US20080311242A9 - Variant lipolytic enzymes - Google Patents

Variant lipolytic enzymes Download PDF

Info

Publication number
US20080311242A9
US20080311242A9 US10/556,511 US55651104A US2008311242A9 US 20080311242 A9 US20080311242 A9 US 20080311242A9 US 55651104 A US55651104 A US 55651104A US 2008311242 A9 US2008311242 A9 US 2008311242A9
Authority
US
United States
Prior art keywords
seq
amino acid
polypeptide
dough
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Granted
Application number
US10/556,511
Other versions
US7465570B2 (en
US20060228446A1 (en
Inventor
Kim Borch
Luise Erlandsen
Jesper Vind
Allan Svendsen
Christel Jorgensen
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novozymes AS
Original Assignee
Novozymes AS
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Novozymes AS filed Critical Novozymes AS
Priority to US10/556,511 priority Critical patent/US7465570B2/en
Publication of US20060228446A1 publication Critical patent/US20060228446A1/en
Assigned to NOVOZYMES A/S reassignment NOVOZYMES A/S ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: JORGENSEN, CHRISTEL T., SVENDSEN, ALLAN, VIND, JESPER, ERLANDSEN, LUISE, BORCH, KIM
Priority to US12/169,679 priority patent/US7638317B2/en
Application granted granted Critical
Publication of US7465570B2 publication Critical patent/US7465570B2/en
Publication of US20080311242A9 publication Critical patent/US20080311242A9/en
Adjusted expiration legal-status Critical
Active legal-status Critical Current

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A21—BAKING; EDIBLE DOUGHS
    • A21D—TREATMENT, e.g. PRESERVATION, OF FLOUR OR DOUGH, e.g. BY ADDITION OF MATERIALS; BAKING; BAKERY PRODUCTS; PRESERVATION THEREOF
    • A21D8/00—Methods for preparing or baking dough
    • A21D8/02—Methods for preparing dough; Treating dough prior to baking
    • A21D8/04—Methods for preparing dough; Treating dough prior to baking treating dough with microorganisms or enzymes
    • A21D8/042—Methods for preparing dough; Treating dough prior to baking treating dough with microorganisms or enzymes with enzymes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/18—Carboxylic ester hydrolases (3.1.1)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/18—Carboxylic ester hydrolases (3.1.1)
    • C12N9/20—Triglyceride splitting, e.g. by means of lipase
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y301/00—Hydrolases acting on ester bonds (3.1)
    • C12Y301/01—Carboxylic ester hydrolases (3.1.1)
    • C12Y301/01032—Phospholipase A1 (3.1.1.32)

Definitions

  • the present invention relates to variant polypeptides made by altering the amino acid sequence of a fungal lipolytic enzyme, particularly to such polypeptides with improved properties for use in a dough, e.g. for making bread and other baked products, and more particularly to such polypeptides having hydrolytic activity towards ester bonds in polar lipids.
  • Phospholipases and galactolipases are known as enzymes with hydrolytic activity towards ester bonds in polar lipids such as phospholipids and galactolipids.
  • WO 0032758 discloses lipolytic enzyme variants having phospholipase and galactolipase activity and their use in baking.
  • WO 9826057 discloses a lipase/phospholipase from Fusarium oxysporum and its use in baking.
  • WO 0183770 describes variants of a fungal lipase.
  • the inventors have developed variant polypeptides by modifying the amino acid sequence of a parent polypeptide which is a fungal lipolytic enzymes.
  • the variant polypeptides result in a reduced dough stickiness, compared to the parent polypeptide, when they are added to a dough.
  • the invention provides a method of producing a polypeptide, comprising:
  • the invention also provides a variant polypeptide which:
  • a) has hydrolytic activity towards an ester bonds in a polar lipid
  • FIG. 1 shows an alignment of amino acid sequences of fungal lipolytic enzymes to identify corresponding amino acids in SEQ ID NO: 1 to 15.
  • SEQ ID NO: 1 is the lipase/phospholipase from Fusarium oxysporum (WO 9826057).
  • SEQ ID NO: 2 is a variant with pohospholipase and galactolipase activity disclosed in WO 0032758.
  • SEQ ID NO: 3 to 15 are known lipolytic enzymes from the following organisms: Absidia reflexa, Absidia corymbefera, Rhizomucor miehei, Rhizopus delemar ( oryzae ), Aspergillus niger, Aspergillus tubingensis, Fusarium heterosporum, Aspergillus oryzae, Penicilium camemberti, Aspergillus foetidus, Aspergillus niger, Aspergillus oryzae and Thermomyces lanuginosus.
  • the parent polypeptide may have the sequence SEQ ID NO: 1 or 2 or one which can be aligned with SEQ ID NO: 1 or 2. It may have at least 50% amino acid identity to SEQ ID NO: 1 or 2, e.g. at least 60%, at least 70% or at least 80%. Examples are the polypeptides having the sequences SEQ ID NO: 1 to 14 or a variant disclosed in WO 0032758.
  • the parent polypeptide has lipolytic enzyme activity, e.g. hydrolytic activity towards an ester bond in a polar lipid.
  • the amino acid at the position corresponding to A29 in SEQ ID NO: 1 may be P.
  • the amino acid at the position corresponding to K33 in SEQ ID NO: 1 may be N.
  • the amino acid at the position corresponding to 183 of SEQ ID NO: 1 may be A/R/N/D/C/Q/E/G/H/L/K/M/F/P/S/T/Y/V.
  • the amino acid at the position corresponding to A255 in SEQ ID NO: 1 may be R/N/D/C/Q/E/G/H/I/L/K/M/F/P/S/T/W/Y/V.
  • the amino acid at the position corresponding to R84 of SEQ ID NO: 2 may be A/N/D/C/Q/E/G/H/I/L/K/M/F/P/S/T/Y/V.
  • the amino acid at the position corresponding to P256 in SEQ ID NO: 2 may be A/R/N/D/C/Q/E/G/H/I/L/K/M/F/S/T/W/Y/V.
  • the polypeptide may comprise further modifications compared to SEQ ID NO: 2., e.g. as disclosed in WO 0032758.
  • it may have the amino acid A/T at position D62, G/T at position A91, D/F/S/G at position W96, E at position K99, G at position S158, D at position G240, S at position N247, D at position N248, K/R at position Q249, K/T at position P250, T at position N251, F at position I252, M/R at position P253, S/Y/W at position D254, L at position I255, G at position A257, H/C at position W260, G at position Q263, L at position A264, I at position T265, G/S/A at position D266, T at position A267, L at position N269 and/or truncation after N269.
  • the polypeptide may additionally comprise amino acid modifications such as insertions or deletions.
  • the N- or C-terminus may be modified, e.g. by truncating residues in SEQ ID NO: 2 after position 269 or by extending the C-terminal of SEQ ID NO: 2 with WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS.
  • the C-terminal may be truncated after position 272, 273, 274 or 286 in SEQ ID NO: 1.
  • the N-terminal may have a peptide extension, e.g. as described in WO 0032758 or WO 9704079, such as the addition of the amino acid residues SPIRR.
  • a similar amino acid substitution or deletion may be made in other fungal lipolytic enzymes, e.g. SEQ ID NO: 3-14 at a corresponding position.
  • the corresponding positions may be found by aligning a given sequence with SEQ ID NO: 1 or 2, e.g. as shown in FIG. 1 .
  • the alignment may be done by use of the GAP program as described below.
  • the variant polypeptide may have improved thermostability compared to the parent polypeptide, particularly a variant polypeptide having a substitution at a position corresponding to A29 or K33 of SEQ ID NO: 1, e.g. the substitution A29P or K33N.
  • the variant polypeptide has at least 80% identity to SEQ ID NO: 1 or 2, particularly at least 85%, at least 90%, at least 95%, or at least 98%.
  • the degree of identity between two sequences may be suitably determined by means of computer programs known in the art, such as GAP provided in the GCG program package (Program Manual for the Wisconsin Package, Version 8, August 1994, Genetics Computer Group, 575 Science Drive, Madison, Wis., USA 53711) (Needleman, S. B. and Wunsch, C. D., (1970), Journal of Molecular Biology, 48, 443-45), using GAP with the following settings for polypeptide sequence comparison: GAP creation penalty of 3.0 and GAP extension penalty of 0.1.
  • the variant polypeptide may be tested by adding it to a dough and evaluating the dough stickiness.
  • the dough may be generated according to a typical European straight dough procedure, a typical American sponge & dough procedure or any other bread making procedures.
  • the polypeptide may be added at a dosage of 0.01-10 mg enzyme protein per kg flour, and the dough stickiness may be evaluated directly after mixing or at any point during processing. Of particular importance is the dough stickiness of the finally mixed dough, i.e. at the time where the dough runs through processing equipment such as divider, molder, sheeter and conveyer belts.
  • the mixing time varies depending on procedure. For a typical European straight dough procedure, the mixing time can e.g. be in the range of 6-10 minutes.
  • the mixing time can e.g. be in the range of 6-20 minutes (on final dough).
  • the dough may have a resting period of 5-20 min before further processing, e.g. at 20-35° C.
  • the dough stickiness may be evaluated by hand by trained bakers, by a sensory panel or by instrumental measurements e.g. by the Chen-Hoseney dough stickiness rig developed for Stable Micro Systems TA-XT2 texture analyser, commercially available from Brookfield Engineering Laboratories, Inc.
  • the parent and variant polypeptides have lipolytic enzyme activity, i.e. they have hydrolytic activity towards an ester bond and are classified in EC 3.1.1 Carboxylic Ester Hydrolases according to Enzyme Nomenclature (available at http://www.chem.qmw.ac.uk/iubmb/enzyme). More specifically, they have hydrolytic activity towards ester bonds in polar lipids so as to split off acyl groups at the sn-1 and/or sn-2 position of polar lipids such as phospholipids and galactolipids. Accordingly, they may have phospholipase activity or galactolipase activity (EC 3.1.1.26), e.g. phospholipase A1 activity (EC 3.1.1.32).
  • Phospholipase activity may be determined by known methods, e.g. the “monolayer phospholipase assay” or the plate assay described in WO 0032758.
  • Galactolipase activity may be determined with digalactosyl diglyceride as substrate, e.g. as described in WO 0032758.
  • the polypeptide may be added to a dough, and the dough may be used to prepare a steamed bread, a baked product (particularly bread), pasta or noodles.
  • the addition of the polypeptide may lead to improved dough stabilization, i.e. a larger loaf volume of the baked product and/or a better shape retention and volume during processing and baking, particularly in a stressed system, e.g. in the case of over-proofing or over-mixing. It may also lead to a lower initial firmness and/or a more uniform and fine crumb, improved crumb structure (finer crumb, thinner cell walls, more rounded cells), of the baked product, and it may further improve dough properties, e.g. a less soft dough, higher elasticity and/or lower extensibility.
  • the process may be conducted in analogy with U.S. Pat. No. 5,578,489 or U.S. Pat. No. 6,077,336.
  • the polypeptides of the invention perform better than known lipolytic enzyme variants in terms of volume and crumb structure.
  • the polypeptide can be used in a process for making bread, comprising adding the polypeptide to the ingredients of a dough, kneading the dough and baking the dough to make the bread.
  • This can be done in analogy with U.S. Pat. No. 4,567,046 (Kyowa Hakko), JP-A 60-78529 (QP Corp.), JP-A 62-111629 (QP Corp.), JP-A 63-258528 (QP Corp.), EP 426211 (Unilever) or WO 99/53769 (Novozymes).
  • composition of a typical dough can be found in WO 99/53769.
  • the polypeptide of the invention may be added together with an anti-staling amylase and optionally also a phospholipid as described in WO 9953769, particularly a maltogenic alpha-amylase (e.g. from Bacillus sp., such as Novamyl® from Novo Nordisk).
  • a fungal or bacterial ⁇ -amylase may be added, e.g. from Aspergillus or Bacillus, particularly A. oryzae, B. licheniformis or B. amyloliquefaciens.
  • an additional enzyme may be added, e.g.
  • amyloglucosidase a beta-amylase
  • a pentosanase such as a xylanase as described in WO 99/53769, e.g. derived from Aspergillus, in particular of A. aculeatus, A. niger (cf. WO 91/19782), A. awamori (WO 91/18977), or A. tubigensis (WO 92/01793), from a strain of Trichoderma, e.g. T. reesei, or from a strain of Humicula, e.g. H. insolens (WO 92/17573), a proteiase and/or a glucose oxidase.
  • Trichoderma e.g. T. reesei
  • Humicula e.g. H. insolens
  • the dough may further comprise an emulsifier such as mono- or diglycerides, diacyl tartaric acid esters of mono- or diglycerides, sugar esters of fatty acids, polyglycerol esters of fatty acids, lactic esters of monoglycerides, acetic acid esters of monoglycerides, polyoxyethylene stearates, polysorbates or lysolecithin.
  • an emulsifier such as mono- or diglycerides, diacyl tartaric acid esters of mono- or diglycerides, sugar esters of fatty acids, polyglycerol esters of fatty acids, lactic esters of monoglycerides, acetic acid esters of monoglycerides, polyoxyethylene stearates, polysorbates or lysolecithin.
  • polypeptides according to the invention were tested together with the corresponding parent polypeptide in a baking evaluation experiment by using conventional baking protocols for European straight dough procedure and US sponge & dough procedure, as follows:
  • a dough is prepared by mixing the below ingredients for 3 minutes slow and 7 minutes fast. % (baker's - by weight) Flour 100 Compressed yeast 4 Salt 1.5 Sugar 1.5 Water 62 Ascorbic acid 40 ppm
  • Dough stickiness is evaluated right after mixing and again after a resting period of 15 minutes. Dough stickiness is evaluated by a trained and experienced bakers by sensory evaluation by hand. Dough stickiness is a measure of how sticky the dough feels and is expressed on a scale from 0 (little stickiness) to 10 (very sticky). The dough with the variant is compared to a reference dough, which is always given the score 5.
  • Sponge Dough % (baker's - by weight) % (baker's - by weight) Flour 60 40 Compressed yeast 7.5 Oil 2.5 Salt 2 High fructose syrup 12 Water 34.4 20.4 Ascorbicc acid 50
  • a liquid sponge is prepared by mixing a sponge consisting of the above listed sponge ingredients for 1 minute slow and 4 minutes fast.
  • the sponge is fermented for 3 hours at 27 C, 86% RH.
  • the sponge is mixed with the dough ingredients listed above and with enzymes for 1 minutes slow and 18 minutes fast.
  • Dough stickiness is evaluated right after mixing, whereafter the dough is extruded on a rebuild pasta-machine to simulate the dough extrusion used for dough dividing in US. Dough stickiness is evaluated again after extrusion. Dough stickiness is evaluated by a trained and experienced bakers by sensory evaluation by hand. Dough stickiness is a measure of how sticky the dough feels and is expressed on a scale from 0 (little stickiness) to 10 (very sticky). The dough with the variant polypeptide is compared to a reference dough made with the parent polypeptide, which is always given the score 5.
  • Polypeptides according to the invention were prepared as described in WO 00/32758.
  • the polypeptides were derived from SEQ ID NO: 15 by making the following amino acid modifications.
  • Polypeptide Amino acid alterations compared to SEQ ID NO: 15 1 G91A +D96W +E99K +P256M +G263Q +L264A +I265T +G266D +T267A +L269N +270A +271G +272G +273F +274S +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS 2 G91A +D96W +E99K +P256N +G263Q +L264A +I265T +G266D +T267A +L269N +270A +271G +272G +273F +274S +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS 2 G91A +D
  • a variant polypeptide according to the invention was compared to its parent enzyme (SEQ ID NO: 1) in the US sponge & dough procedure described above. 40 ppm Fungamyl Super MA (a blend of fungal alpha-amylase and xylanase) was added as background to all doughs. The parent enzyme and the variant were dosed at their optimal level, i.e. the level giving best volume and dough stabilising effect. The below results show that the variant gives reduced dough stickiness compared to the parent enzyme Polypeptide Parent A29P+I83N Dough stickiness after 6 5 mixing Dough stickiness after 6.5 5 extrusion
  • Variant polypeptides with the following amino acid alterations compared SEQ ID NO: 1 (lipase/phosapholipase from F. oxysporum ) were prepared and tested by adding each polypeptide to a dough. The polypeptide with unmodified SEQ ID NO: 1 was also tested, for comparison.
  • Variant polypeptides with the following amino acid alterations compared SEQ ID NO: 2 (variant of T. lanuginosus lipase) were prepared and tested by adding each polypeptide to a dough. The polypeptide with unmodified SEQ ID NO: 2 was also tested for comparison.

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Microbiology (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Food Science & Technology (AREA)
  • Bakery Products And Manufacturing Methods Therefor (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The inventors have developed improved polypeptides by substituting or deleting specified amino acids in fungal lipolytic enzymes. More particularly, the polypeptides result in a reduction of dough stickiness when they are added to a dough. The polypeptides may particularly have activity on polar lipids.

Description

    FIELD OF INVENTION
  • The present invention relates to variant polypeptides made by altering the amino acid sequence of a fungal lipolytic enzyme, particularly to such polypeptides with improved properties for use in a dough, e.g. for making bread and other baked products, and more particularly to such polypeptides having hydrolytic activity towards ester bonds in polar lipids.
    • BACKGROUND OF THE INVENTION
  • Phospholipases and galactolipases are known as enzymes with hydrolytic activity towards ester bonds in polar lipids such as phospholipids and galactolipids. WO 0032758 discloses lipolytic enzyme variants having phospholipase and galactolipase activity and their use in baking. WO 9826057 discloses a lipase/phospholipase from Fusarium oxysporum and its use in baking. WO 0183770 describes variants of a fungal lipase.
    • SUMMARY OF THE INVENTION
  • The inventors have developed variant polypeptides by modifying the amino acid sequence of a parent polypeptide which is a fungal lipolytic enzymes. The variant polypeptides result in a reduced dough stickiness, compared to the parent polypeptide, when they are added to a dough.
  • Accordingly, the invention provides a method of producing a polypeptide, comprising:
  • a) selecting an amino acid sequence for a parent polypeptide which is a fungal lipolytic enzyme,
  • b) selecting an amino acid residue in the sequence which corresponds to A29, K33, I83 or A255 of SEQ ID NO: 1 (corresponding to P29, N33, R84 or P256 of SEQ ID NO: 2),
  • c) modifying the amino acid sequence by substituting or deleting the selected residue,
  • d) preparing a variant polypeptide having the modified amino acid sequence, and
  • e) adding the polypeptide to a dough and testing dough stickiness.
  • The invention also provides a variant polypeptide which:
  • a) has hydrolytic activity towards an ester bonds in a polar lipid, and
  • b) has an amino acid sequence which
      • i) has at least 80% identity to SEQ ID NO: 1 and has a different amino acid or an amino acid deletion at a position corresponding to A29, K33, I83 or A255, or
      • ii) has at least 80% identity to SEQ ID NO: 2 and has a different amino acid or an amino acid deletion at a position corresponding to R84 or P256.
    BRIEF DESCRIPTION OF DRAWINGS
  • FIG. 1 shows an alignment of amino acid sequences of fungal lipolytic enzymes to identify corresponding amino acids in SEQ ID NO: 1 to 15. SEQ ID NO: 1 is the lipase/phospholipase from Fusarium oxysporum (WO 9826057). SEQ ID NO: 2 is a variant with pohospholipase and galactolipase activity disclosed in WO 0032758. SEQ ID NO: 3 to 15 are known lipolytic enzymes from the following organisms: Absidia reflexa, Absidia corymbefera, Rhizomucor miehei, Rhizopus delemar (oryzae), Aspergillus niger, Aspergillus tubingensis, Fusarium heterosporum, Aspergillus oryzae, Penicilium camemberti, Aspergillus foetidus, Aspergillus niger, Aspergillus oryzae and Thermomyces lanuginosus.
    • DETAILED DESCRIPTION OF THE INVENTION
  • Parent Polypeptide
  • The parent polypeptide may have the sequence SEQ ID NO: 1 or 2 or one which can be aligned with SEQ ID NO: 1 or 2. It may have at least 50% amino acid identity to SEQ ID NO: 1 or 2, e.g. at least 60%, at least 70% or at least 80%. Examples are the polypeptides having the sequences SEQ ID NO: 1 to 14 or a variant disclosed in WO 0032758.
  • The parent polypeptide has lipolytic enzyme activity, e.g. hydrolytic activity towards an ester bond in a polar lipid.
  • Variant Polypeptide
  • The amino acid at the position corresponding to A29 in SEQ ID NO: 1 may be P. The amino acid at the position corresponding to K33 in SEQ ID NO: 1 may be N. The amino acid at the position corresponding to 183 of SEQ ID NO: 1 may be A/R/N/D/C/Q/E/G/H/L/K/M/F/P/S/T/Y/V. The amino acid at the position corresponding to A255 in SEQ ID NO: 1 may be R/N/D/C/Q/E/G/H/I/L/K/M/F/P/S/T/W/Y/V.
  • The amino acid at the position corresponding to R84 of SEQ ID NO: 2 may be A/N/D/C/Q/E/G/H/I/L/K/M/F/P/S/T/Y/V. The amino acid at the position corresponding to P256 in SEQ ID NO: 2 may be A/R/N/D/C/Q/E/G/H/I/L/K/M/F/S/T/W/Y/V. The polypeptide may comprise further modifications compared to SEQ ID NO: 2., e.g. as disclosed in WO 0032758. Thus, it may have the amino acid A/T at position D62, G/T at position A91, D/F/S/G at position W96, E at position K99, G at position S158, D at position G240, S at position N247, D at position N248, K/R at position Q249, K/T at position P250, T at position N251, F at position I252, M/R at position P253, S/Y/W at position D254, L at position I255, G at position A257, H/C at position W260, G at position Q263, L at position A264, I at position T265, G/S/A at position D266, T at position A267, L at position N269 and/or truncation after N269.
  • The polypeptide may additionally comprise amino acid modifications such as insertions or deletions. Also, the N- or C-terminus may be modified, e.g. by truncating residues in SEQ ID NO: 2 after position 269 or by extending the C-terminal of SEQ ID NO: 2 with WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS. The C-terminal may be truncated after position 272, 273, 274 or 286 in SEQ ID NO: 1. The N-terminal may have a peptide extension, e.g. as described in WO 0032758 or WO 9704079, such as the addition of the amino acid residues SPIRR.
  • A similar amino acid substitution or deletion may be made in other fungal lipolytic enzymes, e.g. SEQ ID NO: 3-14 at a corresponding position. The corresponding positions may be found by aligning a given sequence with SEQ ID NO: 1 or 2, e.g. as shown in FIG. 1. The alignment may be done by use of the GAP program as described below.
  • The variant polypeptide may have improved thermostability compared to the parent polypeptide, particularly a variant polypeptide having a substitution at a position corresponding to A29 or K33 of SEQ ID NO: 1, e.g. the substitution A29P or K33N.
  • Sequence Identity
  • The variant polypeptide has at least 80% identity to SEQ ID NO: 1 or 2, particularly at least 85%, at least 90%, at least 95%, or at least 98%. The degree of identity between two sequences may be suitably determined by means of computer programs known in the art, such as GAP provided in the GCG program package (Program Manual for the Wisconsin Package, Version 8, August 1994, Genetics Computer Group, 575 Science Drive, Madison, Wis., USA 53711) (Needleman, S. B. and Wunsch, C. D., (1970), Journal of Molecular Biology, 48, 443-45), using GAP with the following settings for polypeptide sequence comparison: GAP creation penalty of 3.0 and GAP extension penalty of 0.1.
  • Dough Stickiness
  • The variant polypeptide may be tested by adding it to a dough and evaluating the dough stickiness. The dough may be generated according to a typical European straight dough procedure, a typical American sponge & dough procedure or any other bread making procedures. The polypeptide may be added at a dosage of 0.01-10 mg enzyme protein per kg flour, and the dough stickiness may be evaluated directly after mixing or at any point during processing. Of particular importance is the dough stickiness of the finally mixed dough, i.e. at the time where the dough runs through processing equipment such as divider, molder, sheeter and conveyer belts. The mixing time varies depending on procedure. For a typical European straight dough procedure, the mixing time can e.g. be in the range of 6-10 minutes. For a typical American Sponge & dough procedure the mixing time can e.g. be in the range of 6-20 minutes (on final dough). The dough may have a resting period of 5-20 min before further processing, e.g. at 20-35° C. The dough stickiness may be evaluated by hand by trained bakers, by a sensory panel or by instrumental measurements e.g. by the Chen-Hoseney dough stickiness rig developed for Stable Micro Systems TA-XT2 texture analyser, commercially available from Brookfield Engineering Laboratories, Inc.
  • Hydrolytic Activity towards Ester Bonds in Polar Lipids
  • The parent and variant polypeptides have lipolytic enzyme activity, i.e. they have hydrolytic activity towards an ester bond and are classified in EC 3.1.1 Carboxylic Ester Hydrolases according to Enzyme Nomenclature (available at http://www.chem.qmw.ac.uk/iubmb/enzyme). More specifically, they have hydrolytic activity towards ester bonds in polar lipids so as to split off acyl groups at the sn-1 and/or sn-2 position of polar lipids such as phospholipids and galactolipids. Accordingly, they may have phospholipase activity or galactolipase activity (EC 3.1.1.26), e.g. phospholipase A1 activity (EC 3.1.1.32).
  • Phospholipase activity may be determined by known methods, e.g. the “monolayer phospholipase assay” or the plate assay described in WO 0032758. Galactolipase activity may be determined with digalactosyl diglyceride as substrate, e.g. as described in WO 0032758.
  • Use of Polypeptide
  • The polypeptide may be added to a dough, and the dough may be used to prepare a steamed bread, a baked product (particularly bread), pasta or noodles. The addition of the polypeptide may lead to improved dough stabilization, i.e. a larger loaf volume of the baked product and/or a better shape retention and volume during processing and baking, particularly in a stressed system, e.g. in the case of over-proofing or over-mixing. It may also lead to a lower initial firmness and/or a more uniform and fine crumb, improved crumb structure (finer crumb, thinner cell walls, more rounded cells), of the baked product, and it may further improve dough properties, e.g. a less soft dough, higher elasticity and/or lower extensibility.
  • The process may be conducted in analogy with U.S. Pat. No. 5,578,489 or U.S. Pat. No. 6,077,336. In the case of un-proofed frozen dough the polypeptides of the invention perform better than known lipolytic enzyme variants in terms of volume and crumb structure.
  • The polypeptide can be used in a process for making bread, comprising adding the polypeptide to the ingredients of a dough, kneading the dough and baking the dough to make the bread. This can be done in analogy with U.S. Pat. No. 4,567,046 (Kyowa Hakko), JP-A 60-78529 (QP Corp.), JP-A 62-111629 (QP Corp.), JP-A 63-258528 (QP Corp.), EP 426211 (Unilever) or WO 99/53769 (Novozymes).
  • The composition of a typical dough can be found in WO 99/53769.
  • The polypeptide of the invention may be added together with an anti-staling amylase and optionally also a phospholipid as described in WO 9953769, particularly a maltogenic alpha-amylase (e.g. from Bacillus sp., such as Novamyl® from Novo Nordisk). Also, a fungal or bacterial α-amylase may be added, e.g. from Aspergillus or Bacillus, particularly A. oryzae, B. licheniformis or B. amyloliquefaciens. Optionally an additional enzyme may be added, e.g. an amyloglucosidase, a beta-amylase, a pentosanase such as a xylanase as described in WO 99/53769, e.g. derived from Aspergillus, in particular of A. aculeatus, A. niger (cf. WO 91/19782), A. awamori (WO 91/18977), or A. tubigensis (WO 92/01793), from a strain of Trichoderma, e.g. T. reesei, or from a strain of Humicula, e.g. H. insolens (WO 92/17573), a proteiase and/or a glucose oxidase.
  • The dough may further comprise an emulsifier such as mono- or diglycerides, diacyl tartaric acid esters of mono- or diglycerides, sugar esters of fatty acids, polyglycerol esters of fatty acids, lactic esters of monoglycerides, acetic acid esters of monoglycerides, polyoxyethylene stearates, polysorbates or lysolecithin.
  • The dough may also comprise other conventional dough ingredients, e.g.: proteins, such as milk powder, gluten, and soy; eggs (either whole eggs, egg yolks or egg whites); an oxidant such as ascorbic acid, potassium bromate, potassium iodate, azodicarbonamide (ADA) or ammonium persulfate; an amino acid such as L-cysteine; a sugar; a salt such as sodium chloride, calcium acetate, sodium sulfate or calcium sulfate.
    • EXAMPLES
  • Baking Evaluation of Polypeptides with Phospholipase Activity
  • In the examples, polypeptides according to the invention were tested together with the corresponding parent polypeptide in a baking evaluation experiment by using conventional baking protocols for European straight dough procedure and US sponge & dough procedure, as follows:
  • European Straight Dough Procedure:
  • A dough is prepared by mixing the below ingredients for 3 minutes slow and 7 minutes fast.
    % (baker's - by weight)
    Flour 100
    Compressed yeast 4
    Salt 1.5
    Sugar 1.5
    Water 62
    Ascorbic acid 40 ppm
  • Dough stickiness is evaluated right after mixing and again after a resting period of 15 minutes. Dough stickiness is evaluated by a trained and experienced bakers by sensory evaluation by hand. Dough stickiness is a measure of how sticky the dough feels and is expressed on a scale from 0 (little stickiness) to 10 (very sticky). The dough with the variant is compared to a reference dough, which is always given the score 5.
  • Sponge & Dough Procedure:
    Sponge Dough
    % (baker's - by weight) % (baker's - by weight)
    Flour 60 40
    Compressed yeast 7.5
    Oil 2.5
    Salt 2
    High fructose syrup 12
    Water 34.4 20.4
    Ascorbicc acid 50
  • A liquid sponge is prepared by mixing a sponge consisting of the above listed sponge ingredients for 1 minute slow and 4 minutes fast. The sponge is fermented for 3 hours at 27 C, 86% RH. The sponge is mixed with the dough ingredients listed above and with enzymes for 1 minutes slow and 18 minutes fast.
  • Dough stickiness is evaluated right after mixing, whereafter the dough is extruded on a rebuild pasta-machine to simulate the dough extrusion used for dough dividing in US. Dough stickiness is evaluated again after extrusion. Dough stickiness is evaluated by a trained and experienced bakers by sensory evaluation by hand. Dough stickiness is a measure of how sticky the dough feels and is expressed on a scale from 0 (little stickiness) to 10 (very sticky). The dough with the variant polypeptide is compared to a reference dough made with the parent polypeptide, which is always given the score 5.
    • Example 1 Construction of Polypeptides
  • Polypeptides according to the invention were prepared as described in WO 00/32758. The polypeptides were derived from SEQ ID NO: 15 by making the following amino acid modifications.
    Polypeptide Amino acid alterations compared to SEQ ID NO: 15
    1 G91A +D96W +E99K +P256M +G263Q +L264A +I265T +G266D +T267A
    +L269N +270A +271G +272G +273F +274S
    +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
    2 G91A +D96W +E99K +P256N +G263Q +L264A +I265T +G266D +T267A
    +L269N +270A +271G +272G +273F +274S
    +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
    3 G91A +D96W +E99K +P256V +G263Q +L264A +I265T +G266D +T267A
    +L269N +270A +271G +272G +273F +274S
    +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
    4 G91A +D96W +E99K +N247S +N248D +Q249K +N251T +P253M +D254S
    +P256L +A257A +G263Q +L264A +I265T +G266D +T267A +L269N
    5 G91A +D96W +E99K +N247S +N248D +Q249R +P250T +N251T +P253M
    +D254W +P256V +A257G +G263Q +L264A +I265T +G266D +T267A
    +L269N
    6 G91A +D96W +E99K +P256T +G263Q +L264A +I265T +G266D +T267A
    +L269N +270A +271G +272G +273F +274S
    +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
    7 G91A +D96W +E99K +P256A +G263Q +L264A +I265T +G266D +T267A
    +L269N +270A +271G +272G +273F +274S
    +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
    8 G91A +D96W +E99K +G240D +P256C +G263Q +L264A +I265T +G266D
    +T267A +L269N +270A +271G +272G +273F +274S
    +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
    9 G91A +D96W +E99K +P256G +G263Q +L264A +I265T +G266D +T267A
    +L269N +270A +271G +272G +273F +274S
    +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
    10 G91A +D96W +E99K +P256R +G263Q +L264A +I265T +G266D +T267A
    +L269N +270A +271G +272G +273F +274S
    +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
    11 G91A +D96W +E99K +P256Q +G263Q +L264A +I265T +G266D +T267A
    +L269N +270A +271G +272G +273F +274S
    +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
    12 G91A +D96W +E99K +P256K +G263Q +L264A +I265T +G266D +T267A
    +L269N +270A +271G +272G +273F +274S
    +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
    13 G91A +D96W +E99K +P256L +G263Q +L264A +I265T +G266D +T267A
    +L269N +270A +271G +272G +273F +274S
    +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
    14 G91A +D96W +E99K +P256D +G263Q +L264A +I265T +G266D +T267A
    +L269N +270A +271G +272G +273F +274S
    +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
    15 R84E +G91A +D96W +E99K +P256V +G263Q +L264A +I265T +G266D
    +T267A +L269N +270A +271G +272G +273F +274S
    +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
    16 R84M +G91A +D96W +E99K +P256V +G263Q +L264A +I265T +G266D
    +T267A +L269N +270A +271G +272G +273F +274S
    +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
    17 R84P +G91A +D96W +E99K +P256V +G263Q +L264A +I265T +G266D
    +T267A +L269N +270A +271G +272G +273F +274S
    +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
    18 R84S +G91A +D96W +E99K +P256V +G263Q +L264A +I265T +G266D
    +T267A +L269N +270A +271G +272G +273F +274S
    +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
    19 G91A +D96W +E99K +P250K +N251T +I252F +P253R +D254Y +I255L
    +P256del +G263Q +L264A +I265T +G266D +T267A +L269N +270A +271G
    +272G +273F +274S
    +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
    • Example 2 Baking Evaluation of a Polypeptide According to the Invention
  • 5 variant polypeptides according to the invention were compared to the parent polypeptide (SEQ ID NO: 2) in the European straight dough procedure described above. 40 ppm Fungamyl Super MA (a blend of fungal alpha-amylase and xylanase) was added as background to all doughs. The parent enzyme and the variants were dosed at their optimal level, i.e. the level giving best volume and dough stabilising effect. The below results show that all 5 variants give reduced dough stickiness compared to the parent polypeptide.
    Polypeptide Parent P256V P256A P256Q P256L P256W
    Dough
    6 5 5 5 5 5
    stickiness after
    mixing
    Dough 6 5 5 5 5 5
    stickiness after
    15 min table
    time
  • 3 variant polypeptides according to the invention were compared to the parent polypeptide (SEQ ID NO: 1) in the European straight dough procedure described above. 40 ppm Fungamyl Super MA (a blend of fungal alpha-amylase and xylanase) was added as background to all doughs. The parent enzyme and the variants were dosed at their optimal level, i.e. the level giving best volume and dough stabilising effect. The below results show that all 4 variants give reduced dough stickiness compared to the parent enzyme
    Polypeptide Parent A29P+K33N+I83T A29P+K33N+I83H A29P+K33N+I83Q
    Dough stickiness
    5 4 4 4
    after mixing
    Dough stickiness 5 4 4 4
    after 15 min table
    time
  • 4 variant polypeptides according to the invention were compared to the parent enzyme (SEQ ID NO: 1) in the European straight dough procedure described above. 10FAU Fungamyl/kg was added as background to all doughs. The parent enzyme and the variants were dosed at their optimal level, i.e. the level giving best volume and dough stabilising effect. The below results show that all 4 variants give reduced dough stickiness compared to the parent enzyme
    Polypeptide Parent A29P + K33N A29P + I83N K33N + I83E K33N + I83K
    Dough stickiness
    7 6 6 6 6
    after mixing
    Dough stickiness 7 6 6 6 6
    after 15 min table
    time
  • A variant polypeptide according to the invention was compared to its parent enzyme (SEQ ID NO: 1) in the US sponge & dough procedure described above. 40 ppm Fungamyl Super MA (a blend of fungal alpha-amylase and xylanase) was added as background to all doughs. The parent enzyme and the variant were dosed at their optimal level, i.e. the level giving best volume and dough stabilising effect. The below results show that the variant gives reduced dough stickiness compared to the parent enzyme
    Polypeptide Parent A29P+I83N
    Dough stickiness after 6 5
    mixing
    Dough stickiness after 6.5 5
    extrusion
    • Example 3 Variant Polypeptides Derived from SEQ ID NO: 1
  • Variant polypeptides with the following amino acid alterations compared SEQ ID NO: 1 (lipase/phosapholipase from F. oxysporum) were prepared and tested by adding each polypeptide to a dough. The polypeptide with unmodified SEQ ID NO: 1 was also tested, for comparison.
    A29P
    K33N
    A29P +I83T
    A29P +I83N
    A29P +I83C
    A29P +I83F
    A29P +I83L
    K33N +I83W
    K33N +I83L
    K33N +I83Q
    K33N +I83S
    K33N +I83N
    K33N +I83N
    K33N +I83R
    K33N +I83L
    K33N +270VASLGDDTEAPRASTRGPP
    A29P +I83N +A255V
  • The results were that with each of the above polypeptides, dough stickiness was better than with the polypeptide with the unmodified sequence of SEQ ID NO: 1.
  • Baking tests with each dough showed that all polypeptides improved the crumb structure, the loaf volume and the dough stability, both for the modified and unmodified sequences.
    • Example 4 Variant Polypeptides Derived from SEQ ID NO: 2
  • Variant polypeptides with the following amino acid alterations compared SEQ ID NO: 2 (variant of T. lanuginosus lipase) were prepared and tested by adding each polypeptide to a dough. The polypeptide with unmodified SEQ ID NO: 2 was also tested for comparison.
    R84D
    R84I
    R84M
    R84Q
    P256A
    P256D
    P256I
    P256L
    P256Q
    P256S
    P256V
  • The results were that with each of the above polypeptides, dough stickiness was better than with the polypeptide with the unmodified sequence of SEQ ID NO: 2.
  • Baking tests with each dough showed that all polypeptides improved the crumb structure, the loaf volume and the dough stability, both for the modified and unmodified sequences.

Claims (21)

1-14. (canceled)
15. A method of producing a polypeptide, comprising:
a) selecting an amino acid sequence for a fungal lipolytic enzyme,
b) selecting an amino acid residue in the sequence which corresponds to A29, K33, I83 or A255 of SEQ ID NO: 1,
c) modifying the amino acid sequence by substituting or deleting the selected residue,
d) preparing a polypeptide having the modified amino acid sequence, and
e) adding the polypeptide to a dough and testing dough stickiness.
16. The method of claim 15, which further comprises testing hydrolytic activity of the polypeptide towards ester bonds in polar lipids and selecting a polypeptide which has such activity.
17. A method of producing a dough, comprising:
a) preparing a variant lipolytic enzyme which comprises an amino acid sequence which has at least 80% identity to SEQ ID NO: 1 or SEQ ID NO:2 and a substitution or deletion of an amino acid residue which corresponds to amino acid residues A29, K33, I83 or A255 of SEQ ID NO: 1, and
b) adding the variant lipolytic enzyme to a dough.
18. The method of claim 17, wherein said method further comprises baking the dough.
19. The method of claim 17, wherein said method comprises preparing a variant lipolytic enzyme which comprises an amino acid sequence which has at least 85% identity to SEQ ID NO:1 or SEQ ID NO:2.
20. The method of claim 17, wherein said method comprises preparing a variant lipolytic enzyme which comprises an amino acid sequence which has at least 90% identity to SEQ ID NO:1 or SEQ ID NO:2.
21. The method of claim 17, wherein said method comprises preparing a variant lipolytic enzyme which comprises an amino acid sequence which has at least 95% identity to SEQ ID NO:1 or SEQ ID NO:2.
22. The method of claim 17, wherein said method comprises preparing a variant lipolytic enzyme which comprises an amino acid sequence which has at least 98% identity to SEQ ID NO:1 or SEQ ID NO:2.
23. The method of claim 17, wherein said variant lipolytic enzyme has phospholipase activity or galactolipase activity (EC 3.1.1.26).
24. A polypeptide which has hydrolytic activity towards an ester bond in a polar lipid, and comprises an amino acid sequence which
i) has at least 80% identity to SEQ ID NO: 1 and has a different amino acid as compared to a position corresponding to A29, K33, I83 or A255 of SEQ ID NO:1 or an amino acid deletion at a position corresponding to A29, K33, I83 or A255 of SEQ ID NO:1, or
ii) has at least 80% identity to SEQ ID NO: 2 and has a different amino acid as compared to a position corresponding to A29, K33, I83 or A255 of SEQ ID NO:1 or an amino acid deletion at a position corresponding to R84 or P256 (using SEQ ID NO:1 for numbering).
25. The polypeptide of claims 24, wherein the polypeptide has phospholipase activity or galactolipase activity (EC 3.1.1.26).
26. The polypeptide of claim 24, wherein the amino acid at the position corresponding to A29 of SEQ ID NO: 1 is P.
27. The polypeptide of claim 24, wherein the amino acid at the position corresponding to K33 of SEQ ID NO: 1 is N.
28. The polypeptide of claim 24, wherein the amino acid at the position corresponding to I83 of SEQ ID NO: 1 is N/C/W.
29. The polypeptide of claim 24, which consists of amino acids 1-272, 1-273, 1-274 or 1-286 of SEQ ID NO: 1 with the following substitutions:
A29P K33N A29P +I83T A29P +I83N A29P +I83C A29P +I83F A29P +I83L K33N +I83W K33N +I83L K33N +I83Q K33N +I83S K33N +I83N K33N +I83R K33N +I83L K33N +270VASLGDDTEAPRASTRGPP A29P +I83N +A255V
30. The polypeptide of claim 24, wherein the amino acid at the position corresponding to R84 of SEQ ID NO: 2 is L/M/Q/I/D.
31. The polypeptide of claim 24, wherein the amino acid at the position corresponding to P256 of SEQ ID NO: 2 is V/Q/A/D/S/I.
32. The polypeptide of claim 24, wherein the polypeptide consists of SEQ ID NO: 2 with the following substitutions:
R84D R84I R84M R84Q P256A P256D P256I P256L P256Q P256S P256V
33. The polypeptide of any of claim 24, wherein said polypeptide as compared to SEQ ID NO: 2 has the amino acid A/T at position D62, G/T at position A91, D/F/S/G at position W96, E at position K99, G at position S158, D at position G240, S at position N247, D at position N248, K/R at position Q249, K/T at position P250, T at position N251, F at position I252, M/R at position P253, S/Y/W at position D254, L at position I255, G at position A257, H/C at position W260, G at position Q263, L at position A264, I at position T265, G/S/A at position D266, T at position A267, L at position N269 and/or is truncated after N269.
34. A polynucleotide encoding the polypeptide of claim 26.
US10/556,511 2003-05-09 2004-04-29 Variant lipolytic enzymes Active 2024-09-29 US7465570B2 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
US10/556,511 US7465570B2 (en) 2003-05-09 2004-04-29 Variant lipolytic enzymes
US12/169,679 US7638317B2 (en) 2003-05-09 2008-07-09 Lipolytic enzymes variants

Applications Claiming Priority (9)

Application Number Priority Date Filing Date Title
US46922803P 2003-05-09 2003-05-09
DKPA200300709 2003-05-09
DKPA200300709 2003-05-09
US47488103P 2003-05-30 2003-05-30
DKPA200300811 2003-05-30
DK200300811 2003-05-30
US47964703P 2003-06-19 2003-06-19
US10/556,511 US7465570B2 (en) 2003-05-09 2004-04-29 Variant lipolytic enzymes
PCT/DK2004/000292 WO2004099400A2 (en) 2003-05-09 2004-04-29 Variant lipolytic ensymes

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
PCT/DK2004/000292 A-371-Of-International WO2004099400A2 (en) 2003-05-09 2004-04-29 Variant lipolytic ensymes

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US12/169,679 Division US7638317B2 (en) 2003-05-09 2008-07-09 Lipolytic enzymes variants

Publications (3)

Publication Number Publication Date
US20060228446A1 US20060228446A1 (en) 2006-10-12
US7465570B2 US7465570B2 (en) 2008-12-16
US20080311242A9 true US20080311242A9 (en) 2008-12-18

Family

ID=43500457

Family Applications (3)

Application Number Title Priority Date Filing Date
US10/556,511 Active 2024-09-29 US7465570B2 (en) 2003-05-09 2004-04-29 Variant lipolytic enzymes
US12/169,679 Expired - Lifetime US7638317B2 (en) 2003-05-09 2008-07-09 Lipolytic enzymes variants
US12/612,398 Active 2024-12-17 US8298800B2 (en) 2003-05-09 2009-11-04 Lipolytic enzyme variants

Family Applications After (2)

Application Number Title Priority Date Filing Date
US12/169,679 Expired - Lifetime US7638317B2 (en) 2003-05-09 2008-07-09 Lipolytic enzymes variants
US12/612,398 Active 2024-12-17 US8298800B2 (en) 2003-05-09 2009-11-04 Lipolytic enzyme variants

Country Status (6)

Country Link
US (3) US7465570B2 (en)
EP (4) EP1625216B1 (en)
AU (2) AU2004236305B2 (en)
CA (1) CA2523400C (en)
DK (3) DK2270139T3 (en)
WO (1) WO2004099400A2 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20080023160A1 (en) * 2001-05-21 2008-01-31 Novozymes A/S Enzymatic hydrolysis of a polymer comprising vinyl acetate monomer

Families Citing this family (40)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DK2270139T3 (en) * 2003-05-09 2016-11-07 Novozymes As Lipolytic Enzyme Variants
CN105112386A (en) 2006-12-21 2015-12-02 诺维信公司 Lipase variants for pharmaceutical use
EP2440656A1 (en) * 2009-06-10 2012-04-18 Novozymes A/S Phospholipases and methods of using same
CA2766009A1 (en) * 2009-06-25 2010-12-29 Danisco A/S Variant lipolytic enzymes with improved expression, functionality and/or activity
EP2343310A1 (en) 2010-01-08 2011-07-13 Novozymes A/S Serine hydrolase formulation
WO2011134809A1 (en) 2010-04-26 2011-11-03 Novozymes A/S Enzyme granules
JP6002381B2 (en) * 2010-12-07 2016-10-05 三菱化学フーズ株式会社 Process for producing flour products containing glyceroglycolipid lipase
WO2012098114A1 (en) 2011-01-21 2012-07-26 Novozymes A/S Production of fatty acid alkyl esters
US9422584B2 (en) 2011-02-04 2016-08-23 Novozymes A/S Fatty acid esterification process
CN103459607A (en) 2011-03-30 2013-12-18 诺维信公司 Esterification process
WO2012140075A2 (en) 2011-04-15 2012-10-18 Novozymes A/S Method for production of brewers wort
MX351761B (en) 2011-06-20 2017-10-26 Novozymes As Particulate composition.
EP2847316A1 (en) 2012-05-11 2015-03-18 Novozymes A/S A brewing method
AU2013328953A1 (en) 2012-10-12 2015-03-26 Danisco Us Inc. Compositions and methods comprising a lipolytic enzyme variant
CN104718289A (en) 2012-10-17 2015-06-17 诺维信公司 Method for production of brewers wort
BR112015024119B1 (en) * 2013-03-21 2022-12-27 Novozymes A/S POLYPEPTIDES HAVING PHOSPHOLIPASE A ACTIVITY AND POLYNUCLEOTIDES ENCODING THEM
EP3696264B1 (en) * 2013-07-19 2023-06-28 Danisco US Inc. Compositions and methods comprising a lipolytic enzyme variant
EP3117001B1 (en) 2014-03-12 2019-02-20 Novozymes A/S Polypeptides with lipase activity and polynucleotides encoding same
US10030215B2 (en) 2014-04-15 2018-07-24 Novozymes A/S Polypeptides with lipase activity and polynucleotides encoding same
EP3760713A3 (en) * 2014-05-27 2021-03-31 Novozymes A/S Lipase variants and polynucleotides encoding same
DK3166411T3 (en) 2014-07-07 2021-03-15 Novozymes As Dough with a lipolytic enzyme and / or xylanase and a monooxygenase
US11124808B2 (en) * 2014-08-28 2021-09-21 Renescience A/S Solubilization of MSW with blend enzymes
MY188051A (en) 2015-10-09 2021-11-15 Novozymes As Enzymatic or non-enzymatic biodiesel polishing process
DE102015224576A1 (en) * 2015-12-08 2017-06-08 Henkel Ag & Co. Kgaa Lipases with increased thermostability
MX2019007375A (en) 2016-12-21 2019-09-18 Dsm Ip Assets Bv Lipolytic enzyme variants.
WO2018114912A1 (en) * 2016-12-21 2018-06-28 Dsm Ip Assets B.V. Lipolytic enzyme variants
WO2018114938A1 (en) * 2016-12-21 2018-06-28 Dsm Ip Assets B.V. Lipolytic enzyme variants
US10918113B2 (en) 2016-12-21 2021-02-16 Dsm Ip Assets B.V. Lipolytic enzyme variants
MX2019009551A (en) * 2017-02-20 2020-01-30 Novozymes As Lipolytic enzyme for use in baking.
EP4248757A3 (en) * 2017-12-19 2023-12-06 DuPont Nutrition Biosciences ApS Improved enzymatic modification of phospholipids in food
CN108504643A (en) * 2018-05-31 2018-09-07 华南理工大学 It is a kind of from partial glyceride lipase of aspergillus oryzae and preparation method thereof and crystal structure
MX2020014191A (en) * 2018-06-19 2021-03-09 Dsm Ip Assets Bv Lipolytic enzyme variants.
EP3937642A1 (en) 2019-03-13 2022-01-19 Novozymes A/S Production of par-baked products with improved freshness employing combination of gh8 xylanase and phospholipase
CN115697066A (en) 2020-05-29 2023-02-03 诺维信公司 Legume and/or legume protein fortified dough and baked products comprising lipase
WO2023225459A2 (en) 2022-05-14 2023-11-23 Novozymes A/S Compositions and methods for preventing, treating, supressing and/or eliminating phytopathogenic infestations and infections
EP4334467A1 (en) 2021-05-04 2024-03-13 Novozymes A/S Enzymatic treatment of feedstock for hydrotreated vegetable oil (hvo) production
WO2023203080A1 (en) 2022-04-20 2023-10-26 Novozymes A/S Process for producing free fatty acids
WO2024046594A1 (en) 2022-09-01 2024-03-07 Novozymes A/S Baking with thermostable amg glucosidase variants (ec 3.2.1.3) and low or no added emulsifier
WO2024079301A1 (en) 2022-10-14 2024-04-18 Novozymes A/S Process for selective hydrolysis of diglycerides in an oil/fat with aid of candida antarctica lipase b
WO2024088550A1 (en) 2022-10-24 2024-05-02 Novozymes A/S Baking method for pulse protein fortified bread employing thermostable amyloglucosidase variante (ec 3.2.1.3)

Family Cites Families (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPS6030488B2 (en) 1982-11-10 1985-07-17 協和醗酵工業株式会社 Fabric improvers and fabrics containing them
JPS6078529A (en) 1983-10-07 1985-05-04 協和醗酵工業株式会社 Dough sheet
JPS62111629A (en) 1985-11-09 1987-05-22 キユーピー株式会社 Production of cake
JPS63258528A (en) 1987-04-15 1988-10-26 キユーピー株式会社 Production of sponge cake
EP0426211B1 (en) 1989-09-29 1993-11-24 Unilever N.V. Food product containing dried lyso-phospholipoprotein
DE4017150A1 (en) 1990-05-28 1991-12-05 Henkel Kgaa PROCESS FOR PREPARING A BACKACTIVE PENTOSANASE PREPARATION
NL9001388A (en) 1990-06-19 1992-01-16 Unilever Nv RECOMBINANT DNA, CELL CONTAINING DERIVED DNA, ENZYME FOR WHICH THE RECOMBINANT CODES DNA AND USES THEREOF.
IE912582A1 (en) 1990-07-24 1992-01-29 Gist Brocades Nv Cloning and expression of xylanase genes from fungal origin
CA2106484A1 (en) 1991-04-02 1992-10-03 Martin Schulein Xylanase, corresponding recombinant dna sequence, xylanase containing agent, and use of the agent
ATE326572T1 (en) 1991-12-20 2006-06-15 Novozymes As REMOVAL OF HYDROPHOBIC ESTERS FROM TEXTILES
DE69633825T2 (en) 1995-07-14 2005-11-10 Novozymes A/S Modified enzyme with lipolytic activity
EP0839224A1 (en) 1995-07-19 1998-05-06 Novo Nordisk A/S Treatment of fabrics
CN1148442C (en) * 1996-12-09 2004-05-05 诺维信公司 Reduction of phosphorus containing components in edible oils comprising high amount of non-hydratable phosphorus by use of phospholipase from filamentous fungus having phospholipase A and/or B activit
DK1073339T4 (en) 1998-04-20 2008-08-18 Novozymes As Manufacture of dough and baked products
US6077336A (en) 1998-07-15 2000-06-20 Ulrich; Marcia A. Air filter system
DK1131416T3 (en) * 1998-11-27 2009-10-26 Novozymes As Lipolytic Enzyme Variants
ATE471377T1 (en) 2000-04-28 2010-07-15 Novozymes As VARIANT OF A LIPOLYTIC ENZYME
EP2287296A1 (en) * 2000-06-26 2011-02-23 Novozymes A/S Lipolytic enzyme
EP1352057B1 (en) 2001-01-10 2009-03-25 Novozymes A/S Lipolytic enzyme variant
CA2467415C (en) * 2002-01-16 2014-03-11 Novozymes A/S Lipolytic enzyme variants and method for their production
DK2270139T3 (en) * 2003-05-09 2016-11-07 Novozymes As Lipolytic Enzyme Variants

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20080023160A1 (en) * 2001-05-21 2008-01-31 Novozymes A/S Enzymatic hydrolysis of a polymer comprising vinyl acetate monomer
US7951267B2 (en) * 2001-05-21 2011-05-31 Kim Borch Enzymatic hydrolysis of a polymer comprising vinyl acetate monomer

Also Published As

Publication number Publication date
EP2270139B1 (en) 2016-07-27
EP2270139A2 (en) 2011-01-05
US20100047388A1 (en) 2010-02-25
EP2270140A3 (en) 2011-11-30
CA2523400A1 (en) 2004-11-18
US7638317B2 (en) 2009-12-29
US20080293120A1 (en) 2008-11-27
EP1625216B1 (en) 2012-11-21
EP2270140A2 (en) 2011-01-05
DK1625216T3 (en) 2013-03-18
US8298800B2 (en) 2012-10-30
EP1625216A2 (en) 2006-02-15
DK2270139T3 (en) 2016-11-07
EP2290057A3 (en) 2011-08-03
WO2004099400A2 (en) 2004-11-18
DK2270140T3 (en) 2016-03-14
EP2270139A3 (en) 2011-11-23
AU2010246333A1 (en) 2010-12-09
EP2270140B1 (en) 2015-12-16
AU2004236305B2 (en) 2010-08-19
US7465570B2 (en) 2008-12-16
CA2523400C (en) 2015-03-17
WO2004099400A3 (en) 2004-12-16
AU2004236305A1 (en) 2004-11-18
EP2290057A2 (en) 2011-03-02
AU2010241524B2 (en) 2013-01-31
AU2010241524A1 (en) 2010-12-09
US20060228446A1 (en) 2006-10-12

Similar Documents

Publication Publication Date Title
US7465570B2 (en) Variant lipolytic enzymes
US9115346B2 (en) Lipolytic enzymes
US11162086B2 (en) Lipase enzymes
US9247753B2 (en) Preparation of dough or baked products
US10993446B2 (en) Baking lipase and methods of use
MXPA02005452A (en) Method of improving dough and bread quality.
AU2008200576A1 (en) Lipolytic enzyme variants and method for their production
AU2001272359B2 (en) Method of preparing a dough or a baked product made from a dough, with addition of lipolytic enzymes
AU2001272359A1 (en) Method of preparing a dough or a baked product made from a dough, with addition of lipolytic enzymes

Legal Events

Date Code Title Description
AS Assignment

Owner name: NOVOZYMES A/S, DENMARK

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:BORCH, KIM;ERLANDSEN, LUISE;VIND, JESPER;AND OTHERS;REEL/FRAME:018406/0390;SIGNING DATES FROM 20050922 TO 20050929

Owner name: NOVOZYMES A/S, DENMARK

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:BORCH, KIM;ERLANDSEN, LUISE;VIND, JESPER;AND OTHERS;SIGNING DATES FROM 20050922 TO 20050929;REEL/FRAME:018406/0390

STCF Information on status: patent grant

Free format text: PATENTED CASE

FPAY Fee payment

Year of fee payment: 4

FPAY Fee payment

Year of fee payment: 8

MAFP Maintenance fee payment

Free format text: PAYMENT OF MAINTENANCE FEE, 12TH YEAR, LARGE ENTITY (ORIGINAL EVENT CODE: M1553); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY

Year of fee payment: 12