAGGCAGCCAGTGGAAATTTTGTG
    TGCCCACCTGTGGCACATGTATTATGCAAATTCATGCAAAAATATATATA
  • The “GCC haplotype” can be described using SNPs rs2764264, rs13217795, and rs2802292 and is the allele that contains the following combination of genotypes:
  • rs2764264 rs13217795 rs2802292
    “C” “C” “G”
  • When viewing these variants from the top of the chromosome (lower nucleotide position on the genetic map) to the bottom (higher nucleotide position on the genetic map) the “GCC haplotype” can be described using SNPs rs2802292, rs2764264, and rs13217795 according to NCBI nomenclature, and is the allele that contains the following combination of genotypes:
  • SNP ID # rs2802292 rs2764264 rs13217795
    SNP Variable Name from FOXO3A3 FOXO3A1 FOXO3A2
    Table 3
    Chromosome 6 Nucleotide 109015211 109041154 109080791
    Position
    SNP Allele “G” “C” “C”
  • The above data are from:
  • Database of Single Nucleotide Polymorphisms (dbSNP). Bethesda (Md.): National Center for Biotechnology Information, National Library of Medicine. (dbSNP Build ID: 129, NCBI genome build 36.3). Available from: http://www.ncbi.nlm.nih.gov/SNP/70
  • Further investigation comparing the genotype frequencies of FOXO3A3 between cases and controls revealed a highly significant difference with an exact p value of 0.00009 using the permutation distribution of the Pearson's chi-square statistic. These results are presented in Table 4. There were five loci with 3 SNPs within each allele in this study (Table 3) so Bonferroni adjustment for multiple comparisons resulted in a corrected p value of 15×0.00009=0.00135. Due to the high link LD between the 3 SNPs of FOXO3A, we further investigated the FOXO3A3 SNP only (rs2802292). The odds ratio (OR) for homozygous minor vs. homozygous major alleles for FOXO3A3 between the cases and controls was 2.75 (95% CI: 1.51−5.02, p=0.0007), and the OR for heterozygous vs. homozygous major alleles between the cases and controls was 1.91 (95% CI: 1.34−2.72, p=0.0003). These results suggest an additive effect on longevity.
  • TABLE 4
    FOXO 3A3 Genotype by Case-Control Status
    FOXO 3A3 Genotype (rs 2802292)
    Case-Control Status TT TG GG
    Average-Lived Phenotype* 223 (55%) 153 (38%) 26 (6%) 
    Longevity Phenotype†  81 (38%) 106 (50%) 26 (12%)
    p value for Pearson Exact test‡ 0.000091
    p value after Bonferroni adjustment 0.00135
    *number and % of subjects from n = 402 “average-lived” decreased controls (mean attained age 78.5 years)
    †number and percent of subjects from n = 213 “long-lived” cases (mean attained age 97.9 years)
    ‡From the exact Pearson Chi-square test comparing the genotype frequencies in the cases and controls.
  • In order to understand more about the longevity phenotype at younger ages, we compared the proportion of people who were healthy at the baseline exam (1991-93) for each of the three FOXO3A genotype groups using the definition of healthy survival from Willcox et al. (2006).44 The differences were highly significant (Table 5). Those who possessed one or more G alleles were much more likely to be healthy at baseline than those who were homozygous for the major (TT) allele. Approximately 75% of those homozygous for the minor allele were healthy at the baseline exam versus only about 57% of those homozygous for the major allele. After adjusting for case-control status, the differences were still marginally significant. This suggests that there was remaining association of the allele with health status within the categories of long term survivors (cases) and controls.
  • TABLE 5
    Difference in Health Status between Genotype Groups at Baseline
    % Healthy at Baseline* p for trend
    Homo. Homo. Un- Adj. for Case-
    Major Heter. Minor adjusted Control Slat
    FOXO3A1 57.41 69.48 75.51 0.01 0.065
    FOXO3A2 57.37 69.35 77.08 0.01 0.035
    FOXO3A3 57.89 68.34 75.00 0.02 0.097
    *“Healthy” defined as absence of six major chronic diseases (CHD; stroke, cancer, PD, COPD and treated Type 2 DM; high physical function (can walk ½ mile) and high cognitive function (CASI score >74).
  • In order to assess whether there was a relation between insulin sensitivity, a potential intermediate phenotype of longevity, and genotype, we tested the relation between fasting insulin, glucose, HOMA and genotype (Table 6). For non-normally distributed variables we used log conversion to a normal distribution. There was a significant relation between insulin, log insulin, HOMA and genotype. Homozygosity for the G allele was associated with markedly lower insulin, log insulin and HOMA score, but in controls only.
  • TABLE 6
    Insulin Sensitivity Phenotypes According to FOXO3A Genotype
    FOXO3A Genotype (rs 2802292)
    TT TG GG P*
    Fasting Glucose
    (mg/dl)
    Average-Lived 118.4 ± 34.0  117.4 ± 38.0  115.9 ± 40.1 0.80
    Long-Lived 108.3 ± 20.7  109.1 ± 23.7  110.5 ± 24.1 0.73
    Fasting Insulin
    (mIU/L)
    Average-Lived 23.7 ± 81.2 30.4 ± 91.9 13.2 ± 5.9 0.004
    Long-Lived 13.5 ± 9.0  14.1 ± 13.4 13.3 ± 9.3 0.77
    Log Fasting
    Insulin (mIU/L)
    Average-Lived 2.68 ± 0.67 2.73 ± 0.85  2.47 ± 0.48 0.03
    Long-Lived 2.45 ± 0.55 2.43 ± 0.61  2.44 ± 0.52 0.99
    HOMA IR Score
    Average-Lived  9.1 ± 53.0 10.0 ± 32.2  3.8 ± 2.4 0.03
    Long-Lived 3.7 ± 2.8 4.0 ± 4.3  3.6 ± 2.2 0.55
    *p-value for Student's t-test comparing mean values between GG genotype and other groups within cases and controls.
  • We also tested for a relation between lifetime prevalence of several chronic diseases and FOXO3A genotype in study participants (Table 7).
  • TABLE 7
    Prevalence of Aging-related Phenotypes in
    Relation to FOXO3A3 Genotype
    FOXO3A3
    Genotype
    TT TG GG p
    CHD prevalence (%)
    Average-Lived 32.3 18.3 23.1 0.010
    Long-Lived  7.4  7.6  7.7 0.998
    All 25.7 14.0 15.4 0.002
    Stroke prevalence (%)
    Average-Lived  6.7  8.5  7.7 0.813
    Long-Lived  4.9  1.9  3.8 0.510
    All  6.3  5.8  5.8 0.974
    Cancer prevalence (%)
    Average-Lived 22.4 18.3 11.5 0.326
    Long-Lived 17.3 12.4  7.7 0.400
    All 21.1 15.9  9.6 0.075
    Diabetes prevalence (%)
    Average-Lived 60.6 62.3 50.0 0.498
    Long-Lived 57.5 64.1 50.0 0.368
    All 59.8 63.0 50.0 0.212
    p value based on Chi-Square test comparing frequency of GG genotype to other genotypes for average lived controls (n = 402), long lived cases (n = 213) and all subjects (n = 615).
  • A significant protective relation was found for homozygosity for the G allele with regard to prevalence of CHD and a borderline relation for cancer and cognitive function. Finally, we assessed the FOXO3A3 minor allele frequency (MAF) distribution by maximum attained age in all participants combined (cases and controls). The MAF increased markedly with age, as expected by earlier case-control analyses (Table 8).
  • TABLE 8
    Genotype Distribution by Maximum Attained Age
    MAF of
    Age at Death (years)* N FOXO3A3
    72-74 17 0.21
    75-79 277 0.25
    80-81 108 0.26
    95-99 185 0.37
    100-106 28 0.39
    *37 “long-lived” cases were still alive; mean age of 98.7 y (range 97-106).
  • The analysis of five candidate genes demonstrated that one gene clearly stood out from the others in terms of a potential human longevity gene FOXO3A. That this gene might be important to human longevity is supported by several lines of evidence. First, in nested case-control analyses, variation within this gene was strongly associated with longevity. The odds ratio (OR) for being homozygous minor vs. homozygous major for FOXO3A3 allele (rs 2802292) between the cases and controls was 2.75 (95% CI: 1.51−5.02, p=0.0007), and the OR for heterozygous vs. homozygous major between the cases and controls was 1.91 (95% CI: 1.34−2.72, p=0.0003). These results suggest an additive effect of the FOXO3A3 G allele on longevity. (i.e., two copies of the G allele conferred about twice the protective effect). Consistent with this, the minor allele frequency rose markedly with age of the study participants, from septuagenarian to centenarian ages (Table 8).
  • Second, all three SNPs that were assessed in the FOXO3A gene, which were in tight linkage disequilibrium (LD), were strongly correlated with the longevity phenotype. This indicates that the finding was unlikely due to chance. Third, those who possessed one or more of the minor (G) alleles were much more likely to be healthy at the baseline exam, approximately 15 years prior, than those homozygous for the major (TT) allele. About 75% of those homozygous for the minor allele were healthy at baseline exam versus only about 57% of those homozygous for the major (TT) allele (Table 5).
  • In fact, the baseline exam suggested that cases were markedly healthier than controls despite the fact that cases were, on average, 11 years older. The cases possessed significantly less age-related disease, including less prevalent CHD, stroke, and cancer. They also had better self-rated health and generally had high physical function, including less difficulty walking. Interestingly, despite being more than a decade older than controls, the longevity cases had similar levels of cognitive function. This supports the existence of a “healthy aging” phenotype where individuals somehow delay or avoid major clinical disease and disability until late in life. The healthy aging phenotype that we observed in cases is similar to the healthy aging phenotypes reported in centenarians at younger ages when compared to their age-matched birth cohorts46-48 and in centenarian offspring.49 Long-lived cases also had metabolic profiles that suggested higher insulin sensitivity at younger ages, with lower waist to hip ratio, lower glucose levels, lower insulin levels and lower HOMA values (Tables 2 and 6). Several phenotypes were associated with variation in FOXO3A genotype.
  • Surprisingly, there was no significant difference in diabetes prevalence between cases and controls. However, since the cases were more than a decade older than controls, and diabetes tends to increase markedly with age, it is noteworthy that prevalence of diabetes was not significantly different. In fact, both cases and controls had a high prevalence of diabetes (near 60%), despite relatively low BMI. Why Type 2 diabetes tends to be more prevalent in Japanese at a relatively low BMI is not completely understood.50 However, there may be metabolic differences in Japanese (and some other Asians) with higher visceral fat in Asians at lower BMI than whites and blacks.51,52 Indeed, Japan national guidelines reflect such population differences and consider Japanese obese at a BMI of 25.53 Other contributing factors to the high prevalence of diabetes in the HHP/HAAS cohort include the fact that all participants were tested for diabetes by several different clinical tests and at several prior examinations making detection more likely.
  • Of note, FOXO3A genotype was significantly associated with plasma insulin levels as well as CHD, cancer and Type 2 diabetes prevalence. This is consistent with a known role for FOXO as a mediator of the effects of insulin and insulin-like growth factors on diverse physiological functions, including cell proliferation, apoptosis and metabolism.17,54 Genetic studies in C. elegans and Drosophila have shown that FOXO proteins are ancient targets of insulin-like signaling that regulate metabolism and longevity. Additional work in mammalian cells has shown that FOXO proteins are the targets of protein kinases, influence cell cycle progression, and regulate resistance to oxidative stress in vitro.54 In vivo studies have shown that FOXO modifies hepatic glucose output in response to insulin and mediates other metabolic actions.54 This strengthens the evidence that FOXO proteins may mediate insulin effects on metabolism and influence longevity in humans.
  • Overall, the totality of the evidence supports a potential role of FOXO3A in human health, aging and longevity. The association of FOXO with diverse aging phenotypes, including insulin sensitivity, CHD, cancer, Type 2 diabetes and longevity, is suggestive of a “gatekeeper” role in the IIS pathway. An important downstream mechanism whereby FOXO3A might influence human aging is through modification of oxidative stress—a long held theory of how we age,33 although we have no direct evidence for this in the current study. However, since FOXO genes are the closest human homologues of C. elegans DAF-16, which protects cells from oxidative stress, this is a plausible mechanism of action for modification of human aging.17 In C. elegans, DAF-16 increases the expression of manganese superoxide dismutase (SOD2), which converts superoxide to less damaging hydrogen peroxide and is a potent endogenous protector against free radicals,55 among other “anti-aging” effects. In vivo studies show that oxidative lesions in DNA, proteins and other tissues accumulate with age and feeding calorically restricted diets (a potent insulin sensitizer) to rodents 56 and humans57 mitigates this damage.
  • While FOXO was clearly associated longevity we did not observe a strong effect of genotype on insulin sensitivity in cases—just controls. However, the GG genotype demonstrated similarly low plasma insulin levels in both cases and controls, consistent with a modulating effect of genotype on insulin levels in both groups. It is tempting to speculate that since the cases showed greater insulin sensitivity no matter what their genotype that they have multiple mechanisms to maintain insulin sensitivity other than FOXO. This would be consistent with the hypothesis that most longevity genes have modest or small effect sizes. It is also possible that small sample size limited our ability to detect differences in the cases. On the other hand, long-lived mice carrying mutations in either IRS-158 or IRS-223 are actually insulin resistant, so insulin sensitivity is not a necessary condition for mutations in the IIS pathway to be able to confer greater longevity.
  • However, it is interesting to note that in C. elegans, several genes that by themselves may have small effects on lifespan, are influenced by the transcription regulating “master gene” DAF-16.59 Small differences in FOXO3A that may be otherwise difficult to detect, could theoretically modify several downstream genes related to DNA binding, protein-protein interactions, cell cycle progression, apoptosis and metabolism. In this manner, a small modifying effect by FOXO3A potentially has larger, additive downstream effects on aging phenotypes and longevity.
  • Supportive evidence is beginning to accumulate for a role of insulin-signaling in human aging and longevity but the genes that might mediate these effects are not known. Prior studies have found over or under representation of single nucleotide polymorphisms (SNPs) from the insulin-IGF-1 signaling pathway in long-lived humans of Italian,36 Japanese,37,42 Dutch and Ashkenazi Jewish38 ethnicity, with links to several aging phenotypes. While some of these findings have been limited by small effect sizes and marginal statistical significance, the study by Suh et al.38 also demonstrated that functionally significant mutations in the IGF-1 receptor exist in some long-lived humans, such as centenarians.
  • To date, there has little study of FOXO genes and phenotypes of aging in humans. Two recent studies suggest that FOXO genes deserve further scrutiny. First, a longitudinal study of elderly Dutch men and women found that a FOXO1A haplotype predicted 4-year survival and that a FOXO3A haplotype predicted stroke risk.39 Second, the Framingham Study, in a genome-wide association analysis, found that a FOXO3A SNP was strongly associated with age at natural menopause in women (p=0.00003). However, the Dutch findings were not statistically significant when accounting for multiple comparisons and both studies need replication. The present study is supportive and extends the associations of FOXO3A to human longevity and insulin sensitivity.
  • One of the major advantages of the current study is that it employed a nested case-control design. This study design selects cases and controls from an ongoing cohort study with longitudinally collected data. Therefore, several phenotypes of interest (e.g. disease prevalence, health status, function) were obtained by direct clinical examination when the participants were younger making the data less subject to recall bias. Recall bias, where study results are less accurate due to difficulty in remembering past events, can be a significant challenge with older adults.
  • Indeed, studies of exceptional survivors, such as centenarians, that have found evidence for phenotypes suggestive of slower aging46-48 could potentially suffer from significant recall bias. That is, older participants may not recall precisely their past medical history and their past functional status. However, in the current study, major diseases were adjudicated by a morbidity and mortality committee and performance-based measures of physical and cognitive function were used to supplement self-reports, and evidence was found for such a healthy aging phenotype. This lends prospective support to previous retrospective work.
  • There are several other strengths to this study. First, the candidate genes selected for analysis were chosen a priori based on hypothesis-driven criteria. That is, studies of models organisms of aging employing various methods, particularly knockouts, have shown that the IIS pathway is important for aging and longevity. And many functions appear to be evolutionarily conserved. Second, the findings are strong, highly significant, and include several adjacent SNPs in the FOXO3A gene. Third, the findings are biologically plausible and support the prior findings in animal models of aging and also support the limited prior human studies. Fourth, the case-control associations with longevity were detected using a nested case-control analysis with a high event rate (deaths) during a long period of follow-up. Fifth, the HHP cohort is a highly homogenous cohort and there was no population stratification detected in our study participants.
  • A possible drawback is that since the cases and controls had an average age difference of 11 years we cannot exclude birth cohort as a confounder. But this is unlikely since there was a maximum 19-year difference in birth years between participants. Also, sub analyses revealed no differences in education and occupation (data not shown) between cases and controls. Moreover, it was the participants who were older at baseline who were more likely to have lived to 95-plus years and thus obtain the longevity phenotype. Most cohort effects show health advantages for younger cohorts. Another possible drawback is that this study was conducted in only one population and thus should be replicated in other populations in order to assess its generalizability.
  • In summary, we found that common, natural genetic variation within the FOXO3A gene was strongly associated with human longevity. The prevalence of the protective allele increased markedly with age. Long-lived cases were also more likely to possess several additional phenotypes linked to healthy aging, including lower prevalence of cancer and cardiovascular disease, better self-reported health, high functional status and they exhibited several biological markers suggestive of greater insulin sensitivity at the baseline exam. Finally, particular variants within the FOXO3A gene were also associated with several of these aging phenotypes, including insulin sensitivity, a putative intermediate phenotype of longevity.
  • B. Detection of Alleles in Patients (Human and Non-Human)
  • Many methods are available for detecting specific alleles at polymorphic loci. The preferred method for detecting a specific polymorphic allele will depend, in part, upon the molecular nature of the polymorphism. For example, the various allelic forms of the polymorphic locus may differ by a single base-pair of the DNA. Such single nucleotide polymorphisms (or SNPs) are major contributors to genetic variation, comprising some 80% of all known polymorphisms, and their density in the human genome is estimated to be on average 1 per 1,000 base pairs. SNPs are most frequently biallelic—occurring in only two different forms (although up to four different forms of an SNP, corresponding to the four different nucleotide bases occurring in DNA, are theoretically possible). Nevertheless, SNPs are mutationally more stable than other polymorphisms, making them suitable for association studies in which linkage disequilibrium between markers and an unknown variant is used to map disease-causing mutations. In addition, because SNPs typically have only two alleles, they can be genotyped by a simple plus/minus assay rather than a length measurement, making them more amenable to automation.
  • A variety of methods are available for detecting the presence of a particular single nucleotide polymorphic allele in an individual. Advancements in this field have provided accurate, easy, and inexpensive large-scale SNP genotyping. Most recently, for example, several new techniques have been described including dynamic allele-specific hybridization (DASH), microplate array diagonal gel electrophoresis (MADGE), pyrosequencing, oligonucleotide-specific ligation, the TaqMan system as well as various DNA “chip” technologies such as the Affymetrix SNP chips. These methods require amplification of the target genetic region, typically by PCR. Still other newly developed methods, based on the generation of small signal molecules by invasive cleavage followed by mass spectrometry or immobilized padlock probes and rolling-circle amplification, might eventually eliminate the need for PCR. Several of the methods known in the art for detecting specific single nucleotide polymorphisms are summarized below. The method of the present invention is understood to include all available methods.
  • Several methods have been developed to facilitate analysis of single nucleotide polymorphisms. In one embodiment, the single base polymorphism can be detected by using a specialized exonuclease-resistant nucleotide, as disclosed, e.g., in Mundy, C. R. (U.S. Pat. No. 4,656,127). According to the method, a primer complementary to the allelic sequence immediately 3′ to the polymorphic site is permitted to hybridize to a target molecule obtained from a particular animal or human. If the polymorphic site on the target molecule contains a nucleotide that is complementary to the particular exonuclease-resistant nucleotide derivative present, then that derivative will be incorporated onto the end of the hybridized primer. Such incorporation renders the primer resistant to exonuclease, and thereby permits its detection. Since the identity of the exonuclease-resistant derivative of the sample is known, a finding that the primer has become resistant to exonucleases reveals that the nucleotide present in the polymorphic site of the target molecule was complementary to that of the nucleotide derivative used in the reaction. This method has the advantage that it does not require the determination of large amounts of extraneous sequence data.
  • In another embodiment of the invention, a solution-based method is used for determining the identity of the nucleotide of a polymorphic site. Cohen, D. et al. (French Patent 2,650,840; PCT Appln. No. WO91/02087). As in the Mundy method of U.S. Pat. No. 4,656,127, a primer is employed that is complementary to allelic sequences immediately 3′ to a polymorphic site. The method determines the identity of the nucleotide of that site using labeled dideoxynucleotide derivatives, which, if complementary to the nucleotide of the polymorphic site will become incorporated onto the terminus of the primer.
  • An alternative method, known as Genetic Bit Analysis or GBA™ is described by Goelet, P. et al. (PCT Appln. No. 92/15712). The method of Goelet, P. et al. uses mixtures of labeled terminators and a primer that is complementary to the sequence 3′ to a polymorphic site. The labeled terminator that is incorporated is thus determined by, and complementary to, the nucleotide present in the polymorphic site of the target molecule being evaluated. In contrast to the method of Cohen et al. (French Patent 2,650,840; PCT Appln. No. WO91/02087) the method of Goelet, P. et al. is preferably a heterogeneous phase assay, in which the primer or the target molecule is immobilized to a solid phase.
  • Recently, several primer-guided nucleotide incorporation procedures for assaying polymorphic sites in DNA have been described (Komher, J. S. et al., Nucl. Acids. Res. 17:7779-7784 (1989); Sokolov, B. P., Nucl. Acids Res. 18:3671 (1990); Syvanen, A.-C., et al., Genomics 8:684-692 (1990); Kuppuswamy, M. N. et al., Proc. Natl. Acad. Sci. (U.S.A.) 88:1143-1147 (1991); Prezant, T. R. et al., Hum. Mutat. 1:159-164 (1992); Ugozzoli, L. et al., GATA 9:107-112 (1992); Nyren, P. et al., Anal. Biochem. 208:171-175 (1993). These methods differ from GBA™ in that they all rely on the incorporation of labeled deoxynucleotides to discriminate between bases at a polymorphic site. In such a format, since the signal is proportional to the number of deoxynucleotides incorporated, polymorphisms that occur in runs of the same nucleotide can result in signals that are proportional to the length of the run (Syvanen, A.-C., et al., Amer. J. Hum. Genet. 52:46-59 (1993)).
  • For mutations that produce premature termination of protein translation, the protein truncation test (PTT) offers an efficient diagnostic approach (Roest, et. al., (1993) Hum. Mol. Genet. 2:1719-21; van der Luijt, et. al., (1994) Genomics 20:1-4). For PTT, RNA is initially isolated from available tissue and reverse-transcribed, and the segment of interest is amplified by PCR. The products of reverse transcription PCR are then used as a template for nested PCR amplification with a primer that contains an RNA polymerase promoter and a sequence for initiating eukaryotic translation. After amplification of the region of interest, the unique motifs incorporated into the primer permit sequential in vitro transcription and translation of the PCR products. Upon sodium dodecyl sulfate-polyacrylamide gel electrophoresis of translation products, the appearance of truncated polypeptides signals the presence of a mutation that causes premature termination of translation. In a variation of this technique, DNA (as opposed to RNA) is used as a PCR template when the target region of interest is derived from a single exon.
  • Any cell type or tissue may be utilized to obtain nucleic acid samples for use in the diagnostics described herein. In a preferred embodiment, the DNA sample is obtained from a bodily fluid, e.g. blood, obtained by known techniques (e.g. venipuncture) or saliva. Alternatively, nucleic acid tests can be performed on dry samples (e.g. hair or skin). When using RNA or protein, the cells or tissues that may be utilized must express an FOXO3A gene.
  • Diagnostic procedures may also be performed in situ directly upon tissue sections (fixed and/or frozen) of patient tissue obtained from biopsies or resections, such that no nucleic acid purification is necessary. Nucleic acid reagents may be used as probes and/or primers for such in situ procedures (see, for example, Nuovo, G. J., 1992, PCR in situ hybridization: protocols and applications, Raven Press, N.Y.).
  • In addition to methods which focus primarily on the detection of one nucleic acid sequence, profiles may also be assessed in such detection schemes. Fingerprint profiles may be generated, for example, by utilizing a differential display procedure, Northern analysis and/or RT-PCR.
  • A preferred detection method is allele specific hybridization using probes overlapping a region of at least one allele of an FOXO3A haplotype and having about 5, 10, 20, 25, or 30 nucleotides around the mutation or polymorphic region. In a preferred embodiment of the invention, several probes capable of hybridizing specifically to other allelic variants are attached to a solid phase support, e.g., a “chip” (which can hold up to about 250,000 oligonucleotides). Oligonucleotides can be bound to a solid support by a variety of processes, including lithography. Mutation detection analysis using these chips comprising oligonucleotides, also termed “DNA probe arrays” is described e.g., in Cronin et al. (1996) Human Mutation 7:244. In one embodiment, a chip comprises all the allelic variants of at least one polymorphic region of a gene. The solid phase support is then contacted with a test nucleic acid and hybridization to the specific probes is detected. Accordingly, the identity of numerous allelic variants of one or more genes can be identified in a simple hybridization experiment.
  • These techniques may also comprise the step of amplifying the nucleic acid before analysis. Amplification techniques are known to those of skill in the art and include, but are not limited to cloning, polymerase chain reaction (PCR), polymerase chain reaction of specific alleles (ASA), ligase chain reaction (LCR), nested polymerase chain reaction, self sustained sequence replication (Guatelli, J. C. et al., 1990, Proc. Natl. Acad. Sci. USA 87:1874-1878), transcriptional amplification system (Kwoh, D. Y. et al., 1989, Proc. Natl. Acad. Sci. USA 86:1173-1177), and Q-Beta Replicase (Lizardi, P. M. et al., 1988, Bio/Technology 6:1197).
  • Amplification products may be assayed in a variety of ways, including size analysis, restriction digestion followed by size analysis, detecting specific tagged oligonucleotide primers in the reaction products, allele-specific oligonucleotide (ASO) hybridization, allele specific 5′ exonuclease detection, sequencing, hybridization, and the like.
  • PCR based detection means can include multiplex amplification of a plurality of markers simultaneously. For example, it is well known in the art to select PCR primers to generate PCR products that do not overlap in size and can be analyzed simultaneously. Alternatively, it is possible to amplify different markers with primers that are differentially labeled and thus can each be differentially detected. Of course, hybridization based detection means allow the differential detection of multiple PCR products in a sample. Other techniques are known in the art to allow multiplex analyses of a plurality of markers.
  • In a merely illustrative embodiment, the method includes the steps of (i) collecting a sample of cells from a patient (from saliva, cheek swab, blood or other body fluid or component), (ii) isolating nucleic acid (e.g., genomic, mRNA or both) from the cells of the sample, (iii) contacting the nucleic acid sample with one or more primers which specifically hybridize 5′ and 3′ to at least one allele of an FOXO3A haplotype under conditions such that hybridization and amplification of the allele occurs, and (iv) detecting the amplification product. These detection schemes are especially useful for the detection of nucleic acid molecules if such molecules are present in very low numbers.
  • In a preferred embodiment of the subject assay, the allele of an FOXO3A haplotype is identified by alterations in restriction enzyme cleavage patterns. For example, sample and control DNA is isolated, amplified (optionally), digested with one or more restriction endonucleases, and fragment length sizes are determined by gel electrophoresis.
  • In yet another embodiment, any of a variety of sequencing reactions known in the art can be used to directly sequence the allele. Exemplary sequencing reactions include those based on techniques developed by Maxim and Gilbert ((1977) Proc. Natl. Acad Sci USA 74:560) or Sanger (Sanger et al (1977) Proc. Nat. Acad. Sci. USA 74:5463). It is also contemplated that any of a variety of automated sequencing procedures may be utilized when performing the subject assays (see, for example Biotechniques (1995) 19:448), including sequencing by mass spectrometry (see, for example PCT publication WO 94/16101; Cohen et al. (1996) Adv Chromatogr 36:127-162; and Griffin et al. (1993) Appl Biochem Biotechnol 38:147-159). It will be evident to one of skill in the art that, for certain embodiments, the occurrence of only one, two or three of the nucleic acid bases need be determined in the sequencing reaction. For instance, A-track or the like, e.g., where only one nucleic acid is detected, can be carried out.
  • In a further embodiment, protection from cleavage agents (such as a nuclease, hydroxylamine or osmium tetroxide and with piperidine) can be used to detect mismatched bases in RNA/RNA or RNA/DNA or DNA/DNA heteroduplexes (Myers, et al. (1985) Science 230:1242). In general, the art technique of “mismatch cleavage” starts by providing heteroduplexes formed by hybridizing (labeled) RNA or DNA containing the wild-type allele with the sample. The double-stranded duplexes are treated with an agent which cleaves single-stranded regions of the duplex such as which will exist due to base pair mismatches between the control and sample strands. For instance, RNA/DNA duplexes can be treated with RNase and DNA/DNA hybrids treated with S1 nuclease to enzymatically digest the mismatched regions. In other embodiments, either DNA/DNA or RNA/DNA duplexes can be treated with hydroxylamine or osmium tetroxide and with piperidine in order to digest mismatched regions. After digestion of the mismatched regions, the resulting material is then separated by size on denaturing polyacrylamide gels to determine the site of mutation. See, for example, Cotton et al (1988) Proc. Natl. Acad Sci USA 85:4397; and Saleeba et al (1992) Methods Enzymol. 217:286-295. In a preferred embodiment, the control DNA or RNA can be labeled for detection.
  • In still another embodiment, the mismatch cleavage reaction employs one or more proteins that recognize mismatched base pairs in double-stranded DNA (so called “DNA mismatch repair” enzymes). For example, the mutt enzyme of E. coli cleaves A at G/A mismatches and the thymidine DNA glycosylase from HeLa cells cleaves T at G/T mismatches (Hsu et al. (1994) Carcinogenesis 15:1657-1662). According to an exemplary embodiment, a probe based on an allele of an FOXO3A locus haplotype is hybridized to a cDNA or other DNA product from a test cell(s). The duplex is treated with a DNA mismatch repair enzyme, and the cleavage products, if any, can be detected from electrophoresis protocols or the like See, for example, U.S. Pat. No. 5,459,039, which is incorporated by reference herein in its entirety.
  • In other embodiments, alterations in electrophoretic mobility will be used to identify an FOXO3A locus allele. For example, single strand conformation polymorphism (SSCP) may be used to detect differences in electrophoretic mobility between mutant and wild type nucleic acids (Orita et al. (1989) Proc Natl. Acad. Sci. USA 86:2766, see also Cotton (1993) Mutat Res 285:125-144; and Hayashi (1992) Genet Anal Tech Appl 9:73-79). Single-stranded DNA fragments of sample and control FOXO3A locus alleles would be denatured and allowed to renature. The secondary structure of single-stranded nucleic acids varies according to sequence, the resulting alteration in electrophoretic mobility enables the detection of even a single base change. The DNA fragments may be labeled or detected with labeled probes. The sensitivity of the assay may be enhanced by using RNA (rather than DNA), in which the secondary structure is more sensitive to a change in sequence. In a preferred embodiment, the subject method utilizes heteroduplex analysis to separate double stranded heteroduplex molecules on the basis of changes in electrophoretic mobility (Keen et al. (1991) Trends Genet. 7:5).
  • In yet another embodiment, the movement of alleles in polyacrylamide gels containing a gradient of denaturant is assayed using denaturing gradient gel electrophoresis (DGGE) (Myers et al. (1985) Nature 313:495). When DGGE is used as the method of analysis, DNA will be modified to insure that it does not completely denature, for example by adding a GC clamp of approximately 40 bp of high-melting GC-rich DNA by PCR. In a further embodiment, a temperature gradient is used in place of a denaturing agent gradient to identify differences in the mobility of control and sample DNA (Rosenbaum and Reissner (1987) Biophys Chem 265:12753).
  • Examples of other techniques for detecting alleles include, but are not limited to, selective oligonucleotide hybridization, selective amplification, or selective primer extension. For example, oligonucleotide primers may be prepared in which the known mutation or nucleotide difference (e.g., in allelic variants) is placed centrally and then hybridized to target DNA under conditions which permit hybridization only if a perfect match is found (Saiki et al. (1986) Nature 324:163); Saiki et al (1989) Proc. Natl. Acad. Sci. USA 86:6230). Such allele specific oligonucleotide hybridization techniques may be used to test one mutation or polymorphic region per reaction when oligonucleotides are hybridized to PCR amplified target DNA or a number of different mutations or polymorphic regions when the oligonucleotides are attached to the hybridizing membrane and hybridized with labelled target DNA.
  • Alternatively, the allele specific amplification technology, which depends on selective PCR amplification, may be used in conjunction with the instant invention. Oligonucleotides used as primers for specific amplification may carry the mutation or polymorphic region of interest in the center of the molecule (so that amplification depends on differential hybridization) (Gibbs et al (1989) Nucleic Acids Res. 17:2437-2448) or at the extreme 3′ end of one primer where, under appropriate conditions, mismatch can prevent, or reduce polymerase extension (Prossner (1993) Tibtech 11:238. In addition it may be desirable to introduce a novel restriction site in the region of the mutation to create cleavage based detection (Gasparini et al (1992) Mol. Cell. Probes 6:1). It is anticipated that in certain embodiments amplification may also be performed using Taq ligase for amplification (Barany (1991) Proc. Natl. Acad. Sci USA 88:189). In such cases, ligation will occur only if there is a perfect match at the 3′ end of the 5′ sequence making it possible to detect the presence of a known mutation at a specific site by looking for the presence or absence of amplification.
  • In another embodiment, identification of the allelic variant is carried out using an oligonucleotide ligation assay (OLA), as described, e.g., in U.S. Pat. No. 4,998,617 and in Landegren, U. et al. ((1988) Science 241:1077-1080). The OLA protocol uses two oligonucleotides which are designed to be capable of hybridizing to abutting sequences of a single strand of a target. One of the oligonucleotides is linked to a separation marker, e.g., biotinylated, and the other is detectably labeled. If the precise complementary sequence is found in a target molecule, the oligonucleotides will hybridize such that their termini abut, and create a ligation substrate. Ligation then permits the labeled oligonucleotide to be recovered using avidin, or another biotin ligand. Nickerson, D. A. et al. have described a nucleic acid detection assay that combines attributes of PCR and OLA (Nickerson, D. A. et al. (1990) Proc. Natl. Acad. Sci. USA 87:8923-27). In this method, PCR is used to achieve the exponential amplification of target DNA, which is then detected using OLA.
  • Several techniques based on this OLA method have been developed and could be used to detect alleles of an FOXO3a locus haplotype. For example, U.S. Pat. No. 5,593,826 discloses an OLA using an oligonucleotide having 3′-amino group and a 5′-phosphorylated oligonucleotide to form a conjugate having a phosphoramidate linkage. In another variation of OLA described in To be et al. ((1996) Nucleic Acids Res 24: 3728), OLA combined with PCR permits typing of two alleles in a single microtiter well. By marking each of the allele-specific primers with a unique hapten, i.e. digoxigenin and fluorescein, each OLA reaction can be detected by using hapten specific antibodies that are labeled with different enzyme reporters, alkaline phosphatase or horseradish peroxidase. This system permits the detection of the two alleles using a high throughput format that leads to the production of two different colors.
  • Another embodiment of the invention is directed to kits for detecting a likelihood for long life or the need for wellness or diagnostic intervention in the near future. This kit may contain one or more oligonucleotides, including 5′ and 3′ oligonucleotides that hybridize 5′ and 3′ to at least one allele of a FOXO3A locus haplotype. PCR amplification oligonucleotides should hybridize between 25 and 2500 base pairs apart, preferably between about 100 and about 500 bases apart, in order to produce a PCR product of convenient size for subsequent analysis.
  • Particularly preferred primers include nucleotide sequences described in SEQ IDs Nos. 2-9. Suitable primers for the detection of a human polymorphism in these genes can be readily designed using this sequence information and standard techniques known in the art for the design and optimization of primers sequences. Optimal design of such primer sequences can be achieved, for example, by the use of commercially available primer selection programs such as Primer 2.1, Primer 3 or GeneFisher.
  • An example of a simple method for the detection of the “GCC haplotype” involves the use of allele-specific primers that amplify the specific nucleotide of interest, similar to that described in paragraph [0067]. This method exploits the fact that oligonucleotide primers must be perfectly annealed at their 3′ ends for a DNA polymerase to extend these primers during PCR. By designing oligonucleotide primers that match only a specific DNA point difference, such as that found in the rs2802292 polymorphisms—primers that do not bind the T-type allele—such primers can distinguish between polymorphic alleles. It is necessary to set up a control reaction in the same tube as the amplification refractory mutation system reaction (ARMS) to ensure that lack of product generation from a given sample is not simply due to failure of the PCR reaction rather than absence of the “G” variant that the assay is probing for. Oligonucleotides used for this purpose included forward outer (“rs2802292_FO”), 5′-GAAACTGAGGCTAACAGCTGGGTCTGGCCC-3′ identified as SEQ ID No. 5; reverse outer (“rs2802292_RO”), 5′-AGCTGATGCTCCTCAACGAAACCACCTTAC-3′ identified as SEQ ID No. 6; reverse G-specific (“rs2802292_RG”), 5′-GGACCCCTTCATCTGTCACACAGAGGCTcC-3′ identified as SEQ ID No.7; and forward T-specific (“rs2802292_FT”), 5′-CTGTTGCTCACAAGAGCTCAGGGCTGGGcT-3′ identified as SEQ ID No.8, where the underlined final base in the latter two primers anneals at the site of the G-T difference, whereas the 2nd by from the 3′ end (lowercase) is intentionally mismatched to maximize allelic specificity. The four primers in this illustrative example are set forth in Table No. 9.
  • TABLE 9
    Primers for Identification of the rs2802292 G-T
    Polymporphism
    Primer Sequence
    forward outer 5′-GAAACTGAGGCTAACAGCTGGGTCTGGCCC-3′
    “rs2802292_FO”
    reverse outer 5′-AGCTGATGCTCCTCAACGAAACCACCTTAC-3′
    “rs2802292_RO”
    reverse G-specific 5′-GGACCCCTTCATCTGTCACACAGAGGCTcC-3′
    “rs2802292_RG”
    forward T-specific 5′-CTGTTGCTCACAAGAGCTCAGGGCTGGGcT-3′
    “rs2802292_FT”

    (Table 9 discloses SEQ ID NOS 5-8 respectively, in order of appearance)
  • The DNA Sequence of PCR Product Denoting Primers and G/T Variants (source Genbank AL391646.12) is as follows:
  • GAAACTGAGGCTAACAGCTGGGTCTGGCCCATGACTGGTTCAGTTGGTAT
    TTGGTGGACCAAGTTGACCAAGCTCACCCAGCTTCTGAGTGACAGAGTGA
    ATATAAACCCAGCCTGCTCACTCCATTTCCTAGTTTTCTCACCTCTACCA
    GGGTCTCTGTTGCTCACAAGAGCTCAGGGCTGGGA(T/G)AAGCCTCTGT
    GTGACAGATGAAGGGGTCCTGCTGCTCTCTAGGGAAGAATCGGTCCCAAA
    TTGCTCAAGGGAGTAAGGTGGTTTCGTTGAGGAGCATCAGCT,
    identified as SEQ ID No. 9.
  • When amplicons generated in this way are resolved in an agarose gel, the G-type primers can be shown to have generated a 186-bp product, whereas the T-type primers give a 132-bp product. The outside primers generate a 288-bp product that must be present in every reaction in order to guarantee the reaction has proceeded accurately.
  • Representative reagents and conditions for the amplification are shown in Table 10.
  • TABLE 10
    PCR conditions for Identification of rs2802292 G-T Polymorphism
    Reagent Final Concentration Vendor
    AmpliTaq Gold PCR Buffer 1 X Perkin-Elmer
    dNTPs
    200 μM Perkin-Elmer
    MgCl2 1.5 mM Perkin-Elmer
    “rs2802292_FO” 1.0 μM see above
    “rs2802292_FI” 1.0 μM see above
    “rs2802292_RG” 0.5 μM see above
    “rs2802292_FT” 0.5 μM see above
    “AmpliTaq Gold” 0.6 U Perkin-Elmer
    Human DNA 5-10 ng/μL
    H2O to volume
    The PCR conditions include 15 minutes at 94° C. followed by 30 cycles of 94° C. for 30 seconds, 60° C. for 30 seconds, 72° C. for 30 seconds, then a final incubation at 72° for 7 minutes. The results shown in the example were performed on an MJ Research model “PTC200” thermocycler.
  • The amplified fragments can be resolved on a 3% agarose gel as shown in FIG. 1. FIG. 1 gives the results of an ARMS-PCR assay to detect the FOXO3A G/T variants using the primers and conditions described above. Track 1 shows a subject homozygous for the “T” allele (132 bp); tracks 2 and 3 show subjects who are homozygous for the “G” allele (186 bp); and tracks 4 and 5 show subjects who are heterozygous for the “T” and “G” alleles (132+186 bp) and M is the 100 bp DNA ladder (Invitrogen, Paisley, United Kingdom).
  • In summary, FIG. 2 shows a schematic outline of the assay. Primers “rs2802292_FO” and “rs2802292_RO” flank the polymorphic locus rs2802292 and should generate a control 288-bp band in all cases. Primers “rs2802292_OF” and “rs2802292_RG” generate a 186-bp G-specific product and primers “rs2802292_FT” and “rs2802292_OR” generate a 132-bp T-specific product.
  • For use in a kit, oligonucleotides may be any of a variety of natural and/or synthetic compositions such as synthetic oligonucleotides, restriction fragments, cDNAs, synthetic peptide nucleic acids (PNAs), and the like. The assay kit and method may also employ labeled oligonucleotides to allow ease of identification in the assays. Examples of labels which may be employed include radio-labels, enzymes, fluorescent compounds, streptavidin, avidin, biotin, magnetic moieties, metal binding moieties, antigen or antibody moieties, and the like.
  • The kit may, optionally, also include DNA sampling means. DNA sampling means are well known to one of skill in the art and can include, but not be limited to substrates, such as filter papers, the AmpliCard™ (University of Sheffield, Sheffield, England S10 2J F; Tarlow, J W, et al., J of Invest. Dermatol. 103:387-389 (1994)) and the like; DNA purification reagents such as Nucleon™ kits, lysis buffers, proteinase solutions and the like; PCR reagents, such as reaction buffers, thermostable polymerase, dNTPs, and the like; and allele detection means such as the HinfI restriction enzyme, allele specific oligonucleotides, degenerate oligonucleotide primers for nested PCR from dried blood.
  • C. Pharmacogenomics
  • Knowledge of the particular alleles associated with a susceptibility to developing a particular disease or condition, alone or in conjunction with information on other genetic defects contributing to the particular disease or condition allows a customization of the prevention or treatment in accordance with the individual's genetic profile, the goal of “pharmacogenomics”. Thus, comparison of an individual's FOXO3A profile to the population profile for healthy aging, permits the selection or design of drugs or other therapeutic regimens that are expected to be safe and efficacious for a particular patient or patient population (i.e., a group of patients having the same genetic alteration).
  • Knowledge of the particular alleles described in this invention can be used to examine differences in cell behavior in cell cultures and tissue systems and measure the response of the cells to chemicals or biological agents that are added to the cell or tissue culture systems. Differences in cell behavior and responses can be compared between the genotypes in order to identify drugs or other pharmacologic agents that may be implemented in the desire to improve health or extend lifespan or to test new compounds for toxicity or potential effects on genes or gene expression.
  • In addition, the ability to target populations expected to show the highest clinical benefit, based on genetic profile can enable: 1) the repositioning of already marketed drugs; 2) the rescue of drug candidates whose clinical development has been discontinued as a result of safety or efficacy limitations, which are patient subgroup-specific; and 3) an accelerated and less costly development for candidate therapeutics and more optimal drug labeling (e.g. since measuring the effect of various doses of an agent on the causative mutation is useful for optimizing effective dose).
  • The treatment of an individual with a particular therapeutic agent can be monitored by measuring the level of expression for a gene associated with longevity. The level of expression can be measured by determining protein (e.g. FOXO3A), mRNA and/or transcriptional level. Depending on the level detected, the therapeutic regimen can then be maintained or adjusted (increased or decreased in dose). In a preferred embodiment, the effectiveness of treating a subject with an agent comprises the steps of: (i) obtaining a pre-administration sample from a subject prior to administration of the agent; (ii) detecting the level or amount of a protein, mRNA or genomic DNA in the pre-administration sample; (iii) obtaining one or more post-administration samples from the subject after administration of the therapeutic agent; (iv) detecting the level of expression or activity of the protein, mRNA or genomic DNA in the post-administration sample; (v) comparing the level of expression or activity of the protein, mRNA or genomic DNA in the pre-administration sample with the corresponding protein, mRNA or genomic DNA in the post-administration sample, respectively; and (vi) altering the administration of the agent to the subject accordingly.
  • Cells of a subject may also be obtained before and after administration of a therapeutic to detect the level of expression of genes other than a FOXO3A gene to verify that the therapeutic does not increase or decrease the expression of genes which could be deleterious. This can be done, e.g., by using the method of transcriptional profiling. Thus, mRNA from cells exposed in vivo to a therapeutic and mRNA from the same type of cells that were not exposed to the therapeutic could be reverse transcribed and hybridized to a chip containing DNA from numerous genes, to thereby compare the expression of genes in cells treated and not treated with the therapeutic.
  • The “GCC” haplotype can be used in risk calculators to aid in the prediction of death and age-associated diseases (heart disease, stroke, cancer, COPD or other chronic lung disease, Parkinson disease, and diabetes and dementia) and future physical function (ability to walk, cognitive function). This information is of interest to the public, physicians, health care companies and insurance companies. Examples of known risk calculators include the system and method disclosed in Perls, U.S. Patent Application Publication No. US 2007/0118398 A1, published on May 24, 2007, which is incorporated by reference herein in its entirety. Risk calculators can be provided in for example, a physician's office, as a handheld or online. An individual, health-care professional, insurance company, health care organization interested in predicting how long someone will live may enter his/her genotype into a computer and obtains a risk score for aging-related disease, number of healthy years of life left, and number of total remaining years of life.
  • Based on a particular score, a physician or health professional may advise the patient on healthy living or risk reduction for the above diseases and death, particularly for persons with the less protective versions of the FOXO3A gene. Some exemplary options include: advice concerning food choices (e.g. red wine, soy products, and other foods that contain compounds that may affect the activity of the FOXO3A gene) or intensive risk factor modification such as weight loss or increased physical activity.
  • The identification of FOXO3A and in particular the GCC haplotype as predictors of healthy aging and longevity provides a probable source of useful biologics and targets for pharmaceutical screens and testing. For example, one may take the gene product or a synthetic version of the protein or other active compound produced by FOXO3A gene for anticipated health benefits in reduction of age-related diseases. Means of taking the gene product may include ingestion, injection, transdermal administration and other methods well known in the pharmaceutical arts. Compounds can be screened to find those that affect the type, activity, or the amount of the gene product produced by FOXO3A, in particular, the GCC haplotype.
  • The invention includes methods of modulating FOXO3A to prevent or treat age-related diseases. The invention also includes methods for treating or preventing a disease or condition in which FOXO3A is implicated, e.g. age-related diseases or enhancing longevity in a subject. “Subject,” as used herein, refers to human and non-human animals. The term “non-human animals” includes all vertebrates, e.g., mammals, such as non-human primates (particularly higher primates), farm mammals such as horses, cows, bison, buffalo, goats, pigs and sheep, chicken, ducks and geese, companion animals such as dogs, cats, rabbits, guinea pigs, rodents, and reptiles, and laboratory animals. In a preferred embodiment, the subject is human. In another embodiment, the subject is an experimental animal or transgenic animal suitable as a disease model. Methods of modulating and treatment are well known to those skilled in the art as set forth in Geesaman et al., U.S. Patent Application Publication No. US 2007/0105109 A1, published on May 10, 2007, which is incorporated by reference herein in its entirety.
  • Many other diagnostic and therapeutic uses of the sequences or gene products of the allelic variations taught by this invention will be evident to those skilled in the art. Some examples include use in small molecule screens, antisense oligonucleotides, double stranded small interfering RNAs (siRNAs) will be evident to those skilled in the art. Several approaches to developing diagnostic and therapeutic uses concerning FOXO activity are described in Goldberg et al., U.S. Patent Application No. US 2006/0069049 A1, published on Mar. 30, 2006, and concerning related pathways in Tissenbaum et al., U.S. Patent Application No. US 2006/0272039, published on Nov. 30, 2006, both of which are incorporated by reference herein in their entirety.
  • The foregoing written specification is considered to be sufficient to enable one skilled in the art to practice the invention. The skilled worker knows, or can identify by using simply routine methods, a large number of equivalents of the specific embodiments of the invention. These equivalents are intended to be included in the patent claims below. Indeed, various modifications of the invention in addition to those shown and described herein will become apparent to those skilled in the art from the foregoing description and fall within the scope of the appended claims.
  • REFERENCES NOT LISTED IN THE TEXT
    • 1. Herskind A M et al. (1996). The heritability of human longevity: a population-based study of 2872 Danish twin pairs born 1870-1900. Hum Genet. 97:319-323.
    • 2. Yashin A I, Iachine I A, Harris J R (1999) Half of variation in susceptibility to mortality is genetic: findings from Swedish twin survival data. Behav Genet. 29:11-19.
    • 3. Christensen K, Johnson T E, Vaupel J W (2006) The quest for genetic determinants of human longevity: challenges and insights. Nat Rev Genet. 7:436-448.
    • 4. Willcox D C, Willcox B J, Hsueh W C, Suzuki M (2006) Genetic determinants of exceptional human longevity: insights from the Okinawa Centenarian Study. AGE 28:313-332.
    • 5. Bishop N A, Guarente L (2007) Genetic links between diet and lifespan: shared mechanisms from yeast to humans. Nat Rev Genet. 8:835-844.
    • 6. Risch N, Zhang H (1995) Extreme discordant sib pairs for mapping quantitative trait loci in humans. Science 268:1584-1589.
    • 7. Gundmundsson H et al. (2000) Inheritance of human longevity in Iceland. Eur J Hum Genet. 8:743-749.
    • 8. Kerber R A, O'Brien E, Smith K R, Cawthon R M (2001) Familial excess longevity in Utah genealogies. J Gerontol A Biol Sci Med Sci 56:B130-B139.
    • 9. Perls T T et al. (2002) Life-long sustained mortality advantage of siblings of centenarians. Proc Natl Acad Sci USA 99:8442-8447.
    • 10. Willcox B J, Willcox D C, He Q, Curb J D, Suzuki M (2006) Siblings of Okinawan centenarians exhibit lifelong mortality advantages. J Gerontol A Biol Med Sci 61:345-354.
    • 11. Partridge L (2007) Some highlights of research on aging with invertebrates, 2006-2007. Aging Cell 6:595-598.
    • 12. Ghazi A, Henis-Korenblit S, Kenyon C (2007) Regulation of Caenorhabditis elegans lifespan by a proteasomal E3 ligase complex. Proc Natl Acad Sci USA 104:5947-5952.
    • 13. Bartke A (2008) New findings in gene knockout, mutant and transgenic mice. Exp Gerontol 43:11-14.
    • 14. Lin K, Dorman J B, Rodan A, Kenyon C (1997) daf-16: An HNF-3/forkhead family member that can function to double the life-span of Caenorhabditis elegans. Science 278:1319-1322.
    • 15. Brunet A et al. (2004) Stress-dependent regulation of FOXO transcription factors by the SIRT1 deacetylase. Science 303:2011-2015.
    • 16. Kenyon C, Murphy C T (2006) Enrichment of regulatory motifs upstream of predicted DAF-16 targets. Nat Genet. 38:397-398.
    • 17. van der Horst A, Burgering B M (2007) Stressing the role of FOXO proteins in lifespan and disease. Nat Rev Mol Cell Biol 8:440-450.
    • 18. Russell S J, Kahn C R (2007) Endocrine regulation of ageing. Nat Rev Mol Cell Biol 8:681-691.
    • 19. Sauve A A, Wolberger C, Schramm V L, Boeke J D (2006) The biochemistry of Sirtuins. Ann Rev Biochem 75:435-465.
    • 20. Tissenbaum H A, Guarente L (2001) Increased dosage of a sir-2 gene extends lifespan in Caenorhabditis elegans. Nature 410:227-230.
    • 21. Blither M, Kahn B B, Kahn C R (2003) Extended longevity in mice lacking the insulin receptor in adipose tissue. Science 299:572-574.
    • 22. Bartke A (2008) Impact of reduced insulin-like growth factor-1/insulin signaling on aging in mammals: novel findings. Aging Cell 7:285-290.
    • 23. White M F (2003) Insulin signaling in health and disease. Science 302:1710-1711.
    • 24. Conover C A, Bale L K (2007) Loss of pregnancy-associated plasma protein A extends lifespan in mice. Aging Cell 6:727-729.
    • 25. Curran S P, Ruvkun G (2007) Lifespan regulation by evolutionarily conserved genes essential for viability. PLoS Genet. 3:e56.
    • 26. Greer E L et al. (2007) An AMPK-FOXO pathway mediates the extension of lifespan induced by a novel method of dietary restriction in C. elegans. Curr Biol 17:1646-1656.
    • 27. Berdichevsky A, Viswanathan M, Horvitz H R, Guarente L (2006) C. elegans SIR-2.1 interacts with 14-3-3 proteins to activate DAF-16 and extend life span. Cell 125:1165-1177.
    • 28. Boehm M, Slack F (2005) A developmental timing MicroRNA and its target regulate life span in C. elegans. Science 310:1954-1957.
    • 29. Hsu A L, Murphy C T, Kenyon C (2003) Regulation of aging and age-related disease by DAF-16 and heat-shock factor. Science 300:1142-1145.
    • 30. Murphy C T (2006) The search for DAF-16/FOXO transcriptional targets: approaches and discoveries. Exp Gerontol 41:910-921.
    • 31. Wang M C, Bohmann D, Jasper H (2005) JNK extends lifespan and limits growth by antagonizing cellular and organism-wide responses to insulin signaling. Cell 121:115-125.
    • 32. Giannakou M E et al. (2007) Dynamics of the action of dFOXO on adult mortality in Drosophila. Aging Cell 6:429-438.
    • 33. Harman D (1956) Aging: a theory based on free radical and radiation chemistry. J Gerontol 11:298-300.
    • 34. Beckman K B, Ames B N (1998) The free radical theory of aging matures. Physiol Rev 78:547-581.
    • 35. Fusco D, Colloca G, Lo Monaco M R, Cesari M (2007) Effects of antioxidant supplementation on the aging process. Clin Intern Aging 2:377-387.
    • 36. Bonafe M et al. (2003) Polymorphic variants of IGF-I receptor and phosphoinositide 3-kinase genes affect IGF-T plasma levels and human longevity: cues for an evolutionarily conserved mechanism of life span control. J Clin Endocrinol Metab 88:3299-3304.
    • 37. Kojima et al. (2004) Association analysis between longevity in the Japanese population and polymorphic variants of genes involved in insulin and insulin-like growth factor 1 signaling pathways. Exp Gerontol 39:1595-1598.
    • 38. Suh Y et al. (2008) Functionally significant insulin-like growth factor I receptor mutations in centenarians. Proc Natl Acad Sci USA 105:3438-3439.
    • 39. Kuningas M et al. (2007) Haplotypes in the human FOXO1a and FOXO3a genes: impact on disease and mortality at old age. Eur J Hum Genet. 15:294-301.
    • 40. Lunetta K L et al. (2007) Genetic correlates of longevity and selected age-related phenotypes: a genome-wide association study in the Framingham Study. BMC Med Genet. 8 Supple 1: S13.
    • 41. Nebel A et al. (2005) No association between microsomal triglyceride transfer protein (MTP) haplotype and longevity in humans. Proc Natl Acad Sci USA 102:7906-7909.
    • 42. Arai Y et al. (2001) Serum insulin like growth factor 1 (IGF-1) in centenarians: implication of IGF-1 as a turnover protein. J Gerontol A Biol Sci Med Sci 56A:M79-M82.
    • 43. Teng E L et al. (1994) The Cognitive Abilities Screening Instrument (CASI): a practical test for cross-cultural epidemiological studies of dementia. Int Psychogeriatr 6:45-58.
    • 44. Willcox B J et al. (2006) Midlife risk factors and survival in men. JAMA 296:2343-2350.
    • 45. Kramarow E, Lubitz J, Lentzner H, Gorina Y (2007) Trends in the health of older Americans, 1970-2005. Health Aff (Millwood) 26:1417-1425.
    • 46. Evert J, Lawler E, Bogan H, Perls T (2003) Morbidity profiles of centenarians: survivors, delayers, and escapers. J Gerontol A Biol Sci Med Sci 58:232-237.
    • 47. Bernstein A M et al. (2004) First autopsy study of an Okinawan centenarian: absence of many age-related diseases. J Gerontol A Biol Sci Med Sci 59:1195-1199.
    • 48. Willcox D C et al. (2007) Aging gracefully: a retrospective analysis of functional status in Okinawan centenarians. Am J Geriatr Psychiatry 15:252-256.
    • 49. Terry D F, Wilcox M A, McCormick M A, Perls T T (2004) Cardiovascular disease delay in centenarian offspring. J Gerontol A Biol Sci Med Sci 59:385-389.
    • 50. Rodriguez B L et al. (2002) The A.D.A and W.H.O. classifications for diabetes: their impact on diabetes prevalence and total and cardiovascular disease mortality in elderly Japanese-American men. Diabetes Care 25:951-955.
    • 51. McNeely M J, Boyko E J (2004) Type 2 diabetes prevalence in Asian Americans: results of a national health survey. Diabetes Care 27:66-69.
    • 52. Fujimoto W Y et al. (1995) Susceptibility to development of central adiposity among populations. Obes Res 3 Suppl 2:179 S-186S.
    • 53. Examination Committee of Criteria for ‘Obesity Disease’ in Japan, et al. (2002). New criteria for ‘obesity disease’ in Japan. Circ J 66:987-992.
    • 54. Barthel A, Schmoll D, Unterman T G (2005). FoxO proteins in insulin action and metabolism. Trends Endocrinol Metab 16:183-189.
    • 55. Kops J G et al. (2002) Forkhead transcription factor FOXO3a protects quiescent cells from oxidative stress. Nature 419:316-321.
    • 56. Youngman L D, Park J Y, Ames B N (1992) Protein oxidation associated with aging is reduced by dietary restriction of protein or calories. Proc Natl Acad Sci USA 89:9112-9116.
    • 57. Heilbronn L K et al. (2006) Effect of 6-month calorie restriction on biomarkers of longevity, metabolic adaptation, and oxidative stress in overweight individuals: a randomized controlled trial. JAMA 295:1539-1548.
    • 58. Selman C et al. (2008) Evidence for lifespan extension and delayed age-related biomarkers in insulin receptor substrate 1 null mice. FASEB J 22:807-818.
    • 59. Murphy C T et al. (2003) Genes that act downstream of DAF-16 to influence the lifespan of Caenorhabditis elegans. Nature 424:277-283.
    • 60. Kuningas M et al. (2007) SIRT1 gene, age-related diseases, and mortality: the Leiden 85-plus study. J Gerontol A Biol Sci Med Sci 62:960-965.
    • 61. Kagan A. Ed (1996) The Honolulu Heart Program: An Epidemiological Study of Coronary Heart Disease and Stroke (Harwood Academic Publishers, the Netherlands).
    • 62. Worth R M, Kagan A (1970) Ascertainment of men of Japanese ancestry in Hawaii through World War II Selective Service registration. J Chronic Dis 23:389-397.
    • 63. Rodriguez B L, Curb J D (1998) Cardiovascular risk factors in the elderly: the Honolulu Heart Program. Cardiovasc Risk Factors 8:99-103.
    • 64. White L, et al. (1996) Prevalence of dementia in Japanese-American men living in Hawaii: the Honolulu-Asia Aging Study. JAMA 276:955-960.
    • 65. National Institutes of Health (NIH): U.S. Department of Health and Human Services, NIH, National Institute on Aging (2001) Report of the National Institute on Aging Advisory Panel on Exceptional Longevity (APEL). NIH Pub 01-4951 (NIH, Washington, D.C.).
    • 66. Arias E (2006) United States life tables, 2003 (National Center for Health Statistics, Hyattsville, Md.), vol. 54, no. 14.
    • 67. Nordyke E C, Lee R, Gardner R W (1984) A profile of Hawaii's elderly population. Papers East West Popul Inst 91:13-14.
    • 68. Mehta C, Patel N (2001) StatXact 5 (CYTEL Software Corporation, Cambridge, Mass.).
    • 69. SAS Institute, Inc. (1990) SAS/STAT user's guide, version 6 (SAS Institute, Cary, N.C.).
    • 70. Sherry S T, Ward M H, Kholodov M, Baker J, Phan L, Smigiclski E M, Sirotkin K. dbSNP: the NCBI database of genetic variation. Nucleic Acids Res. 2001 Jan. 1; 29(1):308-11.)

Claims (19)

1. A method of diagnosing a predisposition to longevity in a subject, which comprises determining in a tissue sample of said subject whether said subject possesses at least one “G” allele of locus/polymorphism rs2802292 at position 109015211 in the FOXO3A gene on chromosome 6.
2. The method of claim 1, wherein longevity is living at least an additional 15 years and said predisposition further includes a predisposition to freedom from of at least one chronic disease associated with aging.
3. The method of claim 2, wherein at least one chronic disease associated with aging is selected from the group consisting of diabetes, coronary artery disease and cancer.
4. A method of diagnosing a predisposition to longevity in a subject, which comprises determining in a tissue sample of said subject whether said subject possesses at least one “C” allele of locus/polymorphism rs2764264 at position 109041154 in the FOXO3A gene on chromosome 6.
5. The method of claim 1, wherein longevity is living at least an additional 15 years and said predisposition further includes a predisposition to freedom from of at least one chronic disease associated with aging.
6. The method of claim 2, wherein at least one chronic disease associated with aging is selected from the group consisting of diabetes, coronary artery disease and cancer
7. A method of diagnosing a predisposition to longevity in a subject, which comprises determining in a tissue sample of said subject whether said subject possesses at least one “C” allele of locus/polymorphism rs13217795 at position 109080791 in the FOXO3A gene on chromosome 6.
8. The method of claim 7, wherein longevity is living at least an additional 15 years and said predisposition further includes a predisposition to freedom from of at least one chronic disease associated with aging.
9. The method of claim 8 wherein at least one chronic disease associated with aging is selected from the group consisting of diabetes, coronary artery disease and cancer
10. The method of claim 1, wherein longevity is living at least an additional 15 years and said predisposition further includes a predisposition to freedom from of at least one chronic disease associated with aging.
11. A method of diagnosing a predisposition to longevity in a subject, which comprises determining in a tissue sample of said subject whether said subject possesses a “GCC” haplotype, the “GCC” haplotype being loci/polymorphisms rs2802292, rs2764264, rs13217795, respectively, in a FOXO3A gene.
12. A method of diagnosing a predisposition to longevity in a non-human subject, which comprises determining in a tissue sample of said subject whether said subject possesses a non-human homologue to a “GCC” haplotype, said “GCC” haplotype being loci/polymorphisms rs2802292, rs2764264, rs13217795, respectively, in a FOXO3A gene.
13. A kit comprising a first nucleic acid of sufficient length to hybridizes to a first target nucleic acid sequence position selected from the group consisting of a “G” allele of locus/polymorphism rs2802292 at position 109015211 in the FOXO3A gene on chromosome 6, a “G” allele of locus/polymorphism rs2802292 at position 109015211 in the FOXO3A gene on chromosome 6 and a “C” allele of locus/polymorphism rs2764264 at position 109041154 in the FOXO3A gene on chromosome 6, wherein said first nucleic acid hybridizes to said first target nucleic acid sequence at the position, or the complement of said first target nucleic acid sequence, in one or more containers and instructions for use.
14. A method for testing for the presence of at least one allele of a FOXO3A haplotype comprising the steps of:
a) collecting a sample of cells from a subject;
b) isolating a nucleic acid sample from the cells of the sample;
c) contacting the nucleic acid sample with at least one primer which specifically hybridizes 5′ and 3′ to at least one allele of a FOXO3A haplotype under conditions such that hybridization and amplification of the allele occurs; and
d) detecting the amplification product by allele detection means.
15. The method according to claim 14, wherein at least one primer is selected from the group consisting of SEQ ID NOS. 5-8.
16. A method of monitoring the treatment of a subject with a therapeutic agent by monitoring the level of gene expression of a gene associated with longevity comprising:
a) obtaining a pre-administration sample from a subject prior to administration of the therapeutic agent;
b) detecting the level of gene expression in the pre-administration sample;
c) obtaining one or more post-administration samples from the subject;
d) detecting the level of gene expression in the post-administration sample;
e) comparing the level of gene expression in the pre- and post-administrative samples to determine the effect of the therapeutic agent on gene expression; and
f) altering the treatment of the subject based on the effect of the therapeutic agent on gene expression.
17. The method of claim 16, wherein the detecting the level of gene expression comprises determining at least one of the protein, mRNA or DNA transcription level of the gene associated with longevity.
18. The method according to claim 16, wherein the gene associated with longevity is selected from the group consisting of FOXO3A, LOC100130966, anon-human homologue of FOXO3A, and a non-human homologue of LOC100130966.
19. The use of the presence or absence of the “GCC” FOXO3A haplotype in a risk calculator to aid in the prediction of death, age-associated diseases or future physical function.
US13/058,179 2008-08-10 2009-08-10 Method of Using FOXO3A Polymorphisms and Haplotypes to Predict and Promote Healthy Aging and Longevity Abandoned US20110212447A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US13/058,179 US20110212447A1 (en) 2008-08-10 2009-08-10 Method of Using FOXO3A Polymorphisms and Haplotypes to Predict and Promote Healthy Aging and Longevity

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US8772208P 2008-08-10 2008-08-10
PCT/US2009/053307 WO2010019519A2 (en) 2008-08-10 2009-08-10 Method of using foxo3a polymorphisms and haplotypes to predict and promote healthy aging and longevity
US13/058,179 US20110212447A1 (en) 2008-08-10 2009-08-10 Method of Using FOXO3A Polymorphisms and Haplotypes to Predict and Promote Healthy Aging and Longevity

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2009/053307 A-371-Of-International WO2010019519A2 (en) 2008-08-10 2009-08-10 Method of using foxo3a polymorphisms and haplotypes to predict and promote healthy aging and longevity

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US14/822,873 Division US20150337383A1 (en) 2008-08-10 2015-08-10 Method of using foxo3a polymorphisms and haplotypes to predict and promote healthy aging and longevity

Publications (1)

Publication Number Publication Date
US20110212447A1 true US20110212447A1 (en) 2011-09-01

Family

ID=41669598

Family Applications (3)

Application Number Title Priority Date Filing Date
US13/058,179 Abandoned US20110212447A1 (en) 2008-08-10 2009-08-10 Method of Using FOXO3A Polymorphisms and Haplotypes to Predict and Promote Healthy Aging and Longevity
US13/831,775 Abandoned US20130295566A1 (en) 2008-08-10 2013-03-15 Method of Using FOXO3A Polymorphisms and Haplotypes to Predict and Promote Healthy Aging and Longevity
US14/822,873 Pending US20150337383A1 (en) 2008-08-10 2015-08-10 Method of using foxo3a polymorphisms and haplotypes to predict and promote healthy aging and longevity

Family Applications After (2)

Application Number Title Priority Date Filing Date
US13/831,775 Abandoned US20130295566A1 (en) 2008-08-10 2013-03-15 Method of Using FOXO3A Polymorphisms and Haplotypes to Predict and Promote Healthy Aging and Longevity
US14/822,873 Pending US20150337383A1 (en) 2008-08-10 2015-08-10 Method of using foxo3a polymorphisms and haplotypes to predict and promote healthy aging and longevity

Country Status (10)

Country Link
US (3) US20110212447A1 (en)
EP (1) EP2324127B1 (en)
JP (1) JP5814119B2 (en)
KR (2) KR20160102081A (en)
CN (1) CN102177255B (en)
AU (1) AU2009282172B2 (en)
CA (1) CA2733597C (en)
DK (1) DK2324127T3 (en)
HK (1) HK1158271A1 (en)
WO (1) WO2010019519A2 (en)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20120059779A1 (en) * 2010-06-15 2012-03-08 Henry Ford Health System Personalized Health Risk Assessment For Critical Care
US20130295566A1 (en) * 2008-08-10 2013-11-07 Timothy Atchison Donlon Method of Using FOXO3A Polymorphisms and Haplotypes to Predict and Promote Healthy Aging and Longevity
WO2018183353A1 (en) * 2017-03-27 2018-10-04 Cardax Pharma, Inc. Small molecule compounds to support healthy human aging

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN103233001B (en) * 2012-06-25 2016-11-02 西北农林科技大学 The detection method of Qinchuan Cattle FoxO1 gene mononucleotide polymorphism molecular marker and application
KR102017562B1 (en) * 2013-03-13 2019-09-03 (주)아모레퍼시픽 Method for screening of ingredients having whitening effect
WO2017062751A1 (en) * 2015-10-08 2017-04-13 The Regents Of The University Of California Compounds and methods for promoting stress resistance
US11593512B2 (en) 2017-05-12 2023-02-28 Massachusetts Institute Of Technology Systems and methods for crowdsourcing, analyzing, and/or matching personal data
WO2019156591A1 (en) * 2018-02-12 2019-08-15 Limited Liability Company "Gero" Methods and systems for prediction of frailty background
CN111235250A (en) * 2020-03-31 2020-06-05 中国科学院昆明动物研究所 Key pathway related to healthy old age and peripheral blood DNA methylation site marker and application thereof
JP7340872B2 (en) 2021-09-06 2023-09-08 株式会社ミヤワキ Measuring device
CN115466321B (en) * 2022-09-23 2024-03-22 南方医科大学珠江医院 FOXO3a-DRI peptide fragment, pharmaceutical composition and application thereof

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20130295566A1 (en) * 2008-08-10 2013-11-07 Timothy Atchison Donlon Method of Using FOXO3A Polymorphisms and Haplotypes to Predict and Promote Healthy Aging and Longevity

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7932049B2 (en) 2002-12-23 2011-04-26 University Of Massachusetts Methods of identifying longevity modulators and therapeutic methods of use thereof
WO2005004814A2 (en) 2003-07-02 2005-01-20 Elixir Pharmaceuticals, Inc. Sirt1 and genetic disorders
US20060069049A1 (en) 2003-12-29 2006-03-30 President And Fellows Of Harvard College Methods and reagents related to foxo
CA2569079A1 (en) * 2004-06-03 2005-12-15 The Johns Hopkins University Methods of screening for cell proliferation or neoplastic disorders
US7622271B2 (en) * 2004-07-26 2009-11-24 University Of Washington Identification of aging genes through large-scale analysis
US20070118398A1 (en) * 2005-11-18 2007-05-24 Flicker Technologies, Llc System and method for estimating life expectancy and providing customized advice for improving life expectancy
JP5292569B2 (en) * 2006-11-10 2013-09-18 国立大学法人名古屋大学 Anti-aging transcription factor activator and use thereof

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20130295566A1 (en) * 2008-08-10 2013-11-07 Timothy Atchison Donlon Method of Using FOXO3A Polymorphisms and Haplotypes to Predict and Promote Healthy Aging and Longevity

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
GenBank Locus: NM_001455 "Homo sapiens forkhead box O3A (FOXO3A), transcript variant 1, mRNA." April 1, 2007, from www.ncbi.nlm.nih.gov, pages 1-6. *
rs2764264 - SNP - NCBI, Summary, Sorted by SNP_ID, from www.ncbi.nlm.nih.gov/snp, pritned on 2/5/2015, one printed page. *

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20130295566A1 (en) * 2008-08-10 2013-11-07 Timothy Atchison Donlon Method of Using FOXO3A Polymorphisms and Haplotypes to Predict and Promote Healthy Aging and Longevity
US20120059779A1 (en) * 2010-06-15 2012-03-08 Henry Ford Health System Personalized Health Risk Assessment For Critical Care
US8990135B2 (en) * 2010-06-15 2015-03-24 The Regents Of The University Of Michigan Personalized health risk assessment for critical care
WO2018183353A1 (en) * 2017-03-27 2018-10-04 Cardax Pharma, Inc. Small molecule compounds to support healthy human aging

Also Published As

Publication number Publication date
WO2010019519A2 (en) 2010-02-18
CN102177255A (en) 2011-09-07
KR20110057147A (en) 2011-05-31
KR101649541B1 (en) 2016-08-19
US20130295566A1 (en) 2013-11-07
JP5814119B2 (en) 2015-11-17
KR20160102081A (en) 2016-08-26
HK1158271A1 (en) 2012-07-13
CA2733597A1 (en) 2010-02-18
DK2324127T3 (en) 2015-04-27
JP2011530312A (en) 2011-12-22
US20150337383A1 (en) 2015-11-26
EP2324127A2 (en) 2011-05-25
CN102177255B (en) 2015-12-16
CA2733597C (en) 2019-02-26
AU2009282172B2 (en) 2016-06-02
EP2324127B1 (en) 2015-01-21
AU2009282172A1 (en) 2010-02-18
WO2010019519A3 (en) 2010-05-27
EP2324127A4 (en) 2012-06-13

Similar Documents

Publication Publication Date Title
EP2324127B1 (en) Method of using foxo3a polymorphisms and haplotypes to predict and promote healthy aging and longevity
JP5651585B2 (en) Genetic markers for weight management and methods of use
Menezes et al. AXIS inhibition protein 2, orofacial clefts and a family history of cancer
JP6263499B2 (en) Detection of genetic predisposition to conditions associated with osteoarthritis
US20130079612A1 (en) Methods for Creating Recommended Dietary Regime
JP2013511535A (en) Genetic markers for weight management and uses thereof
US20100129798A1 (en) Detecting genetic predisposition to osteoarthritis associated conditions
AU2010215061B2 (en) Assay for determining epigenetic profiles of markers of Fragile X alleles
Lorenz et al. Candidate gene analysis of the succinic semialdehyde dehydrogenase gene (ALDH5A1) in patients with idiopathic generalized epilepsy and photosensitivity
US10731219B1 (en) Method for preventing progression to metabolic syndrome
Hansen et al. The rhesus monkey: A nonhuman primate model for T2DM-associated gene screening
US8236497B2 (en) Methods of diagnosing cardiovascular disease
US20100184839A1 (en) Allelic polymorphism associated with diabetes
Suazo et al. PEMT variants are associated with nonsyndromic cleft lip with or without cleft palate in Chile
Hansen et al. The Rhesus Monkey: A Nonhuman Primate Model For T2DM-Associated Gene Screening. J Diabetes Metab 2: 150. doi: 10.4172/2155-6156.1000150 Page 2 of 7 Volume 2• Issue 7• 1000150 J Diabetes Metab ISSN: 2155-6156 JDM, an open access journal nucleotide and amino acid levels; c) 89 percent of the rhesus monkey genes are syngenically aligned with the corresponding human genes; and d) an extraordinary amount of physiological similarity exists between rhesus monkeys and humans [13]
WO2011004345A1 (en) Upstream binding protein 1 polymorphisms and their use for prognosing or diagnosing arterial blood pressure

Legal Events

Date Code Title Description
AS Assignment

Owner name: KUAKINI MEDICAL CENTER, HAWAII

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:WILLCOX, BRADLEY JOHN;DONLON, TIMOTHY ATCHISON;CURB, J. DAVID;SIGNING DATES FROM 20090811 TO 20090909;REEL/FRAME:023253/0749

AS Assignment

Owner name: KUAKINI MEDICAL CENTER, HAWAII

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:WILLCOX, BRADLEY JOHN;DONLON, TIMOTHY ATCHISON;CURB, J. DAVID;SIGNING DATES FROM 20110404 TO 20110408;REEL/FRAME:026306/0001

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION