US20100209948A1 - Biomarkers associated with nephropathy - Google Patents
Biomarkers associated with nephropathy Download PDFInfo
- Publication number
- US20100209948A1 US20100209948A1 US12/694,639 US69463910A US2010209948A1 US 20100209948 A1 US20100209948 A1 US 20100209948A1 US 69463910 A US69463910 A US 69463910A US 2010209948 A1 US2010209948 A1 US 2010209948A1
- Authority
- US
- United States
- Prior art keywords
- nephropathy
- subject
- urine sample
- biomarker
- protein molecule
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Images
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/46—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from vertebrates
- G01N2333/47—Assays involving proteins of known structure or function as defined in the subgroups
- G01N2333/4701—Details
- G01N2333/4728—Details alpha-Glycoproteins
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/70503—Immunoglobulin superfamily, e.g. VCAMs, PECAM, LFA-3
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/34—Genitourinary disorders
- G01N2800/347—Renal failures; Glomerular diseases; Tubulointerstitial diseases, e.g. nephritic syndrome, glomerulonephritis; Renovascular diseases, e.g. renal artery occlusion, nephropathy
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/56—Staging of a disease; Further complications associated with the disease
Definitions
- Nephropathy commonly known as kidney damage, is caused by, among others, diabetes, high blood pressure, drug toxicity, and inflammation.
- nephropathy is diagnosed by determining the level of proteinuria (e.g., the level of urine albumin), or by examining the glomerular filtration rate (GFR), an indicator of renal function. Both approaches are not suitable for detecting early stage nephropathy, which typically displays no symptoms. While nephropathy can also be detected by renal biopsy, this invasive procedure is not an ideal diagnostic approach.
- proteinuria e.g., the level of urine albumin
- GFR glomerular filtration rate
- the present invention is based on unexpected discoveries that the urine levels of leukocyte-associated Ig-like receptor-2, alpha-1 acid glycoprotein, and fragments of these two proteins are significantly higher in a nephropathy patient than in a nephropathy-free patient. These protein molecules are therefore reliable biomarkers for diagnosis of early stage nephropathy.
- one aspect of this invention features a nephropathy diagnostic method.
- This method includes at least the following steps: (a) obtaining a urine sample from a subject suspected of having nephropathy, (b) determining in the urine sample a level of a biomarker, and (c) assessing whether the subject has nephropathy based on the level of the biomarker.
- the biomarker used in the just-described method is one of the following: (i) leukocyte-associated Ig-like receptor-2 or a fragment thereof having at least ten amino acid residues, such as DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1), (ii) a fragment of alpha-1 acid glycoprotein having at least ten amino acid residues, such as GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2), (iii) a combination of (i) and (ii), or (iv) a combination of (i) and alpha-1 acid glycoprotein.
- leukocyte-associated Ig-like receptor-2 or a fragment thereof having at least ten amino acid residues such as DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1)
- a fragment of alpha-1 acid glycoprotein having at least ten amino acid residues such as GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO
- the biomarker level is determined by a mass spectrometry assay (e.g., MALDI-MS, LC-MS, and LC-MS/MS). In another example, it is determined by an immune assay (e.g., ELISA, Westernblot, RIA, FIA and LIA).
- a mass spectrometry assay e.g., MALDI-MS, LC-MS, and LC-MS/MS.
- an immune assay e.g., ELISA, Westernblot, RIA, FIA and LIA.
- nephropathy diagnostic method is applicable to both humans and laboratory animals, e.g., those free of proteinuria.
- a laboratory animal used herein refers to a vertebrate animal commonly used in animal testing, e.g., mouse, rat, rabbit, cat, dog, pig, and non-human primate.
- Another aspect of this invention features a method for monitoring nephropathy progress in a subject.
- This method includes (a) obtaining a first urine sample from a subject suffering from nephropathy (e.g., a human or a laboratory animal), (b) determining in the first urine sample a level of one of the four biomarkers listed above, (c) obtaining a second urine sample from the subject 2 weeks to 12 months after the first urine sample is obtained, (d) determining in the second urine sample a level of the biomarker, and (e) assessing nephropathy progress in the subject.
- An increase in the level of the biomarker in the second urine sample, as compared to that in the first urine sample indicates that nephropathy is exacerbated in the subject.
- the second urine sample is obtained 6 to 12 months after the first urine sample is obtained.
- the second urine sample can be obtained 3 to 6 months later than the first urine sample.
- this method is applied to a laboratory animal, the second urine sample can be obtained 2 to 24 weeks after the first urine sample is obtained.
- the present invention provides a method for monitoring efficacy of a nephropathy treatment in a nephropathy patient, including (a) determining a level of one of the biomarkers listed above in a urine sample from the nephropathy patient before the treatment, (b) determining a level of the biomarker in a urine sample from the patient after the treatment, and (c) assessing efficacy of the treatment based on a change in the level of the biomarker after the treatment.
- the treatment is found to be effective when the post-treatment biomarker level remains the same or decreases as compared with the pre-treatment biomarker level.
- This invention also provides a method of assessing renal toxicity of an agent, including (a) obtaining a plurality of urine samples from a subject treated with an agent at various time points during treatment, (b) determining in each of the urine samples a level of one of the above-described biomarkers, and (c) assessing renal toxicity of the agent based on a change in the level of the biomarker during the treatment.
- An increase in the biomarker level in the course of the treatment indicates that the agent is renal toxic.
- the agent can be a compound (e.g., a drug or a drug candidate), an herb product, and a food product
- This invention further provides a kit useful in any of the methods described above.
- This kit contains a first antibody specifically binding to leukocyte-associated Ig-like receptor-2 and a second antibody specifically binding to alpha-1 acid glycoprotein. Both antibodies can be whole immunoglobulin molecules.
- this kit contains only antibodies specific to antigens to be detected (e.g., biomarkers associated with nephropathy) for practicing one of the methods disclosed herein. Namely, it consists essentially of such antibodies.
- isolated antibody specifically binding to DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1), or GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2).
- isolated antibody refers to an antibody substantially free from naturally associated molecules. More specifically, a preparation containing the antibody is deemed as “an isolated antibody” when the naturally associated molecules in the preparation constitute at most 20% by dry weight. Purity can be measured by any appropriate method, e.g., column chromatography, polyacrylamide gel electrophoresis, and HPLC.
- FIG. 1 is a diagram showing boxplots for combined levels of a fragment of leukocyte-associated Ig-like receptor-2 and a fragment of alpha-1 acid glycoprotein in healthy controls and patients having various types of nephropathy.
- DN, IgAN, CHN, and MGN refer to diabetic nephropathy, IgA nephropathy, Chinese herb nephropathy, and membranous glomerulonephritis nephropathy.
- the upper and lower limits of the boxes mark the 25% and 75% values with the medians as the lines across the boxes.
- the upper whisker marks the largest value below the upper fence, which is the 75% value plus 1.5 interquartile range and the lower whisker marks the smallest value above the lower fence, which is the 25% value minus 1.5 interquartile range.
- FIG. 2 is a diagram showing boxplots for combined levels of a fragment of leukocyte-associated Ig-like receptor-2 and a fragment of alpha-1 acid glycoprotein in healthy controls and patients having CHN.
- the upper and lower limits of the boxes mark the 25% and 75% values with the medians as the lines across the boxes.
- the upper whisker marks the largest value below the upper fence, which is the 75% value plus 1.5 interquartile range and the lower whisker marks the smallest value above the lower fence, which is the 25% value minus 1.5 interquartile range.
- the present invention relates to a method for diagnosing nephropathy based on the level of a urine biomarker, which can be leukocyte-associated Ig-like receptor-2 (GenBank accession number CAQ08962; 10-Jan.-2010), alpha-1 acid glycoprotein (GenBank accession number EAW87416; 10-Jan.-2010), a fragment of either protein, or a combination thereof.
- the fragment of either protein has a minimum length of ten amino acids and preferably, a maximum length of 120 to 200 amino acids.
- fragments of leukocyte-associated Ig-like receptor-2 and alpha-1 acid glycoprotein can contain up to 125 and 191 amino acid residues, respectively.
- the fragment of leukocyte-associated Ig-like receptor-2 is DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) and a fragment of alpha-1 acid glycoprotein is GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2).
- Each of the urine biomarkers mentioned above can be used to diagnose any type of nephropathy, including those related to diabetes (i.e., diabetic nephropathy), glomerulonephritis resulting from deposition of IgA in kidney tissues (i.e., IgA nephropathy), inflammation (e.g., membranous glomerulonephritis), Chinese herb-induced renal fibrosis (i.e., Chinese herbal nephropathy), chronic tubulointerstitial damage, which lead to renal failure (i.e., chronic interstitial nephritis), and focal segmental glomerulosclerosis.
- diabetes i.e., diabetic nephropathy
- glomerulonephritis resulting from deposition of IgA in kidney tissues i.e., IgA nephropathy
- inflammation e.g., membranous glomerulonephritis
- Chinese herb-induced renal fibrosis i.e., Chinese
- a urine sample is obtained from a subject suspected of having nephropathy and the level of any of the biomarkers mentioned above is then determined by conventional methods, e.g., ELISA and Westernblot.
- the biomarker is a peptide or a combination of peptides
- its level can be determined by a mass spectrometry assay.
- the level of the urine biomarker can then be compared with a reference point representing the level of the same urine biomarker in a nephropathy-free subject.
- the reference point can be determined via routine practice based on the representative level of a urine biomarker in a group of nephropathy patients versus that in a group of nephropathy-free subjects. For example, it can be the middle point between the mean levels of these two groups.
- the level of the urine biomarker in the subject is greater than the reference point, it indicates that the subject has nephropathy.
- MCN minimal change nephropathy
- MCD minimal change disease
- the diagnostic method of this invention can be applied to detect incipient nephropathy when presence of proteins (e.g., albumin) in urine is not detectable, i.e., free of proteinuria.
- this invention relates to a method of monitoring nephropathy progress in a subject based on any of the urine biomarkers described above. To practice this method, two urine samples from a subject can be obtained within a suitable time span (e.g., 2 weeks to 12 months) and examined to determine the levels of one of the urine biomarkers described above. If the urine biomarker level in the later-obtained urine sample is greater than that in the earlier-obtained urine sample, it indicates that nephropathy progresses in the subject.
- a suitable time span e.g. 2 weeks to 12 months
- the monitoring method can be applied to a human subject suffering from or at risk for nephropathy.
- the level of the urine biomarker can be determined once every 6 to 12 months to monitor nephropathy progress.
- the human subject is already in late stage of nephropathy, it is preferred that the urine biomarker level be determined once every 3 to 6 months.
- While carrying kidney damage, patients in early stage nephropathy are generally asymptomatic and display normal kidney functions. These patients are at risk for nephropathy progress. Later stage nephropathy is characterized by a progressive decline in GFR (e.g., ⁇ 15 mL/minute/1.73 m 2 ).
- the monitoring method described above is also applicable a laboratory animal, following routine procedures, to study nephropathy.
- the laboratory animal is examined once every 2 to 24 weeks to determine the level of one of the urine biomarkers mentioned above. An increase in the biomarker level over time indicates that the disease progresses in the animal.
- the present invention provides a method for assessing efficacy of a nephropathy treatment in a subject in need (i.e., a human nephropathy patient or a laboratory animal bearing renal damage).
- a nephropathy treatment in a subject in need (i.e., a human nephropathy patient or a laboratory animal bearing renal damage).
- the levels of one of the urine biomarkers described above are determined before, during, and/or after the treatment. If the urine biomarker level remains the same or decreases over the course of the treatment, it indicates that the treatment is effective.
- any of the urine biomarkers can also be used to monitor renal toxicity of a target agent, i.e., whether an agent induces renal damage.
- the target agent can be any compound or composition for human administration. Examples include, but are not limited to, chemical compounds, which can be drugs (e.g., non-steroidal anti-inflammatory drugs) or drug candidates, food products or supplements, and herb supplements. Renal toxicity of a target agent is indicated by its ability to increase the level of a urine biomarker over time.
- kits useful in practicing any of the above-described methods contains at least two antibodies, one specific to Ig-like receptor-2, e.g., capable of binding to its fragment DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) or any epitope contained therein, and the other specific to alpha-1 acid glycoprotein, e.g., capable of binding to its fragment GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2) or any epitope contained therein.
- the kit includes two different antibodies (i.e., a coating antibody and a detecting antibody) that bind to the same biomarker.
- the detecting antibody is conjugated with a molecule which emits a detectable signal either on its own or via binding to another agent.
- antibody used herein refers to a whole immunoglobulin or a fragment thereof, such as Fab or F(ab′) 2 that retains antigen-binding activity. It can be naturally occurring or genetically engineered (e.g., single-chain antibody, chimeric antibody, or humanized antibody).
- the antibodies included in the kit of this invention can be obtained from commercial vendors. Alternatively, they can be prepared by conventional methods. See, for example, Harlow and Lane, (1988) Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, New York.
- the marker optionally coupled to a carrier protein (e.g., KLH)
- KLH carrier protein
- Antibodies produced in the animal can then be purified by affinity chromatography.
- Commonly employed host animals include rabbits, mice, guinea pigs, and rats.
- adjuvants that can be used to increase the immunological response depend on the host species and include Freund's adjuvant (complete and incomplete), mineral gels such as aluminum hydroxide, CpG, surface-active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, and dinitrophenol.
- Useful human adjuvants include BCG (bacille Calmette-Guerin) and Corynebacterium parvum.
- Polyclonal antibodies i.e., heterogeneous populations of antibody molecules, are present in the sera of the immunized animal.
- Monoclonal antibodies i.e., homogeneous populations of antibody molecules, can be prepared using standard hybridoma technology (see, for example, Kohler et al. (1975) Nature 256, 495; Kohler et al. (1976) Eur. J. Immunol. 6, 511; Kohler et al. (1976) Eur J Immunol 6, 292; and Hammerling et al. (1981) Monoclonal Antibodies and T Cell Hybridomas, Elsevier, N.Y.).
- monoclonal antibodies can be obtained by any technique that provides for the production of antibody molecules by continuous cell lines in culture such as described in Kohler et al. (1975) Nature 256, 495 and U.S. Pat. No.
- Such antibodies can be of any immunoglobulin class including IgG, IgM, IgE, IgA, IgD, and any subclass thereof.
- the hybridoma producing the monoclonal antibodies of the invention may be cultivated in vitro or in vivo. The ability to produce high titers of monoclonal antibodies in vivo makes it a particularly useful method of production.
- antibody fragments can be generated by known techniques.
- fragments include, but are not limited to, F(ab′) 2 fragments that can be produced by pepsin digestion of an antibody molecule, and Fab fragments that can be generated by reducing the disulfide bridges of F(ab′) 2 fragments.
- IgAN patients having IgA nephropathy
- Midstream urinary samples were collected from the groups of human subjects listed above in early morning. These urine samples from both healthy donors and patients, mixed with protease inhibitors, were analyzed by MALDI-TOF-MS. Peptide candidates that were differentially presented in the healthy donor group and the various patient groups were identified upon comparison of polypeptide patterns between each patient group and the healthy donor group, taking into consideration statistical evaluation of demographic and sample parameters. These peptides were purified, their amino acid sequences determined via routine technology.
- Western blotting analysis was performed using antibodies specific to leukocyte-associated Ig-like receptor-2 fragment DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) and alpha-1 acid glycoprotein fragment GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2), following routine technology. The results were normalized against the level of creatinine or protein in the same sample.
- Urine samples were mixed with protease inhibitors and diluted at 1:100 with a dilution buffer and serum samples were diluted at 1:10. The diluted samples were placed in ELISA plates in triplicates. The concentrations of leukocyte-associated Ig-like receptor-2 and alpha-1 acid glycoprotein were determined via the standard sandwich ELISA method and normalized against the level of creatinine or protein in the same sample
- SEQ ID NOs:1 and 2 are fragments of leukocyte-associated Ig-like receptor-2 and alpha-1 acid glycoprotein, respectively.
- the positive rates of these two peptides in the healthy donor group and in the various patient groups are shown in Table 2 below:
- leukocyte-associated Ig-like receptor-2 and alpha-1 acid glycorprotein were found to be differentially presented in urine samples from nephropathy patients (e.g., patients having Chinese herb-induced nephropathy) versus urine samples from healthy controls. See Table 3 below. More specifically, presence of either protein in urine samples from healthy controls was barely detectable; while a higher level of the protein was found in urine samples from nephropathy patients. This result indicates that either protein can be used as a marker for diagnosing nephropathy.
- the levels of urine leukocyte-associated Ig-like receptor-2 and alpha-1 acid glycorprotein from both healthy controls and nephropathy patients were determined as described in Example 1 above.
- the combination of urine leukocyte-associated Ig-like receptor-2 and alpha-1 acid glycorprotein was found to be particularly reliable in detecting nephropathy induced by Chinese herb. See FIG. 2 .
- the AUROC obtained from this study reaches 1.0, indicating that the diagnosing accuracy is 100% when using this biomarker in diagnosing patients having Chinese herb-induced nephropathy.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Urology & Nephrology (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Medicinal Chemistry (AREA)
- Cell Biology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Organic Chemistry (AREA)
- Microbiology (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Biotechnology (AREA)
- Analytical Chemistry (AREA)
- Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Genetics & Genomics (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Biophysics (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Other Investigation Or Analysis Of Materials By Electrical Means (AREA)
- Peptides Or Proteins (AREA)
Abstract
Use of urine biomarkers for diagnosing nephropathy, monitoring nephropathy progress, and assessing efficacy of a nephropathy treatment. These urine biomarkers include leukocyte-associated Ig-like receptor-2, alpha-1 acid glycoprotein, their fragments, and combinations thereof.
Description
- This application claims priority to U.S. Provisional Application No. 61/147,785, filed on Jan. 28, 2009, the content of which is hereby incorporated by reference in its entirety.
- Nephropathy, commonly known as kidney damage, is caused by, among others, diabetes, high blood pressure, drug toxicity, and inflammation.
- Typically, nephropathy is diagnosed by determining the level of proteinuria (e.g., the level of urine albumin), or by examining the glomerular filtration rate (GFR), an indicator of renal function. Both approaches are not suitable for detecting early stage nephropathy, which typically displays no symptoms. While nephropathy can also be detected by renal biopsy, this invasive procedure is not an ideal diagnostic approach.
- It is of great importance to develop a method for detecting early stage nephropathy. The key to achieving this goal is to identify reliable biomarkers associated with incipient nephropathy.
- The present invention is based on unexpected discoveries that the urine levels of leukocyte-associated Ig-like receptor-2, alpha-1 acid glycoprotein, and fragments of these two proteins are significantly higher in a nephropathy patient than in a nephropathy-free patient. These protein molecules are therefore reliable biomarkers for diagnosis of early stage nephropathy.
- Accordingly, one aspect of this invention features a nephropathy diagnostic method. This method includes at least the following steps: (a) obtaining a urine sample from a subject suspected of having nephropathy, (b) determining in the urine sample a level of a biomarker, and (c) assessing whether the subject has nephropathy based on the level of the biomarker. The biomarker used in the just-described method is one of the following: (i) leukocyte-associated Ig-like receptor-2 or a fragment thereof having at least ten amino acid residues, such as DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1), (ii) a fragment of alpha-1 acid glycoprotein having at least ten amino acid residues, such as GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2), (iii) a combination of (i) and (ii), or (iv) a combination of (i) and alpha-1 acid glycoprotein.
- An increase in the level of one of the four biomarkers, as compared to that in a nephropathy-free subject, indicates that the subject has nephropathy. In one example, the biomarker level is determined by a mass spectrometry assay (e.g., MALDI-MS, LC-MS, and LC-MS/MS). In another example, it is determined by an immune assay (e.g., ELISA, Westernblot, RIA, FIA and LIA).
- The above-described nephropathy diagnostic method is applicable to both humans and laboratory animals, e.g., those free of proteinuria. The term “a laboratory animal” used herein refers to a vertebrate animal commonly used in animal testing, e.g., mouse, rat, rabbit, cat, dog, pig, and non-human primate.
- Another aspect of this invention features a method for monitoring nephropathy progress in a subject. This method includes (a) obtaining a first urine sample from a subject suffering from nephropathy (e.g., a human or a laboratory animal), (b) determining in the first urine sample a level of one of the four biomarkers listed above, (c) obtaining a second urine sample from the subject 2 weeks to 12 months after the first urine sample is obtained, (d) determining in the second urine sample a level of the biomarker, and (e) assessing nephropathy progress in the subject. An increase in the level of the biomarker in the second urine sample, as compared to that in the first urine sample, indicates that nephropathy is exacerbated in the subject. When the subject is a human in early stage nephropathy, the second urine sample is obtained 6 to 12 months after the first urine sample is obtained. For a human subject in late stage nephropathy, the second urine sample can be obtained 3 to 6 months later than the first urine sample. When this method is applied to a laboratory animal, the second urine sample can be obtained 2 to 24 weeks after the first urine sample is obtained.
- In still another aspect, the present invention provides a method for monitoring efficacy of a nephropathy treatment in a nephropathy patient, including (a) determining a level of one of the biomarkers listed above in a urine sample from the nephropathy patient before the treatment, (b) determining a level of the biomarker in a urine sample from the patient after the treatment, and (c) assessing efficacy of the treatment based on a change in the level of the biomarker after the treatment. The treatment is found to be effective when the post-treatment biomarker level remains the same or decreases as compared with the pre-treatment biomarker level.
- This invention also provides a method of assessing renal toxicity of an agent, including (a) obtaining a plurality of urine samples from a subject treated with an agent at various time points during treatment, (b) determining in each of the urine samples a level of one of the above-described biomarkers, and (c) assessing renal toxicity of the agent based on a change in the level of the biomarker during the treatment. An increase in the biomarker level in the course of the treatment indicates that the agent is renal toxic. The agent can be a compound (e.g., a drug or a drug candidate), an herb product, and a food product
- This invention further provides a kit useful in any of the methods described above. This kit contains a first antibody specifically binding to leukocyte-associated Ig-like receptor-2 and a second antibody specifically binding to alpha-1 acid glycoprotein. Both antibodies can be whole immunoglobulin molecules. In one example, this kit contains only antibodies specific to antigens to be detected (e.g., biomarkers associated with nephropathy) for practicing one of the methods disclosed herein. Namely, it consists essentially of such antibodies.
- Also within the scope of this invention is an isolated antibody specifically binding to DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1), or GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2). The term “isolated antibody” used herein refers to an antibody substantially free from naturally associated molecules. More specifically, a preparation containing the antibody is deemed as “an isolated antibody” when the naturally associated molecules in the preparation constitute at most 20% by dry weight. Purity can be measured by any appropriate method, e.g., column chromatography, polyacrylamide gel electrophoresis, and HPLC.
- Any of the antibodies described above can be used in manufacturing a kit useful in practicing any of the methods of this invention.
- The details of one or more embodiments of the invention are set forth in the description below. Other features or advantages of the present invention will be apparent from the following detailed description of several examples, and also from the appended claims.
- The drawings are first described.
-
FIG. 1 is a diagram showing boxplots for combined levels of a fragment of leukocyte-associated Ig-like receptor-2 and a fragment of alpha-1 acid glycoprotein in healthy controls and patients having various types of nephropathy. DN, IgAN, CHN, and MGN refer to diabetic nephropathy, IgA nephropathy, Chinese herb nephropathy, and membranous glomerulonephritis nephropathy. The upper and lower limits of the boxes mark the 25% and 75% values with the medians as the lines across the boxes. The upper whisker marks the largest value below the upper fence, which is the 75% value plus 1.5 interquartile range and the lower whisker marks the smallest value above the lower fence, which is the 25% value minus 1.5 interquartile range. -
FIG. 2 is a diagram showing boxplots for combined levels of a fragment of leukocyte-associated Ig-like receptor-2 and a fragment of alpha-1 acid glycoprotein in healthy controls and patients having CHN. The upper and lower limits of the boxes mark the 25% and 75% values with the medians as the lines across the boxes. The upper whisker marks the largest value below the upper fence, which is the 75% value plus 1.5 interquartile range and the lower whisker marks the smallest value above the lower fence, which is the 25% value minus 1.5 interquartile range. - In one aspect, the present invention relates to a method for diagnosing nephropathy based on the level of a urine biomarker, which can be leukocyte-associated Ig-like receptor-2 (GenBank accession number CAQ08962; 10-Jan.-2010), alpha-1 acid glycoprotein (GenBank accession number EAW87416; 10-Jan.-2010), a fragment of either protein, or a combination thereof. The fragment of either protein has a minimum length of ten amino acids and preferably, a maximum length of 120 to 200 amino acids. For example, fragments of leukocyte-associated Ig-like receptor-2 and alpha-1 acid glycoprotein can contain up to 125 and 191 amino acid residues, respectively. In one example, the fragment of leukocyte-associated Ig-like receptor-2 is DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) and a fragment of alpha-1 acid glycoprotein is GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2).
- Each of the urine biomarkers mentioned above can be used to diagnose any type of nephropathy, including those related to diabetes (i.e., diabetic nephropathy), glomerulonephritis resulting from deposition of IgA in kidney tissues (i.e., IgA nephropathy), inflammation (e.g., membranous glomerulonephritis), Chinese herb-induced renal fibrosis (i.e., Chinese herbal nephropathy), chronic tubulointerstitial damage, which lead to renal failure (i.e., chronic interstitial nephritis), and focal segmental glomerulosclerosis.
- To practice the diagnostic method of this invention, a urine sample is obtained from a subject suspected of having nephropathy and the level of any of the biomarkers mentioned above is then determined by conventional methods, e.g., ELISA and Westernblot. When the biomarker is a peptide or a combination of peptides, its level can be determined by a mass spectrometry assay. The level of the urine biomarker can then be compared with a reference point representing the level of the same urine biomarker in a nephropathy-free subject. The reference point can be determined via routine practice based on the representative level of a urine biomarker in a group of nephropathy patients versus that in a group of nephropathy-free subjects. For example, it can be the middle point between the mean levels of these two groups. When the level of the urine biomarker in the subject is greater than the reference point, it indicates that the subject has nephropathy.
- When necessary, patients having minimal change nephropathy (MCN) or minimal change disease (MCD) can be used as control groups for determining the reference point mentioned above. Generally, MCN and MCD patients exhibit obvious proteinuria but normal renal functions.
- When a fragment of leukocyte-associated Ig-like receptor-2 or a fragment of alpha-1 acid glycoprotein is used, the diagnostic method of this invention can be applied to detect incipient nephropathy when presence of proteins (e.g., albumin) in urine is not detectable, i.e., free of proteinuria. In another aspect, this invention relates to a method of monitoring nephropathy progress in a subject based on any of the urine biomarkers described above. To practice this method, two urine samples from a subject can be obtained within a suitable time span (e.g., 2 weeks to 12 months) and examined to determine the levels of one of the urine biomarkers described above. If the urine biomarker level in the later-obtained urine sample is greater than that in the earlier-obtained urine sample, it indicates that nephropathy progresses in the subject.
- The monitoring method can be applied to a human subject suffering from or at risk for nephropathy. When the human subject is at risk for or in early stage nephropathy, the level of the urine biomarker can be determined once every 6 to 12 months to monitor nephropathy progress. When the human subject is already in late stage of nephropathy, it is preferred that the urine biomarker level be determined once every 3 to 6 months. While carrying kidney damage, patients in early stage nephropathy are generally asymptomatic and display normal kidney functions. These patients are at risk for nephropathy progress. Later stage nephropathy is characterized by a progressive decline in GFR (e.g., <15 mL/minute/1.73 m2).
- The monitoring method described above is also applicable a laboratory animal, following routine procedures, to study nephropathy. Preferably, the laboratory animal is examined once every 2 to 24 weeks to determine the level of one of the urine biomarkers mentioned above. An increase in the biomarker level over time indicates that the disease progresses in the animal.
- In yet another aspect, the present invention provides a method for assessing efficacy of a nephropathy treatment in a subject in need (i.e., a human nephropathy patient or a laboratory animal bearing renal damage). In this method, the levels of one of the urine biomarkers described above are determined before, during, and/or after the treatment. If the urine biomarker level remains the same or decreases over the course of the treatment, it indicates that the treatment is effective.
- Any of the urine biomarkers can also be used to monitor renal toxicity of a target agent, i.e., whether an agent induces renal damage. The target agent can be any compound or composition for human administration. Examples include, but are not limited to, chemical compounds, which can be drugs (e.g., non-steroidal anti-inflammatory drugs) or drug candidates, food products or supplements, and herb supplements. Renal toxicity of a target agent is indicated by its ability to increase the level of a urine biomarker over time.
- Also disclosed herein is a kit useful in practicing any of the above-described methods. This kit contains at least two antibodies, one specific to Ig-like receptor-2, e.g., capable of binding to its fragment DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) or any epitope contained therein, and the other specific to alpha-1 acid glycoprotein, e.g., capable of binding to its fragment GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2) or any epitope contained therein. In one example, the kit includes two different antibodies (i.e., a coating antibody and a detecting antibody) that bind to the same biomarker. Typically, the detecting antibody is conjugated with a molecule which emits a detectable signal either on its own or via binding to another agent. The term “antibody” used herein refers to a whole immunoglobulin or a fragment thereof, such as Fab or F(ab′)2 that retains antigen-binding activity. It can be naturally occurring or genetically engineered (e.g., single-chain antibody, chimeric antibody, or humanized antibody).
- The antibodies included in the kit of this invention can be obtained from commercial vendors. Alternatively, they can be prepared by conventional methods. See, for example, Harlow and Lane, (1988) Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, New York. To produce antibodies against a particular biomarker as listed above, the marker, optionally coupled to a carrier protein (e.g., KLH), can be mixed with an adjuvant, and injected into a host animal. Antibodies produced in the animal can then be purified by affinity chromatography. Commonly employed host animals include rabbits, mice, guinea pigs, and rats. Various adjuvants that can be used to increase the immunological response depend on the host species and include Freund's adjuvant (complete and incomplete), mineral gels such as aluminum hydroxide, CpG, surface-active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, and dinitrophenol. Useful human adjuvants include BCG (bacille Calmette-Guerin) and Corynebacterium parvum. Polyclonal antibodies, i.e., heterogeneous populations of antibody molecules, are present in the sera of the immunized animal.
- Monoclonal antibodies, i.e., homogeneous populations of antibody molecules, can be prepared using standard hybridoma technology (see, for example, Kohler et al. (1975) Nature 256, 495; Kohler et al. (1976) Eur. J. Immunol. 6, 511; Kohler et al. (1976)
Eur J Immunol 6, 292; and Hammerling et al. (1981) Monoclonal Antibodies and T Cell Hybridomas, Elsevier, N.Y.). In particular, monoclonal antibodies can be obtained by any technique that provides for the production of antibody molecules by continuous cell lines in culture such as described in Kohler et al. (1975) Nature 256, 495 and U.S. Pat. No. 4,376,110; the human B-cell hybridoma technique (Kosbor et al. (1983)Immunol Today - Moreover, antibody fragments can be generated by known techniques. For example, such fragments include, but are not limited to, F(ab′)2 fragments that can be produced by pepsin digestion of an antibody molecule, and Fab fragments that can be generated by reducing the disulfide bridges of F(ab′)2 fragments.
- Without further elaboration, it is believed that one skilled in the art can, based on the above description, utilize the present invention to its fullest extent. The following specific embodiments are, therefore, to be construed as merely illustrative, and not limitative of the remainder of the disclosure in any way whatsoever. All publications cited herein are incorporated by reference.
- The following groups of human subjects were participated in this study:
- (a) healthy donors: free of diabetic mellitus with normal renal functions,
- (b) DM patients: having type 2 diabetic mellitus, but free from nephropathy,
- (c) DN patients: having diabetic nephropathy,
- (d) DN uremia patients: having DN associated with uremia,
- (e) IgAN patients: having IgA nephropathy,
- (f) MGN patients: having membranous glomerulonephritis,
- (g) CHN patients: having nephropathy induced by Chinese herb, and
- (h) CIN patients: having chronic interstitial nephritis.
- Clinical characteristics of the healthy donors and the patients are summarized in Table 1 below:
-
TABLE 1 Patient Characteristics Healthy DM DN DN uremia IgAN MGN CHN CIN Age, mean(SD) 67.94 57.33 72.38 58.14 28.33 38.00 47.42 59.88 (12.30) (10.52) (7.44) (12.79) (12.31) (13.11) (10.43) (7.62) Female, n (%) 6 2 1 2 4 2 14 4 (37.5) (33.33) (12.5) (28.57) (44.44) (66.67) (73.68) (50.00) Serum Creatinine (mg/dL), 0.86 0.85 1.39 4.23 1.03 0.60 5.39 3.54 mean(SD) (0.14) (0.24) (0.49) (4.65) (0.48) (0.20) (5.39) (2.28) MDRD_S_GFR, mean(SD) 86.28 106.86 58.60 58.02 104.29 144.96 22.70 24.32 (13.19) (70.47) (20.75) (61.53) (56.19) (55.15) (17.07) (15.91) - Midstream urinary samples were collected from the groups of human subjects listed above in early morning. These urine samples from both healthy donors and patients, mixed with protease inhibitors, were analyzed by MALDI-TOF-MS. Peptide candidates that were differentially presented in the healthy donor group and the various patient groups were identified upon comparison of polypeptide patterns between each patient group and the healthy donor group, taking into consideration statistical evaluation of demographic and sample parameters. These peptides were purified, their amino acid sequences determined via routine technology.
- (iii) Westernblot Assay
- Western blotting analysis was performed using antibodies specific to leukocyte-associated Ig-like receptor-2 fragment DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) and alpha-1 acid glycoprotein fragment GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2), following routine technology. The results were normalized against the level of creatinine or protein in the same sample.
- Urine samples were mixed with protease inhibitors and diluted at 1:100 with a dilution buffer and serum samples were diluted at 1:10. The diluted samples were placed in ELISA plates in triplicates. The concentrations of leukocyte-associated Ig-like receptor-2 and alpha-1 acid glycoprotein were determined via the standard sandwich ELISA method and normalized against the level of creatinine or protein in the same sample
- Via the MALDI-MS assay described above, peptides DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) and GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2) were detected in urine samples from nephropathy patients at much higher levels as compared to urine samples from healthy controls. SEQ ID NOs:1 and 2 are fragments of leukocyte-associated Ig-like receptor-2 and alpha-1 acid glycoprotein, respectively. The positive rates of these two peptides in the healthy donor group and in the various patient groups are shown in Table 2 below:
-
Positive rates of Positive rates of Patient SEQ ID NO: 2 SEQ ID NO: 1 Categories Groups Numbers N (%) N (%) Healthy Health 19 0 (0%) 1 (5.3%) Diabetic DM 7 0 (0%) 2 (28.6%) Nephropathy DN 8 2 (25%) 8 (100%) DN uremia 11 6 (54.5%) 8 (72.7%) Immune-mediated IgAN 12 0 (0%) 8 (66.7%) Nephropathy MGN 3 0 (0%) 2 (66.7%) Interstitial CHN 18 10 (55.6%) 17 (94.4%) Nephritis CIN 7 3 (42.9%) 7 (100%) Total 85 21 53 - The results also show that the urine levels of these two peptides in nephropathy patients were not correlated with proteinuria, indicating that they can be used to detect kidney lesions prior to the appearance of proteins, particularly albumin, in urine.
- Further, the urine levels of these two peptides in nephropathy patients were found to exhibit reverse correlations with GFR, indicating that they can serve as markers for monitoring renal function changes and nephropathy progress.
- Via the ELISA and Westernblot assays described above, leukocyte-associated Ig-like receptor-2 and alpha-1 acid glycorprotein were found to be differentially presented in urine samples from nephropathy patients (e.g., patients having Chinese herb-induced nephropathy) versus urine samples from healthy controls. See Table 3 below. More specifically, presence of either protein in urine samples from healthy controls was barely detectable; while a higher level of the protein was found in urine samples from nephropathy patients. This result indicates that either protein can be used as a marker for diagnosing nephropathy.
-
TABLE 2 Ratios of Alpha-1 Acid Glycoprotein to Creatinine in Various Patient Groups DN Healthy DM DN IgAN MGN CHN CIN uremia AGP/Cr 2.57 2.91 29.18 15.52 139.51 19.55 51.31 97.13 (ng/mg) × 1000 (2.52) (1.68) (30.93) (20.87) (137.53) (39.36) (65.46) (140.60) mean(SD) - The levels of urine leukocyte-associated Ig-like receptor-2 and alpha-1 acid glycorprotein from both healthy controls and nephropathy patients (including patients having diabetic nephropathy, uremia, IgA nephropathy, Chinese herb-induced nephropathy, and membranous glomerulonephritis nephropathy) were determined as described in Example 1 above.
- As shown in
FIG. 1 , the combined level of the above-mentioned two protein markers was much higher in all types of nephropathy patients as compared to that in healthy controls (AUROC=0.93). This indicates that leukocyte-associated Ig-like receptor-2 and alpha-1 acid glycorprotein, in combination, can be used as a reliable biomarker for diagnosing nephropathy with high sensitivity and specificity. - The combination of urine leukocyte-associated Ig-like receptor-2 and alpha-1 acid glycorprotein was found to be particularly reliable in detecting nephropathy induced by Chinese herb. See
FIG. 2 . The AUROC obtained from this study reaches 1.0, indicating that the diagnosing accuracy is 100% when using this biomarker in diagnosing patients having Chinese herb-induced nephropathy. - All of the features disclosed in this specification may be combined in any combination. Each feature disclosed in this specification may be replaced by an alternative feature serving the same, equivalent, or similar purpose. Thus, unless expressly stated otherwise, each feature disclosed is only an example of a generic series of equivalent or similar features.
- From the above description, one skilled in the art can easily ascertain the essential characteristics of the present invention, and without departing from the spirit and scope thereof, can make various changes and modifications of the invention to adapt it to various usages and conditions. Thus, other embodiments are also within the claims.
Claims (22)
1. A method of diagnosing nephropathy in a subject, comprising:
obtaining a urine sample from a subject suspected of having nephropathy,
determining in the urine sample a level of a biomarker selected from the group consisting of (i) a first protein molecule that is leukocyte-associated Ig-like receptor-2 or a fragment thereof having at least ten amino acid residues, (ii) a second protein molecule that is a fragment of alpha-1 acid glycoprotein having at least ten amino acid residues, (iii) a combination of the first and second protein molecules, and (iv) a combination of the first protein molecule and alpha-1 acid glycoprotein; and
assessing whether the subject has nephropathy based on the level of the biomarker,
wherein an increase in the level of the biomarker, as compared to that in a nephropathy-free subject, indicates that the subject has nephropathy.
2. The method of claim 1 , wherein the fragment of leukocyte-associated Ig-like receptor-2 is DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) and the fragment of alpha-1 acid glycoprotein is
3. The method of claim 1 , wherein the level of the biomarker is determined by a mass spectrometry assay or an immune assay.
4. The method of claim 3 , wherein the mass spectrometry assay is selected from the group consisting of MALDI-MS, LC-MS, and LC-MS/MS.
5. The method of claim 3 , wherein the immune assay is selected from the group consisting of ELISA, Westernblot, RIA, FIA and LIA.
6. The method of claim 1 , wherein the subject is a human.
7. The method of claim 1 , wherein the subject is a laboratory animal.
8. The method of claim 1 , wherein the biomarker is the first protein molecule.
9. The method of claim 8 , wherein the first protein molecule is leukocyte-associated Ig-like receptor-2.
10. The method of claim 8 , wherein the first protein molecule is
11. The method of claim 10 , wherein the subject is free of proteinuria.
12. The method of claim 1 , wherein the biomarker is the second protein molecule.
13. The method of claim 12 , wherein the second protein molecule is
14. The method of claim 13 , wherein the subject is free of proteinuria.
15. The method of claim 1 , wherein the biomarker is the combination of the first and second protein molecules or the combination of the first protein molecule and alpha-1 acid glycoprotein.
16. The method of claim 15 , wherein the first protein molecule is leukocyte-associated Ig-like receptor-2 or a fragment thereof that is DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) and the second protein molecule is GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS (SEQ ID NO:2).
17. A method for monitoring nephropathy progress in a subject, comprising
obtaining a first urine sample from a subject suffering from nephropathy;
determining in the first urine sample a level of a biomarker selected from the group consisting of (i) a first protein molecule that is leukocyte-associated Ig-like receptor-2 or a fragment thereof having at least ten amino acid residues, (ii) a second protein molecule that is a fragment of alpha-1 acid glycoprotein having at least ten amino acid residues, (iii) a combination of the first and second protein molecules, and (iv) a combination of the first protein molecule and alpha-1 acid glycoprotein;
obtaining a second urine sample from the subject 2 weeks to 12 months after the first urine sample is obtained;
determining in the second urine sample a level of the biomarker; and
assessing nephropathy progress in the subject,
wherein an increase in the level of the biomarker in the second urine sample, as compared to that in the first urine sample, indicates that nephropathy is exacerbated in the subject.
18. The method of claim 17 , wherein the fragment of leukocyte-associated Ig-like receptor-2 is DFLELLVKGTVPGTEASGFDAP (SEQ ID NO:1) and the fragment of alpha-1 acid glycoprotein is
19. The method of claim 18 , wherein the subject is a human in early stage nephropathy and the second urine sample is obtained 6 to 12 months after the first urine sample is obtained.
20. The method of claim 18 , wherein the subject is a human in later stage nephropathy and the second urine sample is obtained 3 to 6 months after the first urine sample is obtained.
21. The method of claim 18 , wherein the subject is a laboratory animal and the second urine sample is obtained 2 to 24 weeks after the first urine sample is obtained.
22-30. (canceled)
Priority Applications (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US12/694,639 US20100209948A1 (en) | 2009-01-28 | 2010-01-27 | Biomarkers associated with nephropathy |
US12/968,841 US20110081667A1 (en) | 2009-01-28 | 2010-12-15 | Biomarkers associated with nephropathy |
US12/969,731 US8470547B2 (en) | 2009-01-28 | 2010-12-16 | Biomarkers associated with nephropathy |
US12/973,018 US20110086372A1 (en) | 2009-01-28 | 2010-12-20 | Biomarkers associated with nephropathy |
US13/912,531 US9442120B2 (en) | 2009-01-28 | 2013-06-07 | Biomarkers associated with nephropathy |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US14778509P | 2009-01-28 | 2009-01-28 | |
US12/694,639 US20100209948A1 (en) | 2009-01-28 | 2010-01-27 | Biomarkers associated with nephropathy |
Related Child Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/968,841 Continuation US20110081667A1 (en) | 2009-01-28 | 2010-12-15 | Biomarkers associated with nephropathy |
US12/969,731 Continuation US8470547B2 (en) | 2009-01-28 | 2010-12-16 | Biomarkers associated with nephropathy |
US12/973,018 Continuation US20110086372A1 (en) | 2009-01-28 | 2010-12-20 | Biomarkers associated with nephropathy |
Publications (1)
Publication Number | Publication Date |
---|---|
US20100209948A1 true US20100209948A1 (en) | 2010-08-19 |
Family
ID=42395075
Family Applications (5)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/694,639 Abandoned US20100209948A1 (en) | 2009-01-28 | 2010-01-27 | Biomarkers associated with nephropathy |
US12/968,841 Abandoned US20110081667A1 (en) | 2009-01-28 | 2010-12-15 | Biomarkers associated with nephropathy |
US12/969,731 Active 2030-02-06 US8470547B2 (en) | 2009-01-28 | 2010-12-16 | Biomarkers associated with nephropathy |
US12/973,018 Abandoned US20110086372A1 (en) | 2009-01-28 | 2010-12-20 | Biomarkers associated with nephropathy |
US13/912,531 Active 2031-08-28 US9442120B2 (en) | 2009-01-28 | 2013-06-07 | Biomarkers associated with nephropathy |
Family Applications After (4)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/968,841 Abandoned US20110081667A1 (en) | 2009-01-28 | 2010-12-15 | Biomarkers associated with nephropathy |
US12/969,731 Active 2030-02-06 US8470547B2 (en) | 2009-01-28 | 2010-12-16 | Biomarkers associated with nephropathy |
US12/973,018 Abandoned US20110086372A1 (en) | 2009-01-28 | 2010-12-20 | Biomarkers associated with nephropathy |
US13/912,531 Active 2031-08-28 US9442120B2 (en) | 2009-01-28 | 2013-06-07 | Biomarkers associated with nephropathy |
Country Status (11)
Country | Link |
---|---|
US (5) | US20100209948A1 (en) |
EP (1) | EP2391653B8 (en) |
JP (1) | JP5524241B2 (en) |
CN (1) | CN102300875B (en) |
CA (1) | CA2748852C (en) |
DK (1) | DK2391653T3 (en) |
ES (1) | ES2530574T3 (en) |
MX (1) | MX2011007810A (en) |
PT (1) | PT2391653E (en) |
TW (1) | TWI397687B (en) |
WO (1) | WO2010085878A1 (en) |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20130252267A1 (en) * | 2009-01-28 | 2013-09-26 | Industrial Technology Research Institute | Urine and serum biomarkers associated with diabetic nephropathy |
US20190339284A1 (en) * | 2016-06-10 | 2019-11-07 | Warszawski Uniwersytet Medyczny | Methods for diagnosis, differentiation and monitoring using urine proteins as markers in iga nephropathy |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR101732706B1 (en) * | 2015-06-05 | 2017-05-04 | 압타바이오 주식회사 | USE of SH3YL1 As Diagnostic Marker for Nephropathy |
Citations (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4640909A (en) * | 1985-05-07 | 1987-02-03 | J. T. Baker Chemical Company | Bonded phase of silica and carboalkoxyalkyl silanes for solid phase extraction |
WO1998024906A2 (en) * | 1996-12-06 | 1998-06-11 | Schering Corporation | Isolated mammalian monocyte cell genes; related reagents |
US6447989B1 (en) * | 1998-12-21 | 2002-09-10 | Monash University | Kidney disease detection and treatment |
US6664385B1 (en) * | 1996-05-24 | 2003-12-16 | Biogen, Inc. | Kidney injury-related molecules |
US6682917B1 (en) * | 1999-06-28 | 2004-01-27 | Takeda Chemical Industries, Ltd | Protein having a ribonucleotide Reductase activity and a DNA thereof |
US20050191664A1 (en) * | 1998-12-21 | 2005-09-01 | Monash University | Method for kidney disease detection |
US20080124752A1 (en) * | 2006-10-13 | 2008-05-29 | Metabolon, Inc. | Biomarkers related to metabolic age and methods using the same |
US20080187944A1 (en) * | 2007-01-31 | 2008-08-07 | Appa Rao Allam | Butyrylcholinesterase as a marker of low-grade systemic inflammation |
US20090030037A1 (en) * | 2005-04-21 | 2009-01-29 | Decode Genetics Ehf. | Sustained Release Formulation and Dosing Schedules of Leukotriene Synthesis Inhibitor for Human Therapy |
US7993832B2 (en) * | 2006-08-14 | 2011-08-09 | Xdx, Inc. | Methods and compositions for diagnosing and monitoring the status of transplant rejection and immune disorders |
Family Cites Families (13)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4376110A (en) | 1980-08-04 | 1983-03-08 | Hybritech, Incorporated | Immunometric assays using monoclonal antibodies |
US6140076A (en) * | 1996-12-06 | 2000-10-31 | Schering Corporation | Ig superfamily `dlair` receptors expressed in monocytes |
AU1674400A (en) * | 1998-12-21 | 2000-07-12 | Monash University | Kidney disease detection and treatment |
EP1509618B1 (en) * | 2002-05-13 | 2008-08-20 | Arexis AB | Autoimmune conditions and nadph oxidase defects |
GB0215509D0 (en) * | 2002-07-04 | 2002-08-14 | Novartis Ag | Marker genes |
ATE437371T1 (en) * | 2003-03-27 | 2009-08-15 | Childrens Hosp Medical Center | METHOD AND KIT FOR DETECTING THE EARLY STAGE OF RENAL TUBULAR CELL INJURY |
KR20070092737A (en) * | 2004-12-15 | 2007-09-13 | 베스 이스라엘 데코니스 메디칼 센터 | Nucleic acids and polypeptides useful for diagnosing and treating complications of pregnancy |
EP2004850A2 (en) * | 2006-03-08 | 2008-12-24 | Universitair Medisch Centrum Utrecht | Interfering in activation of an immune cell by influencing interaction of lair and collagen. |
US7662578B2 (en) * | 2006-04-21 | 2010-02-16 | Children's Hospital Medical Center | Method and kit for the early detection of impaired renal status |
JP5244103B2 (en) * | 2006-08-09 | 2013-07-24 | ホームステッド クリニカル コーポレイション | Organ-specific protein and method of use thereof |
CN101680903A (en) * | 2007-03-21 | 2010-03-24 | 比奥波托诊断股份公司 | Diagnostic test for renal injury |
EP2535718B1 (en) * | 2007-05-11 | 2014-07-09 | The Institutes for Pharmaceutical Discovery, LLC | Methods for early diagnosis of kidney disease |
EP2391654B1 (en) * | 2009-01-28 | 2015-09-09 | Industrial Technology Research Institute | Urine and serum biomarkers associated with diabetic nephropathy |
-
2010
- 2010-01-27 CA CA2748852A patent/CA2748852C/en active Active
- 2010-01-27 JP JP2011546554A patent/JP5524241B2/en active Active
- 2010-01-27 US US12/694,639 patent/US20100209948A1/en not_active Abandoned
- 2010-01-27 PT PT107354532T patent/PT2391653E/en unknown
- 2010-01-27 MX MX2011007810A patent/MX2011007810A/en active IP Right Grant
- 2010-01-27 ES ES10735453T patent/ES2530574T3/en active Active
- 2010-01-27 WO PCT/CA2010/000096 patent/WO2010085878A1/en active Application Filing
- 2010-01-27 EP EP10735453.2A patent/EP2391653B8/en active Active
- 2010-01-27 DK DK10735453.2T patent/DK2391653T3/en active
- 2010-01-27 CN CN201080005754.6A patent/CN102300875B/en active Active
- 2010-01-28 TW TW099102366A patent/TWI397687B/en active
- 2010-12-15 US US12/968,841 patent/US20110081667A1/en not_active Abandoned
- 2010-12-16 US US12/969,731 patent/US8470547B2/en active Active
- 2010-12-20 US US12/973,018 patent/US20110086372A1/en not_active Abandoned
-
2013
- 2013-06-07 US US13/912,531 patent/US9442120B2/en active Active
Patent Citations (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4640909A (en) * | 1985-05-07 | 1987-02-03 | J. T. Baker Chemical Company | Bonded phase of silica and carboalkoxyalkyl silanes for solid phase extraction |
US6664385B1 (en) * | 1996-05-24 | 2003-12-16 | Biogen, Inc. | Kidney injury-related molecules |
WO1998024906A2 (en) * | 1996-12-06 | 1998-06-11 | Schering Corporation | Isolated mammalian monocyte cell genes; related reagents |
US6447989B1 (en) * | 1998-12-21 | 2002-09-10 | Monash University | Kidney disease detection and treatment |
US20050191664A1 (en) * | 1998-12-21 | 2005-09-01 | Monash University | Method for kidney disease detection |
US6682917B1 (en) * | 1999-06-28 | 2004-01-27 | Takeda Chemical Industries, Ltd | Protein having a ribonucleotide Reductase activity and a DNA thereof |
US20090030037A1 (en) * | 2005-04-21 | 2009-01-29 | Decode Genetics Ehf. | Sustained Release Formulation and Dosing Schedules of Leukotriene Synthesis Inhibitor for Human Therapy |
US7993832B2 (en) * | 2006-08-14 | 2011-08-09 | Xdx, Inc. | Methods and compositions for diagnosing and monitoring the status of transplant rejection and immune disorders |
US20080124752A1 (en) * | 2006-10-13 | 2008-05-29 | Metabolon, Inc. | Biomarkers related to metabolic age and methods using the same |
US20080187944A1 (en) * | 2007-01-31 | 2008-08-07 | Appa Rao Allam | Butyrylcholinesterase as a marker of low-grade systemic inflammation |
Non-Patent Citations (3)
Title |
---|
Christiansen et al. "Increased urinary orosomucoid excretion is not related to impaired renal function in patients with type 2 diabetes", Journal of Diabetes and Its Complications 24 (2010) 28-36, available online September 25, 2008 * |
Harlow, E. and Lane, D., Antibodies: A Laboratory Manual (1988) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, pages 72-76 * |
Wolfe, S.L., Molecular and Cellular Biology, 1993, pages 790-793 * |
Cited By (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20130252267A1 (en) * | 2009-01-28 | 2013-09-26 | Industrial Technology Research Institute | Urine and serum biomarkers associated with diabetic nephropathy |
US10101340B2 (en) * | 2009-01-28 | 2018-10-16 | Bio Preventive Medicine Corp. | Method of detecting a urine protein fragment and a serum protein fragment |
US20190339284A1 (en) * | 2016-06-10 | 2019-11-07 | Warszawski Uniwersytet Medyczny | Methods for diagnosis, differentiation and monitoring using urine proteins as markers in iga nephropathy |
Also Published As
Publication number | Publication date |
---|---|
WO2010085878A1 (en) | 2010-08-05 |
US8470547B2 (en) | 2013-06-25 |
EP2391653A4 (en) | 2012-06-27 |
JP5524241B2 (en) | 2014-06-18 |
BRPI1007483A2 (en) | 2016-02-16 |
CN102300875A (en) | 2011-12-28 |
CA2748852C (en) | 2019-05-28 |
CA2748852A1 (en) | 2010-08-05 |
PT2391653E (en) | 2015-02-13 |
US20110081667A1 (en) | 2011-04-07 |
ES2530574T3 (en) | 2015-03-03 |
CN102300875B (en) | 2014-07-16 |
US20130266976A1 (en) | 2013-10-10 |
US20110081668A1 (en) | 2011-04-07 |
JP2012516430A (en) | 2012-07-19 |
TW201033615A (en) | 2010-09-16 |
EP2391653B8 (en) | 2015-09-30 |
EP2391653A1 (en) | 2011-12-07 |
TWI397687B (en) | 2013-06-01 |
EP2391653B1 (en) | 2014-12-31 |
DK2391653T3 (en) | 2015-02-09 |
MX2011007810A (en) | 2011-09-30 |
US9442120B2 (en) | 2016-09-13 |
US20110086372A1 (en) | 2011-04-14 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
DK2623517T3 (en) | Urine and serum biomarkers associated with diabetic nephropathy | |
US20100136579A1 (en) | Biomarkers useful in liver fibrosis diagnosis | |
US9442120B2 (en) | Biomarkers associated with nephropathy | |
EA034364B1 (en) | Immunoassay for the detection of chromogranin a | |
US8697368B2 (en) | Diagnostic marker for lung cancer comprising HPαR as active ingredient | |
BRPI1007483B1 (en) | IN VITRO DIAGNOSIS METHOD OF NEPHROPATHY, IN VITRO METHOD FOR MONITORING THE PROGRESS OF NEPHROPATHY, IN VITRO METHOD FOR MONITORING THE EFFECTIVENESS OF A NEPHROPATHY TREATMENT, IN VITRO METHOD OF EVALUATION OF RENAL TOXICITY OF AN AGENT AND KIT FOR DIAGNOSIS OF NEPHROPATHY | |
EP2924437B1 (en) | Method for detecting neurological disease accompanied by inflammation and/or demyelination |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: INDUSTRIAL TECHNOLOGY RESEARCH INSTITUTE, TAIWAN Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:YEH, MARY YA-PING;TSENG, TZU-LING;LU, CHING-FANG;AND OTHERS;SIGNING DATES FROM 20100129 TO 20100224;REEL/FRAME:024019/0726 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |