US20050249728A1 - Anti-IGF-I receptor antibody - Google Patents
Anti-IGF-I receptor antibody Download PDFInfo
- Publication number
- US20050249728A1 US20050249728A1 US10/932,334 US93233404A US2005249728A1 US 20050249728 A1 US20050249728 A1 US 20050249728A1 US 93233404 A US93233404 A US 93233404A US 2005249728 A1 US2005249728 A1 US 2005249728A1
- Authority
- US
- United States
- Prior art keywords
- antibody
- igf
- receptor
- cells
- antibodies
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 102000005962 receptors Human genes 0.000 title description 52
- 108020003175 receptors Proteins 0.000 title description 52
- 239000000556 agonist Substances 0.000 claims abstract description 8
- 230000027455 binding Effects 0.000 claims description 65
- 241001529936 Murinae Species 0.000 claims description 59
- 230000002401 inhibitory effect Effects 0.000 claims description 17
- 239000000427 antigen Substances 0.000 claims description 11
- 102000036639 antigens Human genes 0.000 claims description 11
- 108091007433 antigens Proteins 0.000 claims description 11
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 9
- 108060003951 Immunoglobulin Proteins 0.000 claims description 5
- 102000018358 immunoglobulin Human genes 0.000 claims description 5
- 239000005557 antagonist Substances 0.000 claims description 4
- 230000003993 interaction Effects 0.000 claims description 3
- 108010031794 IGF Type 1 Receptor Proteins 0.000 abstract description 117
- 102000004218 Insulin-Like Growth Factor I Human genes 0.000 abstract description 79
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 abstract description 79
- 206010028980 Neoplasm Diseases 0.000 abstract description 60
- 230000012010 growth Effects 0.000 abstract description 52
- 239000003814 drug Substances 0.000 abstract description 44
- 229940124597 therapeutic agent Drugs 0.000 abstract description 38
- 238000011282 treatment Methods 0.000 abstract description 38
- 108010021625 Immunoglobulin Fragments Proteins 0.000 abstract description 34
- 102000008394 Immunoglobulin Fragments Human genes 0.000 abstract description 34
- 210000002966 serum Anatomy 0.000 abstract description 31
- 239000012634 fragment Substances 0.000 abstract description 28
- 230000004083 survival effect Effects 0.000 abstract description 28
- 210000004881 tumor cell Anatomy 0.000 abstract description 22
- 102000048143 Insulin-Like Growth Factor II Human genes 0.000 abstract description 21
- 108090001117 Insulin-Like Growth Factor II Proteins 0.000 abstract description 21
- 206010006187 Breast cancer Diseases 0.000 abstract description 17
- 208000026310 Breast neoplasm Diseases 0.000 abstract description 17
- 239000002254 cytotoxic agent Substances 0.000 abstract description 17
- 230000000694 effects Effects 0.000 abstract description 16
- 229940127089 cytotoxic agent Drugs 0.000 abstract description 14
- 231100000599 cytotoxic agent Toxicity 0.000 abstract description 11
- 206010009944 Colon cancer Diseases 0.000 abstract description 10
- 206010058467 Lung neoplasm malignant Diseases 0.000 abstract description 10
- 208000029742 colonic neoplasm Diseases 0.000 abstract description 9
- 201000005202 lung cancer Diseases 0.000 abstract description 9
- 208000020816 lung neoplasm Diseases 0.000 abstract description 9
- 206010061902 Pancreatic neoplasm Diseases 0.000 abstract description 7
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 abstract description 7
- 201000002528 pancreatic cancer Diseases 0.000 abstract description 7
- 208000008443 pancreatic carcinoma Diseases 0.000 abstract description 7
- 206010033128 Ovarian cancer Diseases 0.000 abstract description 6
- 206010060862 Prostate cancer Diseases 0.000 abstract description 5
- 208000000236 Prostatic Neoplasms Diseases 0.000 abstract description 5
- 238000003384 imaging method Methods 0.000 abstract description 3
- 238000003745 diagnosis Methods 0.000 abstract description 2
- 206010042863 synovial sarcoma Diseases 0.000 abstract description 2
- 102000038455 IGF Type 1 Receptor Human genes 0.000 abstract 3
- 210000004027 cell Anatomy 0.000 description 172
- 102100039688 Insulin-like growth factor 1 receptor Human genes 0.000 description 115
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 55
- 201000011510 cancer Diseases 0.000 description 43
- 238000000034 method Methods 0.000 description 36
- 230000005764 inhibitory process Effects 0.000 description 34
- 125000003275 alpha amino acid group Chemical group 0.000 description 31
- 239000000872 buffer Substances 0.000 description 28
- 108090000623 proteins and genes Proteins 0.000 description 27
- 101001034652 Homo sapiens Insulin-like growth factor 1 receptor Proteins 0.000 description 24
- 229930012538 Paclitaxel Natural products 0.000 description 21
- 229960001592 paclitaxel Drugs 0.000 description 21
- 210000004408 hybridoma Anatomy 0.000 description 20
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 20
- 241000699670 Mus sp. Species 0.000 description 19
- 235000001014 amino acid Nutrition 0.000 description 19
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 18
- 239000003795 chemical substances by application Substances 0.000 description 18
- 238000002965 ELISA Methods 0.000 description 17
- 150000001413 amino acids Chemical class 0.000 description 17
- 239000002953 phosphate buffered saline Substances 0.000 description 16
- 239000012679 serum free medium Substances 0.000 description 16
- 241000699666 Mus <mouse, genus> Species 0.000 description 15
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 14
- 238000011534 incubation Methods 0.000 description 14
- 231100000433 cytotoxic Toxicity 0.000 description 13
- 230000001472 cytotoxic effect Effects 0.000 description 13
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 13
- 229960005277 gemcitabine Drugs 0.000 description 13
- 102000004169 proteins and genes Human genes 0.000 description 13
- 238000006243 chemical reaction Methods 0.000 description 12
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical group [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 12
- 235000018102 proteins Nutrition 0.000 description 12
- 238000003556 assay Methods 0.000 description 11
- 230000000903 blocking effect Effects 0.000 description 11
- 239000013613 expression plasmid Substances 0.000 description 11
- 108020004414 DNA Proteins 0.000 description 10
- 102000003746 Insulin Receptor Human genes 0.000 description 10
- 108010001127 Insulin Receptor Proteins 0.000 description 10
- 108010034219 Insulin Receptor Substrate Proteins Proteins 0.000 description 10
- 102100025087 Insulin receptor substrate 1 Human genes 0.000 description 10
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 10
- 229960004316 cisplatin Drugs 0.000 description 10
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 10
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 10
- 238000000338 in vitro Methods 0.000 description 10
- 239000000758 substrate Substances 0.000 description 10
- 239000006228 supernatant Substances 0.000 description 10
- 230000001225 therapeutic effect Effects 0.000 description 10
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 9
- 229940079593 drug Drugs 0.000 description 9
- 238000003780 insertion Methods 0.000 description 9
- 230000037431 insertion Effects 0.000 description 9
- 239000006166 lysate Substances 0.000 description 9
- 102000013415 peroxidase activity proteins Human genes 0.000 description 9
- 108040007629 peroxidase activity proteins Proteins 0.000 description 9
- 239000000243 solution Substances 0.000 description 9
- QAPSNMNOIOSXSQ-YNEHKIRRSA-N 1-[(2r,4s,5r)-4-[tert-butyl(dimethyl)silyl]oxy-5-(hydroxymethyl)oxolan-2-yl]-5-methylpyrimidine-2,4-dione Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O[Si](C)(C)C(C)(C)C)C1 QAPSNMNOIOSXSQ-YNEHKIRRSA-N 0.000 description 8
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 8
- OHDRQQURAXLVGJ-HLVWOLMTSA-N azane;(2e)-3-ethyl-2-[(e)-(3-ethyl-6-sulfo-1,3-benzothiazol-2-ylidene)hydrazinylidene]-1,3-benzothiazole-6-sulfonic acid Chemical compound [NH4+].[NH4+].S/1C2=CC(S([O-])(=O)=O)=CC=C2N(CC)C\1=N/N=C1/SC2=CC(S([O-])(=O)=O)=CC=C2N1CC OHDRQQURAXLVGJ-HLVWOLMTSA-N 0.000 description 8
- 229960004562 carboplatin Drugs 0.000 description 8
- 190000008236 carboplatin Chemical compound 0.000 description 8
- 229960003668 docetaxel Drugs 0.000 description 8
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 8
- 229960001756 oxaliplatin Drugs 0.000 description 8
- 230000004044 response Effects 0.000 description 8
- 229960004641 rituximab Drugs 0.000 description 8
- -1 rituximab (Rituxan) Chemical compound 0.000 description 8
- 229960005267 tositumomab Drugs 0.000 description 8
- 101000852815 Homo sapiens Insulin receptor Proteins 0.000 description 7
- 108091007960 PI3Ks Proteins 0.000 description 7
- 102000003993 Phosphatidylinositol 3-kinases Human genes 0.000 description 7
- 108090000430 Phosphatidylinositol 3-kinases Proteins 0.000 description 7
- 229940123237 Taxane Drugs 0.000 description 7
- 238000010367 cloning Methods 0.000 description 7
- 229960004679 doxorubicin Drugs 0.000 description 7
- 230000006870 function Effects 0.000 description 7
- 102000047882 human INSR Human genes 0.000 description 7
- 125000005647 linker group Chemical group 0.000 description 7
- 239000002609 medium Substances 0.000 description 7
- 201000008968 osteosarcoma Diseases 0.000 description 7
- 238000006366 phosphorylation reaction Methods 0.000 description 7
- UOWVMDUEMSNCAV-WYENRQIDSA-N rachelmycin Chemical compound C1([C@]23C[C@@H]2CN1C(=O)C=1NC=2C(OC)=C(O)C4=C(C=2C=1)CCN4C(=O)C1=CC=2C=4CCN(C=4C(O)=C(C=2N1)OC)C(N)=O)=CC(=O)C1=C3C(C)=CN1 UOWVMDUEMSNCAV-WYENRQIDSA-N 0.000 description 7
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 6
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 6
- 239000002246 antineoplastic agent Substances 0.000 description 6
- 230000006907 apoptotic process Effects 0.000 description 6
- 229940127093 camptothecin Drugs 0.000 description 6
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 6
- 239000002299 complementary DNA Substances 0.000 description 6
- 238000001514 detection method Methods 0.000 description 6
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 6
- QRYFGTULTGLGHU-NBERXCRTSA-N iturelix Chemical compound C([C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCNC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@H](C)C(N)=O)NC(=O)[C@H](CCCCNC(=O)C=1C=NC=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](CC=1C=NC=CC=1)NC(=O)[C@@H](CC=1C=CC(Cl)=CC=1)NC(=O)[C@@H](CC=1C=C2C=CC=CC2=CC=1)NC(C)=O)CCCNC(=O)C1=CC=CN=C1 QRYFGTULTGLGHU-NBERXCRTSA-N 0.000 description 6
- 108010083551 iturelix Proteins 0.000 description 6
- 239000003446 ligand Substances 0.000 description 6
- 230000035772 mutation Effects 0.000 description 6
- 230000026731 phosphorylation Effects 0.000 description 6
- 229910052697 platinum Inorganic materials 0.000 description 6
- 230000000638 stimulation Effects 0.000 description 6
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 5
- 241001465754 Metazoa Species 0.000 description 5
- 206010029260 Neuroblastoma Diseases 0.000 description 5
- 206010035226 Plasma cell myeloma Diseases 0.000 description 5
- 238000002835 absorbance Methods 0.000 description 5
- 230000001270 agonistic effect Effects 0.000 description 5
- 230000002424 anti-apoptotic effect Effects 0.000 description 5
- 230000035578 autophosphorylation Effects 0.000 description 5
- 239000011324 bead Substances 0.000 description 5
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 5
- 229960004630 chlorambucil Drugs 0.000 description 5
- 201000010099 disease Diseases 0.000 description 5
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 5
- 239000012091 fetal bovine serum Substances 0.000 description 5
- 230000003053 immunization Effects 0.000 description 5
- 238000001114 immunoprecipitation Methods 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 201000001441 melanoma Diseases 0.000 description 5
- 230000002297 mitogenic effect Effects 0.000 description 5
- 239000013612 plasmid Substances 0.000 description 5
- 230000003389 potentiating effect Effects 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 102000004196 processed proteins & peptides Human genes 0.000 description 5
- 238000011160 research Methods 0.000 description 5
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 5
- 229960001603 tamoxifen Drugs 0.000 description 5
- 238000001262 western blot Methods 0.000 description 5
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 4
- RTQWWZBSTRGEAV-PKHIMPSTSA-N 2-[[(2s)-2-[bis(carboxymethyl)amino]-3-[4-(methylcarbamoylamino)phenyl]propyl]-[2-[bis(carboxymethyl)amino]propyl]amino]acetic acid Chemical compound CNC(=O)NC1=CC=C(C[C@@H](CN(CC(C)N(CC(O)=O)CC(O)=O)CC(O)=O)N(CC(O)=O)CC(O)=O)C=C1 RTQWWZBSTRGEAV-PKHIMPSTSA-N 0.000 description 4
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 4
- VVIAGPKUTFNRDU-UHFFFAOYSA-N 6S-folinic acid Natural products C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-UHFFFAOYSA-N 0.000 description 4
- BFYIZQONLCFLEV-DAELLWKTSA-N Aromasine Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CC(=C)C2=C1 BFYIZQONLCFLEV-DAELLWKTSA-N 0.000 description 4
- 102000015790 Asparaginase Human genes 0.000 description 4
- 108010024976 Asparaginase Proteins 0.000 description 4
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 4
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 4
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 4
- 206010008342 Cervix carcinoma Diseases 0.000 description 4
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 4
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 4
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 4
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 4
- VWUXBMIQPBEWFH-WCCTWKNTSA-N Fulvestrant Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3[C@H](CCCCCCCCCS(=O)CCCC(F)(F)C(F)(F)F)CC2=C1 VWUXBMIQPBEWFH-WCCTWKNTSA-N 0.000 description 4
- BLCLNMBMMGCOAS-URPVMXJPSA-N Goserelin Chemical compound C([C@@H](C(=O)N[C@H](COC(C)(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1[C@@H](CCC1)C(=O)NNC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 BLCLNMBMMGCOAS-URPVMXJPSA-N 0.000 description 4
- 108010069236 Goserelin Proteins 0.000 description 4
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 4
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 4
- 102100040018 Interferon alpha-2 Human genes 0.000 description 4
- 108010079944 Interferon-alpha2b Proteins 0.000 description 4
- 239000005517 L01XE01 - Imatinib Substances 0.000 description 4
- 239000005551 L01XE03 - Erlotinib Substances 0.000 description 4
- HLFSDGLLUJUHTE-SNVBAGLBSA-N Levamisole Chemical compound C1([C@H]2CN3CCSC3=N2)=CC=CC=C1 HLFSDGLLUJUHTE-SNVBAGLBSA-N 0.000 description 4
- 238000000134 MTT assay Methods 0.000 description 4
- 108010090804 Streptavidin Proteins 0.000 description 4
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 4
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 4
- 229960002184 abarelix Drugs 0.000 description 4
- 108010023617 abarelix Proteins 0.000 description 4
- AIWRTTMUVOZGPW-HSPKUQOVSA-N abarelix Chemical compound C([C@@H](C(=O)N[C@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCNC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@H](C)C(N)=O)N(C)C(=O)[C@H](CO)NC(=O)[C@@H](CC=1C=NC=CC=1)NC(=O)[C@@H](CC=1C=CC(Cl)=CC=1)NC(=O)[C@@H](CC=1C=C2C=CC=CC2=CC=1)NC(C)=O)C1=CC=C(O)C=C1 AIWRTTMUVOZGPW-HSPKUQOVSA-N 0.000 description 4
- 229960000473 altretamine Drugs 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 229960002932 anastrozole Drugs 0.000 description 4
- YBBLVLTVTVSKRW-UHFFFAOYSA-N anastrozole Chemical compound N#CC(C)(C)C1=CC(C(C)(C#N)C)=CC(CN2N=CN=C2)=C1 YBBLVLTVTVSKRW-UHFFFAOYSA-N 0.000 description 4
- 229960003272 asparaginase Drugs 0.000 description 4
- DCXYFEDJOCDNAF-UHFFFAOYSA-M asparaginate Chemical compound [O-]C(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-M 0.000 description 4
- 230000003305 autocrine Effects 0.000 description 4
- 229940120638 avastin Drugs 0.000 description 4
- 229960000397 bevacizumab Drugs 0.000 description 4
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 4
- 229960002092 busulfan Drugs 0.000 description 4
- 229960004117 capecitabine Drugs 0.000 description 4
- 201000010881 cervical cancer Diseases 0.000 description 4
- 229960005395 cetuximab Drugs 0.000 description 4
- 229960004397 cyclophosphamide Drugs 0.000 description 4
- 229960000684 cytarabine Drugs 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 230000018109 developmental process Effects 0.000 description 4
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 4
- 229960003957 dexamethasone Drugs 0.000 description 4
- 238000006073 displacement reaction Methods 0.000 description 4
- 230000003828 downregulation Effects 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 229960001904 epirubicin Drugs 0.000 description 4
- 229930013356 epothilone Natural products 0.000 description 4
- AAKJLRGGTJKAMG-UHFFFAOYSA-N erlotinib Chemical compound C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 AAKJLRGGTJKAMG-UHFFFAOYSA-N 0.000 description 4
- 229960001842 estramustine Drugs 0.000 description 4
- FRPJXPJMRWBBIH-RBRWEJTLSA-N estramustine Chemical compound ClCCN(CCCl)C(=O)OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 FRPJXPJMRWBBIH-RBRWEJTLSA-N 0.000 description 4
- 229960005420 etoposide Drugs 0.000 description 4
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 4
- 229960000255 exemestane Drugs 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 229960000390 fludarabine Drugs 0.000 description 4
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 4
- 229960002949 fluorouracil Drugs 0.000 description 4
- VVIAGPKUTFNRDU-ABLWVSNPSA-N folinic acid Chemical compound C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-ABLWVSNPSA-N 0.000 description 4
- 235000008191 folinic acid Nutrition 0.000 description 4
- 239000011672 folinic acid Substances 0.000 description 4
- 229960002258 fulvestrant Drugs 0.000 description 4
- XGALLCVXEZPNRQ-UHFFFAOYSA-N gefitinib Chemical compound C=12C=C(OCCCN3CCOCC3)C(OC)=CC2=NC=NC=1NC1=CC=C(F)C(Cl)=C1 XGALLCVXEZPNRQ-UHFFFAOYSA-N 0.000 description 4
- 210000004602 germ cell Anatomy 0.000 description 4
- 229960002913 goserelin Drugs 0.000 description 4
- 229940022353 herceptin Drugs 0.000 description 4
- UUVWYPNAQBNQJQ-UHFFFAOYSA-N hexamethylmelamine Chemical compound CN(C)C1=NC(N(C)C)=NC(N(C)C)=N1 UUVWYPNAQBNQJQ-UHFFFAOYSA-N 0.000 description 4
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 4
- 229960001001 ibritumomab tiuxetan Drugs 0.000 description 4
- 229960000908 idarubicin Drugs 0.000 description 4
- 229960002411 imatinib Drugs 0.000 description 4
- KTUFNOKKBVMGRW-UHFFFAOYSA-N imatinib Chemical compound C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 KTUFNOKKBVMGRW-UHFFFAOYSA-N 0.000 description 4
- 238000002649 immunization Methods 0.000 description 4
- 239000003112 inhibitor Substances 0.000 description 4
- 229960004768 irinotecan Drugs 0.000 description 4
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 4
- 229960003881 letrozole Drugs 0.000 description 4
- HPJKCIUCZWXJDR-UHFFFAOYSA-N letrozole Chemical compound C1=CC(C#N)=CC=C1C(N1N=CN=C1)C1=CC=C(C#N)C=C1 HPJKCIUCZWXJDR-UHFFFAOYSA-N 0.000 description 4
- 229960001691 leucovorin Drugs 0.000 description 4
- 229960001614 levamisole Drugs 0.000 description 4
- 238000005259 measurement Methods 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 229960001156 mitoxantrone Drugs 0.000 description 4
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 4
- 239000000203 mixture Substances 0.000 description 4
- 238000002703 mutagenesis Methods 0.000 description 4
- 231100000350 mutagenesis Toxicity 0.000 description 4
- 150000007523 nucleic acids Chemical group 0.000 description 4
- 230000003076 paracrine Effects 0.000 description 4
- 230000035755 proliferation Effects 0.000 description 4
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 4
- 239000000523 sample Substances 0.000 description 4
- 238000012216 screening Methods 0.000 description 4
- 230000011664 signaling Effects 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 4
- 239000002904 solvent Substances 0.000 description 4
- 230000009870 specific binding Effects 0.000 description 4
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 4
- 229960001052 streptozocin Drugs 0.000 description 4
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 4
- 229940120982 tarceva Drugs 0.000 description 4
- 229960000303 topotecan Drugs 0.000 description 4
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 4
- XFCLJVABOIYOMF-QPLCGJKRSA-N toremifene Chemical compound C1=CC(OCCN(C)C)=CC=C1C(\C=1C=CC=CC=1)=C(\CCCl)C1=CC=CC=C1 XFCLJVABOIYOMF-QPLCGJKRSA-N 0.000 description 4
- 229960005026 toremifene Drugs 0.000 description 4
- 229960000575 trastuzumab Drugs 0.000 description 4
- 230000004614 tumor growth Effects 0.000 description 4
- 229960002066 vinorelbine Drugs 0.000 description 4
- GBABOYUKABKIAF-GHYRFKGUSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-GHYRFKGUSA-N 0.000 description 4
- XRASPMIURGNCCH-UHFFFAOYSA-N zoledronic acid Chemical compound OP(=O)(O)C(P(O)(O)=O)(O)CN1C=CN=C1 XRASPMIURGNCCH-UHFFFAOYSA-N 0.000 description 4
- 229960004276 zoledronic acid Drugs 0.000 description 4
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- 229920000936 Agarose Polymers 0.000 description 3
- 201000009030 Carcinoma Diseases 0.000 description 3
- 102000000844 Cell Surface Receptors Human genes 0.000 description 3
- 108010001857 Cell Surface Receptors Proteins 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 230000035519 G0 Phase Effects 0.000 description 3
- 230000010190 G1 phase Effects 0.000 description 3
- 239000007995 HEPES buffer Substances 0.000 description 3
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 3
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 3
- 101150018665 MAPK3 gene Proteins 0.000 description 3
- 231100000002 MTT assay Toxicity 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 208000034578 Multiple myelomas Diseases 0.000 description 3
- 241000283973 Oryctolagus cuniculus Species 0.000 description 3
- 239000012979 RPMI medium Substances 0.000 description 3
- 230000004913 activation Effects 0.000 description 3
- 125000000539 amino acid group Chemical group 0.000 description 3
- 230000001093 anti-cancer Effects 0.000 description 3
- 239000004202 carbamide Substances 0.000 description 3
- 230000003915 cell function Effects 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 125000002228 disulfide group Chemical group 0.000 description 3
- 239000012636 effector Substances 0.000 description 3
- 230000002124 endocrine Effects 0.000 description 3
- 239000001963 growth medium Substances 0.000 description 3
- 230000001900 immune effect Effects 0.000 description 3
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 3
- 238000007912 intraperitoneal administration Methods 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 238000000302 molecular modelling Methods 0.000 description 3
- 230000010807 negative regulation of binding Effects 0.000 description 3
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 3
- 238000002823 phage display Methods 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- 229920001184 polypeptide Polymers 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 238000000734 protein sequencing Methods 0.000 description 3
- 210000004989 spleen cell Anatomy 0.000 description 3
- 230000009466 transformation Effects 0.000 description 3
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- QWPXBEHQFHACTK-KZVYIGENSA-N (10e,12e)-86-chloro-12,14,4-trihydroxy-85,14-dimethoxy-33,2,7,10-tetramethyl-15,16-dihydro-14h-7-aza-1(6,4)-oxazina-3(2,3)-oxirana-8(1,3)-benzenacyclotetradecaphane-10,12-dien-6-one Chemical compound CN1C(=O)CC(O)C2(C)OC2C(C)C(OC(=O)N2)CC2(O)C(OC)\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 QWPXBEHQFHACTK-KZVYIGENSA-N 0.000 description 2
- NLXLAEXVIDQMFP-UHFFFAOYSA-N Ammonia chloride Chemical compound [NH4+].[Cl-] NLXLAEXVIDQMFP-UHFFFAOYSA-N 0.000 description 2
- 238000012935 Averaging Methods 0.000 description 2
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 2
- 101100218515 Candida albicans (strain SC5314 / ATCC MYA-2876) BBP gene Proteins 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 2
- 108010076667 Caspases Proteins 0.000 description 2
- 102000011727 Caspases Human genes 0.000 description 2
- 108020004635 Complementary DNA Proteins 0.000 description 2
- 238000011537 Coomassie blue staining Methods 0.000 description 2
- 108010008286 DNA nucleotidylexotransferase Proteins 0.000 description 2
- 102100029764 DNA-directed DNA/RNA polymerase mu Human genes 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 239000000579 Gonadotropin-Releasing Hormone Substances 0.000 description 2
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- 108091054455 MAP kinase family Proteins 0.000 description 2
- 102000043136 MAP kinase family Human genes 0.000 description 2
- 101150116844 MSL5 gene Proteins 0.000 description 2
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 239000002033 PVDF binder Substances 0.000 description 2
- 229930182555 Penicillin Natural products 0.000 description 2
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- 102000007079 Peptide Fragments Human genes 0.000 description 2
- 108010033276 Peptide Fragments Proteins 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 2
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 2
- 239000012980 RPMI-1640 medium Substances 0.000 description 2
- 230000018199 S phase Effects 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 2
- 101000857870 Squalus acanthias Gonadoliberin Proteins 0.000 description 2
- 239000007983 Tris buffer Substances 0.000 description 2
- 230000009824 affinity maturation Effects 0.000 description 2
- 230000003042 antagnostic effect Effects 0.000 description 2
- 230000000340 anti-metabolite Effects 0.000 description 2
- 230000000692 anti-sense effect Effects 0.000 description 2
- 229940100197 antimetabolite Drugs 0.000 description 2
- 239000002256 antimetabolite Substances 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 210000000481 breast Anatomy 0.000 description 2
- 238000012219 cassette mutagenesis Methods 0.000 description 2
- 230000022131 cell cycle Effects 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 239000006285 cell suspension Substances 0.000 description 2
- 230000005754 cellular signaling Effects 0.000 description 2
- 231100000196 chemotoxic Toxicity 0.000 description 2
- 230000002604 chemotoxic effect Effects 0.000 description 2
- 210000001072 colon Anatomy 0.000 description 2
- 238000002648 combination therapy Methods 0.000 description 2
- 238000011284 combination treatment Methods 0.000 description 2
- 239000012228 culture supernatant Substances 0.000 description 2
- 230000001351 cycling effect Effects 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 230000001086 cytosolic effect Effects 0.000 description 2
- 239000000824 cytostatic agent Substances 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 239000003599 detergent Substances 0.000 description 2
- 239000000032 diagnostic agent Substances 0.000 description 2
- 229940039227 diagnostic agent Drugs 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 238000010494 dissociation reaction Methods 0.000 description 2
- 230000005593 dissociations Effects 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 239000002552 dosage form Substances 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 238000001378 electrochemiluminescence detection Methods 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- HESCAJZNRMSMJG-KKQRBIROSA-N epothilone A Chemical class C/C([C@@H]1C[C@@H]2O[C@@H]2CCC[C@@H]([C@@H]([C@@H](C)C(=O)C(C)(C)[C@@H](O)CC(=O)O1)O)C)=C\C1=CSC(C)=N1 HESCAJZNRMSMJG-KKQRBIROSA-N 0.000 description 2
- 150000003883 epothilone derivatives Chemical class 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- XLXSAKCOAKORKW-AQJXLSMYSA-N gonadorelin Chemical compound C([C@@H](C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)NCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 XLXSAKCOAKORKW-AQJXLSMYSA-N 0.000 description 2
- 229940035638 gonadotropin-releasing hormone Drugs 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 229940127121 immunoconjugate Drugs 0.000 description 2
- 239000012133 immunoprecipitate Substances 0.000 description 2
- 238000001802 infusion Methods 0.000 description 2
- 229940125396 insulin Drugs 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 239000012139 lysis buffer Substances 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 230000004060 metabolic process Effects 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- 230000027405 negative regulation of phosphorylation Effects 0.000 description 2
- 108020004707 nucleic acids Proteins 0.000 description 2
- 102000039446 nucleic acids Human genes 0.000 description 2
- 238000011275 oncology therapy Methods 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 229940049954 penicillin Drugs 0.000 description 2
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 2
- 230000004962 physiological condition Effects 0.000 description 2
- 230000003169 placental effect Effects 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 108091033319 polynucleotide Proteins 0.000 description 2
- 102000040430 polynucleotide Human genes 0.000 description 2
- 239000002157 polynucleotide Substances 0.000 description 2
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 210000001236 prokaryotic cell Anatomy 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 229950010131 puromycin Drugs 0.000 description 2
- 108091008146 restriction endonucleases Proteins 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 230000019491 signal transduction Effects 0.000 description 2
- 238000002741 site-directed mutagenesis Methods 0.000 description 2
- PUZPDOWCWNUUKD-UHFFFAOYSA-M sodium fluoride Chemical compound [F-].[Na+] PUZPDOWCWNUUKD-UHFFFAOYSA-M 0.000 description 2
- 210000000952 spleen Anatomy 0.000 description 2
- 230000004936 stimulating effect Effects 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- 239000007929 subcutaneous injection Substances 0.000 description 2
- 238000010254 subcutaneous injection Methods 0.000 description 2
- 230000002195 synergetic effect Effects 0.000 description 2
- DKPFODGZWDEEBT-QFIAKTPHSA-N taxane Chemical class C([C@]1(C)CCC[C@@H](C)[C@H]1C1)C[C@H]2[C@H](C)CC[C@@H]1C2(C)C DKPFODGZWDEEBT-QFIAKTPHSA-N 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 125000000101 thioether group Chemical group 0.000 description 2
- 229940104230 thymidine Drugs 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 238000004448 titration Methods 0.000 description 2
- 238000000954 titration curve Methods 0.000 description 2
- 231100000331 toxic Toxicity 0.000 description 2
- 230000002588 toxic effect Effects 0.000 description 2
- 238000003146 transient transfection Methods 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- 239000013598 vector Substances 0.000 description 2
- 229960004528 vincristine Drugs 0.000 description 2
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 2
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 2
- DTLVBHCSSNJCMJ-JXQFQVJHSA-N (2,5-dioxopyrrolidin-1-yl) 3-[2-[2-[2-[2-[5-[(3as,4s,6ar)-2-oxo-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]pentanoylamino]ethoxy]ethoxy]ethoxy]ethoxy]propanoate Chemical compound C([C@H]1[C@H]2NC(=O)N[C@H]2CS1)CCCC(=O)NCCOCCOCCOCCOCCC(=O)ON1C(=O)CCC1=O DTLVBHCSSNJCMJ-JXQFQVJHSA-N 0.000 description 1
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 1
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 1
- 206010069754 Acquired gene mutation Diseases 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 102000010565 Apoptosis Regulatory Proteins Human genes 0.000 description 1
- 108010063104 Apoptosis Regulatory Proteins Proteins 0.000 description 1
- 108010039627 Aprotinin Proteins 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 102100032985 CCR4-NOT transcription complex subunit 7 Human genes 0.000 description 1
- 108050006912 CCR4-NOT transcription complex subunit 7 Proteins 0.000 description 1
- 239000008000 CHES buffer Substances 0.000 description 1
- 241001569772 Celithemis elisa Species 0.000 description 1
- 241000282552 Chlorocebus aethiops Species 0.000 description 1
- 229910021580 Cobalt(II) chloride Inorganic materials 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- 230000006820 DNA synthesis Effects 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 239000012591 Dulbecco’s Phosphate Buffered Saline Substances 0.000 description 1
- 102000001301 EGF receptor Human genes 0.000 description 1
- 108060006698 EGF receptor Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 108090000371 Esterases Proteins 0.000 description 1
- 208000006168 Ewing Sarcoma Diseases 0.000 description 1
- 239000004230 Fast Yellow AB Substances 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- QYZRTBKYBJRGJB-PCMHIUKPSA-N Granisetron hydrochloride Chemical compound Cl.C1=CC=C2C(C(=O)NC3C[C@H]4CCC[C@@H](C3)N4C)=NN(C)C2=C1 QYZRTBKYBJRGJB-PCMHIUKPSA-N 0.000 description 1
- 102000009465 Growth Factor Receptors Human genes 0.000 description 1
- 108010009202 Growth Factor Receptors Proteins 0.000 description 1
- 208000012766 Growth delay Diseases 0.000 description 1
- 101000599951 Homo sapiens Insulin-like growth factor I Proteins 0.000 description 1
- 101001059454 Homo sapiens Serine/threonine-protein kinase MARK2 Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 102100025092 Insulin receptor substrate 2 Human genes 0.000 description 1
- 101710201820 Insulin receptor substrate 2 Proteins 0.000 description 1
- 102100037852 Insulin-like growth factor I Human genes 0.000 description 1
- 102000004374 Insulin-like growth factor binding protein 3 Human genes 0.000 description 1
- 108090000965 Insulin-like growth factor binding protein 3 Proteins 0.000 description 1
- 102100034343 Integrase Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 102000011782 Keratins Human genes 0.000 description 1
- 108010076876 Keratins Proteins 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- GDBQQVLCIARPGH-UHFFFAOYSA-N Leupeptin Natural products CC(C)CC(NC(C)=O)C(=O)NC(CC(C)C)C(=O)NC(C=O)CCCN=C(N)N GDBQQVLCIARPGH-UHFFFAOYSA-N 0.000 description 1
- 108010000817 Leuprolide Proteins 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- 229940124041 Luteinizing hormone releasing hormone (LHRH) antagonist Drugs 0.000 description 1
- QWPXBEHQFHACTK-UHFFFAOYSA-N Maytansinol Natural products CN1C(=O)CC(O)C2(C)OC2C(C)C(OC(=O)N2)CC2(O)C(OC)C=CC=C(C)CC2=CC(OC)=C(Cl)C1=C2 QWPXBEHQFHACTK-UHFFFAOYSA-N 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- 238000005481 NMR spectroscopy Methods 0.000 description 1
- 101710160107 Outer membrane protein A Proteins 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- BELBBZDIHDAJOR-UHFFFAOYSA-N Phenolsulfonephthalein Chemical compound C1=CC(O)=CC=C1C1(C=2C=CC(O)=CC=2)C2=CC=CC=C2S(=O)(=O)O1 BELBBZDIHDAJOR-UHFFFAOYSA-N 0.000 description 1
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 1
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 1
- 108010047620 Phytohemagglutinins Proteins 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 229920005654 Sephadex Polymers 0.000 description 1
- 239000012507 Sephadex™ Substances 0.000 description 1
- 102100028904 Serine/threonine-protein kinase MARK2 Human genes 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 241000133426 Streptomyces zelensis Species 0.000 description 1
- 229940123468 Transferase inhibitor Drugs 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 108090000901 Transferrin Proteins 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- OUUYBRCCFUEMLH-YDALLXLXSA-N [(1s)-2-[4-[bis(2-chloroethyl)amino]phenyl]-1-carboxyethyl]azanium;chloride Chemical compound Cl.OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 OUUYBRCCFUEMLH-YDALLXLXSA-N 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000008186 active pharmaceutical agent Substances 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 229960005310 aldesleukin Drugs 0.000 description 1
- 108700025316 aldesleukin Proteins 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 230000003281 allosteric effect Effects 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 229960003896 aminopterin Drugs 0.000 description 1
- 235000019270 ammonium chloride Nutrition 0.000 description 1
- 239000003098 androgen Substances 0.000 description 1
- 230000008485 antagonism Effects 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000001772 anti-angiogenic effect Effects 0.000 description 1
- 229940046836 anti-estrogen Drugs 0.000 description 1
- 230000001833 anti-estrogenic effect Effects 0.000 description 1
- 229940044684 anti-microtubule agent Drugs 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000030741 antigen processing and presentation Effects 0.000 description 1
- 239000003972 antineoplastic antibiotic Substances 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 229960004405 aprotinin Drugs 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- PXXJHWLDUBFPOL-UHFFFAOYSA-N benzamidine Chemical compound NC(=N)C1=CC=CC=C1 PXXJHWLDUBFPOL-UHFFFAOYSA-N 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- 102000005936 beta-Galactosidase Human genes 0.000 description 1
- 230000008033 biological extinction Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 238000007413 biotinylation Methods 0.000 description 1
- 230000006287 biotinylation Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 229930195731 calicheamicin Natural products 0.000 description 1
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 1
- 230000005907 cancer growth Effects 0.000 description 1
- 239000012830 cancer therapeutic Substances 0.000 description 1
- 230000004856 capillary permeability Effects 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 230000007541 cellular toxicity Effects 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 238000011260 co-administration Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 238000010293 colony formation assay Methods 0.000 description 1
- 230000002301 combined effect Effects 0.000 description 1
- 238000012875 competitive assay Methods 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 230000001268 conjugating effect Effects 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000013068 control sample Substances 0.000 description 1
- 230000001085 cytostatic effect Effects 0.000 description 1
- HAAZLUGHYHWQIW-KVQBGUIXSA-N dGTP Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 HAAZLUGHYHWQIW-KVQBGUIXSA-N 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- ZPWVASYFFYYZEW-UHFFFAOYSA-L dipotassium hydrogen phosphate Chemical compound [K+].[K+].OP([O-])([O-])=O ZPWVASYFFYYZEW-UHFFFAOYSA-L 0.000 description 1
- 229910000396 dipotassium phosphate Inorganic materials 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 239000003534 dna topoisomerase inhibitor Substances 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 230000013020 embryo development Effects 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 239000002532 enzyme inhibitor Substances 0.000 description 1
- 238000011067 equilibration Methods 0.000 description 1
- 210000003743 erythrocyte Anatomy 0.000 description 1
- 239000000328 estrogen antagonist Substances 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 239000008098 formaldehyde solution Substances 0.000 description 1
- 239000005338 frosted glass Substances 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 239000002474 gonadorelin antagonist Substances 0.000 description 1
- 230000009036 growth inhibition Effects 0.000 description 1
- 238000001794 hormone therapy Methods 0.000 description 1
- 239000012216 imaging agent Substances 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 230000000984 immunochemical effect Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 239000002955 immunomodulating agent Substances 0.000 description 1
- 229940121354 immunomodulator Drugs 0.000 description 1
- 238000011503 in vivo imaging Methods 0.000 description 1
- ZPNFWUPYTFPOJU-LPYSRVMUSA-N iniprol Chemical compound C([C@H]1C(=O)NCC(=O)NCC(=O)N[C@H]2CSSC[C@H]3C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(N[C@H](C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC=4C=CC=CC=4)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC=4C=CC=CC=4)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC2=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC=2C=CC=CC=2)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]2N(CCC2)C(=O)[C@@H](N)CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N2[C@@H](CCC2)C(=O)N2[C@@H](CCC2)C(=O)N[C@@H](CC=2C=CC(O)=CC=2)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N2[C@@H](CCC2)C(=O)N3)C(=O)NCC(=O)NCC(=O)N[C@@H](C)C(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@H](C(=O)N1)C(C)C)[C@@H](C)O)[C@@H](C)CC)=O)[C@@H](C)CC)C1=CC=C(O)C=C1 ZPNFWUPYTFPOJU-LPYSRVMUSA-N 0.000 description 1
- 102000028416 insulin-like growth factor binding Human genes 0.000 description 1
- 108091022911 insulin-like growth factor binding Proteins 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 230000031146 intracellular signal transduction Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 238000007919 intrasynovial administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 230000002601 intratumoral effect Effects 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- GDBQQVLCIARPGH-ULQDDVLXSA-N leupeptin Chemical compound CC(C)C[C@H](NC(C)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C=O)CCCN=C(N)N GDBQQVLCIARPGH-ULQDDVLXSA-N 0.000 description 1
- 108010052968 leupeptin Proteins 0.000 description 1
- GFIJNRVAKGFPGQ-LIJARHBVSA-N leuprolide Chemical compound CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 GFIJNRVAKGFPGQ-LIJARHBVSA-N 0.000 description 1
- 229960004338 leuprorelin Drugs 0.000 description 1
- 238000012417 linear regression Methods 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 201000005296 lung carcinoma Diseases 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical class ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 239000003226 mitogen Substances 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 230000000869 mutational effect Effects 0.000 description 1
- 230000035407 negative regulation of cell proliferation Effects 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 231100000956 nontoxicity Toxicity 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 238000011580 nude mouse model Methods 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 229950000964 pepstatin Drugs 0.000 description 1
- 108010091212 pepstatin Proteins 0.000 description 1
- FAXGPCHRFPCXOO-LXTPJMTPSA-N pepstatin A Chemical compound OC(=O)C[C@H](O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)C[C@H](O)[C@H](CC(C)C)NC(=O)[C@H](C(C)C)NC(=O)[C@H](C(C)C)NC(=O)CC(C)C FAXGPCHRFPCXOO-LXTPJMTPSA-N 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 229960003531 phenolsulfonphthalein Drugs 0.000 description 1
- 208000028591 pheochromocytoma Diseases 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 230000001885 phytohemagglutinin Effects 0.000 description 1
- 230000036470 plasma concentration Effects 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 238000012342 propidium iodide staining Methods 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 235000019833 protease Nutrition 0.000 description 1
- 235000019419 proteases Nutrition 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 239000012521 purified sample Substances 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 239000003488 releasing hormone Substances 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 230000000979 retarding effect Effects 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 235000017557 sodium bicarbonate Nutrition 0.000 description 1
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- FQENQNTWSFEDLI-UHFFFAOYSA-J sodium diphosphate Chemical compound [Na+].[Na+].[Na+].[Na+].[O-]P([O-])(=O)OP([O-])([O-])=O FQENQNTWSFEDLI-UHFFFAOYSA-J 0.000 description 1
- 235000013024 sodium fluoride Nutrition 0.000 description 1
- 239000011775 sodium fluoride Substances 0.000 description 1
- 229940048086 sodium pyrophosphate Drugs 0.000 description 1
- IBKZNJXGCYVTBZ-IDBHZBAZSA-M sodium;1-[3-[2-[5-[(3as,4s,6ar)-2-oxo-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]pentanoylamino]ethyldisulfanyl]propanoyloxy]-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)CCSSCCNC(=O)CCCC[C@H]1[C@H]2NC(=O)N[C@H]2CS1 IBKZNJXGCYVTBZ-IDBHZBAZSA-M 0.000 description 1
- JJGWLCLUQNFDIS-GTSONSFRSA-M sodium;1-[6-[5-[(3as,4s,6ar)-2-oxo-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]pentanoylamino]hexanoyloxy]-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)CCCCCNC(=O)CCCC[C@H]1[C@H]2NC(=O)N[C@H]2CS1 JJGWLCLUQNFDIS-GTSONSFRSA-M 0.000 description 1
- 238000005063 solubilization Methods 0.000 description 1
- 230000007928 solubilization Effects 0.000 description 1
- 230000037439 somatic mutation Effects 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 238000003153 stable transfection Methods 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 108010051423 streptavidin-agarose Proteins 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 230000007755 survival signaling Effects 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 125000002456 taxol group Chemical group 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 235000019818 tetrasodium diphosphate Nutrition 0.000 description 1
- 239000001577 tetrasodium phosphonato phosphate Substances 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 229940044693 topoisomerase inhibitor Drugs 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 239000003558 transferase inhibitor Substances 0.000 description 1
- 238000005820 transferase reaction Methods 0.000 description 1
- 239000012581 transferrin Substances 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- IHIXIJGXTJIKRB-UHFFFAOYSA-N trisodium vanadate Chemical compound [Na+].[Na+].[Na+].[O-][V]([O-])([O-])=O IHIXIJGXTJIKRB-UHFFFAOYSA-N 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39541—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against normal tissues, cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present invention relates to antibodies that bind to human insulin-like growth factor-I receptor (IGF-I receptor). More particularly, the invention relates to anti-IGF-I receptor antibodies that inhibit the cellular functions of the IGF-I receptor. Still more particularly, the invention relates to anti-IGF-I receptor antibodies that antagonize the effects of IGF-I, IGF-II and serum on the growth and survival of tumor cells and which are substantially devoid of agonist activity. The invention also relates to fragments of said antibodies, humanized and resurfaced versions of said antibodies, conjugates of said antibodies, antibody derivatives, and the uses of same in diagnostic, research and therapeutic applications. The invention further relates to improved antibodies or fragments thereof that are made from the above-described antibodies and fragments thereof. In another aspect, the invention relates to a polynucleotide encoding the antibodies or fragments thereof, and to vectors comprising the polynucleotides.
- Insulin-like growth factor-I receptor is a transmembrane heterotetrameric protein, which has two extracellular alpha chains and two membrane-spanning beta chains in a disulfide-linked ⁇ - ⁇ - ⁇ - ⁇ configuration.
- the binding of the ligands, which are insulin-like growth-factor-I (IGF-I) and insulin-like growth factor-II (IGF-II) by the extracellular domain of IGF-I receptor activates its intracellular tyrosine kinase domain resulting in autophosphorylation of the receptor and substrate phosphorylation.
- the IGF-I receptor is homologous to insulin receptor, having a high sequence similarity of 84% in the beta chain tyrosine kinase domain and a low sequence similarity of 48% in the alpha chain extracellular cysteine rich domain (Ulrich, A. et al., 1986 , EMBO , 5, 2503-2512; Fujita-Yamaguchi, Y. et al., 1986 , J. Biol. Chem ., 261, 16727-16731; LeRoith, D. et al., 1995 , Endocrine Reviews , 16, 143-163).
- IGF-I receptor and its ligands play important roles in numerous physiological processes including growth and development during embryogenesis, metabolism, cellular proliferation and cell differentiation in adults (LeRoith, D., 2000 , Endocrinology , 141, 1287-1288; LeRoith, D., 1997 , New England J. Med ., 336, 633-640).
- IGF-I and IGF-II function both as endocrine hormones in the blood, where they are predominantly present in complexes with IGF-binding proteins, and as paracrine and autocrine growth factors that are produced locally (Humbel, R. E., 1990 , Eur. J. Biochem ., 190, 445-462; Cohick, W. S. and Clemmons, D. R., 1993 , Annu. Rev. Physiol . 55, 131-153).
- the IGF-I receptor has been implicated in promoting growth, transformation and survival of tumor cells (Baserga, R. et al., 1997 , Biochem. Biophys. Acta , 1332, F105-F126; Blakesley, V. A. et al., 1997 , Journal of Endocrinology , 152, 339-344; Kaleko, M., Rutter, W. J., and Miller, A. D. 1990 , Mol. Cell. Biol ., 10, 464-473).
- tumors include breast cancer, colon cancer, ovarian carcinoma, synovial sarcoma and pancreatic cancer (Khandwala, H. M.
- IGF-I and IGF-II have been shown to be potent mitogens for several human tumor cell lines such as lung cancer, breast cancer, colon cancer, osteosarcoma and cervical cancer (Ankrapp, D. P. and Bevan, D. R., 1993 , Cancer Res ., 53, 3399-3404; Cullen, K. J., 1990 , Cancer Res ., 50, 48-53; Hermanto, U. et al., 2000 , Cell Growth & Differentiation , 11, 655-664; Guo, Y. S. et al., 1995 , J. Am. Coll.
- the IGF-I receptor protects tumor cells from apoptosis caused by growth factor deprivation, anchorage independence or cytotoxic drug treatment (Navarro, M. and Baserga, R., 2001 , Endocrinology , 142, 1073-1081; Baserga, R. et al., 1997 , Biochem. Biophys. Acta , 1332, F105-F126).
- the domains of IGF-I receptor that are critical for its mitogenic, transforming and anti-apoptotic activities have been identified by mutational analysis.
- the tyrosine 1251 residue of IGF-I receptor has been identified as critical for anti-apoptotic and transformation activities but not for its mitogenic activity (O'Connor, R. et al., 1997 , Mol. Cell. Biol ., 17, 427-435; Miura, M. et al., 1995 , J. Biol. Chem ., 270, 22639-22644).
- the intracellular signaling pathway of ligand-activated IGF-I receptor involves phosphorylation of tyrosine residues of insulin receptor substrates (IRS-1 and IRS-2), which recruit phosphatidylinositol-3-kinase (PI-3-kinase) to the membrane.
- Akt serine/threonine kinase
- substrates include the pro-apoptotic protein BAD which is phosphorylated to an inactive state
- the mitogenic signaling of IGF-I receptor in MCF-7 human breast cancer cells requires PI-3-kinase and is independent of mitogen-activated protein kinase, whereas the survival signaling in differentiated rat pheochromocytoma PC12 cells requires both PI-3-kinase and mitogen-activated protein kinase pathways (Dufourny, B. et al., 1997 , J. Biol. Chem ., 272, 31163-31171; Parrizas, M., Saltiel, A. R. and LeRoith, D., 1997 , J. Biol. Chem ., 272, 154-161).
- IGF-I receptor Tumor cells expressing an antisense to the IGF-I receptor mRNA undergo massive apoptosis when injected into animals in biodiffusion chambers. This observation makes the IGF-I receptor an attractive therapeutic target, based upon the hypothesis that tumor cells are more susceptible than normal cells to apoptosis by inhibition of IGF-I receptor (Resnicoff, M. et al., 1995 , Cancer Res ., 55, 2463-2469; Baserga, R., 1995 , Cancer Res ., 55, 249-252).
- IGF-I receptor antibodies which bind to the extracellular domains of IGF-I receptor and inhibit its activation.
- Several attempts have been reported to develop mouse monoclonal antibodies against IGF-I receptor, of which two inhibitory antibodies—IR3 and 1H7—are available and their use has been reported in several IGF-I receptor studies.
- the IR3 antibody was developed using a partially purified placental preparation of insulin receptor to immunize mice, which yielded an antibody, IR1, that was selective for binding insulin receptor, and two antibodies, IR2 and IR3, that showed preferential immunoprecipitation of IGF-I receptor (somatomedin-C receptor) but also weak immunoprecipitation of insulin receptor (Kull, F. C. et al., 1983 , J. Biol. Chem ., 258, 6561-6566).
- the 1H7 antibody was developed by immunizing mice with purified placental preparation of IGF-I receptor, which yielded the inhibitory antibody 1H7 in addition to three stimulatory antibodies (Li, S.-L. et al., 1993 , Biochem. Biophys. Res. Commun ., 196, 92-98; Xiong, L. et al., 1992 , Proc. Natl. Acad. Sci. USA , 89, 5356-5360).
- mice a panel of mouse monoclonal antibodies specific for human IGF-I receptor were obtained by immunization of mice with transfected 3T3 cells expressing high levels of IGF-I receptor, which were categorized into seven groups by binding competition studies and by their inhibition or stimulation of IGF-I binding to transfected 3T3 cells (Soos, M. A. et al., 1992 , J. Biol. Chem ., 267, 12955-12963).
- IR3 antibody is the most commonly used inhibitory antibody for IGF-I receptor studies in vitro, it suffers from the drawback that it exhibits agonistic activity in transfected 3T3 and CHO cells expressing human IGF-I receptor (Kato, H. et al., 1993 , J. Biol. Chem ., 268, 2655-2661; Steele-Perkins, G. and Roth, R. A., 1990 , Biochem. Biophys. Res. Commun ., 171, 1244-1251). Similarly, among the panel of antibodies developed by Soos et al., the most inhibitory antibodies 24-57 and 24-60 also showed agonistic activities in the transfected 3T3 cells (Soos, M. A.
- IR3 antibody is reported to inhibit the binding of IGF-I (but not IGF-II) to expressed receptors in intact cells and after solubilization, it is shown to inhibit the ability of both IGF-I and IGF-II to stimulate DNA synthesis in cells in vitro (Steele-Perkins, G. and Roth, R. A., 1990 , Biochem. Biophys. Res. Commun ., 171, 1244-1251).
- the binding epitope of IR3 antibody has been inferred from chimeric insulin-IGF-I receptor constructs to be the 223-274 region of IGF-I receptor (Gustafson, T. A.
- the MCF-7 human breast cancer cell line is typically used as a model cell line to demonstrate the growth response of IGF-I and IGF-II in vitro (Dufourny, B. et al., 1997 , J. Biol. Chem ., 272, 31163-31171).
- the IR3 antibody incompletely blocks the stimulatory effect of exogenously added IGF-I and IGF-II in serum-free conditions by approximately 80%.
- the IR3 antibody does not significantly inhibit (less than 25%) the growth of MCF-7 cells in 10% serum (Cullen, K. J. et al., 1990 , Cancer Res ., 50, 48-53).
- This weak inhibition of serum-stimulated growth of MCF-7 cells by IR3 antibody in vitro may be related to the results of an in vivo study in which IR3 antibody treatment did not significantly inhibit the growth of a MCF-7 xenograft in nude mice (Arteaga, C. L. et al., 1989 , J. Clin. Invest ., 84, 1418-1423).
- murine antibody EM164 which is fully characterized herein with respect to the amino acid sequences of both its light and heavy chain variable regions, the cDNA sequences of the genes for the light and heavy chain variable regions, the identification of its CDRs (complementarity-determining regions), the identification of its surface amino acids, and means for its expression in recombinant form.
- resurfaced or humanized versions of antibody EM164 wherein surface-exposed residues of the antibody or its fragments are replaced in both light and heavy chains to more closely resemble known human antibody surfaces.
- Such humanized antibodies may have increased utility, compared to murine EM164, as therapeutic or diagnostic agents.
- Humanized versions of antibody EM164 are also fully characterized herein with respect to their respective amino acid sequences of both light and heavy chain variable regions, the DNA sequences of the genes for the light and heavy chain variable regions, the identification of the CDRs, the identification of their surface amino acids, and disclosure of a means for their expression in recombinant form.
- an antibody that is capable of inhibiting the growth of a cancer cell by greater than about 80% in the presence of a growth stimulant such as, for example, serum, insulin-like growth factor-I and insulin-like growth factor-II.
- an antibody or antibody fragment having a heavy chain including CDRs having amino acid sequences represented by SEQ ID NOS: 1-3, respectively: SYWMH: (SEQ ID NO:1) EINPSNGRTNYNEKFKR, (SEQ ID NO:2) GRPDYYGSSKWYFDV; (SEQ ID NO:3)
- SEQ ID NOS:4-6 RSSQSIVHSNVNTYLE; (SEQ ID NO:4) KVSNRFS; (SEQ ID NO:5) FQGSHVPPT. (SEQ ID NO:6)
- antibodies having a humanized or resurfaced light chain variable region having an amino acid sequence corresponding to one of SEQ ID NOS:9-12: (SEQ ID NO:9) DVVMTQTPLSLPVSLGDPASISCRSSQSIVHSNVNTYLEWYLQKPGQSPR LLIYKVSNRFSGVPDRFSGSGAGTDFTLRISRVEAEDLGIYYCFQGSHVP PTFGGGTKLEIKR; (SEQ ID NO:10) DVLMTQTPLSLPVSLGDPASISCRSSQSIVHSNVNTYLEWYLQKPGQSPK LLIYKVSNRFSGVPDRFSGSGAGTDFTLRISRVEAEDLGIYYCFQGSHVP PTFGGGTKLEIKR; (SEQ ID NO:11) DVLMTQTPLSLPVSLGDPASISCRSSQSIVHSNVNTYLEWYLQKPGQSPR LLIYKVSNRFSGVPDRFSGSGAGTDFTLRISRVEAEDLGIYY
- antibodies having a humanized or resurfaced heavy chain variable region having an amino acid sequence corresponding to SEQ ID NO: 13: (SEQ ID NO:13) QVQLVQSGAEVVKPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGE INPSNGRTNYNQKFQGKATLTVDKSSSTAYMQLSSLTSEDSAVYYFARGR PDYYGSSKWYFDVWGQGTTVTVSS.
- antibodies or antibody fragments of the present invention are provided that have improved properties.
- antibodies or antibody fragments having improved affinity for IGF-I-receptor are prepared by affinity maturation of an antibody or fragment of the present invention.
- the present invention further provides conjugates of said antibodies, wherein a cytotoxic agent is covalently attached, directly or via a cleavable or non-cleavable linker, to an antibody or epitope-binding fragment of an antibody of the present invention.
- a cytotoxic agent is covalently attached, directly or via a cleavable or non-cleavable linker, to an antibody or epitope-binding fragment of an antibody of the present invention.
- the cytotoxic agent is a taxol, a maytansinoid, CC-1065 or a CC-1065 analog.
- the present invention further provides for antibodies or fragments thereof that are further labeled for use in research or diagnostic applications.
- the label is a radiolabel, a fluorophore, a chromophore, an imaging agent or a metal ion.
- a method for diagnosis is also provided in which said labeled antibodies or fragments are administered to a subject suspected of having a cancer, and the distribution of the label within the body of the subject is measured or monitored.
- the invention provides methods for the treatment of a subject having a cancer by administering an antibody, antibody fragment or antibody conjugate of the present invention, either alone or in combination with other cytotoxic or therapeutic agents.
- the cancer can be one or more of, for example, breast cancer, colon cancer, ovarian carcinoma, osteosarcoma, cervical cancer, prostate cancer, lung cancer, synovial carcinoma, pancreatic cancer, or other cancer yet to be determined in which IGF-I receptor levels are elevated.
- the invention provides methods for the treatment of a subject having a cancer by administering an antibody, antibody fragment or antibody conjugate of the present invention, either alone or in combination with other cytotoxic or therapeutic agents.
- preferred cytotoxic and therapeutic agents include docetaxel, paclitaxel, doxorubicin, epirubicin, cyclophosphamide, trastuzumab (Herceptin), capecitabine, tamoxifen, toremifene, letrozole, anastrozole, fulvestrant, exemestane, goserelin, oxaliplatin, carboplatin, cisplatin, dexamethasone, antide, bevacizumab (Avastin), 5-fluorouracil, leucovorin, levamisole, irinotecan, etoposide, topotecan, gemcitabine, vinorelbine, estramustine, mitoxantrone, abarelix,
- the cancer can be one or more of, for example, breast cancer, colon cancer, ovarian carcinoma, osteosarcoma, cervical cancer, prostate cancer, lung cancer, synovial carcinoma, pancreatic cancer, melanoma, multiple myeloma, neuroblastoma, and rhabdomyosarcoma, or other cancer yet to be determined in which IGF-I receptor levels are elevated.
- kits comprising one or more of the elements described herein, and instructions for the use of those elements.
- a kit of the present invention includes antibody, antibody fragment or conjugate of the invention, and a therapeutic agent.
- the instructions for this preferred embodiment include instructions for inhibiting the growth of a cancer cell using the antibody, antibody fragment or conjugate of the invention, and the therapeutic agent, and/or instructions for a method of treating a patient having a cancer using the antibody, antibody fragment or conjugate of the invention, and the therapeutic agent.
- FIG. 1 shows fluorescence activated cell sorting (FACS) analysis of the specific binding of purified EM164 antibody to cells overexpressing human Y1251F IGF-I receptor or human insulin receptor.
- FACS fluorescence activated cell sorting
- FIG. 2 shows a binding titration curve for the binding of EM164 antibody to biotinylated human IGF-I receptor.
- FIG. 3 shows the inhibition of the binding of biotinylated IGF-I to human breast cancer MCF-7 cells by EM164 antibody.
- FIG. 4 shows the inhibition of IGF-I-stimulated autophosphorylation of IGF-I receptor in MCF-7 cells by EM164 antibody.
- FIG. 5 shows the inhibition of IGF-I-stimulated IRS-1-phosphorylation in MCF-7 cells by EM164 antibody.
- FIG. 6 shows the inhibition of IGF-I-stimulated signal transduction in SaOS-2 cells by EM164 antibody.
- FIG. 7 shows the effect of EM164 antibody on the growth and survival of MCF-7 cells under different growth conditions, as assessed by MTT assay.
- FIG. 8 shows the effect of EM164 antibody on the growth and survival of MCF-7 cells in the presence of various serum concentrations.
- FIG. 9 shows the inhibition of IGF-I- and serum-stimulated growth and survival of NCI-H838 cells by EM164 antibody.
- FIG. 10 shows the effect of treatment with EM164 antibody, taxol, or a combination of EM164 antibody and taxol, on the growth of a Calu-6 lung cancer xenograft in mice.
- FIG. 11 shows competition between the binding of humanized EM164 antibody (v.1.0) and murine EM164 antibody.
- FIG. 12 shows the cDNA (SEQ ID NO:49) and amino acid sequences (SEQ ID NO:50) of the light chain leader and variable region of the murine anti-IGF-I receptor antibody EM164.
- the arrow marks the start of framework 1.
- the 3 CDR sequences according to Kabat are underlined.
- FIG. 13 shows the cDNA (SEQ ID NO:51) and amino acid sequences (SEQ ID NO:52) of the heavy chain leader and variable region for the murine anti-IGF-I receptor antibody EM164.
- the arrow marks the start of framework 1.
- the 3 CDR sequences according to Kabat are underlined.
- FIG. 14 shows the light and heavy chain CDR amino acid sequences of antibody EM164 as determined from Chothia canonical class definitions. AbM modeling software definitions for the heavy chain CDRs are also shown.
- Light Chain: CDR1 is SEQ ID NO:4, CDR2 is SEQ ID NO:5, and CDR3 is SEQ ID NO:6.
- Heavy Chain: CDR1 is SEQ ID NO:1, CDR2 is SEQ ID NO:2, and CDR3 is SEQ ID NO:3.
- AbM Heavy Chain: CDR1 is SEQ ID NO:53, CDR2 is SEQ ID NO:54, and CDR3 is SEQ ID NO:55.
- FIG. 15 shows the light chain and heavy chain amino acid sequences for anti-IGF-I-receptor antibody EM164 aligned with the germline sequences for the Cr1 (SEQ ID NO:56) and J558.c (SEQ ID NO:57) genes. Dashes (-) indicate sequence identity.
- FIG. 16 shows the plasmids used to build and express the recombinant chimeric and humanized EM164 antibodies.
- FIG. 17 shows the 10 most homologous amino acid sequences of the light chains screened from the 127 antibodies in the set of structure files used to predict the surface residues of EM164.
- em164 LC (SEQ ID NO:58), 2jel (SEQ ID NO:59), 2pcp (SEQ ID NO:60), 1nqb (SEQ ID NO:61), 1kel (SEQ ID NO:62), 1hyx (SEQ ID NO:63), 1igf (SEQ ID NO:64), 1tet (SEQ ID NO:65), 1clz (SEQ ID NO:66), 1bln (SEQ ID NO:67), 1cly (SEQ ID NO:68), Consensus (SEQ ID NO:69).
- FIG. 18 shows the 10 most homologous amino acid sequences of the heavy chains screened from the 127 antibodies in the set of structure files used to predict the surface residues of EM164.
- em164 HC (SEQ ID NO:70), 1nqb (SEQ ID NO:71), 1ngp (SEQ ID NO:72), 1fbi (SEQ ID NO:73), 1afv (SEQ ID NO:74), 1yuh (SEQ ID NO:75), 1plg (SEQ ID NO:76), 1d5b (SEQ ID NO:77), 1ae6 (SEQ ID NO:78), 1axs (SEQ ID NO:79), 3hfl (SEQ ID NO:80), Consensus (SEQ ID NO:81).
- FIG. 19 shows the average accessibility for each of the (A) light, and (B) heavy chain variable region residues from the 10 most homologous structures.
- the numbers represent the Kabat antibody sequence position numbers.
- FIG. 20 shows the light chain variable region amino acid sequences for murine EM164 (muEM164) and humanized EM164 (huEM164) antibodies.
- muEM164 SEQ ID NO:82
- huEM164 V1.0 SEQ ID NO:83
- huEM164 V1.1 SEQ ID NO:84
- huEM164 V1.2 SEQ ID NO:85
- huEM164 V1.3 SEQ ID NO:86.
- FIG. 21 shows the heavy chain variable region amino acid sequences for murine (muEM164, SEQ ID NO:87) and humanized EM164 antibodies (huEM164, SEQ ID NO:88).
- FIG. 22 shows the huEM164 v1.0 variable region DNA and amino acid sequences for both the light (DNA, SEQ ID NO:89, amino acid SEQ ID NO:90) and heavy chains (DNA, SEQ ID NO:91, amino acid SEQ ID NO:92).
- FIG. 23 shows the light chain variable region DNA and amino acid sequences for humanized EM164 v1.1 (DNA, SEQ ID NO:93; amino acid SEQ ID NO:94), v1.2 (DNA, SEQ ID NO:95; amino acid SEQ ID NO:96) and v1.3 (DNA, SEQ ID NO:97; amino acid SEQ ID NO:98).
- FIG. 24 shows the inhibition of IGF-I-stimulated growth and survival of MCF-7 cells by humanized EM164 v1.0 antibody and murine EM164 antibody.
- FIG. 25 shows that EM164 suppresses IGF-1-stimulated cycling of MCF-7 cells.
- FIG. 26 shows that EM164 suppresses the anti-apoptotic effect of IGF-1 and serum. Treatment with EM164 results in apoptotic cell death as demonstrated by the increased levels of cleaved CK18 protein.
- FIG. 27 shows the effect of treatment with EM164 antibody, gemcitabine, or a combination of EM164 antibody and gemcitabine, on the growth of human BxPC-3 pancreatic cancer xenografts in immunodeficient mice.
- the present inventors have discovered and improved novel antibodies that specifically bind to the human insulin-like growth factor-I receptor (IGF-IR) on the cell surface.
- the antibodies and fragments have the unique ability to inhibit the cellular functions of the receptor without the capacity to activate the receptor themselves.
- the antibodies or fragments of the present invention antagonize IGF-IR but are substantially devoid of agonist activity.
- the antibodies and antibody fragments of the present invention inhibit the growth of human tumor cells such as MCF-7 cells in the presence of serum by greater than 80%, which is a higher degree of inhibition than is obtained using previously known anti-IGF-IR antibodies.
- the present invention proceeds from a murine anti-IGF-IR antibody, herein EM164, that is fully characterized with respect to the amino acid sequences of both light and heavy chains, the identification of the CDRs, the identification of surface amino acids, and means for its expression in recombinant form.
- EM164 murine anti-IGF-IR antibody
- the germline sequences are shown in FIG. 15 aligned with the sequence of EM164.
- the comparison identifies probable somatic mutations in EM164, including one each in CDR1 in the light chain and in CDR2 in the heavy chain.
- antibodies and antibody fragments may differ from antibody EM164 or the humanized derivatives in the amino acid sequences of their scaffold, CDRs, light chain and heavy chain, and still fall within the scope of the present invention.
- the CDRs of antibody EM164 are identified by modeling and their molecular structures have been predicted. Again, while the CDRs are important for epitope recognition, they are not essential to the antibodies and fragments of the invention. Accordingly, antibodies and fragments are provided that have improved properties produced by, for example, affinity maturation of an antibody of the present invention.
- variable and constant region sequences that flank a particular set of CDRs.
- different classes of Ab are possible for a given set of CDRs by substitution of different heavy chains, whereby, for example, IgG1-4, IgM, IgA1-2, IgD, IgE antibody types and isotypes may be produced.
- artificial antibodies within the scope of the invention may be produced by embedding a given set of CDRs within an entirely synthetic framework.
- the term “variable” is used herein to describe certain portions of the variable domains that differ in sequence among antibodies and are used in the binding and specificity of each particular antibody for its antigen.
- variable domains of the antibodies typically concentrated in three segments called complementarity determining regions (CDRs) or hypervariable regions both in the light chain and the heavy chain variable domains.
- CDRs complementarity determining regions
- FR framework
- the variable domains of heavy and light chains each comprise four framework regions, largely adopting a beta-sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of the beta-sheet structure.
- the CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen binding site of antibodies (E. A. Kabat et al. Sequences of Proteins of Immunological Interest , fifth edition, 1991, NIH).
- the constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.
- Humanized antibodies, or antibodies adapted for non-rejection by other mammals may be produced using several technologies such as resurfacing and CDR grafting.
- resurfacing technology molecular modeling, statistical analysis and mutagenesis are combined to adjust the non-CDR surfaces of variable regions to resemble the surfaces of known antibodies of the target host.
- Strategies and methods for the resurfacing of antibodies, and other methods for reducing immunogenicity of antibodies within a different host, are disclosed in U.S. Pat. No. 5,639,641, which is hereby incorporated in its entirety by reference.
- the murine heavy and light chain CDRs are grafted into a fully human framework sequence.
- the invention also includes functional equivalents of the antibodies described in this specification.
- Functional equivalents have binding characteristics that are comparable to those of the antibodies, and include, for example, chimerized, humanized and single chain antibodies as well as fragments thereof.
- Methods of producing such functional equivalents are disclosed in PCT Application WO 93/21319, European Patent Application No. 239,400; PCT Application WO 89/09622; European Patent Application 338,745; and European Patent Application EP 332,424, which are incorporated in their respective entireties by reference.
- Functional equivalents include polypeptides with amino acid sequences substantially the same as the amino acid sequence of the variable or hypervariable regions of the antibodies of the invention. “Substantially the same” as applied to an amino acid sequence is defined herein as a sequence with at least about 90%, and more preferably at least about 95% sequence identity to another amino acid sequence, as determined by the FASTA search method in accordance with Pearson and Lipman, Proc. Natl. Acad. Sci. USA 85, 2444-2448 (1988).
- Chimerized antibodies preferably have constant regions derived substantially or exclusively from human antibody constant regions and variable regions derived substantially or exclusively from the sequence of the variable region from a mammal other than a human.
- Humanized forms of the antibodies are made by substituting the complementarity determining regions of, for example, a mouse antibody, into a human framework domain, e.g., see PCT Pub. No. WO92/22653.
- Humanized antibodies preferably have constant regions and variable regions other than the complementarity determining regions (CDRs) derived substantially or exclusively from the corresponding human antibody regions and CDRs derived substantially or exclusively from a mammal other than a human.
- CDRs complementarity determining regions
- Functional equivalents also include single-chain antibody fragments, also known as single-chain antibodies (scFvs). These fragments contain at least one fragment of an antibody variable heavy-chain amino acid sequence (V H ) tethered to at least one fragment of an antibody variable light-chain sequence (V L ) with or without one or more interconnecting linkers.
- V H antibody variable heavy-chain amino acid sequence
- V L antibody variable light-chain sequence
- Such a linker may be a short, flexible peptide selected to assure that the proper three-dimensional folding of the (V L ) and (V H ) domains occurs once they are linked so as to maintain the target molecule binding-specificity of the whole antibody from which the single-chain antibody fragment is derived.
- the carboxyl terminus of the (V L ) or (V H ) sequence may be covalently linked by such a peptide linker to the amino acid terminus of a complementary (V L ) and (V H ) sequence.
- Single-chain antibody fragments may be generated by molecular cloning, antibody phage display library or similar techniques. These proteins may be produced either in eukaryotic cells or prokaryotic cells, including bacteria.
- Single-chain antibody fragments contain amino acid sequences having at least one of the variable or complementarity determining regions (CDRs) of the whole antibodies described in this specification, but are lacking some or all of the constant domains of those antibodies. These constant domains are not necessary for antigen binding, but constitute a major portion of the structure of whole antibodies. Single-chain antibody fragments may therefore overcome some of the problems associated with the use of antibodies containing a part or all of a constant domain. For example, single-chain antibody fragments tend to be free of undesired interactions between biological molecules and the heavy-chain constant region, or other unwanted biological activity.
- single-chain antibody fragments are considerably smaller than whole antibodies and may therefore have greater capillary permeability than whole antibodies, allowing single-chain antibody fragments to localize and bind to target antigen-binding sites more efficiently. Also, antibody fragments can be produced on a relatively large scale in prokaryotic cells, thus facilitating their production. Furthermore, the relatively small size of single-chain antibody fragments makes them less likely to provoke an immune response in a recipient than whole antibodies.
- Functional equivalents further include fragments of antibodies that have the same, or comparable binding characteristics to those of the whole antibody.
- Such fragments may contain one or both Fab fragments or the F(ab′) 2 fragment.
- the antibody fragments Preferably contain all six complementarity determining regions of the whole antibody, although fragments containing fewer than all of such regions, such as three, four or five CDRs, are also functional.
- the functional equivalents may be or may combine members of any one of the following immunoglobulin classes: IgG, IgM, IgA, IgD, or IgE, and the subclasses thereof.
- variants of the primary antibody have been generated by changing the sequences of the heavy and light chain genes in the CDR1, CDR2, CDR3, or framework regions, using methods such as oligonucleotide-mediated site-directed mutagenesis, cassette mutagenesis, error-prone PCR, DNA shuffling, or mutator-strains of E. coli (Vaughan, T. J. et al., 1998 , Nature Biotechnology , 16, 535-539; Adey, N. B. et al., 1996, Chapter 16, pp. 277-291, in “ Phage Display of Peptides and Proteins ”, Eds. Kay, B. K. et al., Academic Press).
- the antibody sequences described in this invention can be used to develop anti-IGF-I receptor antibodies with improved functions.
- the conjugates of the present invention comprise the antibody, fragments, and their analogs as disclosed herein, linked to a cytotoxic agent.
- cytotoxic agents are maytansinoids, taxanes and analogs of CC-1065.
- the conjugates can be prepared by in vitro methods.
- a linking group is used. Suitable linking groups are well known in the art and include disulfide groups, thioether groups, acid labile groups, photolabile groups, peptidase labile groups and esterase labile groups.
- Preferred linking groups are disulfide groups and thioether groups.
- conjugates can be constructed using a disulfide exchange reaction or by forming a thioether bond between the antibody and the cytotoxic agent.
- Maytansinoids and maytansinoid analogs are among the preferred cytotoxic agents.
- suitable maytansinoids include maytansinol and maytansinol analogs.
- suitable maytansinoids are disclosed in U.S. Pat. Nos. 4,424,219; 4,256,746; 4,294,757; 4,307,016; 4,313,946; 4,315,929; 4,331,598; 4,361,650; 4,362,663; 4,364,866; 4,450,254; 4,322,348; 4,371,533; 6,333,410; 5,475,092; 5,585,499; and 5,846,545.
- Taxanes are also preferred cytotoxic agents. Taxanes suitable for use in the present invention are disclosed in U.S. Pat. Nos. 6,372,738 and 6,340,701.
- CC-1065 and its analogs are also preferred cytotoxic drugs for use in the present invention.
- CC-1065 and its analogs are disclosed in U.S. Pat. Nos. 6,372,738; 6,340,701; 5,846,545 and 5,585,499.
- CC-1065 is a potent anti-tumor antibiotic isolated from the culture broth of Streptomyces zelensis .
- CC-1065 is about 1000-fold more potent in vitro than are commonly used anti-cancer drugs, such as doxorubicin, methotrexate and vincristine (B. K. Bhuyan et al., Cancer Res ., 42, 3532-3537 (1982)).
- Cytotoxic drugs such as methotrexate, daunorubicin, doxorubicin, vincristine, vinblastine, melphalan, mitomycin C, chlorambucil, and calicheamicin are also suitable for the preparation of conjugates of the present invention, and the drug molecules can also be linked to the antibody molecules through an intermediary carrier molecule such as serum albumin.
- the antibodies of the present invention typically will be labeled with a detectable moiety.
- the detectable moiety can be any one which is capable of producing, either directly or indirectly, a detectable signal.
- the detectable moiety may be a radioisotope, such as 3 H, 14 C, 32 P, 35 S, or 131 I; a fluorescent or chemiluminescent compound, such as fluorescein isothiocyanate, rhodamine, or luciferin; or an enzyme, such as alkaline phosphatase, beta-galactosidase or horseradish peroxidase.
- any method known in the art for conjugating the antibody to the detectable moiety may be employed, including those methods described by Hunter, et al., Nature 144:945 (1962); David, et al., Biochemistry 13:1014 (1974); Pain, et al., J. Immunol. Meth. 40:219 (1981); and Nygren, J. Histochem. and Cytochem. 30:407 (1982).
- the antibodies of the present invention can be employed in any known assay method, such as competitive binding assays, direct and indirect sandwich assays, and immunoprecipitation assays (Zola, Monoclonal Antibodies: A Manual of Techniques, pp.147-158 (CRC Press, Inc., 1987)).
- the antibodies of the invention also are useful for in vivo imaging, wherein an antibody labeled with a detectable moiety such as a radio-opaque agent or radioisotope is administered to a subject, preferably into the bloodstream, and the presence and location of the labeled antibody in the host is assayed.
- a detectable moiety such as a radio-opaque agent or radioisotope
- This imaging technique is useful in the staging and treatment of malignancies.
- the antibody may be labeled with any moiety that is detectable in a host, whether by nuclear magnetic resonance, radiology, or other detection means known in the art.
- the antibodies of the invention also are useful as affinity purification agents.
- the antibodies are immobilized on a suitable support, such a Sephadex resin or filter paper, using methods well known in the art.
- the antibodies of the invention also are useful as reagents in biological research, based on their inhibition of the function of IGF-I receptor in cells.
- the antibodies or conjugates of the invention are administered to a subject, in a pharmaceutically acceptable dosage form. They can be administered intravenously as a bolus or by continuous infusion over a period of time, by intramuscular, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, topical, or inhalation routes.
- the antibody may also be administered by intratumoral, peritumoral, intralesional, or perilesional routes, to exert local as well as systemic therapeutic effects.
- Suitable pharmaceutically acceptable carriers, diluents, and excipients are well known and can be determined by those of skill in the art as the clinical situation warrants.
- Suitable carriers, diluents and/or excipients include: (1) Dulbecco's phosphate buffered saline, pH about 7.4, containing about 1 mg/ml to 25 mg/ml human serum albumin, (2) 0.9% saline (0.9% w/v NaCl), and (3) 5% (w/v) dextrose.
- the method of the present invention can be practiced in vitro, in vivo, or ex vivo.
- the antibodies, antibody fragments or conjugates of the invention are co-administered, or administered sequentially, with one or more additional therapeutic agents.
- Suitable therapeutic agents include, but are not limited to, cytotoxic or cytostatic agents. Taxol is a preferred therapeutic agent that is also a cytotoxic agent.
- Cancer therapeutic agents are those agents that seek to kill or limit the growth of cancer cells while doing minimal damage to the host. Thus, such agents may exploit any difference in cancer cell properties (e.g. metabolism, vascularization or cell-surface antigen presentation) from healthy host cells. Differences in tumor morphology are potential sites for intervention: for example, the second therapeutic can be an antibody such as an anti-VEGF antibody that is useful in retarding the vascularization of the interior of a solid tumor, thereby slowing its growth rate.
- the second therapeutic can be an antibody such as an anti-VEGF antibody that is useful in retarding the vascularization of the interior of a solid tumor, thereby slowing its growth rate.
- adjuncts such as granisetron HCl, androgen inhibitors such as leuprolide acetate, antibiotics such as doxorubicin, antiestrogens such as tamoxifen, antimetabolites such as interferon alpha-2a, cytotoxic agents such as taxol, enzyme inhibitors such as ras famesyl-transferase inhibitor, immunomodulators such as aldesleukin, and nitrogen mustard derivatives such as melphalan HCl, and the like.
- adjuncts such as granisetron HCl
- androgen inhibitors such as leuprolide acetate
- antibiotics such as doxorubicin
- antiestrogens such as tamoxifen
- antimetabolites such as interferon alpha-2a
- cytotoxic agents such as taxol
- enzyme inhibitors such as ras famesyl-transferase inhibitor
- immunomodulators such as aldesleukin, and nitrogen mustard derivatives such as melphal
- the therapeutic agents that can be combined with EM164 for improved anti-cancer efficacy include diverse agents used in oncology practice (Reference: Cancer, Principles & Practice of Oncology, DeVita, V. T., Hellman, S., Rosenberg, S.
- the one or more additional therapeutic agents can be administered before, concurrently, or after the antibody, antibody fragment or conjugate of the invention.
- the skilled artisan will understand that for each therapeutic agent there may be advantages to a particular order of administration. Similarly, the skilled artisan will understand that for each therapeutic agent, the length of time between which the agent, and an antibody, antibody fragment or conjugate of the invention is administered, will vary.
- the dosage of each therapeutic agent will be dependent on the identity of the agent, the preferred dosages can range from about 10 mg/square meter to about 2000 mg/square meter, more preferably from about 50 mg/square meter to about 1000 mg/square meter.
- the preferred dosage is about 10 mg/square meter to about 400 mg/square meter
- for taxanes (paclitaxel, docetaxel) the preferred dosage is about 20 mg/square meter to about 150 mg/square meter
- for gemcitabine the preferred dosage is about 100 mg/square meter to about 2000 mg/square meter
- for camptothecin the preferred dosage is about 50 mg/square meter to about 350 mg/square meter.
- the dosage of this and other therapeutic agents may depend on whether the antibody, antibody fragment or conjugate of the invention is administered concurrently or sequentially with a therapeutic agent.
- an antibody, antibody fragment or conjugate of the invention, and one or more additional therapeutic agents may occur as described above for therapeutic applications.
- Suitable pharmaceutically acceptable carriers, diluents, and excipients for co-administration will be understood by the skilled artisan to depend on the identity of the particular therapeutic agent being co-administered.
- the antibody When present in an aqueous dosage form, rather than being lyophilized, the antibody typically will be formulated at a concentration of about 0.1 mg/ml to 100 mg/ml, although wide variation outside of these ranges is permitted.
- the appropriate dosage of antibody or conjugate will depend on the type of disease to be treated, as defined above, the severity and course of the disease, whether the antibodies are administered for preventive or therapeutic purposes, the course of previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician.
- the antibody is suitably administered to the patient at one time or over a series of treatments.
- preferably from about 1 mg/square meter to about 2000 mg/square meter of antibody is an initial candidate dosage for administration to the patient, more preferably from about 10 mg/square meter to about 1000 mg/square meter of antibody whether, for example, by one or more separate administrations, or by continuous infusion.
- the treatment is repeated until a desired suppression of disease symptoms occurs.
- other dosage regimens may be useful and are not excluded.
- kits comprising one or more of the elements described herein, and instructions for the use of those elements.
- a kit of the present invention includes antibody, antibody fragment or conjugate of the invention, and a therapeutic agent.
- the instructions for this preferred embodiment include instructions for inhibiting the growth of a cancer cell using the antibody, antibody fragment or conjugate of the invention, and the therapeutic agent, and/or instructions for a method of treating a patient having a cancer using the antibody, antibody fragment or conjugate of the invention, and the therapeutic agent.
- the antibody used in the kit has the same amino acid sequence as the murine antibody EM164 produced by mouse hybridoma EM164 (ATCC accession number PTA-4457), or the antibody is an epitope-binding fragment thereof, wherein both the antibody and the fragment specifically bind to insulin-like growth factor-I receptor.
- the antibody and antibody fragment used in the kit may also be a resurfaced version of the EM164 antibody, a humanized version of the EM164 antibody, or an altered version of the EM164 antibody having least one nucleotide mutation, deletion or insertion. Antibodies and antibody fragments of each of these three versions retain the same binding specificity as the EM164 antibody.
- the therapeutic agent used in the kit is selected from the group consisting of docetaxel, paclitaxel, doxorubicin, epirubicin, cyclophosphamide, trastuzumab (Herceptin), capecitabine, tamoxifen, toremifene, letrozole, anastrozole, fulvestrant, exemestane, goserelin, oxaliplatin, carboplatin, cisplatin, dexamethasone, antide, bevacizumab (Avastin), 5-fluorouracil, leucovorin, levamisole, irinotecan, etoposide, topotecan, gemcitabine, vinorelbine, estramustine, mitoxantrone, abarelix, zoledronate, streptozocin, rituximab (Rituxan), idarubicin, busulfan, chlorambucil, fludar
- kits of the present invention are in a suitable form for a kit, such as a solution or lyophilized powder.
- concentration or amount of the elements of the kits will be understood by the skilled artisan to varying depending on the identity and intended use of each element of the kit.
- kits include breast cancer, colon cancer, ovarian carcinoma, osteosarcoma, cervical cancer, prostate cancer, lung cancer, synovial carcinoma, pancreatic cancer, melanoma, multiple myeloma, neuroblastoma, and rhabdomyosarcoma.
- a cell line expressing human IGF-I receptor with a Y1251F mutation was used for immunization as it expressed a high number of IGF-I receptors ( ⁇ 10 7 per cell).
- the Y1251F-mutation in the cytoplasmic domain of IGF-I receptor resulted in loss of transformation and anti-apoptotic signaling, but did not affect IGF-I binding and IGF-I-stimulated mitogenic signaling (O'Connor, R. et al., 1997 , Mol. Cell. Biol ., 17, 427-435; Miura, M. et al., 1995 , J. Biol. Chem ., 270, 22639-22644).
- the mutation did not otherwise affect antibody generation because the antibody of this example bound to the extracellular domain of IGF-I receptor, which was identical for both the Y1251F mutant and the wild type receptor.
- a cell line expressing human IGF-I receptor with a Y1251F mutation was generated from 3T3-like cells of a IGF-I-receptor-deficient mouse by transfection with Y1251F-mutant human IGF-I-receptor gene together with a puromycin-resistance gene, and was selected using puromycin (2.5 microgram/mL) and by FACS sorting for high IGF-I receptor expression (Miura, M. et al., 1995 , J. Biol. Chem ., 270, 22639-22644).
- a cell line having a high level of IGF-I receptor expression was further selected using a high concentration of puromycin such as 25 microgram/mL, which was toxic to most of the cells. Surviving colonies were picked and those displaying a high level of IGF-I receptor expression were selected.
- CAF1/J female mice 6 months old, were immunized intraperitoneally on day 0 with Y125IF-mutant-human-IGF-I-receptor-overexpressing cells (5 ⁇ 10 5 cells, suspended in 0.2 mL PBS). The animals were boosted with 0.2 mL cell suspension as follows: day 2, 1 ⁇ 10 6 cells; day 5, 2 ⁇ 10 6 cells; days 7, 9, 12, and 23, 1 ⁇ 10 7 cells. On day 26, a mouse was sacrificed and its spleen removed.
- the spleen was ground between two frosted glass slides to obtain a single cell suspension, which was washed with serum-free RPMI medium containing penicillin and streptomycin (SFM).
- the spleen cell pellet was resuspended in 10 mL of 0.83% (w/v) ammonium chloride solution in water for 10 min on ice to lyse the red blood cells, and was then washed with serum-free medium (SFM).
- Spleen cells (1.2 ⁇ 10 8 ) were pooled with myeloma cells (4 ⁇ 10 7 ) from the non-secreting mouse myeloma cell line P3X63Ag8.653 (ATCC, Rockville, Md.; Cat.
- ⁇ cells were pelleted by centrifugation, washed in SFM and resuspended in RPMI-1640 growth medium supplemented with 5% fetal bovine serum (FBS), hypoxanthine/aminopterin/thymidine (HAT), penicillin, streptomycin, and 10% hybridoma cloning supplement (HCS).
- FBS fetal bovine serum
- HAT hypoxanthine/aminopterin/thymidine
- HCS hybridoma cloning supplement
- Cells were seeded into 96-well flat-bottom tissue culture plates at 2 ⁇ 10 5 spleen cells in 200 ⁇ L per well. After 5-7 days, 100 ⁇ L per well were removed and replaced with growth medium supplemented with hypoxanthine/thymidine (HT) and 5% FBS.
- HT hypoxanthine/thymidine
- FBS hypoxanthine/thymidine
- Culture supernatants from hybridoma clones were screened for binding to purified human IGF-I receptor by ELISA, for specific binding to cells overexpressing human IGF-I receptor, and for a lack of binding to cells overexpressing human insulin receptor by ELISA and FACS screening as described below. Clones exhibiting higher binding affinity to cells overexpressing human IGF-I receptor than to cells overexpressing human insulin receptor were expanded and subcloned. The culture supernatants of the subclones were further screened by the above binding assays. By this procedure, subclone 3F1-C8-D7 (EM164) was selected, and the heavy and light chain genes were cloned and sequenced as described below.
- EM164 subclone 3F1-C8-D7
- Human IGF-I receptor was isolated for use in the screening of supernatants from hybridoma clones for their binding to IGF-I receptor by the method below.
- Biotinylated IGF-I was prepared by modification of recombinant IGF-I using biotinylating reagents such as sulfo-NHS-LC-biotin, sulfo-NHS-SS-biotin, or NHS-PEO 4 -biotin. Biotinylated IGF-I was absorbed on streptavidin-agarose beads and incubated with lysate from cells that overexpressed human wild type or Y1251F mutant IGFR.
- the beads were washed and eluted with a buffer containing 2 to 4 M urea and detergent such as triton X-100 or octyl- ⁇ -glucoside.
- Eluted IGF-I receptor was dialyzed against PBS and was analyzed for purity by SDS-PAGE under reducing conditions, which showed alpha and beta chain bands of IGF-I receptor of molecular weights about 135 kDa and 95 kDa, respectively.
- an Immulon-4HB ELISA plate (Dynatech) was coated with a purified human IGF-I receptor sample (prepared by dialysis from urea/octyl- ⁇ -glucoside elution of affinity purified sample) diluted in 50 mM CHES buffer at pH 9.5 (100 ⁇ L; 4° C., overnight).
- the wells were blocked with 200 ⁇ L of blocking buffer (10 mg/mL BSA in TBS-T buffer containing 50 mM Tris, 150 mM NaCl, pH 7.5, and 0.1% Tween-20) and incubated with supernatants from hybridoma clones (100 ⁇ L; diluted in blocking buffer) for about 1 h to 12 h, washed with TBS-T buffer, and incubated with goat-anti-mouse-IgG-Fc-antibody-horseradish peroxidase (HRP) conjugate (100 ⁇ L; 0.8 ⁇ g/mL in blocking buffer; Jackson ImmunoResearch Laboratories), followed by washes and detection using ABTS/H 2 O 2 substrate at 405 nm (0.5 mg/mL ABTS, 0.03% H 2 O 2 in 0.1 M citrate buffer pH 4.2).
- blocking buffer 10 mg/mL BSA in TBS-T buffer containing 50 mM Tris, 150 mM NaC
- a supernatant from a 3F1 hybridoma subclone yielded a signal of about 1.2 absorbance units within 3 min of development, in contrast to values of 0.0 obtained for supernatants from some other hybridoma clones.
- General conditions for this ELISA were similar to the standard ELISA conditions for antibody binding and detection as described by E. Harlow and D. Lane (“Using Antibodies: A Laboratory Manual”; 1999, Cold Spring Harbor Laboratory Press, New York), which conditions can also be used.
- the washed cells (100 ⁇ L of about 1-3 ⁇ 10 6 cells/mL) were added to wells of an Immulon-2HB plate coated with phytohemagglutinin (100 ⁇ L of 20 ⁇ g/mL PHA), centrifuged and allowed to adhere to PHA-coated wells for 10 min.
- the plate with cells was flicked to remove PBS and was then dried overnight at 37° C.
- the wells were blocked with 5 mg/mL BSA solution in PBS for 1 h at 37° C. and were then washed gently with PBS.
- a typical supernatant from a 3F1 hybridoma subclone upon incubation with cells overexpressing IGF-I receptor yielded a signal of 0.88 absorbance units within 12 min of development, in contrast to a value of 0.22 absorbance units obtained upon incubation with cells overexpressing human insulin receptor.
- the hybridoma was grown in Integra CL 350 flasks (Integra Biosciences, Maryland), according to manufacturer's specifications, to provide purified EM164 antibody.
- a yield of about 0.5-1 mg/mL antibody was obtained in the harvested supernatants from the Integra flasks, based on quantitation by ELISA and by SDS-PAGE/Coomassie blue staining using antibody standards.
- the antibody was purified by affinity chromatography on Protein A-agarose bead column under standard purification conditions of loading and washing in 100 mM Tris buffer, pH 8.9, containing 3 M NaCl, followed by elution in 100 mM acetic acid solution containing 150 mM NaCl.
- the eluted fractions containing antibody were neutralized with cold 2 M K 2 HPO 4 solution and dialyzed in PBS at 4° C.
- the purified antibody sample was analyzed by SDS-PAGE under reducing conditions and Coomassie blue staining, which indicated only heavy and light chain bands of antibody at about 55 kDa and 25 kDa, respectively.
- the isotype of the purified antibody was IgG 1 with kappa light chain.
- the specific binding of the purified EM 164 antibody was demonstrated by fluorescence activated cell sorting (FACS) using cells overexpressing human IGF-I receptor and by using cells that overexpressed human insulin receptor ( FIG. 1 ).
- FACS fluorescence activated cell sorting
- Incubation of EM 164 antibody (50-100 nM) in 100 ⁇ L cold FACS buffer (1 mg/mL BSA in Dulbecco's MEM medium) was performed using cells overexpressing IGF-I receptor and using cells overexpressing insulin receptor (2 ⁇ 10 5 cells/mL) in a round-bottom 96-well plate for 1 h.
- the cells were pelleted by centrifugation and washed with cold FACS buffer by gentle flicking, followed by incubation with goat-anti-mouse-IgG-antibody-FITC conjugate (100 ⁇ L; 10 ⁇ mg/mL in FACS buffer) on ice for 1 h.
- the cells were pelleted, washed, and resuspended in 120 ⁇ L of 1% formaldehyde solution in PBS.
- the plate was analyzed using a FACSCalibur reader (BD Biosciences).
- FIG. 1 A strong fluorescence shift was obtained upon incubation of IGF-I receptor overexpressing cells with EM 164 antibody, in contrast to an insignificant shift upon incubation of insulin receptor overexpressing cells with EM 164 antibody ( FIG. 1 ), which demonstrated that the EM 164 antibody was selective in its binding to IGF-I receptor and did not bind to insulin receptor.
- the dissociation constant (K d ) for the binding of EM164 antibody with human IGF-I receptor was determined by ELISA titration of the binding of antibody at several concentrations with either directly coated IGF-I receptor (affinity purified using biotinylated IGF-I, as above) or indirectly captured biotinylated IGF-I receptor.
- Biotinylated IGF-I receptor was prepared by biotinylation of detergent-solubilized lysate from IGF-I receptor overexpressing cells using PEO-maleimide-biotin reagent (Pierce, Molecular Biosciences), which was affinity purified using an anti-IGF-I receptor beta chain antibody immobilized on NHS-agarose beads and was eluted with 2-4 M urea in buffer containing NP-40 detergent and dialyzed in PBS.
- the K d determination for the binding of EM164 antibody with biotinylated IGF-I receptor was carried out by coating Immulon-2HB plates with 100 ⁇ L of 1 ⁇ g/mL streptavidin in carbonate buffer (150 mM sodium carbonate, 350 mM sodium bicarbonate) at 4° C. overnight.
- the streptavidin-coated wells were blocked with 200 ⁇ L of blocking buffer (10 mg/mL BSA in TBS-T buffer), washed with TBS-T buffer and incubated with biotinylated IGF-I receptor (10 to 100 ng) for 4 h at ambient temperature.
- the wells containing indirectly captured biotinylated IGF-I receptor were then washed and incubated with EM164 antibody in blocking buffer at several concentrations (5.1 ⁇ 10 ⁇ 13 M to 200 nM) for 2 h at ambient temperature and were then incubated overnight at 4° C.
- the wells were next washed with TBS-T buffer and incubated with goat-anti-mouse-IgGH H+L -antibody-horseradish peroxidase conjugate (100 ⁇ L; 0.5 ⁇ g/mL in blocking buffer), followed by washes and detection using ABTS/H 2 O 2 substrate at 405 nm.
- the value of K d was estimated by non-linear regression for one-site binding.
- the binding titration curve for the binding of EM164 antibody to biotinylated human IGF-I receptor yielded a K d value of 0.1 nM ( FIG. 2 ).
- the Fab fragment of EM164 antibody also bound the human IGF-I receptor very tightly with a K d value of 0.3 nM, which indicated that the monomeric binding of the EM164 antibody to IGF-I receptor was also very strong.
- EM164 antibody can be used for immunoprecipitation of IGF-I receptor, as demonstrated by incubation of detergent-solubilized lysate of the human breast cancer MCF-7 cells with EM164 antibody immobilized on protein G-agarose beads (Pierce Chemical Company).
- a Western blot of the EM164 antibody immunoprecipitate was detected using a rabbit polyclonal anti-IGF-I receptor beta chain (C-terminus) antibody (Santa Cruz Biotechnology) and a goat-anti-rabbit-IgG-antibody-horseradish peroxidase conjugate, followed by washes and enhanced chemiluminescence (ECL) detection.
- the Western blot of EM164 immunoprecipitate from MCF-7 cells exhibited bands corresponding to the beta chain of IGF-I receptor at about 95 kDa and the pro-IGF-I receptor at about 220 kDa. Similar immunoprecipitations were carried out for other cell types to check species specificity of the binding of EM164 antibody, which also bound to IGF-I receptor from cos-7 cells (African green monkey), but did not bind to IGF-I receptor of 3T3 cells (mouse), CHO cells (Chinese hamster) or goat fibroblast cells (goat).
- the EM164 antibody did not detect SDS-denatured human IGF-I receptor in Western blots of lysates from MCF-7 cells, which indicated that it bound to a conformational epitope of native, non-denatured human IGF-I receptor.
- the binding domain of EM164 antibody was further characterized using a truncated alpha chain construct, which comprised the cysteine rich domain flanked by L1 and L2 domains (residues 1-468) fused with the 16-mer-C-terminus piece (residues 704-719) and which was terminated by a C-terminus epitope tag.
- This smaller IGF-I receptor which lacked residues 469-703, has been reported to bind IGF-I, although less tightly compared to the native full-length IGF-I receptor (Molina, L. et al., 2000 , FEBS Letters , 467, 226-230; Kristensen, C. et al., 1999 , J.
- a truncated IGF-I receptor alpha chain construct comprising residues 1-468 fused to the C-terminus piece that is residues 704-719 and flanked by a C-terminus myc epitope tag.
- MCF-7 cells were incubated with or without 5 ⁇ g/mL EM164 antibody for 2 h in serum-free medium, followed by incubation with 50 ng/mL biotinylated IGF-I for 20 min at 37° C. The cells were then washed twice with serum-free medium to remove unbound biotin-IGF-I, and were then lysed in 50 mM HEPES, pH 7.4, containing 1% NP-40 and protease inhibitors.
- An Immulon-2HB ELISA plate was coated with a mouse monoclonal anti-IGF-I receptor beta chain antibody and was used to capture the IGF-I receptor and bound biotin-IGF-I from the lysate.
- the binding of the coated antibody to the cytoplasmic C-terminal domain of the beta chain of IGF-I receptor did not interfere with the binding of biotin-IGF-I to the extracellular domain of IGF-I receptor.
- the wells were washed, incubated with streptavidin-horseradish peroxidase conjugate, washed again, and then detected using ABTS/H 2 O 2 substrate.
- the inhibition of IGF-I binding to MCF-7 cells by 5 ⁇ g/mL EM164 antibody was essentially quantitative, and was almost equivalent to that of the ELISA background obtained using a control lacking biotin-IGF-I.
- EM164 antibody was highly effective at displacing bound IGF-I from MCF-7 cells, as desired under physiological conditions for an antagonistic anti-IGF-I receptor antibody to displace the bound endogenous physiological ligand (such as IGF-I or IGF-II).
- an antagonistic anti-IGF-I receptor antibody to displace the bound endogenous physiological ligand (such as IGF-I or IGF-II).
- IGF-I displacement assay MCF-7 cells grown in a 12-well plate were serum-starved and then incubated with biotinylated IGF-I (20-50 ng/mL) in serum-free medium at 37° C. (or at 4° C.) for 1 to 2 h.
- the cells with bound biotinylated IGF-I were then treated with EM164 antibody or a control antibody (10-100 ⁇ g/mL) at 37° C. (or at 4° C.) for 30 min to 4 h. Cells were then washed with PBS and lysed in lysis buffer containing 1% NP-40 at 4° C. ELISA was carried out as described above to capture the IGF-I receptor from the lysate and then detect the biotinylated IGF-I bound to the receptor using streptavidin-horseradish peroxidase conjugate.
- the mechanism for the potent inhibition of the binding of IGF-I to IGF-I receptor and for the displacement of the pre-bound IGF-I by EM164 antibody is likely to be competition for binding, either through sharing of the binding site or through steric occlusion or through allosteric effects.
- IGF-I receptor signaling Treatment of breast cancer MCF-7 cells and osteosarcoma SaOS-2 cells with EM164 antibody almost completely inhibited intracellular IGF-I receptor signaling, as shown by the inhibition of IGF-I receptor autophosphorylation and by the inhibition of phosphorylation of its downstream effectors such as insulin receptor substrate-1 (IRS-1), Akt and Erk1/2 ( FIGS. 4-6 ).
- IGF-I receptor autophosphorylation As shown by the inhibition of IGF-I receptor autophosphorylation and by the inhibition of phosphorylation of its downstream effectors such as insulin receptor substrate-1 (IRS-1), Akt and Erk1/2 ( FIGS. 4-6 ).
- the MCF-7 cells were grown in a 12-well plate in regular medium for 3 days, and were then treated with 20 ⁇ g/mL EM164 antibody (or anti-B4 control antibody) in serum-free medium for 3 h, followed by stimulation with 50 ng/mL IGF-I for 20 min at 37° C.
- the cells were then lysed in ice-cold lysis buffer containing protease and phosphatase inhibitors (50 mM HEPES buffer, pH 7.4, 1% NP-40, 1 mM sodium orthovanadate, 100 mM sodium fluoride, 10 mM sodium pyrophosphate, 2.5 mM EDTA, 10 ⁇ M leupeptin, 5 ⁇ M pepstatin, 1 mM PMSF, 5 mM benzamidine, and 5 ⁇ g/mL aprotinin).
- protease and phosphatase inhibitors 50 mM HEPES buffer, pH 7.4, 1% NP-40, 1 mM sodium orthovanadate, 100 mM sodium fluoride, 10 mM sodium pyrophosphate, 2.5 mM EDTA, 10 ⁇ M leupeptin, 5 ⁇ M pepstatin, 1 mM PMSF, 5 mM benzamidine, and 5 ⁇ g/mL aprotinin
- An ELISA plate was pre-coated with anti-IGF-I receptor beta chain C-terminus monoclonal antibody TC123 and was incubated with the lysate samples for 5 h at ambient temperature to capture IGF-I receptor.
- the wells containing the captured IGF-I receptor were then washed and incubated with biotinylated anti-phosphotyrosine antibody (PY20; 0.25 ⁇ g/mL; BD Transduction Laboratories) for 30 min, followed by washes and incubation with streptavidin-horseradish peroxidase conjugate (0.8 ⁇ g/mL) for 30 min.
- the wells were washed and detected with ABTS/H 2 O 2 substrate.
- IRS-1 insulin receptor substrate-1
- an ELISA using immobilized anti-IRS-1 antibody to capture IRS-1 from lysates was used, followed by measurement of the associated p85 subunit of phosphatidylinositol-3-kinase (PI-3-kinase) that binds to the phosphorylated IRS-1 (Jackson, J. G. et al., 1998 , J. Biol. Chem ., 273, 9994-10003).
- PI-3-kinase phosphatidylinositol-3-kinase
- MCF-7 cells were treated with 5 ⁇ g/mL antibody (EM164 or IR3) in serum-free medium for 2 h, followed by stimulation with 50 ng/mL IGF-I for 10 min at 37° C.
- Anti-IRS-1 antibody (rabbit polyclonal; Upstate Biotechnology) was indirectly captured by incubation with coated goat-anti-rabbit-IgG antibody on an ELISA plate, which was then used to capture IRS-1 from the cell lysate samples by overnight incubation at 4° C. The wells were then incubated with mouse monoclonal anti-p85-PI-3-kinase antibody (Upstate Biotechnology) for 4 h, followed by treatment with goat-anti-mouse-IgG-antibody-HRP conjugate for 30 min. The wells were then washed and detected using ABTS/H 2 O 2 substrate ( FIG. 5 ). As shown in FIG.
- EM164 antibody was more effective at inhibiting the IGF-I-stimulated IRS-1 phosphorylation than was IR3 antibody, and EM164 antibody did not show any agonistic activity on IRS-1 phosphorylation when incubated with cells in the absence of IGF-I.
- the cells were incubated with about 75 ⁇ L of 10 ⁇ g/mL antibody for 30 min.-3 h, followed by the addition of 25 ⁇ L of IGF-I (or IGF-II or serum) solution to obtain a final concentration of 10 ng/mL IGF-I, or 20 ng/mL IGF-II, or 0.04-10% serum.
- IGF-I or IGF-II or serum
- the cells were stimulated first with IGF-I for 15 min before the addition of EM164 antibody, or both IGF-I and EM164 antibody were added together. The cells were then allowed to grow for another 2-3 days.
- the EM164 antibody strongly inhibited IGF-I-or serum-stimulated growth and survival of breast cancer MCF-7 cells ( FIGS. 7 and 8 ).
- the EM164 antibody strongly inhibited IGF-II-stimulated growth and survival of MCF-7 cells.
- Previous reports using commercially available antibodies such as IR3 antibody showed only weak inhibition of serum-stimulated growth and survival of MCF-7 cells, as confirmed in FIG. 7 for the IR3 and 1H7 antibodies (Cullen, K. J. et al., 1990 , Cancer Res ., 50, 48-53).
- EM164 antibody was a potent inhibitor of the serum- or IGF-stimulated growth of MCF-7 cells.
- FIG. 8 EM164 antibody was equally effective in inhibiting the growth and survival of MCF-7 cells over a wide range of serum concentrations (0.04-10% serum).
- the growth inhibition of MCF-7 cells by EM164 antibody was measured by counting cells.
- EM164 antibody The growth inhibition of MCF-7 cells by EM164 antibody was measured by counting cells.
- a 12-well plate about 7500 cells were plated in RPMI medium with 10% FBS, in the presence or absence of 10 ⁇ g/mL EM164 antibody.
- the cell count for the untreated control sample was 20.5 ⁇ 10 4 cells, in contrast to a cell count of only 1.7 ⁇ 10 4 cells for the EM164 antibody-treated sample.
- Treatment with the EM164 antibody inhibited the growth of MCF-7 cells by about 12-fold in 5 days. This inhibition by EM164 antibody was significantly greater than was a reported 2.5-fold inhibition using IR3 antibody in a 6-day assay for MCF-7 cells (Rohlik, Q. T. et al., 1987 , Biochem. Biophys. Res. Commun ., 149, 276-281).
- the IGF-I- and serum-stimulated growth and survival of a non-small cell lung cancer line NCI-H838 were also strongly inhibited by EM164 antibody, compared to a control anti-B4 antibody ( FIG. 9 ).
- Treatment with EM164 antibody in serum-free medium produced a smaller signal than the untreated sample for both NCI-H838 and MCF-7 cells, presumably because EM 164 antibody also inhibited the autocrine and paracrine IGF-I and IGF-II stimulation of these cells ( FIGS. 7 and 9 ).
- the colony size of HT29 colon cancer cells was also greatly reduced upon treatment with EM164 antibody.
- EM164 antibody is therefore unique among all known anti-IGF-I receptor antibodies in its effectiveness to inhibit the serum-stimulated growth of tumor cells such as MCF-7 cells and NCI-H838 cells by greater than 80%.
- the EM164 antibody caused growth arrest of cells in G0/G1 phase of cell cycle and abrogated the mitogenic effect of IGF-I.
- MCF-7 cells were treated with IGF-I (20 ng/mL) in the presence or absence of EM164 (20 ⁇ g/mL) for 1 day and then analyzed by propidium iodide staining and flow cytometry. As shown in FIG. 25 , the cycling of cells in response to IGF-I stimulation in the absence of EM164 (with 41% of the cells in the S phase and 50% in the G0/G1 phase) was suppressed in EM164-treated cells (with only 9% in the S phase and 77% of the cells in the G0/G1 phase).
- EM164 antibody treatment resulted in apoptosis of cells.
- cleavage of the cytokeratin CK18 protein by caspase was measured in NCI-H838 lung cancer cells incubated with IGF-I or serum in the presence or absence of EM164 for 1 day ( FIG. 26 ).
- the addition of IGF-I or serum resulted in a lower caspase-cleaved CK18 signal compared to the no IGF-I control, indicating that IGF-I and serum prevent the activation of caspase.
- Treatment with EM164 suppressed the anti-apoptotic effects of IGF-I and serum, as indicated by the greater cleaved CK18 levels obtained in the presence of EM164 than in the absence of EM164 ( FIG. 26 ).
- EM164 antibody with taxol was significantly more inhibitory to the growth and survival of non-small cell lung cancer Calu6 cells than was taxol alone.
- the combination of EM164 antibody with camptothecin was significantly more inhibitory than camptothecin alone toward the growth and survival of colon cancer HT29 cells. Because EM164 antibody alone was not expected to be as toxic to cells as organic chemotoxic drugs, the synergism between the predominantly cytostatic effect of EM164 antibody and the cytotoxic effect of the chemotoxic drug may be highly efficacious in combination cancer therapies in clinical settings.
- EM164 antibody with an anti-EGF receptor antibody was significantly more inhibitory than either EM164 antibody or KS77 antibody alone on the growth and survival of several tumor cell lines such as HT-3 cells, RD cells, MCF-7 cells, and A431 cells. Therefore, the synergistic effect of combining neutralizing antibodies for two growth factor receptors such as IGF-I receptor and EGF receptor may also be useful in clinical cancer treatment.
- EM164 antibody As a single agent in inhibiting the proliferation and survival of diverse human cancer cell lines as shown in Table 1, additional efficacy studies were carried out using combinations of EM164 antibody with other anti-cancer therapeutic agents. In these studies on diverse cancer cell lines, the combined treatment of EM164 antibody and other anti-cancer therapeutic agents resulted in an even greater anti-cancer efficacy than with either EM164 or the other therapeutic agent alone. These combinations of EM164 with other therapeutic agents are therefore highly effective in inhibiting the proliferation and survival of cancer cells.
- the therapeutic agents that can be combined with EM164 for improved anti-cancer efficacy include diverse agents used in oncology practice (Reference: Cancer, Principles & Practice of Oncology, DeVita, V.
- EM164 is combined with one or-more anti-cancer agents of diverse mechanisms of action such as alkylating agents, platinum agents, hormonal therapies, antimetabolites, topoisomerase inhibitors, antimicrotubule agents, differentiation agents, antiangiogenic or antivascularization therapies, radiation therapy, agonists and antagonists of leuteinizing hormone releasing hormone (LHRH) or gonadotropin-releasing hormone (GnRH), inhibitory antibodies or small molecule inhibitors against cell-surface receptors, and other chemotherapeutic agents (Reference: Cancer, Principles & Practice of Oncology, DeVita, V. T., Hellman, S., Rosenberg, S. A., 6th edition, Lippincott-Raven, Philadelphia, 2001).
- LHRH leuteinizing hormone releasing hormone
- GnRH gonadotropin-releasing hormone
- inhibitory antibodies or small molecule inhibitors against cell-surface receptors and other chemotherapeutic agents
- the combination of an LHRH antagonist antide (0.1 to 10 micromolar) and EM164 antibody (0.1 to 10 nanomolar) inhibited the proliferation of MCF-7 breast cancer cells significantly more than that with either EM164 or antide alone.
- the combined treatment with EM164 antibody (10 microgram/ml) and cisplatin (0.1-60 microgram/ml) resulted in a greater inhibition of the proliferation and survival of MCF-7 breast cancer cells in comparison to the inhibition by either EM164 antibody or cisplatin alone.
- EM164 antibody with other therapeutic agents are effective against several types of cancers including breast, lung, colon, prostate, pancreatic, cervical, ovarian, melanoma, multiple myeloma, neuroblastoma, rhabdomyosarcoma and osteosarcoma.
- the EM164 antibody and the therapeutic agent can be administered for cancer therapy either simultaneously or in sequence.
- Conjugates of EM164 antibody with cytotoxic drugs are also valuable in targeted delivery of the cytotoxic drugs to the tumors overexpressing IGF-I receptor.
- Conjugates of EM164 antibody with radiolabels or other labels can be used in the treatment and imaging of tumors that overexpress IGF-I receptor.
- Calu-6 xenografts were established in immunodeficient mice by subcutaneous injections of 1 ⁇ 10 7 Calu-6 cells. As shown in FIG. 10 , these mice containing established 100 mm 3 Calu-6 xenografts were treated with EM 164 antibody alone (6 injections of 0.8 mg/mouse, i. v., two per week) or with taxol alone (five injections of taxol, i.p. every two days; 15 mg/kg), or with a combination of taxol and EM164 antibody treatments, or PBS alone (200 ⁇ L/mouse, 6 injections, two per week, i.v.) using five mice per treatment group.
- EM 164 antibody alone 6 injections of 0.8 mg/mouse, i. v., two per week
- taxol alone five injections of taxol, i.p. every two days; 15 mg/kg
- PBS alone 200 ⁇ L/mouse, 6 injections, two per week, i.v
- the growth of tumors was significantly slowed by EM164 antibody treatment compared to a PBS control. No toxicity of EM164 antibody was observed, based on measurements of the weights of the mice. Although taxol treatment alone was effective until day 14, the tumor then started to grow back. However, the growth of the tumor was delayed significantly in the group that was treated by a combination of taxol and EM164 antibody, compared to the group that was treated with taxol alone.
- mice Human pancreatic cancer xenografts were established in 5 week-old, female SCID/ICR mice (Taconic) by subcutaneous injections of 10 7 BxPC-3 cells in PBS (day 0). The mice bearing established tumors of 80 mm 3 were then treated with EM164 alone (13 injections of 0.8 mg/mouse, i.v., lateral tail vein, on days 12, 16, 19, 23, 26, 29, 36, 43, 50, 54, 58, 61 and 64), with gemcitabine alone (two injections of 150 mg/kg/mouse, i.p., on days 12 and 19), with a combination of gemcitabine and EM164 following the above schedules, PBS alone, and a control antibody alone (following the same schedule as EM164) using five mice in each of the five treatment groups.
- EM164 0.8 mg/mouse, i.v., lateral tail vein, on days 12, 16, 19, 23, 26, 29, 36, 43, 50, 54, 58, 61 and 64
- the murine EM164 and the humanized EM164 antibodies showed equivalent inhibition of the growth of established BxPC-3 xenografts in mice, thus demonstrating that the potency of the humanized EM164 is equivalent to that of the murine EM164 in vivo.
- both intraperitoneal and intravenous administrations of EM164 antibody showed equivalent inhibition of the growth of established BxPC-3 xenografts in mice.
- treatment with EM164 antibody showed significant growth delay of established A-673 human rhabdomyosarcoma/Ewing's sarcoma xenografts in mice.
- PCR reactions were performed using a RACE method described in Co et al. (J. Immunol., 148, 1149-1154 (1992)) and using degenerate primers as described in Wang et al., (J. Immunol. Methods, 233, 167-177 (2000)).
- the RACE PCR method required an intermediate step to add a poly G tail on the 3′ ends of the first strand cDNAs.
- RT reactions were purified with Qianeasy (Qiagen) columns and eluted in 50 ⁇ l 1 ⁇ NEB buffer 4.
- a dG tailing reaction was performed on the eluate with 0.25 mM CoCl 2 , 1 mM dGTP, and 5 units terminal transferase (NEB), in 1 ⁇ NEB buffer 4. The mixture was incubated at 37° C. for 30 minutes and then 1 ⁇ 5 of the reaction (10 ⁇ l) was added directly to a PCR reaction to serve as the template DNA.
- the RACE and degenerate PCR reactions were identical except for differences in primers and template.
- the terminal transferase reaction was used directly for the RACE PCR template, while the RT reaction mix was used directly for degenerate PCR reactions.
- PCR reactions were performed using the following program: 1) 94° C. 3 min, 2) 94° C. 15 sec, 3) 45° C. 1 min, 4) 72° C. 2 min, 5) cycle back to step #2 29 times, 6) finish with a final extension step at 72° C. for 10 min.
- PCR products were cloned into pBluescript II SK+ (Stratagene) using restriction enzymes created by the PCR primers.
- FIGS. 12 and 13 Several individual light and heavy chain clones were sequenced by conventional means to identify and avoid possible polymerase generated sequence errors ( FIGS. 12 and 13 ). Using Chothia canonical classification definitions, the three light chain and heavy chain CDRs were identified ( FIGS. 12-14 ).
- Protein sequencing of murine EM164 antibody was performed to confirm the sequences shown in FIGS. 12 and 13 .
- the heavy and light chain protein bands of purified EM164 antibody were transferred to a PVDF membrane from a gel (SDS-PAGE, reducing conditions), excised from the PVDF membrane and analyzed by protein sequencing.
- the N-terminal sequence of the light chain was determined by Edman sequencing to be: DVLMTQTPLS (SEQ ID NO:20), which matches the N-terminal sequence of the cloned light chain gene obtained from the EM164 hybridoma.
- the N-terminus of the heavy chain was found to be blocked for Edman protein sequencing.
- a tryptic digest peptide fragment of the heavy chain of mass 1129.5 (M+H+, monoisotopic) was fragmented via post-source decay (PSD) and its sequence was determined to be GRPDYYGSSK (SEQ ID NO:21).
- Another tryptic digest peptide fragment of the heavy chain of mass 2664.2 (M+H+, monoisotopic) was also fragmented via post-source decay (PSD) and its sequence was identified as: SSSTAYMQLSSLTSEDSAVYYFAR (SEQ ID NO:22). Both of these sequences match perfectly those of CDR3 and framework 3 (FR3) of the cloned heavy chain gene obtained from the EM164 hybridoma.
- the light and heavy chain paired sequences were cloned into a single mammalian expression vector ( FIG. 16 ).
- the PCR primers for the human variable sequences created restriction sites that allowed the human signal sequence to be attached while in the pBluescriptII cloning vector, and the variable sequences were cloned into the mammalian expression plasmid using EcoRI and BsiWI or HindIII and ApaI sites for the light chain or heavy chain, respectively ( FIG. 16 ).
- the light chain variable sequences were cloned in-frame onto the human IgK constant region and the heavy chain variable sequences were cloned into the human Iggamma1 constant region sequence.
- human CMV promoters drove the expression of both the light and heavy chain cDNA sequences. Expression and purification of the recombinant mouse EM164 antibody proceeded according to methods that are well-known in the art.
- Resurfacing of the EM164 antibody to provide humanized versions suitable as therapeutic or diagnostic agents generally proceeds according to the principles and methods disclosed in U.S. Pat. No. 5,639,641, and as follows.
- variable region residues for a set of antibodies with solved structures were used to predict the surface residues for the murine anti-IGF-I receptor antibody (EM164) variable region.
- the amino acid solvent accessibility for a set of 127 unique antibody structure files (Table 2) were calculated with the MC software package (Pedersen et al., 1994, J. Mol. Biol., 235, 959-973). The ten most similar light chain and heavy chain amino acid sequences from this set of 127 structures were determined by sequence alignment.
- the average solvent accessibility for each variable region residue was calculated, and positions with greater than a 30% average accessibility were considered to be surface residues. Positions with average accessibilities of between 25% and 35% were further examined by calculating the individual residue accessibility for only those structures with two identical flanking residues.
- a molecular model of murine EM164 was generated using the Oxford Molecular software package AbM.
- the antibody framework was built from structure files for the antibodies with the most similar amino acid sequences, which were 2jel for the light chain and lnqb for the heavy chain.
- the non-canonical CDRs were built by searching a C- ⁇ structure database containing non-redundant solved structures. Residues that lie within 5 ⁇ of a CDR were determined.
- the surface positions of murine EM164 were compared to the corresponding positions in human antibody sequences in the Kabat database (Johnson, G. and Wu, T. T. (2001) Nucleic Acids Research, 29: 205-206).
- the antibody database management software SR (Searle 1998) was used to extract and align the antibody surface residues from natural heavy and light chain human antibody pairs.
- PCR mutagenesis was performed on the murine EM164 cDNA clone (above) to build the resurfaced, human EM164 (herein huEM164).
- Primer sets were designed to make the 8 amino acid changes required for all tested versions of huEM164, and additional primers were designed to alternatively make the two 5 ⁇ residue changes (Table 3).
- PCR reactions were performed with the following program: 1) 94° C. 1 min, 2) 94° C. 15 sec, 3) 55° C. 1 min, 4) 72° C. 1 min, 5) cycle back to step #2 29 times, 6) finish with a final extension step at 72° C. for 4 min.
- a surface residue is defined as an amino acid that has at least 30% of its total surface area accessible to a water molecule.
- the molecular model above generated with the AbM software package, was analyzed to determine which EM164 surface residues were within 5 ⁇ of a CDR.
- all surface residues outside of a CDR should be changed to the human counterpart, but residues within 5 ⁇ of a CDR are treated with special care because they may also contribute to antigen specificity. Therefore, these latter residues must be identified and carefully considered throughout the humanization process.
- the CDR definitions used for resurfacing combine the AbM definition for heavy chain CDR2 and Kabat definitions for the remaining 5 CDRs ( FIG. 14 ). Table 6 shows the residues that were within 5 ⁇ of any CDR residue in either the light or heavy chain sequence of the EM164 model.
- Candidate human antibody surfaces for resurfacing EM164 were identified within the Kabat antibody sequence database using SR software, which provided for the searching of only specified residue positions against the antibody database. To preserve the natural pairings, surface residues of both the light and heavy chains were compared together. The most homologous human surfaces from the Kabat database were aligned in rank order of sequence identity. The top 5 surfaces are given in Table 7. These surfaces were then compared to identify which of them would require the least changes within 5 ⁇ of a CDR. The Leukemic B-cell antibody, CLL 1.69, required the least number of surface residue changes (10 in total) and only two of these residues were within 5 ⁇ of a CDR.
- version 1.0 has all 10 human surface residues.
- version 1.1 The most conservative version with respect to changes in the vicinity of the CDR is version 1.1, which retained both of the murine surface residues that were within 5 ⁇ of a CDR.
- All four humanized EM164 antibody genes were cloned into an antibody expression plasmid ( FIG. 16 ) for use in transient and stable transfections.
- the affinities of the humanized EM164 antibody versions 1.0-1.3 were compared to those of murine EM164 antibody through binding competition assays using biotinylated full-length human IGF-I receptor or myc-epitope tagged truncated IGF-I receptor alpha chain, as described above.
- Humanized EM164 antibody samples were obtained by transient transfection of the appropriate expression vectors in human embryonic kidney 293T cells, and antibody concentrations were determined by ELISA using purified humanized antibody standards.
- FIG. 11 An exemplary competition assay is shown in FIG. 11 .
- An Immulon-2HB ELISA plate was coated with 100 ⁇ L of 5 ⁇ g/mnL streptavidin per well in carbonate buffer at ambient temperature for 7 h.
- the streptavidin-coated wells were blocked with 200 ⁇ L of blocking buffer (10 mg/mL BSA in TBS-T buffer) for 1 h, washed with TBS-T buffer and incubated with biotinylated IGF-I receptor (5 ng per well) overnight at 4° C.
- the wells containing indirectly captured biotinylated IGF-I receptor were then washed and incubated with mixtures of humanized EM164 antibody (15.5 ng) and murine antibody (0 ng, or 16.35 ng, or 32.7 ng, or 65.4 ng, or 163.5 ng) in 100 ⁇ L blocking buffer for 2 h at ambient temperature and were then incubated overnight at 4° C.
- the wells were then washed with TBS-T buffer and incubated with goat-anti-human-Fab′ 2 -antibody-horseradish peroxidase conjugate for 1 h (100 ⁇ L; 1 ⁇ g/mL in blocking buffer), followed by washes and detection using ABTS/H 2 O 2 substrate at 405 nm.
- the humanized EM164 v1.0 antibody showed a similar inhibition of IGF-I-stimulated growth and survival of MCF-7 cells as did the murine EM164 antibody ( FIG. 24 ).
- the inhibition of serum-stimulated growth and survival of MCF-7 cells by humanized EM164 v1.0 antibody was similar to the inhibition by murine EM164 antibody.
- the amino acid residues are grouped into Framework (FR) and Complementarity Determining Regions (CDR) according to position in the polypeptide chain.
- FR Framework
- CDR Complementarity Determining Regions
- the amino acid and nucleic acid sequences of the anti-IGF-I receptor antibody EM164 and its humanized variants were used to develop other antibodies that have improved properties and that are also within the scope of the present invention. Such improved properties include increased affinity for the IGF-I receptor.
- Several studies have surveyed the effects of introducing one or more amino acid changes at various positions in the sequence of an antibody, based on the knowledge of the primary antibody sequence, on its properties such as binding and level of expression (Yang, W. P. et al., 1995 , J. Mol. Biol ., 254, 392-403; Rader, C. et al., 1998 , Proc. Natl. Acad. Sci. USA , 95, 8910-8915; Vaughan, T. J. et al., 1998 , Nature Biotechnology , 16, 535-539).
- variants of the primary antibody have been generated by changing the sequences of the heavy and light chain genes in the CDR1, CDR2, CDR3, or framework regions, using methods such as oligonucleotide-mediated site-directed mutagenesis, cassette mutagenesis, error-prone PCR, DNA shuffling, or mutator-strains of E. coli (Vaughan, T. J. et al., 1998 , Nature Biotechnology , 16, 535-539; Adey, N. B. et al., 1996 , Chapter 16, pp. 277-291, in “ Phage Display of Peptides and Proteins ”, Eds. Kay, B. K. et al., Academic Press).
- the antibody sequences described in this invention can be used to develop anti-IGF-I receptor antibodies with improved functions, such as antibodies having suitable groups such as free amino groups or thiols at convenient attachment points for covalent modification for use, for example, in the attachment of therapeutic agents.
- the murine anti IGF-I receptor antibody was also expressed from mammalian expression plasmids similar to those used to express the humanized antibody (above).
- Expression plasmids are known that have murine constant regions including the light chain kappa and heavy chain gamma-1 sequences (McLean et al., 2000 , Mol Immunol ., 37, 837-845). These plasmids were designed to accept any antibody variable region, such as for example the murine anti-IGF-I receptor antibody, by a simple restriction digest and cloning. Additional PCR of the anti-IGF-I receptor antibody was usually required to create the restriction compatible with those in the expression plasmid.
- the chimeric expression plasmid ( FIG. 16 ) was constructed using cassettes for the variable regions and for both the light and heavy chain constant regions. Just as the antibody variable sequences were cloned into this expression plasmid by restriction digests, separate restriction digests were used to clone in any constant region sequences.
- the kappa light chain and gamma-I heavy chain cDNAs were cloned, for example, from murine hybridoma RNA, such as the RNA described herein for cloning of the anti-IGF-I antibody variable regions.
- RNA sequences available in the Kabat database were designed from sequences available in the Kabat database (see Table 10).
- RT-PCR was used to clone the constant region sequences and to create the restriction sites needed to clone these fragments into the chimeric anti-IGF-I receptor antibody expression plasmid.
- This plasmid was then used to express the fully murine anti-IGF-I receptor antibody in standard mammalian expression systems such as the CHO cell line.
- Murine Constant Region Primers Primer name Primer Sequence SEQ ID NO: MuIgG1 C3endX TTTTGAGCTCTTATTTACCAGGA 45 GAGTGGGAGAGGCTCTT MuIgG1 C5endH TTTTAAGCTTGCCAAAACGACAC 46 CCCCATCTGTCTAT MuIgKap C3endB TTTTGGATCCTAACACTCATTCC 47 TGTTGAAGC MuIgKap C5endE TTTTGAATTCGGGCTGATGCTGC 48 ACCAACTG The primers were designed from sequences available in the Kabat database (Johnson, G and Wu, T.T. (2001) Nucleic Acids Research, 29: 205-206).
- the hybridoma that makes murine EM164 antibody was deposited with the American Type Culture Collection, PO Box 1549, Manassas, Va. 20108, on Jun. 14, 2002, under the Terms of the Budapest Treaty and assigned ATCC accession number PTA-4457.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Biomedical Technology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
Antibodies, humanized antibodies, resurfaced antibodies, antibody fragments, derivatized antibodies, and conjugates of same with cytotoxic agents, which specifically bind to, and inhibit, insulin-like growth factor-I receptor, antagonize the effects of IGF-I, IGF-II and serum on the growth and survival of tumor cells, and which are substantially devoid of agonist activity. Said antibodies and fragments thereof may be used, optionally in conjunction with other therapeutic agents, in the treatment of tumors that express elevated levels of IGF-I receptor, such as breast cancer, colon cancer, lung cancer, ovarian carcinoma, synovial sarcoma, prostate cancer and pancreatic cancer, and said derivatized antibodies may be used in the diagnosis and imaging of tumors that express elevated levels of IGF-I receptor.
Description
- The present application is a continuation-in-part of parent application Ser. No. 10/170,390, filed Jun. 14, 2002, incorporated herein by reference in its entirety.
- The present invention relates to antibodies that bind to human insulin-like growth factor-I receptor (IGF-I receptor). More particularly, the invention relates to anti-IGF-I receptor antibodies that inhibit the cellular functions of the IGF-I receptor. Still more particularly, the invention relates to anti-IGF-I receptor antibodies that antagonize the effects of IGF-I, IGF-II and serum on the growth and survival of tumor cells and which are substantially devoid of agonist activity. The invention also relates to fragments of said antibodies, humanized and resurfaced versions of said antibodies, conjugates of said antibodies, antibody derivatives, and the uses of same in diagnostic, research and therapeutic applications. The invention further relates to improved antibodies or fragments thereof that are made from the above-described antibodies and fragments thereof. In another aspect, the invention relates to a polynucleotide encoding the antibodies or fragments thereof, and to vectors comprising the polynucleotides.
- Insulin-like growth factor-I receptor (IGF-I receptor) is a transmembrane heterotetrameric protein, which has two extracellular alpha chains and two membrane-spanning beta chains in a disulfide-linked β-α-α-β configuration. The binding of the ligands, which are insulin-like growth-factor-I (IGF-I) and insulin-like growth factor-II (IGF-II), by the extracellular domain of IGF-I receptor activates its intracellular tyrosine kinase domain resulting in autophosphorylation of the receptor and substrate phosphorylation. The IGF-I receptor is homologous to insulin receptor, having a high sequence similarity of 84% in the beta chain tyrosine kinase domain and a low sequence similarity of 48% in the alpha chain extracellular cysteine rich domain (Ulrich, A. et al., 1986, EMBO, 5, 2503-2512; Fujita-Yamaguchi, Y. et al., 1986, J. Biol. Chem., 261, 16727-16731; LeRoith, D. et al., 1995, Endocrine Reviews, 16, 143-163). The IGF-I receptor and its ligands (IGF-I and IGF-II) play important roles in numerous physiological processes including growth and development during embryogenesis, metabolism, cellular proliferation and cell differentiation in adults (LeRoith, D., 2000, Endocrinology, 141, 1287-1288; LeRoith, D., 1997, New England J. Med., 336, 633-640).
- IGF-I and IGF-II function both as endocrine hormones in the blood, where they are predominantly present in complexes with IGF-binding proteins, and as paracrine and autocrine growth factors that are produced locally (Humbel, R. E., 1990, Eur. J. Biochem., 190, 445-462; Cohick, W. S. and Clemmons, D. R., 1993, Annu. Rev. Physiol. 55, 131-153).
- The IGF-I receptor has been implicated in promoting growth, transformation and survival of tumor cells (Baserga, R. et al., 1997, Biochem. Biophys. Acta, 1332, F105-F126; Blakesley, V. A. et al., 1997, Journal of Endocrinology, 152, 339-344; Kaleko, M., Rutter, W. J., and Miller, A. D. 1990, Mol. Cell. Biol., 10, 464-473). Thus, several types of tumors are known to express higher than normal levels of IGF-I receptor, including breast cancer, colon cancer, ovarian carcinoma, synovial sarcoma and pancreatic cancer (Khandwala, H. M. et al., 2000, Endocrine Reviews, 21, 215-244; Werner, H. and LeRoith, D., 1996, Adv. Cancer Res., 68,183-223; Happerfield, L. C. et al., 1997, J. Pathol., 183, 412-417; Frier, S. et al., 1999, Gut, 44, 704-708; van Dam, P. A. et al., 1994, J. Clin. Pathol., 47, 914-919; Xie, Y. et al., 1999, Cancer Res., 59, 3588-3591; Bergmann, U. et al., 1995, Cancer Res., 55, 2007-2011). In vitro, IGF-I and IGF-II have been shown to be potent mitogens for several human tumor cell lines such as lung cancer, breast cancer, colon cancer, osteosarcoma and cervical cancer (Ankrapp, D. P. and Bevan, D. R., 1993, Cancer Res., 53, 3399-3404; Cullen, K. J., 1990, Cancer Res., 50, 48-53; Hermanto, U. et al., 2000, Cell Growth & Differentiation, 11, 655-664; Guo, Y. S. et al., 1995, J. Am. Coll. Surg., 181, 145-154; Kappel, C. C. et al., 1994, Cancer Res., 54, 2803-2807; Steller, M. A. et al., 1996, Cancer Res., 56, 1761-1765). Several of these tumors and tumor cell lines also express high levels of IGF-I or IGF-II, which may stimulate their growth in an autocrine or paracrine manner (Quinn, K. A. et al., 1996, J. Biol. Chem., 271, 11477-11483).
- Epidemiological studies have shown a correlation of elevated plasma level of IGF-I (and lower level of IGF-binding protein-3) with increased risk for prostate cancer, colon cancer, lung cancer and breast cancer (Chan, J. M. et al., 1998, Science, 279, 563-566; Wolk, A. et al., 1998, J. Natl. Cancer Inst., 90, 911-915; Ma, J. et al., 1999, J. Natl. Cancer Inst., 91, 620-625; Yu, H. et al., 1999, J. Natl. Cancer Inst., 91, 151-156; Hankinson, S. E. et al., 1998, Lancet, 351, 1393-1396). Strategies to lower the IGF-I level in plasma or to inhibit the function of IGF-I receptor have been suggested for cancer prevention (Wu, Y. et al., 2002, Cancer Res., 62, 1030-1035; Grimberg, A and Cohen P., 2000, J. Cell. Physiol., 183, 1-9).
- The IGF-I receptor protects tumor cells from apoptosis caused by growth factor deprivation, anchorage independence or cytotoxic drug treatment (Navarro, M. and Baserga, R., 2001, Endocrinology, 142, 1073-1081; Baserga, R. et al., 1997, Biochem. Biophys. Acta, 1332, F105-F126). The domains of IGF-I receptor that are critical for its mitogenic, transforming and anti-apoptotic activities have been identified by mutational analysis.
- For example, the tyrosine 1251 residue of IGF-I receptor has been identified as critical for anti-apoptotic and transformation activities but not for its mitogenic activity (O'Connor, R. et al., 1997, Mol. Cell. Biol., 17, 427-435; Miura, M. et al., 1995, J. Biol. Chem., 270, 22639-22644). The intracellular signaling pathway of ligand-activated IGF-I receptor involves phosphorylation of tyrosine residues of insulin receptor substrates (IRS-1 and IRS-2), which recruit phosphatidylinositol-3-kinase (PI-3-kinase) to the membrane. The membrane-bound phospholipid products of PI-3-kinase activate a serine/threonine kinase Akt, whose substrates include the pro-apoptotic protein BAD which is phosphorylated to an inactive state (Datta, S. R., Brunet, A. and Greenberg, M. E., 1999, Genes & Development, 13, 2905-2927; Kulik, G., Klippel, A. and Weber, M. J., 1997, Mol. Cell. Biol. 17, 1595-1606). The mitogenic signaling of IGF-I receptor in MCF-7 human breast cancer cells requires PI-3-kinase and is independent of mitogen-activated protein kinase, whereas the survival signaling in differentiated rat pheochromocytoma PC12 cells requires both PI-3-kinase and mitogen-activated protein kinase pathways (Dufourny, B. et al., 1997, J. Biol. Chem., 272, 31163-31171; Parrizas, M., Saltiel, A. R. and LeRoith, D., 1997, J. Biol. Chem., 272, 154-161).
- Down-regulation of IGF-I receptor level by anti-sense strategies has been shown to reduce the tumorigenicity of several tumor cell lines in vivo and in vitro, such as melanoma, lung carcinoma, ovarian cancer, glioblastoma, neuroblastoma and rhabdomyosarcoma (Resnicoff, M. et al., 1994, Cancer Res., 54, 4848-4850; Lee, C.-T. et al., 1996, Cancer Res., 56, 3038-3041; Muller, M. et al., 1998, Int. J. Cancer, 77, 567-571; Trojan, J. et al., 1993, Science, 259, 94-97; Liu, X. et al., 1998, Cancer Res., 58, 5432-5438; Shapiro, D. N. et al., 1994, J. Clin. Invest., 94, 1235-1242). Likewise, a dominant negative mutant of IGF-I receptor has been reported to reduce the tumorigenicity in vivo and growth in vitro of transformed Rat-1 cells overexpressing IGF-I receptor (Prager, D. et al., 1994, Proc. Natl. Acad. Sci. USA, 91, 2181-2185).
- Tumor cells expressing an antisense to the IGF-I receptor mRNA undergo massive apoptosis when injected into animals in biodiffusion chambers. This observation makes the IGF-I receptor an attractive therapeutic target, based upon the hypothesis that tumor cells are more susceptible than normal cells to apoptosis by inhibition of IGF-I receptor (Resnicoff, M. et al., 1995, Cancer Res., 55, 2463-2469; Baserga, R., 1995, Cancer Res., 55, 249-252).
- Another strategy to inhibit the function of IGF-I receptor in tumor cells has been to use anti-IGF-I receptor antibodies which bind to the extracellular domains of IGF-I receptor and inhibit its activation. Several attempts have been reported to develop mouse monoclonal antibodies against IGF-I receptor, of which two inhibitory antibodies—IR3 and 1H7—are available and their use has been reported in several IGF-I receptor studies.
- The IR3 antibody was developed using a partially purified placental preparation of insulin receptor to immunize mice, which yielded an antibody, IR1, that was selective for binding insulin receptor, and two antibodies, IR2 and IR3, that showed preferential immunoprecipitation of IGF-I receptor (somatomedin-C receptor) but also weak immunoprecipitation of insulin receptor (Kull, F. C. et al., 1983, J. Biol. Chem., 258, 6561-6566).
- The 1H7 antibody was developed by immunizing mice with purified placental preparation of IGF-I receptor, which yielded the inhibitory antibody 1H7 in addition to three stimulatory antibodies (Li, S.-L. et al., 1993, Biochem. Biophys. Res. Commun., 196, 92-98; Xiong, L. et al., 1992, Proc. Natl. Acad. Sci. USA, 89, 5356-5360).
- In another report, a panel of mouse monoclonal antibodies specific for human IGF-I receptor were obtained by immunization of mice with transfected 3T3 cells expressing high levels of IGF-I receptor, which were categorized into seven groups by binding competition studies and by their inhibition or stimulation of IGF-I binding to transfected 3T3 cells (Soos, M. A. et al., 1992, J. Biol. Chem., 267, 12955-12963).
- Thus, although IR3 antibody is the most commonly used inhibitory antibody for IGF-I receptor studies in vitro, it suffers from the drawback that it exhibits agonistic activity in transfected 3T3 and CHO cells expressing human IGF-I receptor (Kato, H. et al., 1993, J. Biol. Chem., 268, 2655-2661; Steele-Perkins, G. and Roth, R. A., 1990, Biochem. Biophys. Res. Commun., 171, 1244-1251). Similarly, among the panel of antibodies developed by Soos et al., the most inhibitory antibodies 24-57 and 24-60 also showed agonistic activities in the transfected 3T3 cells (Soos, M. A. et al., 1992, J. Biol. Chem., 267, 12955-12963). Although, IR3 antibody is reported to inhibit the binding of IGF-I (but not IGF-II) to expressed receptors in intact cells and after solubilization, it is shown to inhibit the ability of both IGF-I and IGF-II to stimulate DNA synthesis in cells in vitro (Steele-Perkins, G. and Roth, R. A., 1990, Biochem. Biophys. Res. Commun., 171, 1244-1251). The binding epitope of IR3 antibody has been inferred from chimeric insulin-IGF-I receptor constructs to be the 223-274 region of IGF-I receptor (Gustafson, T. A. and Rutter, W. J., 1990, J. Biol. Chem., 265, 18663-18667; Soos, M. A. et al., 1992, J. Biol. Chem., 267, 12955-12963).
- The MCF-7 human breast cancer cell line is typically used as a model cell line to demonstrate the growth response of IGF-I and IGF-II in vitro (Dufourny, B. et al., 1997, J. Biol. Chem., 272, 31163-31171). In MCF-7 cells, the IR3 antibody incompletely blocks the stimulatory effect of exogenously added IGF-I and IGF-II in serum-free conditions by approximately 80%. Also, the IR3 antibody does not significantly inhibit (less than 25%) the growth of MCF-7 cells in 10% serum (Cullen, K. J. et al., 1990, Cancer Res., 50, 48-53). This weak inhibition of serum-stimulated growth of MCF-7 cells by IR3 antibody in vitro may be related to the results of an in vivo study in which IR3 antibody treatment did not significantly inhibit the growth of a MCF-7 xenograft in nude mice (Arteaga, C. L. et al., 1989, J. Clin. Invest., 84, 1418-1423).
- Because of the weak agonistic activities of the IR3 and other reported antibodies, and their inability to significantly inhibit the growth of tumor cells such as MCF-7 cells in the more physiological condition of serum-stimulation (instead of stimulation by exogenously added IGF-I or IGF-II in serum-free condition), there is a need for new anti-IGF-I receptor antibodies which significantly inhibit the serum-stimulated growth of tumor cells but which do not show significant agonistic activity by themselves.
- Accordingly, it is an object of the invention to provide antibodies, antibody fragments and antibody derivatives that specifically bind to insulin-like growth factor-I receptor and inhibit the cellular activity of the receptor by antagonizing the receptor, and are also substantially devoid of agonist activity towards the receptor.
- Thus, in a first embodiment, there is provided murine antibody EM164, which is fully characterized herein with respect to the amino acid sequences of both its light and heavy chain variable regions, the cDNA sequences of the genes for the light and heavy chain variable regions, the identification of its CDRs (complementarity-determining regions), the identification of its surface amino acids, and means for its expression in recombinant form.
- In a second embodiment, there are provided resurfaced or humanized versions of antibody EM164 wherein surface-exposed residues of the antibody or its fragments are replaced in both light and heavy chains to more closely resemble known human antibody surfaces. Such humanized antibodies may have increased utility, compared to murine EM164, as therapeutic or diagnostic agents. Humanized versions of antibody EM164 are also fully characterized herein with respect to their respective amino acid sequences of both light and heavy chain variable regions, the DNA sequences of the genes for the light and heavy chain variable regions, the identification of the CDRs, the identification of their surface amino acids, and disclosure of a means for their expression in recombinant form.
- In a third embodiment, there is provided an antibody that is capable of inhibiting the growth of a cancer cell by greater than about 80% in the presence of a growth stimulant such as, for example, serum, insulin-like growth factor-I and insulin-like growth factor-II.
- In a fourth embodiment, there is provided an antibody or antibody fragment having a heavy chain including CDRs having amino acid sequences represented by SEQ ID NOS: 1-3, respectively:
SYWMH: (SEQ ID NO:1) EINPSNGRTNYNEKFKR, (SEQ ID NO:2) GRPDYYGSSKWYFDV; (SEQ ID NO:3) - and having a light chain that comprises CDRs having amino acid sequences represented by SEQ ID NOS:4-6:
RSSQSIVHSNVNTYLE; (SEQ ID NO:4) KVSNRFS; (SEQ ID NO:5) FQGSHVPPT. (SEQ ID NO:6) - In a fifth embodiment, there are provided antibodies having a heavy chain that has an amino acid sequence that shares at least 90% sequence identity with an amino acid sequence represented by SEQ ID NO:7:
(SEQ ID NO:7) QVQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGE INPSNGRTNYNEKFKRKATLTVDKSSSTAYMQLSSLTSEDSAVYYFARGR PDYYGSSKWYFDVWGAGTTVTVSS. - Similarly, there are provided antibodies having a light chain that has an amino acid sequence that shares at least 90% sequence identity with an amino acid sequence represented by SEQ ID NO:8:
(SEQ ID NO:8) DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNVNTYLEWYLQKPGQSPK LLIYKVSNRFSGVPDRFSGSGSGTDFTLRISRVEAEDLGIYYCFQGSHVP PTFGGGTKLEIKR. - In a sixth embodiment, antibodies are provided having a humanized or resurfaced light chain variable region having an amino acid sequence corresponding to one of SEQ ID NOS:9-12:
(SEQ ID NO:9) DVVMTQTPLSLPVSLGDPASISCRSSQSIVHSNVNTYLEWYLQKPGQSPR LLIYKVSNRFSGVPDRFSGSGAGTDFTLRISRVEAEDLGIYYCFQGSHVP PTFGGGTKLEIKR; (SEQ ID NO:10) DVLMTQTPLSLPVSLGDPASISCRSSQSIVHSNVNTYLEWYLQKPGQSPK LLIYKVSNRFSGVPDRFSGSGAGTDFTLRISRVEAEDLGIYYCFQGSHVP PTFGGGTKLEIKR; (SEQ ID NO:11) DVLMTQTPLSLPVSLGDPASISCRSSQSIVHSNVNTYLEWYLQKPGQSPR LLIYKVSNRFSGVPDRFSGSGAGTDFTLRISRVEAEDLGIYYCFQGSHVP PTFGGGTKLEIKR; or (SEQ ID NO:12) DVVMTQTPLSLPVSLGDPASISCRSSQSIVHSNVNTYLEWYLQKPGQSPK LLIYKVSNRFSGVPDRFSGSGAGTDFTLRISRVEAEDLGIYYCFQGSHVP PTFGGGTKLEIKR. - Similarly, antibodies are provided having a humanized or resurfaced heavy chain variable region having an amino acid sequence corresponding to SEQ ID NO: 13:
(SEQ ID NO:13) QVQLVQSGAEVVKPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGE INPSNGRTNYNQKFQGKATLTVDKSSSTAYMQLSSLTSEDSAVYYFARGR PDYYGSSKWYFDVWGQGTTVTVSS. - In a seventh embodiment, antibodies or antibody fragments of the present invention are provided that have improved properties. For example, antibodies or antibody fragments having improved affinity for IGF-I-receptor are prepared by affinity maturation of an antibody or fragment of the present invention.
- The present invention further provides conjugates of said antibodies, wherein a cytotoxic agent is covalently attached, directly or via a cleavable or non-cleavable linker, to an antibody or epitope-binding fragment of an antibody of the present invention. In preferred embodiments, the cytotoxic agent is a taxol, a maytansinoid, CC-1065 or a CC-1065 analog.
- The present invention further provides for antibodies or fragments thereof that are further labeled for use in research or diagnostic applications. In preferred embodiments, the label is a radiolabel, a fluorophore, a chromophore, an imaging agent or a metal ion.
- A method for diagnosis is also provided in which said labeled antibodies or fragments are administered to a subject suspected of having a cancer, and the distribution of the label within the body of the subject is measured or monitored.
- In an eighth embodiment, the invention provides methods for the treatment of a subject having a cancer by administering an antibody, antibody fragment or antibody conjugate of the present invention, either alone or in combination with other cytotoxic or therapeutic agents. The cancer can be one or more of, for example, breast cancer, colon cancer, ovarian carcinoma, osteosarcoma, cervical cancer, prostate cancer, lung cancer, synovial carcinoma, pancreatic cancer, or other cancer yet to be determined in which IGF-I receptor levels are elevated.
- In a ninth embodiment, the invention provides methods for the treatment of a subject having a cancer by administering an antibody, antibody fragment or antibody conjugate of the present invention, either alone or in combination with other cytotoxic or therapeutic agents. In particular, preferred cytotoxic and therapeutic agents include docetaxel, paclitaxel, doxorubicin, epirubicin, cyclophosphamide, trastuzumab (Herceptin), capecitabine, tamoxifen, toremifene, letrozole, anastrozole, fulvestrant, exemestane, goserelin, oxaliplatin, carboplatin, cisplatin, dexamethasone, antide, bevacizumab (Avastin), 5-fluorouracil, leucovorin, levamisole, irinotecan, etoposide, topotecan, gemcitabine, vinorelbine, estramustine, mitoxantrone, abarelix, zoledronate, streptozocin, rituximab (Rituxan), idarubicin, busulfan, chlorambucil, fludarabine, imatinib, cytarabine, ibritumomab (Zevalin), tositumomab (Bexxar), interferon alpha-2b, melphalam, bortezomib (Velcade), altretamine, asparaginase, gefitinib (Iressa), erlonitib (Tarceva), anti-EGF receptor antibody (Cetuximab, Abx-EGF), and an epothilone. More preferably, the therapeutic agent is a platinum agent (such as carboplatin, oxaliplatin, cisplatin), a taxane (such as paclitaxel, docetaxel), gemcitabine, or camptothecin.
- The cancer can be one or more of, for example, breast cancer, colon cancer, ovarian carcinoma, osteosarcoma, cervical cancer, prostate cancer, lung cancer, synovial carcinoma, pancreatic cancer, melanoma, multiple myeloma, neuroblastoma, and rhabdomyosarcoma, or other cancer yet to be determined in which IGF-I receptor levels are elevated.
- In a tenth embodiment, the invention provides kits comprising one or more of the elements described herein, and instructions for the use of those elements. In a preferred embodiment, a kit of the present invention includes antibody, antibody fragment or conjugate of the invention, and a therapeutic agent. The instructions for this preferred embodiment include instructions for inhibiting the growth of a cancer cell using the antibody, antibody fragment or conjugate of the invention, and the therapeutic agent, and/or instructions for a method of treating a patient having a cancer using the antibody, antibody fragment or conjugate of the invention, and the therapeutic agent.
-
FIG. 1 shows fluorescence activated cell sorting (FACS) analysis of the specific binding of purified EM164 antibody to cells overexpressing human Y1251F IGF-I receptor or human insulin receptor. -
FIG. 2 shows a binding titration curve for the binding of EM164 antibody to biotinylated human IGF-I receptor. -
FIG. 3 shows the inhibition of the binding of biotinylated IGF-I to human breast cancer MCF-7 cells by EM164 antibody. -
FIG. 4 shows the inhibition of IGF-I-stimulated autophosphorylation of IGF-I receptor in MCF-7 cells by EM164 antibody. -
FIG. 5 shows the inhibition of IGF-I-stimulated IRS-1-phosphorylation in MCF-7 cells by EM164 antibody. -
FIG. 6 shows the inhibition of IGF-I-stimulated signal transduction in SaOS-2 cells by EM164 antibody. -
FIG. 7 shows the effect of EM164 antibody on the growth and survival of MCF-7 cells under different growth conditions, as assessed by MTT assay. -
FIG. 8 shows the effect of EM164 antibody on the growth and survival of MCF-7 cells in the presence of various serum concentrations. -
FIG. 9 shows the inhibition of IGF-I- and serum-stimulated growth and survival of NCI-H838 cells by EM164 antibody. -
FIG. 10 shows the effect of treatment with EM164 antibody, taxol, or a combination of EM164 antibody and taxol, on the growth of a Calu-6 lung cancer xenograft in mice. -
FIG. 11 shows competition between the binding of humanized EM164 antibody (v.1.0) and murine EM164 antibody. -
FIG. 12 shows the cDNA (SEQ ID NO:49) and amino acid sequences (SEQ ID NO:50) of the light chain leader and variable region of the murine anti-IGF-I receptor antibody EM164. The arrow marks the start offramework 1. The 3 CDR sequences according to Kabat are underlined. -
FIG. 13 shows the cDNA (SEQ ID NO:51) and amino acid sequences (SEQ ID NO:52) of the heavy chain leader and variable region for the murine anti-IGF-I receptor antibody EM164. The arrow marks the start offramework 1. The 3 CDR sequences according to Kabat are underlined. -
FIG. 14 shows the light and heavy chain CDR amino acid sequences of antibody EM164 as determined from Chothia canonical class definitions. AbM modeling software definitions for the heavy chain CDRs are also shown. Light Chain: CDR1 is SEQ ID NO:4, CDR2 is SEQ ID NO:5, and CDR3 is SEQ ID NO:6. Heavy Chain: CDR1 is SEQ ID NO:1, CDR2 is SEQ ID NO:2, and CDR3 is SEQ ID NO:3. AbM Heavy Chain: CDR1 is SEQ ID NO:53, CDR2 is SEQ ID NO:54, and CDR3 is SEQ ID NO:55. -
FIG. 15 shows the light chain and heavy chain amino acid sequences for anti-IGF-I-receptor antibody EM164 aligned with the germline sequences for the Cr1 (SEQ ID NO:56) and J558.c (SEQ ID NO:57) genes. Dashes (-) indicate sequence identity. -
FIG. 16 shows the plasmids used to build and express the recombinant chimeric and humanized EM164 antibodies. A) a light chain cloning plasmid, B) a heavy chain cloning plasmid, C) a mammalian antibody expression plasmid. -
FIG. 17 shows the 10 most homologous amino acid sequences of the light chains screened from the 127 antibodies in the set of structure files used to predict the surface residues of EM164. em164 LC (SEQ ID NO:58), 2jel (SEQ ID NO:59), 2pcp (SEQ ID NO:60), 1nqb (SEQ ID NO:61), 1kel (SEQ ID NO:62), 1hyx (SEQ ID NO:63), 1igf (SEQ ID NO:64), 1tet (SEQ ID NO:65), 1clz (SEQ ID NO:66), 1bln (SEQ ID NO:67), 1cly (SEQ ID NO:68), Consensus (SEQ ID NO:69). -
FIG. 18 shows the 10 most homologous amino acid sequences of the heavy chains screened from the 127 antibodies in the set of structure files used to predict the surface residues of EM164. em164 HC (SEQ ID NO:70), 1nqb (SEQ ID NO:71), 1ngp (SEQ ID NO:72), 1fbi (SEQ ID NO:73), 1afv (SEQ ID NO:74), 1yuh (SEQ ID NO:75), 1plg (SEQ ID NO:76), 1d5b (SEQ ID NO:77), 1ae6 (SEQ ID NO:78), 1axs (SEQ ID NO:79), 3hfl (SEQ ID NO:80), Consensus (SEQ ID NO:81). -
FIG. 19 shows the average accessibility for each of the (A) light, and (B) heavy chain variable region residues from the 10 most homologous structures. The numbers represent the Kabat antibody sequence position numbers. -
FIG. 20 shows the light chain variable region amino acid sequences for murine EM164 (muEM164) and humanized EM164 (huEM164) antibodies. muEM164 (SEQ ID NO:82), huEM164 V1.0 (SEQ ID NO:83), huEM164 V1.1 (SEQ ID NO:84), huEM164 V1.2 (SEQ ID NO:85), huEM164 V1.3 (SEQ ID NO:86). -
FIG. 21 shows the heavy chain variable region amino acid sequences for murine (muEM164, SEQ ID NO:87) and humanized EM164 antibodies (huEM164, SEQ ID NO:88). -
FIG. 22 shows the huEM164 v1.0 variable region DNA and amino acid sequences for both the light (DNA, SEQ ID NO:89, amino acid SEQ ID NO:90) and heavy chains (DNA, SEQ ID NO:91, amino acid SEQ ID NO:92). -
FIG. 23 shows the light chain variable region DNA and amino acid sequences for humanized EM164 v1.1 (DNA, SEQ ID NO:93; amino acid SEQ ID NO:94), v1.2 (DNA, SEQ ID NO:95; amino acid SEQ ID NO:96) and v1.3 (DNA, SEQ ID NO:97; amino acid SEQ ID NO:98). -
FIG. 24 shows the inhibition of IGF-I-stimulated growth and survival of MCF-7 cells by humanized EM164 v1.0 antibody and murine EM164 antibody. -
FIG. 25 shows that EM164 suppresses IGF-1-stimulated cycling of MCF-7 cells. -
FIG. 26 shows that EM164 suppresses the anti-apoptotic effect of IGF-1 and serum. Treatment with EM164 results in apoptotic cell death as demonstrated by the increased levels of cleaved CK18 protein. -
FIG. 27 shows the effect of treatment with EM164 antibody, gemcitabine, or a combination of EM164 antibody and gemcitabine, on the growth of human BxPC-3 pancreatic cancer xenografts in immunodeficient mice. - The present inventors have discovered and improved novel antibodies that specifically bind to the human insulin-like growth factor-I receptor (IGF-IR) on the cell surface. The antibodies and fragments have the unique ability to inhibit the cellular functions of the receptor without the capacity to activate the receptor themselves. Thus, while previously known antibodies that specifically bind and inhibit IGF-IR also activate the receptor even in the absence of IGF-IR ligands, the antibodies or fragments of the present invention antagonize IGF-IR but are substantially devoid of agonist activity. Furthermore, the antibodies and antibody fragments of the present invention inhibit the growth of human tumor cells such as MCF-7 cells in the presence of serum by greater than 80%, which is a higher degree of inhibition than is obtained using previously known anti-IGF-IR antibodies.
- The present invention proceeds from a murine anti-IGF-IR antibody, herein EM164, that is fully characterized with respect to the amino acid sequences of both light and heavy chains, the identification of the CDRs, the identification of surface amino acids, and means for its expression in recombinant form.
- The germline sequences are shown in
FIG. 15 aligned with the sequence of EM164. The comparison identifies probable somatic mutations in EM164, including one each in CDR1 in the light chain and in CDR2 in the heavy chain. - The primary amino acid and DNA sequences of antibody EM164 light and heavy chains, and of humanized versions, are disclosed herein. However, the scope of the present invention is not limited to antibodies and fragments comprising these sequences. Instead, all antibodies and fragments that specifically bind to an insulin-like growth factor-I receptor and antagonize the biological activity of the receptor, but which are substantially devoid of agonist activity, fall within the scope of the present invention. Thus, antibodies and antibody fragments may differ from antibody EM164 or the humanized derivatives in the amino acid sequences of their scaffold, CDRs, light chain and heavy chain, and still fall within the scope of the present invention.
- The CDRs of antibody EM164 are identified by modeling and their molecular structures have been predicted. Again, while the CDRs are important for epitope recognition, they are not essential to the antibodies and fragments of the invention. Accordingly, antibodies and fragments are provided that have improved properties produced by, for example, affinity maturation of an antibody of the present invention.
- Diverse antibodies and antibody fragments, as well as antibody mimics may be readily produced by mutation, deletion and/or insertion within the variable and constant region sequences that flank a particular set of CDRs. Thus, for example, different classes of Ab are possible for a given set of CDRs by substitution of different heavy chains, whereby, for example, IgG1-4, IgM, IgA1-2, IgD, IgE antibody types and isotypes may be produced. Similarly, artificial antibodies within the scope of the invention may be produced by embedding a given set of CDRs within an entirely synthetic framework. The term “variable” is used herein to describe certain portions of the variable domains that differ in sequence among antibodies and are used in the binding and specificity of each particular antibody for its antigen. However, the variability is not usually evenly distributed through the variable domains of the antibodies. It is typically concentrated in three segments called complementarity determining regions (CDRs) or hypervariable regions both in the light chain and the heavy chain variable domains. The more highly conserved portions of the variable domains are called the framework (FR). The variable domains of heavy and light chains each comprise four framework regions, largely adopting a beta-sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of the beta-sheet structure. The CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen binding site of antibodies (E. A. Kabat et al. Sequences of Proteins of Immunological Interest, fifth edition, 1991, NIH). The constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.
- Humanized antibodies, or antibodies adapted for non-rejection by other mammals, may be produced using several technologies such as resurfacing and CDR grafting. In the resurfacing technology, molecular modeling, statistical analysis and mutagenesis are combined to adjust the non-CDR surfaces of variable regions to resemble the surfaces of known antibodies of the target host. Strategies and methods for the resurfacing of antibodies, and other methods for reducing immunogenicity of antibodies within a different host, are disclosed in U.S. Pat. No. 5,639,641, which is hereby incorporated in its entirety by reference. In the CDR grafting technology, the murine heavy and light chain CDRs are grafted into a fully human framework sequence.
- The invention also includes functional equivalents of the antibodies described in this specification. Functional equivalents have binding characteristics that are comparable to those of the antibodies, and include, for example, chimerized, humanized and single chain antibodies as well as fragments thereof. Methods of producing such functional equivalents are disclosed in PCT Application WO 93/21319, European Patent Application No. 239,400; PCT Application WO 89/09622; European Patent Application 338,745; and European Patent Application EP 332,424, which are incorporated in their respective entireties by reference.
- Functional equivalents include polypeptides with amino acid sequences substantially the same as the amino acid sequence of the variable or hypervariable regions of the antibodies of the invention. “Substantially the same” as applied to an amino acid sequence is defined herein as a sequence with at least about 90%, and more preferably at least about 95% sequence identity to another amino acid sequence, as determined by the FASTA search method in accordance with Pearson and Lipman, Proc. Natl.
Acad. Sci. USA 85, 2444-2448 (1988). - Chimerized antibodies preferably have constant regions derived substantially or exclusively from human antibody constant regions and variable regions derived substantially or exclusively from the sequence of the variable region from a mammal other than a human. Humanized forms of the antibodies are made by substituting the complementarity determining regions of, for example, a mouse antibody, into a human framework domain, e.g., see PCT Pub. No. WO92/22653. Humanized antibodies preferably have constant regions and variable regions other than the complementarity determining regions (CDRs) derived substantially or exclusively from the corresponding human antibody regions and CDRs derived substantially or exclusively from a mammal other than a human.
- Functional equivalents also include single-chain antibody fragments, also known as single-chain antibodies (scFvs). These fragments contain at least one fragment of an antibody variable heavy-chain amino acid sequence (VH) tethered to at least one fragment of an antibody variable light-chain sequence (VL) with or without one or more interconnecting linkers. Such a linker may be a short, flexible peptide selected to assure that the proper three-dimensional folding of the (VL) and (VH) domains occurs once they are linked so as to maintain the target molecule binding-specificity of the whole antibody from which the single-chain antibody fragment is derived. Generally, the carboxyl terminus of the (VL) or (VH) sequence may be covalently linked by such a peptide linker to the amino acid terminus of a complementary (VL) and (VH) sequence. Single-chain antibody fragments may be generated by molecular cloning, antibody phage display library or similar techniques. These proteins may be produced either in eukaryotic cells or prokaryotic cells, including bacteria.
- Single-chain antibody fragments contain amino acid sequences having at least one of the variable or complementarity determining regions (CDRs) of the whole antibodies described in this specification, but are lacking some or all of the constant domains of those antibodies. These constant domains are not necessary for antigen binding, but constitute a major portion of the structure of whole antibodies. Single-chain antibody fragments may therefore overcome some of the problems associated with the use of antibodies containing a part or all of a constant domain. For example, single-chain antibody fragments tend to be free of undesired interactions between biological molecules and the heavy-chain constant region, or other unwanted biological activity. Additionally, single-chain antibody fragments are considerably smaller than whole antibodies and may therefore have greater capillary permeability than whole antibodies, allowing single-chain antibody fragments to localize and bind to target antigen-binding sites more efficiently. Also, antibody fragments can be produced on a relatively large scale in prokaryotic cells, thus facilitating their production. Furthermore, the relatively small size of single-chain antibody fragments makes them less likely to provoke an immune response in a recipient than whole antibodies.
- Functional equivalents further include fragments of antibodies that have the same, or comparable binding characteristics to those of the whole antibody. Such fragments may contain one or both Fab fragments or the F(ab′)2 fragment. Preferably the antibody fragments contain all six complementarity determining regions of the whole antibody, although fragments containing fewer than all of such regions, such as three, four or five CDRs, are also functional. Further, the functional equivalents may be or may combine members of any one of the following immunoglobulin classes: IgG, IgM, IgA, IgD, or IgE, and the subclasses thereof.
- The knowledge of the amino acid and nucleic acid sequences for the anti-IGF-I receptor antibody EM164 and its humanized variants, which are described herein, can be used to develop other antibodies which also bind to human IGF-I receptor and inhibit the cellular functions of the IGF-I receptor. Several studies have surveyed the effects of introducing one or more amino acid changes at various positions in the sequence of an antibody, based on the knowledge of the primary antibody sequence, on its properties such as binding and level of expression (Yang, W. P. et al., 1995, J. Mol. Biol., 254, 392-403; Rader, C. et al., 1998, Proc. Natl. Acad. Sci. USA, 95, 8910-8915; Vaughan, T. J. et al., 1998, Nature Biotechnology, 16, 535-539).
- In these studies, variants of the primary antibody have been generated by changing the sequences of the heavy and light chain genes in the CDR1, CDR2, CDR3, or framework regions, using methods such as oligonucleotide-mediated site-directed mutagenesis, cassette mutagenesis, error-prone PCR, DNA shuffling, or mutator-strains of E. coli (Vaughan, T. J. et al., 1998, Nature Biotechnology, 16, 535-539; Adey, N. B. et al., 1996,
Chapter 16, pp. 277-291, in “Phage Display of Peptides and Proteins”, Eds. Kay, B. K. et al., Academic Press). These methods of changing the sequence of the primary antibody have resulted in improved affinities of the secondary antibodies (Gram, H. et al., 1992, Proc. Natl. Acad. Sci. USA, 89, 3576-3580; Boder, E. T. et al., 2000, Proc. Natl. Acad. Sci. USA, 97, 10701-10705; Davies, J. and Riechmann, L., 1996, Immunotechnolgy, 2, 169-179; Thompson, J. et al., 1996, J. Mol. Biol., 256, 77-88; Short, M. K. et al., 2002, J. Biol. Chem., 277, 16365-16370; Furukawa, K. et al., 2001, J. Biol. Chem., 276, 27622-27628). - By a similar directed strategy of changing one or more amino acid residues of the antibody, the antibody sequences described in this invention can be used to develop anti-IGF-I receptor antibodies with improved functions.
- The conjugates of the present invention comprise the antibody, fragments, and their analogs as disclosed herein, linked to a cytotoxic agent. Preferred cytotoxic agents are maytansinoids, taxanes and analogs of CC-1065. The conjugates can be prepared by in vitro methods. In order to link the cytotoxic agent to the antibody, a linking group is used. Suitable linking groups are well known in the art and include disulfide groups, thioether groups, acid labile groups, photolabile groups, peptidase labile groups and esterase labile groups. Preferred linking groups are disulfide groups and thioether groups. For example, conjugates can be constructed using a disulfide exchange reaction or by forming a thioether bond between the antibody and the cytotoxic agent.
- Maytansinoids and maytansinoid analogs are among the preferred cytotoxic agents. Examples of suitable maytansinoids include maytansinol and maytansinol analogs. Suitable maytansinoids are disclosed in U.S. Pat. Nos. 4,424,219; 4,256,746; 4,294,757; 4,307,016; 4,313,946; 4,315,929; 4,331,598; 4,361,650; 4,362,663; 4,364,866; 4,450,254; 4,322,348; 4,371,533; 6,333,410; 5,475,092; 5,585,499; and 5,846,545.
- Taxanes are also preferred cytotoxic agents. Taxanes suitable for use in the present invention are disclosed in U.S. Pat. Nos. 6,372,738 and 6,340,701.
- CC-1065 and its analogs are also preferred cytotoxic drugs for use in the present invention. CC-1065 and its analogs are disclosed in U.S. Pat. Nos. 6,372,738; 6,340,701; 5,846,545 and 5,585,499.
- An attractive candidate for the preparation of such cytotoxic conjugates is CC-1065, which is a potent anti-tumor antibiotic isolated from the culture broth of Streptomyces zelensis. CC-1065 is about 1000-fold more potent in vitro than are commonly used anti-cancer drugs, such as doxorubicin, methotrexate and vincristine (B. K. Bhuyan et al., Cancer Res., 42, 3532-3537 (1982)).
- Cytotoxic drugs such as methotrexate, daunorubicin, doxorubicin, vincristine, vinblastine, melphalan, mitomycin C, chlorambucil, and calicheamicin are also suitable for the preparation of conjugates of the present invention, and the drug molecules can also be linked to the antibody molecules through an intermediary carrier molecule such as serum albumin.
- For diagnostic applications, the antibodies of the present invention typically will be labeled with a detectable moiety. The detectable moiety can be any one which is capable of producing, either directly or indirectly, a detectable signal. For example, the detectable moiety may be a radioisotope, such as 3H, 14C, 32P, 35S, or 131I; a fluorescent or chemiluminescent compound, such as fluorescein isothiocyanate, rhodamine, or luciferin; or an enzyme, such as alkaline phosphatase, beta-galactosidase or horseradish peroxidase.
- Any method known in the art for conjugating the antibody to the detectable moiety may be employed, including those methods described by Hunter, et al., Nature 144:945 (1962); David, et al., Biochemistry 13:1014 (1974); Pain, et al., J. Immunol. Meth. 40:219 (1981); and Nygren, J. Histochem. and Cytochem. 30:407 (1982).
- The antibodies of the present invention can be employed in any known assay method, such as competitive binding assays, direct and indirect sandwich assays, and immunoprecipitation assays (Zola, Monoclonal Antibodies: A Manual of Techniques, pp.147-158 (CRC Press, Inc., 1987)).
- The antibodies of the invention also are useful for in vivo imaging, wherein an antibody labeled with a detectable moiety such as a radio-opaque agent or radioisotope is administered to a subject, preferably into the bloodstream, and the presence and location of the labeled antibody in the host is assayed. This imaging technique is useful in the staging and treatment of malignancies. The antibody may be labeled with any moiety that is detectable in a host, whether by nuclear magnetic resonance, radiology, or other detection means known in the art.
- The antibodies of the invention also are useful as affinity purification agents. In this process, the antibodies are immobilized on a suitable support, such a Sephadex resin or filter paper, using methods well known in the art.
- The antibodies of the invention also are useful as reagents in biological research, based on their inhibition of the function of IGF-I receptor in cells.
- For therapeutic applications, the antibodies or conjugates of the invention are administered to a subject, in a pharmaceutically acceptable dosage form. They can be administered intravenously as a bolus or by continuous infusion over a period of time, by intramuscular, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, topical, or inhalation routes. The antibody may also be administered by intratumoral, peritumoral, intralesional, or perilesional routes, to exert local as well as systemic therapeutic effects. Suitable pharmaceutically acceptable carriers, diluents, and excipients are well known and can be determined by those of skill in the art as the clinical situation warrants. Examples of suitable carriers, diluents and/or excipients include: (1) Dulbecco's phosphate buffered saline, pH about 7.4, containing about 1 mg/ml to 25 mg/ml human serum albumin, (2) 0.9% saline (0.9% w/v NaCl), and (3) 5% (w/v) dextrose. The method of the present invention can be practiced in vitro, in vivo, or ex vivo.
- In other therapeutic treatments, the antibodies, antibody fragments or conjugates of the invention are co-administered, or administered sequentially, with one or more additional therapeutic agents. Suitable therapeutic agents include, but are not limited to, cytotoxic or cytostatic agents. Taxol is a preferred therapeutic agent that is also a cytotoxic agent.
- Cancer therapeutic agents are those agents that seek to kill or limit the growth of cancer cells while doing minimal damage to the host. Thus, such agents may exploit any difference in cancer cell properties (e.g. metabolism, vascularization or cell-surface antigen presentation) from healthy host cells. Differences in tumor morphology are potential sites for intervention: for example, the second therapeutic can be an antibody such as an anti-VEGF antibody that is useful in retarding the vascularization of the interior of a solid tumor, thereby slowing its growth rate. Other therapeutic agents include, but are not limited to, adjuncts such as granisetron HCl, androgen inhibitors such as leuprolide acetate, antibiotics such as doxorubicin, antiestrogens such as tamoxifen, antimetabolites such as interferon alpha-2a, cytotoxic agents such as taxol, enzyme inhibitors such as ras famesyl-transferase inhibitor, immunomodulators such as aldesleukin, and nitrogen mustard derivatives such as melphalan HCl, and the like.
- The therapeutic agents that can be combined with EM164 for improved anti-cancer efficacy include diverse agents used in oncology practice (Reference: Cancer, Principles & Practice of Oncology, DeVita, V. T., Hellman, S., Rosenberg, S. A., 6th edition, Lippincott-Raven, Philadelphia, 2001), such as docetaxel, paclitaxel, doxorubicin, epirubicin, cyclophosphamide, trastuzumab (Herceptin), capecitabine, tamoxifen, toremifene, letrozole, anastrozole, fulvestrant, exemestane, goserelin, oxaliplatin, carboplatin, cisplatin, dexamethasone, antide, bevacizumab (Avastin), 5-fluorouracil, leucovorin, levamisole, irinotecan, etoposide, topotecan, gemcitabine, vinorelbine, estramustine, mitoxantrone, abarelix, zoledronate, streptozocin, rituximab (Rituxan), idarubicin, busulfan, chlorambucil, fludarabine, imatinib, cytarabine, ibritumomab (Zevalin), tositumomab (Bexxar), interferon alpha-2b, melphalam, bortezomib (Velcade), altretamine, asparaginase, gefitinib (Iressa), erlonitib (Tarceva), anti-EGF receptor antibody (Cetuximab, Abx-EGF), epothilones, and conjugates of cytotoxic drugs and antibodies against cell-surface receptors. Preferred therapeutic agents are platinum agents (such as carboplatin, oxaliplatin, cisplatin), taxanes (such as paclitaxel, docetaxel), gemcitabine, and camptothecin.
- The one or more additional therapeutic agents can be administered before, concurrently, or after the antibody, antibody fragment or conjugate of the invention. The skilled artisan will understand that for each therapeutic agent there may be advantages to a particular order of administration. Similarly, the skilled artisan will understand that for each therapeutic agent, the length of time between which the agent, and an antibody, antibody fragment or conjugate of the invention is administered, will vary.
- While the skilled artisan will understand that the dosage of each therapeutic agent will be dependent on the identity of the agent, the preferred dosages can range from about 10 mg/square meter to about 2000 mg/square meter, more preferably from about 50 mg/square meter to about 1000 mg/square meter. For preferred agents such as platinum agents (carboplatin, oxaliplatin, cisplatin), the preferred dosage is about 10 mg/square meter to about 400 mg/square meter, for taxanes (paclitaxel, docetaxel) the preferred dosage is about 20 mg/square meter to about 150 mg/square meter, for gemcitabine the preferred dosage is about 100 mg/square meter to about 2000 mg/square meter, and for camptothecin the preferred dosage is about 50 mg/square meter to about 350 mg/square meter. The dosage of this and other therapeutic agents may depend on whether the antibody, antibody fragment or conjugate of the invention is administered concurrently or sequentially with a therapeutic agent.
- Administration of an antibody, antibody fragment or conjugate of the invention, and one or more additional therapeutic agents, whether co-administered or administered sequentially, may occur as described above for therapeutic applications. Suitable pharmaceutically acceptable carriers, diluents, and excipients for co-administration will be understood by the skilled artisan to depend on the identity of the particular therapeutic agent being co-administered.
- When present in an aqueous dosage form, rather than being lyophilized, the antibody typically will be formulated at a concentration of about 0.1 mg/ml to 100 mg/ml, although wide variation outside of these ranges is permitted. For the treatment of disease, the appropriate dosage of antibody or conjugate will depend on the type of disease to be treated, as defined above, the severity and course of the disease, whether the antibodies are administered for preventive or therapeutic purposes, the course of previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician. The antibody is suitably administered to the patient at one time or over a series of treatments.
- Depending on the type and severity of the disease, preferably from about 1 mg/square meter to about 2000 mg/square meter of antibody is an initial candidate dosage for administration to the patient, more preferably from about 10 mg/square meter to about 1000 mg/square meter of antibody whether, for example, by one or more separate administrations, or by continuous infusion. For repeated administrations over several days or longer, depending on the condition, the treatment is repeated until a desired suppression of disease symptoms occurs. However, other dosage regimens may be useful and are not excluded.
- The present invention also includes kits comprising one or more of the elements described herein, and instructions for the use of those elements. In a preferred embodiment, a kit of the present invention includes antibody, antibody fragment or conjugate of the invention, and a therapeutic agent. The instructions for this preferred embodiment include instructions for inhibiting the growth of a cancer cell using the antibody, antibody fragment or conjugate of the invention, and the therapeutic agent, and/or instructions for a method of treating a patient having a cancer using the antibody, antibody fragment or conjugate of the invention, and the therapeutic agent.
- Preferably, the antibody used in the kit has the same amino acid sequence as the murine antibody EM164 produced by mouse hybridoma EM164 (ATCC accession number PTA-4457), or the antibody is an epitope-binding fragment thereof, wherein both the antibody and the fragment specifically bind to insulin-like growth factor-I receptor. The antibody and antibody fragment used in the kit may also be a resurfaced version of the EM164 antibody, a humanized version of the EM164 antibody, or an altered version of the EM164 antibody having least one nucleotide mutation, deletion or insertion. Antibodies and antibody fragments of each of these three versions retain the same binding specificity as the EM164 antibody.
- Preferably, the therapeutic agent used in the kit is selected from the group consisting of docetaxel, paclitaxel, doxorubicin, epirubicin, cyclophosphamide, trastuzumab (Herceptin), capecitabine, tamoxifen, toremifene, letrozole, anastrozole, fulvestrant, exemestane, goserelin, oxaliplatin, carboplatin, cisplatin, dexamethasone, antide, bevacizumab (Avastin), 5-fluorouracil, leucovorin, levamisole, irinotecan, etoposide, topotecan, gemcitabine, vinorelbine, estramustine, mitoxantrone, abarelix, zoledronate, streptozocin, rituximab (Rituxan), idarubicin, busulfan, chlorambucil, fludarabine, imatinib, cytarabine, ibritumomab (Zevalin), tositumomab (Bexxar), interferon alpha-2b, melphalam, bortezomib (Velcade), altretamine, asparaginase, gefitinib (Iressa), erlonitib (Tarceva), anti-EGF receptor antibody (Cetuximab, Abx-EGF), and an epothilone. More preferably, the therapeutic agent is a platinum agent (such as carboplatin, oxaliplatin, cisplatin), a taxane (such as paclitaxel, docetaxel), gemcitabine, or camptothecin.
- The elements of the kits of the present invention are in a suitable form for a kit, such as a solution or lyophilized powder. The concentration or amount of the elements of the kits will be understood by the skilled artisan to varying depending on the identity and intended use of each element of the kit.
- The cancers and cells therefrom referred to in the instructions of the kits include breast cancer, colon cancer, ovarian carcinoma, osteosarcoma, cervical cancer, prostate cancer, lung cancer, synovial carcinoma, pancreatic cancer, melanoma, multiple myeloma, neuroblastoma, and rhabdomyosarcoma.
- The invention is now described by reference to the following examples, which are illustrative only, and are not intended to limit the present invention.
- In this first example, the complete primary amino acid structure and cDNA sequence of a murine antibody of the present invention is disclosed, together with its binding properties and means for its expression in recombinant form. Accordingly, there is provided a full and complete disclosure of an antibody of the invention and its preparation, such that one of ordinary skill in the immunological arts would be able to prepare said antibody without undue experimentation.
- A. Generation of Anti-IGF-I Receptor Monoclonal Antibody Hybridoma
- A cell line expressing human IGF-I receptor with a Y1251F mutation was used for immunization as it expressed a high number of IGF-I receptors (˜107 per cell). The Y1251F-mutation in the cytoplasmic domain of IGF-I receptor resulted in loss of transformation and anti-apoptotic signaling, but did not affect IGF-I binding and IGF-I-stimulated mitogenic signaling (O'Connor, R. et al., 1997, Mol. Cell. Biol., 17, 427-435; Miura, M. et al., 1995, J. Biol. Chem., 270, 22639-22644). The mutation did not otherwise affect antibody generation because the antibody of this example bound to the extracellular domain of IGF-I receptor, which was identical for both the Y1251F mutant and the wild type receptor.
- A cell line expressing human IGF-I receptor with a Y1251F mutation was generated from 3T3-like cells of a IGF-I-receptor-deficient mouse by transfection with Y1251F-mutant human IGF-I-receptor gene together with a puromycin-resistance gene, and was selected using puromycin (2.5 microgram/mL) and by FACS sorting for high IGF-I receptor expression (Miura, M. et al., 1995, J. Biol. Chem., 270, 22639-22644). A cell line having a high level of IGF-I receptor expression was further selected using a high concentration of puromycin such as 25 microgram/mL, which was toxic to most of the cells. Surviving colonies were picked and those displaying a high level of IGF-I receptor expression were selected.
- CAF1/J female mice, 6 months old, were immunized intraperitoneally on
day 0 with Y125IF-mutant-human-IGF-I-receptor-overexpressing cells (5×105 cells, suspended in 0.2 mL PBS). The animals were boosted with 0.2 mL cell suspension as follows: 2, 1×106 cells;day 5, 2×106 cells;day 7, 9, 12, and 23, 1×107 cells. On day 26, a mouse was sacrificed and its spleen removed.days - The spleen was ground between two frosted glass slides to obtain a single cell suspension, which was washed with serum-free RPMI medium containing penicillin and streptomycin (SFM). The spleen cell pellet was resuspended in 10 mL of 0.83% (w/v) ammonium chloride solution in water for 10 min on ice to lyse the red blood cells, and was then washed with serum-free medium (SFM). Spleen cells (1.2×108) were pooled with myeloma cells (4×107) from the non-secreting mouse myeloma cell line P3X63Ag8.653 (ATCC, Rockville, Md.; Cat. #CRL1580) in a tube, and washed with the serum-free RPMI-1640 medium (SFM). The supernatant was removed and the cell pellet resuspended in the residual medium. The tube was placed in a beaker of water at 37° C. and 1.5 mL of polyethylene glycol solution (50% PEG (w/v), average molecular weight 1500 in 75 mM HEPES, pH 8) was added slowly at a drop rate of 0.5 mL/minute while the tube was gently shaken. After a wait of one minute, 10 mL of SFM was added as follows: 1 mL over the first minute, 2 mL over the second minute, and 7 mL over the third minute. Another 10 mL was then added slowly over one minute. Cells were pelleted by centrifugation, washed in SFM and resuspended in RPMI-1640 growth medium supplemented with 5% fetal bovine serum (FBS), hypoxanthine/aminopterin/thymidine (HAT), penicillin, streptomycin, and 10% hybridoma cloning supplement (HCS). Cells were seeded into 96-well flat-bottom tissue culture plates at 2×105 spleen cells in 200 μL per well. After 5-7 days, 100 μL per well were removed and replaced with growth medium supplemented with hypoxanthine/thymidine (HT) and 5% FBS. The general conditions used for immunization and hybridoma production were as described by J. Langone and H. Vunakis (Eds., Methods in Enzymology, Vol. 121, “Immunochemical Techniques, Part I”; 1986; Academic Press, Florida) and E. Harlow and D. Lane (“Antibodies: A Laboratory Manual”; 1988; Cold Spring Harbor Laboratory Press, New York). Other techniques of immunization and hybridoma production can also be used, as are well known to those of skill in the art.
- Culture supernatants from hybridoma clones were screened for binding to purified human IGF-I receptor by ELISA, for specific binding to cells overexpressing human IGF-I receptor, and for a lack of binding to cells overexpressing human insulin receptor by ELISA and FACS screening as described below. Clones exhibiting higher binding affinity to cells overexpressing human IGF-I receptor than to cells overexpressing human insulin receptor were expanded and subcloned. The culture supernatants of the subclones were further screened by the above binding assays. By this procedure, subclone 3F1-C8-D7 (EM164) was selected, and the heavy and light chain genes were cloned and sequenced as described below.
- Human IGF-I receptor was isolated for use in the screening of supernatants from hybridoma clones for their binding to IGF-I receptor by the method below. Biotinylated IGF-I was prepared by modification of recombinant IGF-I using biotinylating reagents such as sulfo-NHS-LC-biotin, sulfo-NHS-SS-biotin, or NHS-PEO4-biotin. Biotinylated IGF-I was absorbed on streptavidin-agarose beads and incubated with lysate from cells that overexpressed human wild type or Y1251F mutant IGFR. The beads were washed and eluted with a buffer containing 2 to 4 M urea and detergent such as triton X-100 or octyl-β-glucoside. Eluted IGF-I receptor was dialyzed against PBS and was analyzed for purity by SDS-PAGE under reducing conditions, which showed alpha and beta chain bands of IGF-I receptor of molecular weights about 135 kDa and 95 kDa, respectively.
- To check for the binding of hybridoma supernatants to purified IGF-I receptor, an Immulon-4HB ELISA plate (Dynatech) was coated with a purified human IGF-I receptor sample (prepared by dialysis from urea/octyl-β-glucoside elution of affinity purified sample) diluted in 50 mM CHES buffer at pH 9.5 (100 μL; 4° C., overnight). The wells were blocked with 200 μL of blocking buffer (10 mg/mL BSA in TBS-T buffer containing 50 mM Tris, 150 mM NaCl, pH 7.5, and 0.1% Tween-20) and incubated with supernatants from hybridoma clones (100 μL; diluted in blocking buffer) for about 1 h to 12 h, washed with TBS-T buffer, and incubated with goat-anti-mouse-IgG-Fc-antibody-horseradish peroxidase (HRP) conjugate (100 μL; 0.8 μg/mL in blocking buffer; Jackson ImmunoResearch Laboratories), followed by washes and detection using ABTS/H2O2 substrate at 405 nm (0.5 mg/mL ABTS, 0.03% H2O2 in 0.1 M citrate buffer pH 4.2). Typically, a supernatant from a 3F1 hybridoma subclone yielded a signal of about 1.2 absorbance units within 3 min of development, in contrast to values of 0.0 obtained for supernatants from some other hybridoma clones. General conditions for this ELISA were similar to the standard ELISA conditions for antibody binding and detection as described by E. Harlow and D. Lane (“Using Antibodies: A Laboratory Manual”; 1999, Cold Spring Harbor Laboratory Press, New York), which conditions can also be used.
- Screening of hybridoma supernatants for specific binding to human IGF-I receptor and not to human insulin receptor was performed using ELISA on cell lines that overexpressed human Y1251F-IGF-I receptor and on cell lines that overexpressed human insulin receptor. Both cell lines were generated from 3T3-like cells of IGF-I receptor deficient mice. The IGF-I receptor overexpressing cells and insulin receptor overexpressing cells were separately harvested from tissue culture flasks by quick trypsin/EDTA treatment, suspended in growth medium containing 10% FBS, pelleted by centrifugation, and washed with PBS. The washed cells (100 μL of about 1-3×106 cells/mL) were added to wells of an Immulon-2HB plate coated with phytohemagglutinin (100 μL of 20 μg/mL PHA), centrifuged and allowed to adhere to PHA-coated wells for 10 min. The plate with cells was flicked to remove PBS and was then dried overnight at 37° C. The wells were blocked with 5 mg/mL BSA solution in PBS for 1 h at 37° C. and were then washed gently with PBS. Aliquots of the supernatants from hybridoma clones (100 μL; diluted in blocking buffer) were then added to wells containing IGF-I-receptor-overexpressing cells and to wells containing insulin receptor-overexpressing cells and were incubated at ambient temperature for 1 h. The wells were washed with PBS, incubated with goat-anti-mouse-IgG-Fc-antibody-horseradish peroxidase conjugate (100 μL; 0.8 μg/mL in blocking buffer) for 1 h, followed by washes and then binding was detected using an ABTS/H2O2 substrate. A typical supernatant from a 3F1 hybridoma subclone upon incubation with cells overexpressing IGF-I receptor yielded a signal of 0.88 absorbance units within 12 min of development, in contrast to a value of 0.22 absorbance units obtained upon incubation with cells overexpressing human insulin receptor.
- The hybridoma was grown in Integra CL 350 flasks (Integra Biosciences, Maryland), according to manufacturer's specifications, to provide purified EM164 antibody. A yield of about 0.5-1 mg/mL antibody was obtained in the harvested supernatants from the Integra flasks, based on quantitation by ELISA and by SDS-PAGE/Coomassie blue staining using antibody standards. The antibody was purified by affinity chromatography on Protein A-agarose bead column under standard purification conditions of loading and washing in 100 mM Tris buffer, pH 8.9, containing 3 M NaCl, followed by elution in 100 mM acetic acid solution containing 150 mM NaCl. The eluted fractions containing antibody were neutralized with cold 2 M K2HPO4 solution and dialyzed in PBS at 4° C. The concentration of the antibody was determined by measuring absorbance at 280 nm (extinction coefficient=1.4 mg−1 mL cm−1). The purified antibody sample was analyzed by SDS-PAGE under reducing conditions and Coomassie blue staining, which indicated only heavy and light chain bands of antibody at about 55 kDa and 25 kDa, respectively. The isotype of the purified antibody was IgG1 with kappa light chain.
- B. Binding Characterization of EM164 Antibody
- The specific binding of the
purified EM 164 antibody was demonstrated by fluorescence activated cell sorting (FACS) using cells overexpressing human IGF-I receptor and by using cells that overexpressed human insulin receptor (FIG. 1 ). Incubation ofEM 164 antibody (50-100 nM) in 100 μL cold FACS buffer (1 mg/mL BSA in Dulbecco's MEM medium) was performed using cells overexpressing IGF-I receptor and using cells overexpressing insulin receptor (2×105 cells/mL) in a round-bottom 96-well plate for 1 h. The cells were pelleted by centrifugation and washed with cold FACS buffer by gentle flicking, followed by incubation with goat-anti-mouse-IgG-antibody-FITC conjugate (100 μL; 10 μmg/mL in FACS buffer) on ice for 1 h. The cells were pelleted, washed, and resuspended in 120 μL of 1% formaldehyde solution in PBS. The plate was analyzed using a FACSCalibur reader (BD Biosciences). - A strong fluorescence shift was obtained upon incubation of IGF-I receptor overexpressing cells with
EM 164 antibody, in contrast to an insignificant shift upon incubation of insulin receptor overexpressing cells withEM 164 antibody (FIG. 1 ), which demonstrated that theEM 164 antibody was selective in its binding to IGF-I receptor and did not bind to insulin receptor. The control antibodies, anti-IGF-I receptor antibody 1H7 (Santa Cruz Biotechnology) and anti-insulin receptor alpha antibody (BD Pharmingen Laboratories), yielded fluorescence shifts upon incubations with cells that overexpressed IGF-I receptor and insulin receptor, respectively (FIG. 1 ). A strong fluorescence shift was also observed by FACSassay using EM 164 antibody and human breast cancer MCF-7 cells, which expressed IGF-I receptor (Dufourny, B. et al., 1997, J. Biol. Chem., 272, 31163-31171), which showed that EM164 antibody bound to human IGF-I receptor on the surface of human tumor cells. - The dissociation constant (Kd) for the binding of EM164 antibody with human IGF-I receptor was determined by ELISA titration of the binding of antibody at several concentrations with either directly coated IGF-I receptor (affinity purified using biotinylated IGF-I, as above) or indirectly captured biotinylated IGF-I receptor. Biotinylated IGF-I receptor was prepared by biotinylation of detergent-solubilized lysate from IGF-I receptor overexpressing cells using PEO-maleimide-biotin reagent (Pierce, Molecular Biosciences), which was affinity purified using an anti-IGF-I receptor beta chain antibody immobilized on NHS-agarose beads and was eluted with 2-4 M urea in buffer containing NP-40 detergent and dialyzed in PBS.
- The Kd determination for the binding of EM164 antibody with biotinylated IGF-I receptor was carried out by coating Immulon-2HB plates with 100 μL of 1 μg/mL streptavidin in carbonate buffer (150 mM sodium carbonate, 350 mM sodium bicarbonate) at 4° C. overnight. The streptavidin-coated wells were blocked with 200 μL of blocking buffer (10 mg/mL BSA in TBS-T buffer), washed with TBS-T buffer and incubated with biotinylated IGF-I receptor (10 to 100 ng) for 4 h at ambient temperature. The wells containing indirectly captured biotinylated IGF-I receptor were then washed and incubated with EM164 antibody in blocking buffer at several concentrations (5.1×10−13 M to 200 nM) for 2 h at ambient temperature and were then incubated overnight at 4° C. The wells were next washed with TBS-T buffer and incubated with goat-anti-mouse-IgGHH+L-antibody-horseradish peroxidase conjugate (100 μL; 0.5 μg/mL in blocking buffer), followed by washes and detection using ABTS/H2O2 substrate at 405 nm. The value of Kd was estimated by non-linear regression for one-site binding.
- A similar binding titration was carried out using the Fab fragment of EM164 antibody, prepared by papain digestion of the antibody as described by E. Harlow and D. Lane (“Using Antibodies: A Laboratory Manual”; 1999, Cold Spring Harbor Laboratory Press, New York).
- The binding titration curve for the binding of EM164 antibody to biotinylated human IGF-I receptor yielded a Kd value of 0.1 nM (
FIG. 2 ). The Fab fragment of EM164 antibody also bound the human IGF-I receptor very tightly with a Kd value of 0.3 nM, which indicated that the monomeric binding of the EM164 antibody to IGF-I receptor was also very strong. - This extremely low value of dissociation constant for the binding of IGF-I receptor by EM164 antibody was in part due to a very slow off rate as verified by the strong binding signals observed after prolonged 1-2 day washes of the antibody bound to immobilized IGF-I receptor.
- EM164 antibody can be used for immunoprecipitation of IGF-I receptor, as demonstrated by incubation of detergent-solubilized lysate of the human breast cancer MCF-7 cells with EM164 antibody immobilized on protein G-agarose beads (Pierce Chemical Company). A Western blot of the EM164 antibody immunoprecipitate was detected using a rabbit polyclonal anti-IGF-I receptor beta chain (C-terminus) antibody (Santa Cruz Biotechnology) and a goat-anti-rabbit-IgG-antibody-horseradish peroxidase conjugate, followed by washes and enhanced chemiluminescence (ECL) detection. The Western blot of EM164 immunoprecipitate from MCF-7 cells exhibited bands corresponding to the beta chain of IGF-I receptor at about 95 kDa and the pro-IGF-I receptor at about 220 kDa. Similar immunoprecipitations were carried out for other cell types to check species specificity of the binding of EM164 antibody, which also bound to IGF-I receptor from cos-7 cells (African green monkey), but did not bind to IGF-I receptor of 3T3 cells (mouse), CHO cells (Chinese hamster) or goat fibroblast cells (goat). The EM164 antibody did not detect SDS-denatured human IGF-I receptor in Western blots of lysates from MCF-7 cells, which indicated that it bound to a conformational epitope of native, non-denatured human IGF-I receptor.
- The binding domain of EM164 antibody was further characterized using a truncated alpha chain construct, which comprised the cysteine rich domain flanked by L1 and L2 domains (residues 1-468) fused with the 16-mer-C-terminus piece (residues 704-719) and which was terminated by a C-terminus epitope tag. This smaller IGF-I receptor, which lacked residues 469-703, has been reported to bind IGF-I, although less tightly compared to the native full-length IGF-I receptor (Molina, L. et al., 2000, FEBS Letters, 467, 226-230; Kristensen, C. et al., 1999, J. Biol. Chem., 274, 37251-37356). Thus, a truncated IGF-I receptor alpha chain construct was prepared comprising residues 1-468 fused to the C-terminus piece that is residues 704-719 and flanked by a C-terminus myc epitope tag. A stable cell line which expressed this construct, and which also expresses the construct transiently in human embryonic kidney 293T cells, was constructed. A strong binding of EM164 antibody to this truncated IGF-I receptor alpha chain construct was observed. Of the two antibodies tested, IR3 (Calbiochem) also bound to this truncated alpha chain, but 1H7 antibody (Santa Cruz Biotechnology) did not bind, which indicated that the epitope of EM164 antibody was clearly distinct from that of 1H7 antibody.
- C. Inhibition of Binding of IGF-I to MCF-7 Cells by EM164 Antibody
- The binding of IGF-I to human breast cancer MCF-7 cells was inhibited by EM164 antibody (
FIG. 3 ). MCF-7 cells were incubated with or without 5 μg/mL EM164 antibody for 2 h in serum-free medium, followed by incubation with 50 ng/mL biotinylated IGF-I for 20 min at 37° C. The cells were then washed twice with serum-free medium to remove unbound biotin-IGF-I, and were then lysed in 50 mM HEPES, pH 7.4, containing 1% NP-40 and protease inhibitors. An Immulon-2HB ELISA plate was coated with a mouse monoclonal anti-IGF-I receptor beta chain antibody and was used to capture the IGF-I receptor and bound biotin-IGF-I from the lysate. The binding of the coated antibody to the cytoplasmic C-terminal domain of the beta chain of IGF-I receptor did not interfere with the binding of biotin-IGF-I to the extracellular domain of IGF-I receptor. The wells were washed, incubated with streptavidin-horseradish peroxidase conjugate, washed again, and then detected using ABTS/H2O2 substrate. The inhibition of IGF-I binding to MCF-7 cells by 5 μg/mL EM164 antibody was essentially quantitative, and was almost equivalent to that of the ELISA background obtained using a control lacking biotin-IGF-I. - In addition to the assay described above for the inhibition of binding of IGF-I to MCF-7 cells by EM164 antibody, the following assay demonstrated that EM164 antibody was highly effective at displacing bound IGF-I from MCF-7 cells, as desired under physiological conditions for an antagonistic anti-IGF-I receptor antibody to displace the bound endogenous physiological ligand (such as IGF-I or IGF-II). In this IGF-I displacement assay, MCF-7 cells grown in a 12-well plate were serum-starved and then incubated with biotinylated IGF-I (20-50 ng/mL) in serum-free medium at 37° C. (or at 4° C.) for 1 to 2 h. The cells with bound biotinylated IGF-I were then treated with EM164 antibody or a control antibody (10-100 μg/mL) at 37° C. (or at 4° C.) for 30 min to 4 h. Cells were then washed with PBS and lysed in lysis buffer containing 1% NP-40 at 4° C. ELISA was carried out as described above to capture the IGF-I receptor from the lysate and then detect the biotinylated IGF-I bound to the receptor using streptavidin-horseradish peroxidase conjugate. This ELISA demonstrated that EM164 antibody was able to displace pre-bound biotinylated IGF-I from cells nearly completely (90% within 30 min and ˜100% within 4 h) at 37° C. and by about 50% in 2 h at 4° C. In another experiment, NCI-H838 lung cancer cells were incubated with biotin-IGF-I, then washed and incubated with EM164 antibody at 4° C. for 2 h, which resulted in a 80% decrease in the bound biotin-IGF-I. Therefore, EM164 antibody was highly effective at displacing pre-bound IGF-I from cancer cells, which would be important therapeutically for the antagonism of the IGF-I receptor by displacement of the bound endogenous physiological ligand.
- The incubation of MCF-7 cells with EM164 antibody at 4° C. for 2 h (or at 37° C. for 30 min) did not result in a significant downregulation of the IGF-I receptor based on Western blot analysis using anti-IGF-I receptor beta chain antibody (Santa Cruz Biotechnology; sc-713), although a longer incubation with EM164 antibody at 37° C. for 2 h resulted in a 25% downregulation of the IGF-I receptor. Therefore, the inhibition of binding of IGF-I and the displacement of bound IGF-I by EM164 antibody at both 4° C. and 37° C. in these short-term experiments may not be explained by the down-regulation of the receptor due to the binding of the EM164 antibody. The mechanism for the potent inhibition of the binding of IGF-I to IGF-I receptor and for the displacement of the pre-bound IGF-I by EM164 antibody is likely to be competition for binding, either through sharing of the binding site or through steric occlusion or through allosteric effects.
- D. Inhibition of IGF-I Receptor Mediated Cell Signaling by EM164 Antibody
- Treatment of breast cancer MCF-7 cells and osteosarcoma SaOS-2 cells with EM164 antibody almost completely inhibited intracellular IGF-I receptor signaling, as shown by the inhibition of IGF-I receptor autophosphorylation and by the inhibition of phosphorylation of its downstream effectors such as insulin receptor substrate-1 (IRS-1), Akt and Erk1/2 (
FIGS. 4-6 ). - In
FIG. 4 , the MCF-7 cells were grown in a 12-well plate in regular medium for 3 days, and were then treated with 20 μg/mL EM164 antibody (or anti-B4 control antibody) in serum-free medium for 3 h, followed by stimulation with 50 ng/mL IGF-I for 20 min at 37° C. The cells were then lysed in ice-cold lysis buffer containing protease and phosphatase inhibitors (50 mM HEPES buffer, pH 7.4, 1% NP-40, 1 mM sodium orthovanadate, 100 mM sodium fluoride, 10 mM sodium pyrophosphate, 2.5 mM EDTA, 10 μM leupeptin, 5 μM pepstatin, 1 mM PMSF, 5 mM benzamidine, and 5 μg/mL aprotinin). An ELISA plate was pre-coated with anti-IGF-I receptor beta chain C-terminus monoclonal antibody TC123 and was incubated with the lysate samples for 5 h at ambient temperature to capture IGF-I receptor. The wells containing the captured IGF-I receptor were then washed and incubated with biotinylated anti-phosphotyrosine antibody (PY20; 0.25 μg/mL; BD Transduction Laboratories) for 30 min, followed by washes and incubation with streptavidin-horseradish peroxidase conjugate (0.8 μg/mL) for 30 min. The wells were washed and detected with ABTS/H2O2 substrate. Use of a control anti-B4 antibody showed no inhibition of the IGF-I stimulated autophosphorylation of IGF-I receptor. In contrast, a complete inhibition of the IGF-I stimulated autophosphorylation of IGF-I receptor was obtained upon treatment with EM164 antibody (FIG. 4 ). - To demonstrate inhibition of phosphorylation of insulin receptor substrate-1 (IRS-1), an ELISA using immobilized anti-IRS-1 antibody to capture IRS-1 from lysates was used, followed by measurement of the associated p85 subunit of phosphatidylinositol-3-kinase (PI-3-kinase) that binds to the phosphorylated IRS-1 (Jackson, J. G. et al., 1998, J. Biol. Chem., 273, 9994-10003). In
FIG. 5 , MCF-7 cells were treated with 5 μg/mL antibody (EM164 or IR3) in serum-free medium for 2 h, followed by stimulation with 50 ng/mL IGF-I for 10 min at 37° C. Anti-IRS-1 antibody (rabbit polyclonal; Upstate Biotechnology) was indirectly captured by incubation with coated goat-anti-rabbit-IgG antibody on an ELISA plate, which was then used to capture IRS-1 from the cell lysate samples by overnight incubation at 4° C. The wells were then incubated with mouse monoclonal anti-p85-PI-3-kinase antibody (Upstate Biotechnology) for 4 h, followed by treatment with goat-anti-mouse-IgG-antibody-HRP conjugate for 30 min. The wells were then washed and detected using ABTS/H2O2 substrate (FIG. 5 ). As shown inFIG. 5 , EM164 antibody was more effective at inhibiting the IGF-I-stimulated IRS-1 phosphorylation than was IR3 antibody, and EM164 antibody did not show any agonistic activity on IRS-1 phosphorylation when incubated with cells in the absence of IGF-I. - The activation of other downstream effectors, such as Akt and Erk1/2, was also inhibited in a dose-dependent manner by EM164 antibody in SaOS-2 cells (
FIG. 6 ) and in MCF-7 cells, as was shown using Western blots of lysates and phosphorylation-specific antibodies (rabbit polyclonal anti-phospho-Ser473 Akt polyclonal and anti-phospho-ERK1/2 antibodies; Cell Signaling Technology). A pan-ERK antibody demonstrated equal protein loads in all lanes (FIG. 6 ). Treatment of SaOS-2 cells with EM164 antibody did not inhibit the EGF-stimulated phosphorylation of Erk1/2, thus demonstrating the specificity of inhibition of IGF-I receptor signaling pathway by EM164 antibody. - E. Inhibition of IGF-I-, IGF-II- and Serum-Stimulated Growth and Survival of Human Tumor Cells by EM164 Antibody
- Several human tumor cell lines were tested in serum-free conditions for their growth and survival response to IGF-I. These cell lines were treated with EM164 antibody in the presence of IGF-I, IGF-II, or serum, and their growth and survival responses were measured using an Mu assay after 2-4 days. Approximately 1500 cells were plated in a 96-well plate in regular medium with serum, which was replaced with serum-free medium the following day (either serum-free RPMI medium supplemented with transferrin and BSA, or phenol-red free medium as specified by Dufourny, B. et al., 1997, J. Biol. Chem., 272, 31163-31171). After one day of growth in serum-free medium, the cells were incubated with about 75 μL of 10 μg/mL antibody for 30 min.-3 h, followed by the addition of 25 μL of IGF-I (or IGF-II or serum) solution to obtain a final concentration of 10 ng/mL IGF-I, or 20 ng/mL IGF-II, or 0.04-10% serum. In some experiments, the cells were stimulated first with IGF-I for 15 min before the addition of EM164 antibody, or both IGF-I and EM164 antibody were added together. The cells were then allowed to grow for another 2-3 days. A solution of MTT (3-(4,5)-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide; 25 μL of a 5 mg/mL solution in PBS) was then added and the cells were returned to the incubator for 2-3 h. The medium was then removed and replaced by 100 μL DMSO, mixed, and the absorbance of the plate was measured at 545 nm. Several human tumor cell lines showed a growth and survival response upon addition of IGF-I or IGF-II or serum that was significantly inhibited by EM164 antibody, irrespective of whether the antibody was added before IGF-I, or if IGF-I was added before the antibody, or if both IGF-I and antibody were added together (Table 1).
TABLE 1 Inhibition of IGF-I-stimulated growth and survival of tumor cells by EM164 antibody % Inhibition by Fold growth response EM164 antibody Inhibition by to IGF-I (MTT assay: of IGF-I- EM164 antibody of ratio for IGF-I treated stimulated growth Growth/survival of vs untreated cells in in serum-free cells in 1.25-10% Tumor Cell Type serum-free medium)a medium serumb MCF-7 (breast) 1.7-2.8 100% 85% HT-3 (cervical) 2 70-90% ND Colo 205 (colon) 2.3 50% Yes HT-29 1.5 60% Yes NCI-H838 (lung) 3 100% 85-90% Calu-6 1.6-1.8 85% Yes SK-LU-1 1.4 100% No NCI-H596 1.4 100% Weakly A 549 1.2 80% ND A 375 (melanoma) 1.6 90% No SK-Mel-37 1.4 85% ND RD (rhabdomyocarcoma) 1.7 85-100% Yes SaOS-2 (osteosarcoma) 2.5 100% Yes A 431 (epidermoid) 2.2 85% Yes SK-N-SH (neuroblastoma) 2 85% 30-50%
aMTT assay of 3- to 4-day growth/survival of cells in response to 10 ng/mL IGF-I in serum-free medium containing 5-10 μg/mL EM164 antibody.
bInhibition of growth of cells in 1.25-10% serum in the presence of 5-10 μg/mL EM164 antibody by MTT assay or colony formation assay based on comparison with the control (with serum but without antibody); the extent of inhibition was quantitatively measured for MCF-7, NCI-H838 and SK-N-SH cells based on controls (without serum but
# with antibody, and with serum but without antibody) to account for autocrine/paracrine IGF-stimulation by cells. ND indicates no data or poor data due to staining difficulties. - The EM164 antibody strongly inhibited IGF-I-or serum-stimulated growth and survival of breast cancer MCF-7 cells (
FIGS. 7 and 8 ). In a separate experiment, the EM164 antibody strongly inhibited IGF-II-stimulated growth and survival of MCF-7 cells. Previous reports using commercially available antibodies such as IR3 antibody showed only weak inhibition of serum-stimulated growth and survival of MCF-7 cells, as confirmed inFIG. 7 for the IR3 and 1H7 antibodies (Cullen, K. J. et al., 1990, Cancer Res., 50, 48-53). In contrast, EM164 antibody was a potent inhibitor of the serum- or IGF-stimulated growth of MCF-7 cells. As shown inFIG. 8 , EM164 antibody was equally effective in inhibiting the growth and survival of MCF-7 cells over a wide range of serum concentrations (0.04-10% serum). - The growth inhibition of MCF-7 cells by EM164 antibody was measured by counting cells. Thus, in a 12-well plate, about 7500 cells were plated in RPMI medium with 10% FBS, in the presence or absence of 10 μg/mL EM164 antibody. After 5 days of growth, the cell count for the untreated control sample was 20.5×104 cells, in contrast to a cell count of only 1.7×104 cells for the EM164 antibody-treated sample. Treatment with the EM164 antibody inhibited the growth of MCF-7 cells by about 12-fold in 5 days. This inhibition by EM164 antibody was significantly greater than was a reported 2.5-fold inhibition using IR3 antibody in a 6-day assay for MCF-7 cells (Rohlik, Q. T. et al., 1987, Biochem. Biophys. Res. Commun., 149, 276-281).
- The IGF-I- and serum-stimulated growth and survival of a non-small cell lung cancer line NCI-H838 were also strongly inhibited by EM164 antibody, compared to a control anti-B4 antibody (
FIG. 9 ). Treatment with EM164 antibody in serum-free medium produced a smaller signal than the untreated sample for both NCI-H838 and MCF-7 cells, presumably becauseEM 164 antibody also inhibited the autocrine and paracrine IGF-I and IGF-II stimulation of these cells (FIGS. 7 and 9 ). The colony size of HT29 colon cancer cells was also greatly reduced upon treatment with EM164 antibody. - EM164 antibody is therefore unique among all known anti-IGF-I receptor antibodies in its effectiveness to inhibit the serum-stimulated growth of tumor cells such as MCF-7 cells and NCI-H838 cells by greater than 80%.
- The EM164 antibody caused growth arrest of cells in G0/G1 phase of cell cycle and abrogated the mitogenic effect of IGF-I. For cell cycle analysis, MCF-7 cells were treated with IGF-I (20 ng/mL) in the presence or absence of EM164 (20 μg/mL) for 1 day and then analyzed by propidium iodide staining and flow cytometry. As shown in
FIG. 25 , the cycling of cells in response to IGF-I stimulation in the absence of EM164 (with 41% of the cells in the S phase and 50% in the G0/G1 phase) was suppressed in EM164-treated cells (with only 9% in the S phase and 77% of the cells in the G0/G1 phase). - In addition to its inhibition of cell proliferation, EM164 antibody treatment resulted in apoptosis of cells. For measurement of apoptosis, cleavage of the cytokeratin CK18 protein by caspase was measured in NCI-H838 lung cancer cells incubated with IGF-I or serum in the presence or absence of EM164 for 1 day (
FIG. 26 ). In the absence of EM164, the addition of IGF-I or serum resulted in a lower caspase-cleaved CK18 signal compared to the no IGF-I control, indicating that IGF-I and serum prevent the activation of caspase. Treatment with EM164 suppressed the anti-apoptotic effects of IGF-I and serum, as indicated by the greater cleaved CK18 levels obtained in the presence of EM164 than in the absence of EM164 (FIG. 26 ). - F. Synergistic Inhibition by EM164 Antibody of Growth and Survival of Human Tumor Cells in Combinations with Other Cytotoxic and Cytostatic Agents
- The combined administration of EM164 antibody with taxol was significantly more inhibitory to the growth and survival of non-small cell lung cancer Calu6 cells than was taxol alone. Similarly, the combination of EM164 antibody with camptothecin was significantly more inhibitory than camptothecin alone toward the growth and survival of colon cancer HT29 cells. Because EM164 antibody alone was not expected to be as toxic to cells as organic chemotoxic drugs, the synergism between the predominantly cytostatic effect of EM164 antibody and the cytotoxic effect of the chemotoxic drug may be highly efficacious in combination cancer therapies in clinical settings.
- The combined effect of EM164 antibody with an anti-EGF receptor antibody (KS77) was significantly more inhibitory than either EM164 antibody or KS77 antibody alone on the growth and survival of several tumor cell lines such as HT-3 cells, RD cells, MCF-7 cells, and A431 cells. Therefore, the synergistic effect of combining neutralizing antibodies for two growth factor receptors such as IGF-I receptor and EGF receptor may also be useful in clinical cancer treatment.
- Based on the efficacy of EM164 antibody as a single agent in inhibiting the proliferation and survival of diverse human cancer cell lines as shown in Table 1, additional efficacy studies were carried out using combinations of EM164 antibody with other anti-cancer therapeutic agents. In these studies on diverse cancer cell lines, the combined treatment of EM164 antibody and other anti-cancer therapeutic agents resulted in an even greater anti-cancer efficacy than with either EM164 or the other therapeutic agent alone. These combinations of EM164 with other therapeutic agents are therefore highly effective in inhibiting the proliferation and survival of cancer cells. The therapeutic agents that can be combined with EM164 for improved anti-cancer efficacy include diverse agents used in oncology practice (Reference: Cancer, Principles & Practice of Oncology, DeVita, V. T., Hellman, S., Rosenberg, S. A., 6th edition, Lippincott-Raven, Philadelphia, 2001), such as docetaxel, paclitaxel, doxorubicin, epirubicin, cyclophosphamide, trastuzumab (Herceptin), capecitabine, tamoxifen, toremifene, letrozole, anastrozole, fulvestrant, exemestane, goserelin, oxaliplatin, carboplatin, cisplatin, dexamethasone, antide, bevacizumab (Avastin), 5-fluorouracil, leucovorin, levamisole, irinotecan, etoposide, topotecan, gemcitabine, vinorelbine, estramustine, mitoxantrone, abarelix, zoledronate, streptozocin, rituximab (Rituxan), idarubicin, busulfan, chlorambucil, fludarabine, imatinib, cytarabine, ibritumomab (Zevalin), tositumomab (Bexxar), interferon alpha-2b, melphalam, bortezomib (Velcade), altretamine, asparaginase, gefitinib (Iressa), erlonitib (Tarceva), anti-EGF receptor antibody (Cetuximab, Abx-EGF), epothilones, and conjugates of cytotoxic drugs and antibodies against cell-surface receptors.
- For these combination therapies, EM164 is combined with one or-more anti-cancer agents of diverse mechanisms of action such as alkylating agents, platinum agents, hormonal therapies, antimetabolites, topoisomerase inhibitors, antimicrotubule agents, differentiation agents, antiangiogenic or antivascularization therapies, radiation therapy, agonists and antagonists of leuteinizing hormone releasing hormone (LHRH) or gonadotropin-releasing hormone (GnRH), inhibitory antibodies or small molecule inhibitors against cell-surface receptors, and other chemotherapeutic agents (Reference: Cancer, Principles & Practice of Oncology, DeVita, V. T., Hellman, S., Rosenberg, S. A., 6th edition, Lippincott-Raven, Philadelphia, 2001). In one example, the combination of an LHRH antagonist antide (0.1 to 10 micromolar) and EM164 antibody (0.1 to 10 nanomolar) inhibited the proliferation of MCF-7 breast cancer cells significantly more than that with either EM164 or antide alone. In an example of a combination therapy with a platinum agent, the combined treatment with EM164 antibody (10 microgram/ml) and cisplatin (0.1-60 microgram/ml) resulted in a greater inhibition of the proliferation and survival of MCF-7 breast cancer cells in comparison to the inhibition by either EM164 antibody or cisplatin alone.
- These combinations of EM164 antibody with other therapeutic agents are effective against several types of cancers including breast, lung, colon, prostate, pancreatic, cervical, ovarian, melanoma, multiple myeloma, neuroblastoma, rhabdomyosarcoma and osteosarcoma. The EM164 antibody and the therapeutic agent can be administered for cancer therapy either simultaneously or in sequence.
- Conjugates of EM164 antibody with cytotoxic drugs are also valuable in targeted delivery of the cytotoxic drugs to the tumors overexpressing IGF-I receptor. Conjugates of EM164 antibody with radiolabels or other labels can be used in the treatment and imaging of tumors that overexpress IGF-I receptor.
- G. Effect of EM164 Treatment, as a Single Agent or in Combination with Anti-Cancer Agents, in Human Cancer Xenografts in Immunodeficient Mice
- Human non-small cell lung cancer Calu-6 xenografts were established in immunodeficient mice by subcutaneous injections of 1×107 Calu-6 cells. As shown in
FIG. 10 , these mice containing established 100 mm3 Calu-6 xenografts were treated withEM 164 antibody alone (6 injections of 0.8 mg/mouse, i. v., two per week) or with taxol alone (five injections of taxol, i.p. every two days; 15 mg/kg), or with a combination of taxol and EM164 antibody treatments, or PBS alone (200 μL/mouse, 6 injections, two per week, i.v.) using five mice per treatment group. The growth of tumors was significantly slowed by EM164 antibody treatment compared to a PBS control. No toxicity of EM164 antibody was observed, based on measurements of the weights of the mice. Although taxol treatment alone was effective untilday 14, the tumor then started to grow back. However, the growth of the tumor was delayed significantly in the group that was treated by a combination of taxol and EM164 antibody, compared to the group that was treated with taxol alone. - Human pancreatic cancer xenografts were established in 5 week-old, female SCID/ICR mice (Taconic) by subcutaneous injections of 107 BxPC-3 cells in PBS (day 0). The mice bearing established tumors of 80 mm3 were then treated with EM164 alone (13 injections of 0.8 mg/mouse, i.v., lateral tail vein, on
12, 16, 19, 23, 26, 29, 36, 43, 50, 54, 58, 61 and 64), with gemcitabine alone (two injections of 150 mg/kg/mouse, i.p., ondays days 12 and 19), with a combination of gemcitabine and EM164 following the above schedules, PBS alone, and a control antibody alone (following the same schedule as EM164) using five mice in each of the five treatment groups. As shown inFIG. 27 , treatment with EM164 alone, or in combination with gemcitabine, resulted initially in total regression of tumor xenografts in 4 of 5 animals in the EM164 treatment group and in all 5 animals in the combination treatment group. Measurable tumor regrowth was only seen in more than one animal on day 43 in the EM164 group and on day 68 in the combination treatment group, resulting in significantly smaller mean tumor volumes on day 74 in comparison with the control treatments (P=0.029 and 0.002, respectively; two-tailed T-test;FIG. 27 ). In another study, EM164 antibody treatment (alone or in combination with an anti-EGF receptor antibody; intraperitoneal injections) inhibited the growth of established BxPC-3 xenografts in mice. - The murine EM164 and the humanized EM164 antibodies showed equivalent inhibition of the growth of established BxPC-3 xenografts in mice, thus demonstrating that the potency of the humanized EM164 is equivalent to that of the murine EM164 in vivo. In a comparison of different modes of administration of EM164 antibody, both intraperitoneal and intravenous administrations of EM164 antibody showed equivalent inhibition of the growth of established BxPC-3 xenografts in mice. In another xenograft study, treatment with EM164 antibody showed significant growth delay of established A-673 human rhabdomyosarcoma/Ewing's sarcoma xenografts in mice.
- H. Cloning and Sequencing of the Light and Heavy Chains of EM164 Antibody
- Total RNA was purified from EM164 hybridoma cells. Reverse transcriptase reactions were performed using 4-5 μg total RNA and either oligo dT or random hexamer primers.
- PCR reactions were performed using a RACE method described in Co et al. (J. Immunol., 148, 1149-1154 (1992)) and using degenerate primers as described in Wang et al., (J. Immunol. Methods, 233, 167-177 (2000)). The RACE PCR method required an intermediate step to add a poly G tail on the 3′ ends of the first strand cDNAs. RT reactions were purified with Qianeasy (Qiagen) columns and eluted in 50
μl 1×NEB buffer 4. A dG tailing reaction was performed on the eluate with 0.25 mM CoCl2, 1 mM dGTP, and 5 units terminal transferase (NEB), in 1×NEB buffer 4. The mixture was incubated at 37° C. for 30 minutes and then ⅕ of the reaction (10 μl) was added directly to a PCR reaction to serve as the template DNA. - The RACE and degenerate PCR reactions were identical except for differences in primers and template. The terminal transferase reaction was used directly for the RACE PCR template, while the RT reaction mix was used directly for degenerate PCR reactions.
- In both RACE and degenerate PCR reactions the same 3′ light chain primer: HindKL-tatagagctcaagcttggatggtgggaagatggatacagttggtgc (SEQ ID NO: 14) and 3′ heavy chain primer:
- Bgl2IgGI-ggaagatctatagacagatgggggtgtcgttttggc (SEQ ID NO: 15) were used.
- In the RACE PCR, one
poly C 5′ primer was used for both the heavy and light chain: - EcoPolyC-TATATCTAGAATTCCCCCCCCCCCCCCCCC (SEQ ID NO: 16), while the
degenerate 5′ end PCR primers were: - SacI MK-GGGAGCTCGAYATTGTGMTSACMCARWCTMCA (SEQ ID NO: 17) for the light chain, and an equal mix of:
- EcoRIMH1-CTTCCGGAATTCSARGTNMAGCTGSAGSAGTC (SEQ ID NO: 18) and
- EcoRIMH2-CTTCCGGAATTCSARGTNMAGCTGSAGSAGTCWGG (SEQ ID NO: 19) for the heavy chain.
- In the above primer sequences, mixed bases are defined as follows: H=A+T+C, S=g+C, Y=C+T, K=G+T, M=A+C, R=A+g, W=A+T, V=A+C+G.
- The PCR reactions were performed using the following program: 1) 94° C. 3 min, 2) 94° C. 15 sec, 3) 45° C. 1 min, 4) 72° C. 2 min, 5) cycle back to
step # 2 29 times, 6) finish with a final extension step at 72° C. for 10 min. - The PCR products were cloned into pBluescript II SK+ (Stratagene) using restriction enzymes created by the PCR primers.
- Several individual light and heavy chain clones were sequenced by conventional means to identify and avoid possible polymerase generated sequence errors (
FIGS. 12 and 13 ). Using Chothia canonical classification definitions, the three light chain and heavy chain CDRs were identified (FIGS. 12-14 ). - A search of the NCBI IgBlast database indicated that the anti-IGF-I receptor antibody light chain variable region probably derived from the mouse IgVk Cr1 germline gene while the heavy chain variable region probably derived from the IgVh J558.c germline gene (
FIG. 15 ). - Protein sequencing of murine EM164 antibody was performed to confirm the sequences shown in
FIGS. 12 and 13 . The heavy and light chain protein bands of purified EM164 antibody were transferred to a PVDF membrane from a gel (SDS-PAGE, reducing conditions), excised from the PVDF membrane and analyzed by protein sequencing. The N-terminal sequence of the light chain was determined by Edman sequencing to be: DVLMTQTPLS (SEQ ID NO:20), which matches the N-terminal sequence of the cloned light chain gene obtained from the EM164 hybridoma. - The N-terminus of the heavy chain was found to be blocked for Edman protein sequencing. A tryptic digest peptide fragment of the heavy chain of mass 1129.5 (M+H+, monoisotopic) was fragmented via post-source decay (PSD) and its sequence was determined to be GRPDYYGSSK (SEQ ID NO:21). Another tryptic digest peptide fragment of the heavy chain of mass 2664.2 (M+H+, monoisotopic) was also fragmented via post-source decay (PSD) and its sequence was identified as: SSSTAYMQLSSLTSEDSAVYYFAR (SEQ ID NO:22). Both of these sequences match perfectly those of CDR3 and framework 3 (FR3) of the cloned heavy chain gene obtained from the EM164 hybridoma.
- I. Recombinant Expression of EM164 Antibody
- The light and heavy chain paired sequences were cloned into a single mammalian expression vector (
FIG. 16 ). The PCR primers for the human variable sequences created restriction sites that allowed the human signal sequence to be attached while in the pBluescriptII cloning vector, and the variable sequences were cloned into the mammalian expression plasmid using EcoRI and BsiWI or HindIII and ApaI sites for the light chain or heavy chain, respectively (FIG. 16 ). The light chain variable sequences were cloned in-frame onto the human IgK constant region and the heavy chain variable sequences were cloned into the human Iggamma1 constant region sequence. In the final expression plasmids, human CMV promoters drove the expression of both the light and heavy chain cDNA sequences. Expression and purification of the recombinant mouse EM164 antibody proceeded according to methods that are well-known in the art. - Resurfacing of the EM164 antibody to provide humanized versions suitable as therapeutic or diagnostic agents generally proceeds according to the principles and methods disclosed in U.S. Pat. No. 5,639,641, and as follows.
- A. Surface Prediction
- The solvent accessibility of the variable region residues for a set of antibodies with solved structures was used to predict the surface residues for the murine anti-IGF-I receptor antibody (EM164) variable region. The amino acid solvent accessibility for a set of 127 unique antibody structure files (Table 2) were calculated with the MC software package (Pedersen et al., 1994, J. Mol. Biol., 235, 959-973). The ten most similar light chain and heavy chain amino acid sequences from this set of 127 structures were determined by sequence alignment. The average solvent accessibility for each variable region residue was calculated, and positions with greater than a 30% average accessibility were considered to be surface residues. Positions with average accessibilities of between 25% and 35% were further examined by calculating the individual residue accessibility for only those structures with two identical flanking residues.
TABLE 2 127 antibody structures from the Brookhaven database used to predict the surface of anti-IGF-I-receptor antibody (EM164) 127 Brookhaven structure files used for surface predictions 2rcs 3hfl 3hfm 1aif 1a3r 1bbj 43c9 4fab 6fab 7fab 2gfb 2h1p 2hfl 1a6t 1axt 1bog 2hrp 2jel 2mcp 2pcp 1yuh 2bfv 2cgr 8fab 1ae6 1bvl 2dbl 2f19 2fb4 2fbj 1sm3 1tet 1vfa glb2 1a4j 1cly 1vge 1yec 1yed 1yee 1nsn 1opg 1osp 1aj7 1ay1 1clz 1plg 1psk 1rmf 1sbs 1ncd 1nfd 1ngp 1acy 1afv 1cbv 1nld 1nma 1nmb 1nqb 1mcp 1mfb 1mim 15c8 1a5f 1axs 1mlb 1mpa 1nbv 1ncb 1jrh 1kb5 1kel 1ap2 1b2w 1adq 1kip 1kir 1lve 1mam 1igi 1igm 1igt 1ad0 1baf 1cfv 1igy 1ikf 1jel 1jhl 1gpo 1hil 1hyx 1a0q 1bjm 1clo 1iai 1ibg 1igc 1igf 1fpt 1frg 1fvc 1aqk 1bln 1d5b 1gaf 1ggi 1ghf 1gig 1fai 1fbi 1fdl 1ad9 1bbd 1f58 1fgv 1fig 1flr 1for 1dbl 1dfb 1a3l 1bfo 1eap 1dsf 1dvf
B. Molecular Modeling: - A molecular model of murine EM164 was generated using the Oxford Molecular software package AbM. The antibody framework was built from structure files for the antibodies with the most similar amino acid sequences, which were 2jel for the light chain and lnqb for the heavy chain. The non-canonical CDRs were built by searching a C-α structure database containing non-redundant solved structures. Residues that lie within 5 Å of a CDR were determined.
- C. Human Ab Selection
- The surface positions of murine EM164 were compared to the corresponding positions in human antibody sequences in the Kabat database (Johnson, G. and Wu, T. T. (2001) Nucleic Acids Research, 29: 205-206). The antibody database management software SR (Searle 1998) was used to extract and align the antibody surface residues from natural heavy and light chain human antibody pairs. The human antibody surface with the most identical surface residues, with special consideration given to positions that come within 5 Å of a CDR, was chosen to replace the murine anti-IGF-I receptor antibody surface residues.
- D. PCR Mutagenesis
- PCR mutagenesis was performed on the murine EM164 cDNA clone (above) to build the resurfaced, human EM164 (herein huEM164). Primer sets were designed to make the 8 amino acid changes required for all tested versions of huEM164, and additional primers were designed to alternatively make the two 5 Å residue changes (Table 3). PCR reactions were performed with the following program: 1) 94° C. 1 min, 2) 94° C. 15 sec, 3) 55° C. 1 min, 4) 72° C. 1 min, 5) cycle back to
step # 2 29 times, 6) finish with a final extension step at 72° C. for 4 min. The PCR products were digested with their corresponding restriction enzymes and were cloned into the pBluescript cloning vectors as described above. Clones were sequenced to confirm the desired amino acid changes.TABLE 3 PCR primers used to build 4 humanized EM164 antibodies Primer Sequence SEQ ID NO: Em164hcvv CAGGTGTACACTCCCAGGTCCAACTG 23 GTGCAGTCTGGGGCTGAAGTGGTGAA GCCTG Em164hcqqgo11 CAATCAGAAGTTCCAGGGGAAGGCCA 24 CAC Em164hcqqgo12 CCTTCCCCTGGAACTTTCTGATTGTAG 25 TTAGTACG Em164lcv3 CAGGTGTACACTCCGATGTTGTGATG 26 ACCCAAACTCC Em164lc13 CAGGTGTACACTCCGATGTTTTGATG 27 ACCCAAACTCC Em164lcp18 GACTAGATCTGCAAGAGATGGAGGCT 28 GGATCTCCAAGAC Em164lcbg12 TTGCAGATCTAGTCAGAGCATAGTAC 29 ATAGTAATG Em164r45 GAATGGTACCTGCAGAAACCAGGCCA 30 GTCTCCAAGGCTCCTGATCTAC Em164a67o11 GTGGCAGTGGAGCAGGGACAGATTTC 31 AC Em164a67o12 GAAATCTGTCCCTGCTCCACTGCCAC 32 TG
E. Variable Region Surface Residues - The antibody resurfacing techniques described by Pedersen et al. (J. Mol. Biol., 235, 959-973, 1994) and Roguska et al. (Protein Eng., 9, 895-904, 1996) begin by predicting the surface residues of the murine antibody variable sequences. A surface residue is defined as an amino acid that has at least 30% of its total surface area accessible to a water molecule.
- The 10 most homologous antibodies in the set of 127 antibody structure files were identified (
FIGS. 17 and 18 ). The solvent accessibility for each Kabat position was averaged for these aligned sequences and the distribution of the relative accessibilities for each residue were as shown inFIG. 19 . Both the light and heavy chain have 26 residues with average relative accessibilities of at least 30% (FIG. 19 ): these residues were therefore the predicted surface residues for EM164. Several residues had average accessibilities of between 25% and 35%, and these were further examined by averaging only the antibodies with two identical residues flanking either side of the residue (Tables 4 and 5). After this additional analysis, the original set of surface residues that was identified above remained unchanged.TABLE 4 Surface residues and average accessibility (ave. acc.) for the light and heavy chain variable sequences of EM164 antibody EM164 Surface Residues Light Chain Heavy Chain EM164 Kabat # Ave. Acc. EM164 Kabat # Ave. Acc. D 1 45.89 Q 1 58.19 L 3 41.53 Q 3 34.08 T 7 31.40 Q 5 34.36 L 9 50.08 A 9 38.01 L 15 35.45 L 11 47.72 Q 18 39.79 K 13 46.51 R 24 34.36 P 14 31.49 S 26 32.63 G 15 31.42 Q 27 34.35 K 19 34.41 N 28 36.38 K 23 31.23 P 40 43.05 T 28 36.24 G 41 46.56 P 41 44.01 Q 42 34.92 G 42 42.62 K 45 30.58 Q 43 46.85 S 52 30.40 E 61 46.68 S 56 41.46 K 62 44.87 G 57 42.41 K 64 38.92 D 60 45.96 R 65 40.06 S 67 38.20 K 73 35.92 R 77 42.61 S 74 48.91 E 81 38.46 S 82B 32.72 V 95E 34.83 S 84 35.21 K 103 31.10 E 85 39.62 K 107 36.94 D 98 36.00 R 108 60.13 A 106 37.65 A 109 53.65 S 113 43.42 -
TABLE 5 Borderline Surface Residues Light Chain Heavy Chain EM164 Kabat # Ave. Acc. EM164 Kabat # Ave. Acc. T 5 28.68 Q 3 31.62 T 7 30.24 Q 5 36.07 P 12 26.59 P 14 29.88 G 16 25.20 G 15 30.87 D 17 25.73 S 17 25.64 S 20 25.37 K 19 35.06 R 24 36.73 K 23 31.48 S 26 31.00 G 26 30.53 Q 27 32.29 S 31 27.12 S 27A 29.78 R 56 NA V 27C 29.05 T 68 27.71 V 29 NA T 70 24.65 Q 42 34.92 S 75 18.80 K 45 32.24 S 82B 32.87 S 52 30.02 P 97 NA R 54 29.50 Y 99 NA D 70 26.03 V 103 NA R 74 NA T 111 25.95 E 79 26.64 A 80 29.61 V 95E 42.12 G 100 29.82 K 103 31.10 E 105 25.78
Residues which had average accessibilities between 25% and 35% were further analyzed by averaging a subset of antibodies that had two identical residues flanking either side of the residue in question. These borderline surface positions and their new average accessibilities are given. The NA's refer to residues with no identical flanking residues in the 10 most similar antibodies.
F. Molecular Modeling to Determine which Residues Fall within 5 Å of a CDR - The molecular model above, generated with the AbM software package, was analyzed to determine which EM164 surface residues were within 5 Å of a CDR. In order to resurface the murine EM164 antibody, all surface residues outside of a CDR should be changed to the human counterpart, but residues within 5 Å of a CDR are treated with special care because they may also contribute to antigen specificity. Therefore, these latter residues must be identified and carefully considered throughout the humanization process. The CDR definitions used for resurfacing combine the AbM definition for heavy chain CDR2 and Kabat definitions for the remaining 5 CDRs (
FIG. 14 ). Table 6 shows the residues that were within 5 Å of any CDR residue in either the light or heavy chain sequence of the EM164 model.TABLE 6 EM164 antibody framework surface residues within 5 Å of a CDR EM164 Surface Residues within 5 Å of a CDR Light chain Heavy chain D1 T28 L3 K73 T7 S74 P40 Q42 K45 G57 D60 E81
G. Identification of the Most Homologous Human Surfaces - Candidate human antibody surfaces for resurfacing EM164 were identified within the Kabat antibody sequence database using SR software, which provided for the searching of only specified residue positions against the antibody database. To preserve the natural pairings, surface residues of both the light and heavy chains were compared together. The most homologous human surfaces from the Kabat database were aligned in rank order of sequence identity. The top 5 surfaces are given in Table 7. These surfaces were then compared to identify which of them would require the least changes within 5Å of a CDR. The Leukemic B-cell antibody, CLL 1.69, required the least number of surface residue changes (10 in total) and only two of these residues were within 5Å of a CDR.
- The full length variable region sequence for EM164 was also aligned against the Kabat human antibody database and CLL 1.69 was again identified as the most similar human variable region sequence. Together, these sequence comparisons identified the human Leukemic B-cell antibody CLL 1.69 as the preferred choice as a human surface for EM164.
TABLE 7 The top 5 human sequences extracted from the Kabat database 5 Most Homologous Human Antibody Surfaces Antibody Light Chain SEQ ID NO: MuEM164 D L TL L Q PG Q K G DS R EK K R A 33 CLL1.69 D V T L L P P G Q R G D A R E K K R — 34 MSL5 D Q S L I P P G Q K G D S R D K K R A 35 CDP571 D M S S V R P G Q K G S S S D K K R — 36 LC3aPB E V S G P R P G Q R G D S R E K K R — 37 SSbPB E V S G P R P G Q R G D S R E K K R — 38 Antibody Heavy Chain SEQ ID NO: MuEM164 Q Q Q A L K P G K K TP G Q E K K R K SS S E A S 39 CLL1.69 Q Q V A V K P G K K T P G Q Q K Q G K S S S E Q S 40 MSL5 Q Q Q P L K P G K K T P G K D D K G T S N N E Q S 41 CDP571 Q Q V A V K P G K K T P G Q Q K K G K S S S E Q S 42 LC3aPB — Q V A V K P G K K T P G Q Q K Q G K S S S E Q S 43 SSbPB — Q V A V K P G K K T P G Q Q K Q G E S S S E Q S 44
Alignments were generated by SR (Pedersen 1993). The EM164 surface residues that come within 5Å of a CDR are underlined.
H. Construction of Humanized EM164 Genes - The ten surface residue changes for EM164 (Table 7) were made using PCR mutagenesis techniques as described above. Because eight of the surface residues for CLL 1.69 were not within 5Å of a CDR, these residues were changed from murine to human in all versions of humanized EM164 (Tables 8 and 9). The two light chain surface residues that were within 5Å of a CDR (Kabat positions 3 and 45) were either changed to human or were retained as murine. Together, these options generate the four humanized versions of EM164 that were constructed (
FIGS. 22 and 23 ). - Of the four humanized versions, version 1.0 has all 10 human surface residues. The most conservative version with respect to changes in the vicinity of the CDR is version 1.1, which retained both of the murine surface residues that were within 5Å of a CDR. All four humanized EM164 antibody genes were cloned into an antibody expression plasmid (
FIG. 16 ) for use in transient and stable transfections.TABLE 8 Residue changes for versions 1.0-1.3 of humanized EM164 antibody Changes in all versions Light muQ18 to huP18; muS67 to huA67 Chain: Heavy muQ5 to huV5; muL11 to huV11; muE61 to muK64 to Chain: huQ61; huQ64; muR65 to huG65; muA106 to huQ106 huEM164 changes Light Chain aa3 Light Chain aa45 +TC,25/32 Total 5A Mu hu mu hu Mouse Res v1.0 V R 0 v1.1 L K 2 v1.2 L R 1 v1.3 V K 1
I. Comparison of the Affinities of Humanized EM164 Antibody Versions with Murine EM164 Antibody for Binding to Full-Length IGF-I Receptor and to Truncated IGF-I Receptor Alpha Chain - The affinities of the humanized EM164 antibody versions 1.0-1.3 were compared to those of murine EM164 antibody through binding competition assays using biotinylated full-length human IGF-I receptor or myc-epitope tagged truncated IGF-I receptor alpha chain, as described above. Humanized EM164 antibody samples were obtained by transient transfection of the appropriate expression vectors in human embryonic kidney 293T cells, and antibody concentrations were determined by ELISA using purified humanized antibody standards. For ELISA binding competition measurements, mixtures of humanized antibody samples and various concentrations of murine EM164 antibody were incubated with indirectly captured biotinylated full-length IGF-I receptor or myc-epitope tagged truncated IGF-I receptor alpha chain. After equilibration, the bound humanized antibody was detected using a goat-anti-human-Fab′2-antibody-horseradish peroxidase conjugate. Plots of ([bound murine Ab]/[bound humanized Ab]) vs ([murine Ab]/[humanized Ab]), which theoretically yield a straight line with slope=(Kd humanized Ab/Kd murine Ab), were used to determine the relative affinities of the humanized and murine antibodies.
- An exemplary competition assay is shown in
FIG. 11 . An Immulon-2HB ELISA plate was coated with 100 μL of 5 μg/mnL streptavidin per well in carbonate buffer at ambient temperature for 7 h. The streptavidin-coated wells were blocked with 200 μL of blocking buffer (10 mg/mL BSA in TBS-T buffer) for 1 h, washed with TBS-T buffer and incubated with biotinylated IGF-I receptor (5 ng per well) overnight at 4° C. The wells containing indirectly captured biotinylated IGF-I receptor were then washed and incubated with mixtures of humanized EM164 antibody (15.5 ng) and murine antibody (0 ng, or 16.35 ng, or 32.7 ng, or 65.4 ng, or 163.5 ng) in 100 μL blocking buffer for 2 h at ambient temperature and were then incubated overnight at 4° C. The wells were then washed with TBS-T buffer and incubated with goat-anti-human-Fab′2-antibody-horseradish peroxidase conjugate for 1 h (100 μL; 1 μg/mL in blocking buffer), followed by washes and detection using ABTS/H2O2 substrate at 405 nm. - The plot of ([bound murine Ab]/[bound humanized Ab]) vs ([murine Ab]/[humanized Ab]) yielded a straight line (r2=0.996) with slope (=Kd humanized Ab/Kd murine Ab) of 0.52. The humanized antibody version 1.0 therefore bound to IGF-I receptor more tightly than did murine EM164 antibody. Similar values for the gradient, ranging from about 0.5 to 0.8, were obtained for competitions of versions 1.0, 1.1, 1.2 and 1.3 of humanized EM164 antibodies with murine EM164 antibody for binding to full-length IGF-I receptor or to truncated IGF-I receptor alpha chain, which indicated that all of the humanized versions of EM164 antibody had similar affinities, which were all better than that of the parent murine EM164 antibody. A chimeric version of EM164 antibody with 92F→C mutation in heavy chain showed a slope of about 3 in a similar binding competition with murine EM164 antibody, which indicated that the 92F→C mutant of
EM 164 had a 3-fold lower affinity than did murine EM164 antibody for binding to IGF-I receptor. The humanized EM164 v1.0 antibody showed a similar inhibition of IGF-I-stimulated growth and survival of MCF-7 cells as did the murine EM164 antibody (FIG. 24 ). The inhibition of serum-stimulated growth and survival of MCF-7 cells by humanized EM164 v1.0 antibody was similar to the inhibition by murine EM164 antibody.TABLE 9 Segment Light Chain Heavy Chain FR1 1-23 (with an occasional residue 1-30 (with an occasional at 0, and a deletion at 10 in residue at 0) Vλ chains) CDR1 24-34 (with possible insertions 31-35 (with possible numbered as 27A, B, C, D, E, F) insertions numbered as 35A, B) FR2 35-49 36-49 CDR2 50-56 50-65 (with possible insertions numbered as 52A, B, C) FR3 57-88 66-94 (with possible insertions numbered as 82A, B, C) CDR3 89-97 (with possible insertions 95-102 (with possible numbered as 95A, B, C, D, E, F) insertions numbered as 100A, B, C, D, E, F, G, H, I, J, K) FR4 98-107 (with a possible insertion 103-113 numbered as 106A)
The Kabat numbering system is used for the light chain and heavy chain variable region polypeptides of the different versions of the EM164 Ab. The amino acid residues are grouped into Framework (FR) and Complementarity Determining Regions (CDR) according to position in the polypeptide chain.
Taken from Kabat et al. Sequences of Proteins of Immunological Interest, Fifth Edition, 1991, NIH Publication No. 91-3242
J. Process of Providing Improved Anti-IGF-I-Receptor Antibodies Starting from the Murine and Humanized Antibody Sequences Described Herein: - The amino acid and nucleic acid sequences of the anti-IGF-I receptor antibody EM164 and its humanized variants were used to develop other antibodies that have improved properties and that are also within the scope of the present invention. Such improved properties include increased affinity for the IGF-I receptor. Several studies have surveyed the effects of introducing one or more amino acid changes at various positions in the sequence of an antibody, based on the knowledge of the primary antibody sequence, on its properties such as binding and level of expression (Yang, W. P. et al., 1995, J. Mol. Biol., 254, 392-403; Rader, C. et al., 1998, Proc. Natl. Acad. Sci. USA, 95, 8910-8915; Vaughan, T. J. et al., 1998, Nature Biotechnology, 16, 535-539).
- In these studies, variants of the primary antibody have been generated by changing the sequences of the heavy and light chain genes in the CDR1, CDR2, CDR3, or framework regions, using methods such as oligonucleotide-mediated site-directed mutagenesis, cassette mutagenesis, error-prone PCR, DNA shuffling, or mutator-strains of E. coli (Vaughan, T. J. et al., 1998, Nature Biotechnology, 16, 535-539; Adey, N. B. et al., 1996,
Chapter 16, pp. 277-291, in “Phage Display of Peptides and Proteins”, Eds. Kay, B. K. et al., Academic Press). These methods of changing the sequence of the primary antibody have resulted, through the use of standard screening techniques, in improved affinities of such secondary antibodies (Gram, H. et al., 1992, Proc. Natl. Acad. Sci. USA, 89, 3576-3580; Boder, E. T. et al., 2000, Proc. Natl. Acad. Sci. USA, 97, 10701-10705; Davies, J. and Riechmann, L., 1996, Immunotechnolgy, 2, 169-179; Thompson, J. et al., 1996, J. Mol. Biol., 256, 77-88; Short, M. K. et al., 2002, J. Biol. Chem., 277, 16365-16370; Furukawa, K. et al., 2001, J. Biol. Chem., 276, 27622-27628). - By a similar directed strategy of changing one or more amino acid residues of the antibody, the antibody sequences described in this invention can be used to develop anti-IGF-I receptor antibodies with improved functions, such as antibodies having suitable groups such as free amino groups or thiols at convenient attachment points for covalent modification for use, for example, in the attachment of therapeutic agents.
- K. Alternative Expression System for Murine, Chimeric and Other Anti-IGF-I Receptor Antibodies
- The murine anti IGF-I receptor antibody was also expressed from mammalian expression plasmids similar to those used to express the humanized antibody (above). Expression plasmids are known that have murine constant regions including the light chain kappa and heavy chain gamma-1 sequences (McLean et al., 2000, Mol Immunol., 37, 837-845). These plasmids were designed to accept any antibody variable region, such as for example the murine anti-IGF-I receptor antibody, by a simple restriction digest and cloning. Additional PCR of the anti-IGF-I receptor antibody was usually required to create the restriction compatible with those in the expression plasmid.
- An alternative approach for expressing the fully murine anti-IGF-I receptor antibody was to replace the human constant regions in the chimeric anti-IGF-I receptor antibody expression plasmid. The chimeric expression plasmid (
FIG. 16 ) was constructed using cassettes for the variable regions and for both the light and heavy chain constant regions. Just as the antibody variable sequences were cloned into this expression plasmid by restriction digests, separate restriction digests were used to clone in any constant region sequences. The kappa light chain and gamma-I heavy chain cDNAs were cloned, for example, from murine hybridoma RNA, such as the RNA described herein for cloning of the anti-IGF-I antibody variable regions. Similarly, suitable primers were designed from sequences available in the Kabat database (see Table 10). For example, RT-PCR was used to clone the constant region sequences and to create the restriction sites needed to clone these fragments into the chimeric anti-IGF-I receptor antibody expression plasmid. This plasmid was then used to express the fully murine anti-IGF-I receptor antibody in standard mammalian expression systems such as the CHO cell line.TABLE 10 Primers designed to clone the murine gamma-1 constant region and murine kappa constant region respectively. Murine Constant Region Primers Primer name Primer Sequence SEQ ID NO: MuIgG1 C3endX TTTTGAGCTCTTATTTACCAGGA 45 GAGTGGGAGAGGCTCTT MuIgG1 C5endH TTTTAAGCTTGCCAAAACGACAC 46 CCCCATCTGTCTAT MuIgKap C3endB TTTTGGATCCTAACACTCATTCC 47 TGTTGAAGC MuIgKap C5endE TTTTGAATTCGGGCTGATGCTGC 48 ACCAACTG
The primers were designed from sequences available in the Kabat database (Johnson, G and Wu, T.T. (2001) Nucleic Acids Research, 29: 205-206).
- The hybridoma that makes murine EM164 antibody was deposited with the American Type Culture Collection, PO Box 1549, Manassas, Va. 20108, on Jun. 14, 2002, under the Terms of the Budapest Treaty and assigned ATCC accession number PTA-4457.
- Certain patents and printed publications have been referred to in the present disclosure, the teachings of which are hereby each incorporated in their respective entireties by reference.
- While the invention has been described in detail and with reference to specific embodiments thereof, it will be apparent to one of skill in the art that various changes and modifications can be made thereto without departing from the spirit and scope thereof.
Claims (11)
1.-31. (canceled)
32. An IGF-IR antagonist comprising a recombinant single-chain antibody capable of effectively inhibiting IGF-IR-agonist interaction.
33. An IGF-IR antagonist according to claim 32 , wherein, the antibody is a chimeric single-chain recombinant antibody.
34. An IGF-IR antagonist according to claim 33 , wherein the antibody is a humanized single-chain recombinant antibody.
35. An IGF-IR single-chain recombinant antibody capable of effectively inhibiting IGF-IR-agonist interaction wherein the recombinant antibody consists essentially of a VL domain antigen binding portion linked to a VH domain antigen binding portion through a peptide linker.
36. A recombinant antibody according to claim 35 , wherein said antigen binding portions of said VL and VH domains are murine antibody domains.
37. A recombinant antibody according to claim 35 , wherein the antibody consists essentially of a VL domain antigen binding portion linked through a peptide linker to a VH domain antigen binding portion linked to an immunoglobulin constant domain.
38. A recombinant antibody according to claim 37 , wherein said VL and VH domains are murine antibody domains.
39. A recombinant antibody according to claim 37 , wherein said immunoglobulin constant domain comprises CH2 and CH3 regions of a constant domain.
40. A recombinant antibody according to claim 39 , wherein said CH2 and CH3 regions are from a non-murine mammalian immunoglobulin domain.
41. A recombinant antibody according to claim 40 , wherein said CH2 and CH3 regions are human immunoglobulin regions.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US10/932,334 US20050249728A1 (en) | 2002-06-14 | 2004-09-02 | Anti-IGF-I receptor antibody |
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US10/170,390 US7538195B2 (en) | 2002-06-14 | 2002-06-14 | Anti-IGF-I receptor antibody |
| US10/729,441 US8034904B2 (en) | 2002-06-14 | 2003-12-08 | Anti-IGF-I receptor antibody |
| US10/932,334 US20050249728A1 (en) | 2002-06-14 | 2004-09-02 | Anti-IGF-I receptor antibody |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US10/729,441 Continuation US8034904B2 (en) | 2002-06-14 | 2003-12-08 | Anti-IGF-I receptor antibody |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20050249728A1 true US20050249728A1 (en) | 2005-11-10 |
Family
ID=34713337
Family Applications (4)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US10/729,441 Expired - Fee Related US8034904B2 (en) | 2002-06-14 | 2003-12-08 | Anti-IGF-I receptor antibody |
| US10/897,406 Abandoned US20050186203A1 (en) | 2002-06-14 | 2004-07-23 | Anti-IGF-I receptor antibody |
| US10/932,334 Abandoned US20050249728A1 (en) | 2002-06-14 | 2004-09-02 | Anti-IGF-I receptor antibody |
| US12/771,239 Abandoned US20100260678A1 (en) | 2002-06-14 | 2010-04-30 | Anti-igf-i receptor antibodies |
Family Applications Before (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US10/729,441 Expired - Fee Related US8034904B2 (en) | 2002-06-14 | 2003-12-08 | Anti-IGF-I receptor antibody |
| US10/897,406 Abandoned US20050186203A1 (en) | 2002-06-14 | 2004-07-23 | Anti-IGF-I receptor antibody |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US12/771,239 Abandoned US20100260678A1 (en) | 2002-06-14 | 2010-04-30 | Anti-igf-i receptor antibodies |
Country Status (3)
| Country | Link |
|---|---|
| US (4) | US8034904B2 (en) |
| AU (1) | AU2011201809A1 (en) |
| WO (1) | WO2005061541A1 (en) |
Cited By (104)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20040018191A1 (en) * | 2002-05-24 | 2004-01-29 | Schering Corporation | Neutralizing human anti-IGFR antibody |
| US20050136063A1 (en) * | 2003-11-21 | 2005-06-23 | Schering Corporation | Anti-IGFR antibody therapeutic combinations |
| US20060233810A1 (en) * | 2005-04-15 | 2006-10-19 | Yaolin Wang | Methods and compositions for treating or preventing cancer |
| US20060286103A1 (en) * | 2005-06-15 | 2006-12-21 | Parag Kolhe | Stable antibody formulation |
| US20080025990A1 (en) * | 2003-05-01 | 2008-01-31 | Ludwig Dale L | Fully Human Antibodies Directed Against the Human Insulin-Like Growth Factor-1 Receptor |
| US7326567B2 (en) | 2003-11-12 | 2008-02-05 | Schering Corporation | Plasmid system for multigene expression |
| US20090092614A1 (en) * | 2007-08-28 | 2009-04-09 | Biogen Idec Ma Inc. | Anti-IGF-1R Antibodies and Uses Thereof |
| US20090110678A1 (en) * | 2005-06-17 | 2009-04-30 | Imclone Systems Incorporated | Receptor antagonists for treatment of metastatic bone cancer |
| US20090117117A1 (en) * | 2007-04-12 | 2009-05-07 | The Brigham And Women's Hospital, Inc. | Targeting abcb5 for cancer therapy |
| US20090130105A1 (en) * | 2007-08-28 | 2009-05-21 | Biogen Idec Ma Inc. | Compositions that bind multiple epitopes of igf-1r |
| US20090175868A1 (en) * | 2006-02-03 | 2009-07-09 | Ludwig Dale L | IGF-IR antagonists as adjuvants for treatment of prostate cancer |
| US20090265797A1 (en) * | 2005-07-22 | 2009-10-22 | Pierre Fabre Medicament | Novel Anti-IGF-IR Antibodies and Uses Thereof |
| US20090285824A1 (en) * | 2004-12-22 | 2009-11-19 | Amgen Inc. | Compositions and methods relating to anti IGF-1 receptor antibodies |
| US20100098710A1 (en) * | 2006-03-28 | 2010-04-22 | Biogen Idec Ma Inc. | Anti-IGF-1R Antibodies and Uses Thereof |
| US20100166747A1 (en) * | 2007-03-02 | 2010-07-01 | Beltran Pedro J | Methods and compositions for treating tumor diseases |
| US7811562B2 (en) | 2004-12-03 | 2010-10-12 | Schering Corporation | Biomarkers for pre-selection of patients for anti-IGF1R therapy |
| US20100297106A1 (en) * | 2007-09-27 | 2010-11-25 | Christopher James Sloey | Pharmaceutical Formulations |
| WO2010146059A2 (en) | 2009-06-16 | 2010-12-23 | F. Hoffmann-La Roche Ag | Biomarkers for igf-1r inhibitor therapy |
| US20110097318A1 (en) * | 2007-08-31 | 2011-04-28 | Amgen Inc. | Solid-State Protein Formulation |
| WO2011050333A1 (en) | 2009-10-23 | 2011-04-28 | Amgen Inc. | Vial adapter and system |
| WO2011156373A1 (en) | 2010-06-07 | 2011-12-15 | Amgen Inc. | Drug delivery device |
| WO2011143318A3 (en) * | 2010-05-11 | 2012-01-05 | Aveo Pharmaceuticals, Inc. | Anti-fgfr2 antibodies |
| WO2012106556A2 (en) | 2011-02-02 | 2012-08-09 | Amgen Inc. | Methods and compositons relating to inhibition of igf-1r |
| WO2012135315A1 (en) | 2011-03-31 | 2012-10-04 | Amgen Inc. | Vial adapter and system |
| WO2013055873A1 (en) | 2011-10-14 | 2013-04-18 | Amgen Inc. | Injector and method of assembly |
| WO2013071056A2 (en) | 2011-11-11 | 2013-05-16 | Duke University | Combination drug therapy for the treatment of solid tumors |
| WO2014015280A1 (en) | 2012-07-20 | 2014-01-23 | Novartis Pharma Ag | Combination therapy of inhibitors for igf1 r and pi3k |
| WO2014081780A1 (en) | 2012-11-21 | 2014-05-30 | Amgen Inc. | Drug delivery device |
| WO2014144096A1 (en) | 2013-03-15 | 2014-09-18 | Amgen Inc. | Drug cassette, autoinjector, and autoinjector system |
| WO2014143770A1 (en) | 2013-03-15 | 2014-09-18 | Amgen Inc. | Body contour adaptable autoinjector device |
| WO2014149357A1 (en) | 2013-03-22 | 2014-09-25 | Amgen Inc. | Injector and method of assembly |
| WO2015061389A1 (en) | 2013-10-24 | 2015-04-30 | Amgen Inc. | Drug delivery system with temperature-sensitive control |
| WO2015061386A1 (en) | 2013-10-24 | 2015-04-30 | Amgen Inc. | Injector and method of assembly |
| WO2015119906A1 (en) | 2014-02-05 | 2015-08-13 | Amgen Inc. | Drug delivery system with electromagnetic field generator |
| WO2015171777A1 (en) | 2014-05-07 | 2015-11-12 | Amgen Inc. | Autoinjector with shock reducing elements |
| WO2015187793A1 (en) | 2014-06-03 | 2015-12-10 | Amgen Inc. | Drug delivery system and method of use |
| WO2016061220A2 (en) | 2014-10-14 | 2016-04-21 | Amgen Inc. | Drug injection device with visual and audio indicators |
| WO2016100781A1 (en) | 2014-12-19 | 2016-06-23 | Amgen Inc. | Drug delivery device with proximity sensor |
| WO2016100055A1 (en) | 2014-12-19 | 2016-06-23 | Amgen Inc. | Drug delivery device with live button or user interface field |
| WO2016133947A1 (en) | 2015-02-17 | 2016-08-25 | Amgen Inc. | Drug delivery device with vacuum assisted securement and/or feedback |
| WO2016138434A1 (en) | 2015-02-27 | 2016-09-01 | Amgen Inc. | Drug delivery device having a needle guard mechanism with a tunable threshold of resistance to needle guard movement |
| WO2017039786A1 (en) | 2015-09-02 | 2017-03-09 | Amgen Inc. | Syringe assembly adapter for a syringe |
| WO2017100501A1 (en) | 2015-12-09 | 2017-06-15 | Amgen Inc. | Auto-injector with signaling cap |
| WO2017120178A1 (en) | 2016-01-06 | 2017-07-13 | Amgen Inc. | Auto-injector with signaling electronics |
| WO2017160799A1 (en) | 2016-03-15 | 2017-09-21 | Amgen Inc. | Reducing probability of glass breakage in drug delivery devices |
| US9801912B2 (en) | 2013-02-19 | 2017-10-31 | Va Boston Healthcare System | ABCB5(+) stem cells for treating ocular disease |
| WO2017189089A1 (en) | 2016-04-29 | 2017-11-02 | Amgen Inc. | Drug delivery device with messaging label |
| WO2017192287A1 (en) | 2016-05-02 | 2017-11-09 | Amgen Inc. | Syringe adapter and guide for filling an on-body injector |
| WO2017197222A1 (en) | 2016-05-13 | 2017-11-16 | Amgen Inc. | Vial sleeve assembly |
| WO2017200989A1 (en) | 2016-05-16 | 2017-11-23 | Amgen Inc. | Data encryption in medical devices with limited computational capability |
| WO2017209899A1 (en) | 2016-06-03 | 2017-12-07 | Amgen Inc. | Impact testing apparatuses and methods for drug delivery devices |
| WO2018004842A1 (en) | 2016-07-01 | 2018-01-04 | Amgen Inc. | Drug delivery device having minimized risk of component fracture upon impact events |
| WO2018034784A1 (en) | 2016-08-17 | 2018-02-22 | Amgen Inc. | Drug delivery device with placement detection |
| WO2018081234A1 (en) | 2016-10-25 | 2018-05-03 | Amgen Inc. | On-body injector |
| WO2018136398A1 (en) | 2017-01-17 | 2018-07-26 | Amgen Inc. | Injection devices and related methods of use and assembly |
| WO2018151890A1 (en) | 2017-02-17 | 2018-08-23 | Amgen Inc. | Drug delivery device with sterile fluid flowpath and related method of assembly |
| WO2018152073A1 (en) | 2017-02-17 | 2018-08-23 | Amgen Inc. | Insertion mechanism for drug delivery device |
| WO2018165499A1 (en) | 2017-03-09 | 2018-09-13 | Amgen Inc. | Insertion mechanism for drug delivery device |
| WO2018165143A1 (en) | 2017-03-06 | 2018-09-13 | Amgen Inc. | Drug delivery device with activation prevention feature |
| WO2018164829A1 (en) | 2017-03-07 | 2018-09-13 | Amgen Inc. | Needle insertion by overpressure |
| EP3381445A2 (en) | 2007-11-15 | 2018-10-03 | Amgen Inc. | Aqueous formulation of antibody stablised by antioxidants for parenteral administration |
| WO2018183039A1 (en) | 2017-03-28 | 2018-10-04 | Amgen Inc. | Plunger rod and syringe assembly system and method |
| WO2018226515A1 (en) | 2017-06-08 | 2018-12-13 | Amgen Inc. | Syringe assembly for a drug delivery device and method of assembly |
| WO2018226565A1 (en) | 2017-06-08 | 2018-12-13 | Amgen Inc. | Torque driven drug delivery device |
| WO2018237225A1 (en) | 2017-06-23 | 2018-12-27 | Amgen Inc. | ELECTRONIC DRUG DELIVERY DEVICE COMPRISING A CAP ACTIVATED BY A SWITCH ASSEMBLY |
| WO2018236619A1 (en) | 2017-06-22 | 2018-12-27 | Amgen Inc. | REDUCING THE IMPACTS / IMPACTS OF ACTIVATION OF A DEVICE |
| WO2019014014A1 (en) | 2017-07-14 | 2019-01-17 | Amgen Inc. | Needle insertion-retraction system having dual torsion spring system |
| WO2019018169A1 (en) | 2017-07-21 | 2019-01-24 | Amgen Inc. | Gas permeable sealing member for drug container and methods of assembly |
| WO2019022951A1 (en) | 2017-07-25 | 2019-01-31 | Amgen Inc. | Drug delivery device with gear module and related method of assembly |
| WO2019022950A1 (en) | 2017-07-25 | 2019-01-31 | Amgen Inc. | Drug delivery device with container access system and related method of assembly |
| WO2019032482A2 (en) | 2017-08-09 | 2019-02-14 | Amgen Inc. | Hydraulic-pneumatic pressurized chamber drug delivery system |
| WO2019036181A1 (en) | 2017-08-18 | 2019-02-21 | Amgen Inc. | Wearable injector with sterile adhesive patch |
| WO2019040548A1 (en) | 2017-08-22 | 2019-02-28 | Amgen Inc. | Needle insertion mechanism for drug delivery device |
| WO2019070472A1 (en) | 2017-10-04 | 2019-04-11 | Amgen Inc. | Flow adapter for drug delivery device |
| WO2019070552A1 (en) | 2017-10-06 | 2019-04-11 | Amgen Inc. | Drug delivery device with interlock assembly and related method of assembly |
| WO2019074579A1 (en) | 2017-10-09 | 2019-04-18 | Amgen Inc. | Drug delivery device with drive assembly and related method of assembly |
| WO2019090303A1 (en) | 2017-11-06 | 2019-05-09 | Amgen Inc. | Fill-finish assemblies and related methods |
| WO2019089178A1 (en) | 2017-11-06 | 2019-05-09 | Amgen Inc. | Drug delivery device with placement and flow sensing |
| WO2019090086A1 (en) | 2017-11-03 | 2019-05-09 | Amgen Inc. | Systems and approaches for sterilizing a drug delivery device |
| WO2019094138A1 (en) | 2017-11-10 | 2019-05-16 | Amgen Inc. | Plungers for drug delivery devices |
| WO2019099322A1 (en) | 2017-11-16 | 2019-05-23 | Amgen Inc. | Autoinjector with stall and end point detection |
| WO2019099324A1 (en) | 2017-11-16 | 2019-05-23 | Amgen Inc. | Door latch mechanism for drug delivery device |
| EP3498323A2 (en) | 2011-04-20 | 2019-06-19 | Amgen Inc. | Autoinjector apparatus |
| WO2019231618A1 (en) | 2018-06-01 | 2019-12-05 | Amgen Inc. | Modular fluid path assemblies for drug delivery devices |
| WO2019231582A1 (en) | 2018-05-30 | 2019-12-05 | Amgen Inc. | Thermal spring release mechanism for a drug delivery device |
| EP3593839A1 (en) | 2013-03-15 | 2020-01-15 | Amgen Inc. | Drug cassette |
| WO2020023451A1 (en) | 2018-07-24 | 2020-01-30 | Amgen Inc. | Delivery devices for administering drugs |
| WO2020023336A1 (en) | 2018-07-24 | 2020-01-30 | Amgen Inc. | Hybrid drug delivery devices with grip portion |
| WO2020023220A1 (en) | 2018-07-24 | 2020-01-30 | Amgen Inc. | Hybrid drug delivery devices with tacky skin attachment portion and related method of preparation |
| WO2020023444A1 (en) | 2018-07-24 | 2020-01-30 | Amgen Inc. | Delivery devices for administering drugs |
| WO2020028009A1 (en) | 2018-07-31 | 2020-02-06 | Amgen Inc. | Fluid path assembly for a drug delivery device |
| WO2020068623A1 (en) | 2018-09-24 | 2020-04-02 | Amgen Inc. | Interventional dosing systems and methods |
| WO2020068476A1 (en) | 2018-09-28 | 2020-04-02 | Amgen Inc. | Muscle wire escapement activation assembly for a drug delivery device |
| WO2020072577A1 (en) | 2018-10-02 | 2020-04-09 | Amgen Inc. | Injection systems for drug delivery with internal force transmission |
| WO2020072846A1 (en) | 2018-10-05 | 2020-04-09 | Amgen Inc. | Drug delivery device having dose indicator |
| WO2020081479A1 (en) | 2018-10-15 | 2020-04-23 | Amgen Inc. | Drug delivery device having damping mechanism |
| WO2020081480A1 (en) | 2018-10-15 | 2020-04-23 | Amgen Inc. | Platform assembly process for drug delivery device |
| WO2020091981A1 (en) | 2018-11-01 | 2020-05-07 | Amgen Inc. | Drug delivery devices with partial drug delivery member retraction |
| WO2020092056A1 (en) | 2018-11-01 | 2020-05-07 | Amgen Inc. | Drug delivery devices with partial needle retraction |
| WO2020091956A1 (en) | 2018-11-01 | 2020-05-07 | Amgen Inc. | Drug delivery devices with partial drug delivery member retraction |
| WO2020219482A1 (en) | 2019-04-24 | 2020-10-29 | Amgen Inc. | Syringe sterilization verification assemblies and methods |
| WO2021041067A2 (en) | 2019-08-23 | 2021-03-04 | Amgen Inc. | Drug delivery device with configurable needle shield engagement components and related methods |
| US11446331B2 (en) | 2013-05-10 | 2022-09-20 | The Brigham And Women's Hospital, Inc. | Wound healing and tissue engineering |
| WO2022246055A1 (en) | 2021-05-21 | 2022-11-24 | Amgen Inc. | Method of optimizing a filling recipe for a drug container |
Families Citing this family (44)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7754208B2 (en) | 2001-01-17 | 2010-07-13 | Trubion Pharmaceuticals, Inc. | Binding domain-immunoglobulin fusion proteins |
| US20080063639A1 (en) * | 2002-01-18 | 2008-03-13 | Pierre Fabre Medicament | Method for the treatment of psoriasis comprising novel anti-IGF-IR antibodies |
| US7524831B2 (en) * | 2005-03-02 | 2009-04-28 | Schering Corporation | Treatments for Flaviviridae virus infection |
| EP2586798A3 (en) | 2005-07-25 | 2013-08-07 | Emergent Product Development Seattle, LLC | B-cell reduction using CD37-specific and CD20-specific binding molecules |
| WO2007020509A1 (en) * | 2005-08-15 | 2007-02-22 | Ed. Geistlich Soehne Ag Fuer Chemische Industrie | Combination of methylol transfer agents with tumour-inhibiting proteins or peptides and the use thereof for the treatment of cancer or tumor growth |
| WO2007093008A1 (en) * | 2006-02-17 | 2007-08-23 | Adelaide Research & Innovation Pty Ltd | Antibodies to insulin-like growth factor i receptor |
| EP3805269A1 (en) | 2006-06-12 | 2021-04-14 | Aptevo Research and Development LLC | Single-chain multivalent binding proteins with effector function |
| ME02371B (en) | 2006-09-29 | 2016-06-20 | Oncomed Pharm Inc | Compositions and methods for diagnosing and treating cancer |
| AU2007325838B2 (en) | 2006-11-22 | 2013-09-19 | Bristol-Myers Squibb Company | Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including IGF-IR |
| JP2010518140A (en) * | 2007-02-14 | 2010-05-27 | グラクソ グループ リミテッド | Novel antibody against IGF-1R |
| GB0702888D0 (en) * | 2007-02-14 | 2007-03-28 | Glaxo Group Ltd | Novel Antibodies |
| PE20090368A1 (en) | 2007-06-19 | 2009-04-28 | Boehringer Ingelheim Int | ANTI-IGF ANTIBODIES |
| EP2019104B1 (en) | 2007-07-19 | 2013-09-04 | Sanofi | Cytotoxic agents comprising new tomaymycin derivatives and their therapeutic use |
| US20110105724A1 (en) * | 2007-08-16 | 2011-05-05 | Stephanie Jane Clegg | Novel compounds |
| EP2201378A2 (en) * | 2007-10-03 | 2010-06-30 | OSI Pharmaceuticals, Inc. | Biological markers predictive of anti-cancer response to insulin-like growth factor-1 receptor kinase inhibitors |
| EP2208066A2 (en) | 2007-10-03 | 2010-07-21 | OSI Pharmaceuticals, Inc. | Biological markers predictive of anti-cancer response to insulin-like growth factor-1 receptor kinase inhibitors |
| CN102007145A (en) | 2008-02-14 | 2011-04-06 | 百时美施贵宝公司 | Targeted therapeutics based on engineered proteins that bind egfr |
| RU2531754C2 (en) | 2008-04-11 | 2014-10-27 | ЭМЕРДЖЕНТ ПРОДАКТ ДИВЕЛОПМЕНТ СИЭТЛ,ЭлЭлСи,US | Immunotherapeutic agent combined with cd37, and its combination with bifunctional chemotherapeutic agent |
| PE20091931A1 (en) | 2008-05-22 | 2009-12-31 | Bristol Myers Squibb Co | MULTIVALENT FIBRONECTIN-BASED FRAME DOMAIN PROTEINS |
| BRPI0914789A2 (en) * | 2008-06-16 | 2015-10-20 | Immunogen Inc | synergistic effects |
| MX2011006055A (en) | 2008-12-12 | 2011-07-04 | Boehringer Ingelheim Int | Anti-igf antibodies. |
| EP3485908B1 (en) | 2009-10-16 | 2021-08-18 | Mereo BioPharma 5, Inc. | Therapeutic combination and use of dll4 antagonist antibodies and anti-hypertensive agents |
| RU2609658C2 (en) | 2009-12-21 | 2017-02-02 | Дженентек, Инк. | Composition containing antibody |
| US9464136B2 (en) | 2010-08-20 | 2016-10-11 | Massachusetts Institute Of Technology | Antibody-based constructs directed against tyrosine kinase receptors |
| US8551479B2 (en) | 2010-09-10 | 2013-10-08 | Oncomed Pharmaceuticals, Inc. | Methods for treating melanoma |
| US9428565B2 (en) | 2011-01-31 | 2016-08-30 | The General Hospital Corporation | Treatment and bioluminescent visualization using multimodal TRAIL molecules |
| EP2702173A1 (en) | 2011-04-25 | 2014-03-05 | OSI Pharmaceuticals, LLC | Use of emt gene signatures in cancer drug discovery, diagnostics, and treatment |
| EP3485903B1 (en) | 2011-09-23 | 2022-11-16 | Mereo BioPharma 5, Inc. | Vegf/dll4 binding agents and uses thereof |
| EP2877572B1 (en) | 2012-07-24 | 2018-11-28 | The General Hospital Corporation | Oncolytic virus therapy for resistant tumors |
| US9605074B2 (en) * | 2012-08-30 | 2017-03-28 | The General Hospital Corporation | Multifunctional nanobodies for treating cancer |
| US20140227252A1 (en) | 2012-10-31 | 2014-08-14 | Oncomed Pharmaceuticals , Inc. | Methods and Monitoring of Treatment with a DLL4 Antagonist |
| US20140255413A1 (en) | 2013-03-07 | 2014-09-11 | Boehringer Ingelheim International Gmbh | Combination therapy for neoplasia treatment |
| WO2014177460A1 (en) | 2013-04-29 | 2014-11-06 | F. Hoffmann-La Roche Ag | Human fcrn-binding modified antibodies and methods of use |
| PL2992010T3 (en) | 2013-04-29 | 2021-08-23 | F.Hoffmann-La Roche Ag | Fc-receptor binding modified asymmetric antibodies and methods of use |
| CN103509117B (en) * | 2013-05-06 | 2016-03-09 | 江苏匡亚生物医药科技有限公司 | Bi-specific antibody of anti-human HER2 and people IGF-IR and its production and use |
| MX380658B (en) | 2014-01-15 | 2025-03-11 | Hoffmann La Roche | REGION FC VARIANTS WITH ENHANCED PROTEIN A BINDING. |
| DK3212233T3 (en) | 2014-10-31 | 2020-07-27 | Oncomed Pharm Inc | COMBINATION THERAPY FOR TREATMENT OF DISEASE |
| CA2999138C (en) | 2015-09-21 | 2024-05-21 | Aptevo Research And Development Llc | Cd3 binding polypeptides |
| AU2016326609B2 (en) | 2015-09-23 | 2023-03-09 | Mereo Biopharma 5, Inc. | Methods and compositions for treatment of cancer |
| WO2017053889A2 (en) | 2015-09-23 | 2017-03-30 | Precision Immunotherapy, Inc. | Flt3 directed car cells for immunotherapy |
| WO2019046600A1 (en) | 2017-08-30 | 2019-03-07 | Amgen Inc. | Insulin-like growth factor-1 receptor (igf-1r) binding proteins and methods of use |
| TW202228775A (en) * | 2020-10-14 | 2022-08-01 | 美商維里迪恩醫療股份有限公司 | Compositions and methods for treatment of thyroid eye disease |
| TW202320850A (en) | 2021-08-10 | 2023-06-01 | 美商維里迪恩醫療股份有限公司 | Compositions, doses, and methods for treatment of thyroid eye disease |
| EP4408470A4 (en) * | 2021-10-01 | 2025-09-03 | Univ Utah Res Found | Pathological TDP-43 as a biomarker for diagnosing TDP-43 proteinopathy |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20030165502A1 (en) * | 2000-06-13 | 2003-09-04 | City Of Hope | Single-chain antibodies against human insulin-like growth factor I receptor: expression, purification, and effect on tumor growth |
| US20030195147A1 (en) * | 1998-09-02 | 2003-10-16 | Renuka Pillutla | Insulin and IGF-1 receptor agonists and antagonists |
| US20030236190A1 (en) * | 1998-09-02 | 2003-12-25 | Renuka Pillutla | Isulin and IGF-1 receptor agonists and antagonists |
| US20040023887A1 (en) * | 1998-09-02 | 2004-02-05 | Renuka Pillutla | Insulin and IGF-1 receptor agonists and antagonists |
| US20040086503A1 (en) * | 2001-01-05 | 2004-05-06 | Cohen Bruce D. | Antibodies to insulin-like growth factor I receptor |
Family Cites Families (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5530101A (en) * | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| KR930701975A (en) | 1990-11-09 | 1993-09-08 | 제랄드 에프. 버크 | How to determine the sensitivity and / or specificity of a test system for antibody detection |
| DE4203545A1 (en) * | 1992-02-07 | 1993-08-12 | Behringwerke Ag | SPECIFIC ANTIBODIES AGAINST ACTIVATED PLATES, THEIR PRODUCTION AND THEIR USE IN DIAGNOSIS AND THERAPY |
| US5804187A (en) * | 1992-11-16 | 1998-09-08 | Cancer Research Fund Of Contra Costa | Modified antibodies with human milk fat globule specificity |
| HU221001B1 (en) * | 1994-03-17 | 2002-07-29 | Merck Patent Gmbh. | Anti-egfr single-chain fvs, anti-egfr antibodies |
| US6309636B1 (en) * | 1995-09-14 | 2001-10-30 | Cancer Research Institute Of Contra Costa | Recombinant peptides derived from the Mc3 anti-BA46 antibody, methods of use thereof, and methods of humanizing antibody peptides |
| GB9525180D0 (en) * | 1995-12-08 | 1996-02-07 | Univ Mcgill | Design of hormone-like antibodies with agonistic and antagonistic fuctions |
| JP2002518493A (en) * | 1998-06-25 | 2002-06-25 | チバ スペシャルティ ケミカルズ ホールディング インコーポレーテッド | Method for producing 3-aryl-benzofuranone |
| CA2351452A1 (en) | 1998-12-04 | 2000-06-15 | Novartis Ag | Methods and compositions useful for targeting activated vitronectin receptor .alpha.v.beta.3 |
| US7365167B2 (en) * | 2001-11-26 | 2008-04-29 | Cell Matrix, Inc. | Humanized collagen antibodies and related methods |
| US7241444B2 (en) * | 2002-01-18 | 2007-07-10 | Pierre Fabre Medicament | Anti-IGF-IR antibodies and uses thereof |
| ATE357460T1 (en) | 2002-01-18 | 2007-04-15 | Pf Medicament | ANTIBODIES TO IGF-IR AND THEIR USES |
| NZ554740A (en) | 2002-05-24 | 2009-01-31 | Schering Corp | Neutralizing human anti-IGFR antibody |
| US7538195B2 (en) * | 2002-06-14 | 2009-05-26 | Immunogen Inc. | Anti-IGF-I receptor antibody |
| NZ582210A (en) | 2003-02-13 | 2011-04-29 | Pfizer Prod Inc | Uses of anti-insulin-like growth factor I receptor antibodies |
| MXPA05009837A (en) | 2003-03-14 | 2005-12-05 | Pharmacia Corp | Antibodies to igf-i receptor for the treatment of cancers. |
-
2003
- 2003-12-08 US US10/729,441 patent/US8034904B2/en not_active Expired - Fee Related
-
2004
- 2004-07-23 US US10/897,406 patent/US20050186203A1/en not_active Abandoned
- 2004-09-02 US US10/932,334 patent/US20050249728A1/en not_active Abandoned
- 2004-12-07 WO PCT/US2004/038230 patent/WO2005061541A1/en active Application Filing
-
2010
- 2010-04-30 US US12/771,239 patent/US20100260678A1/en not_active Abandoned
-
2011
- 2011-04-20 AU AU2011201809A patent/AU2011201809A1/en not_active Abandoned
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20030195147A1 (en) * | 1998-09-02 | 2003-10-16 | Renuka Pillutla | Insulin and IGF-1 receptor agonists and antagonists |
| US20030236190A1 (en) * | 1998-09-02 | 2003-12-25 | Renuka Pillutla | Isulin and IGF-1 receptor agonists and antagonists |
| US20040023887A1 (en) * | 1998-09-02 | 2004-02-05 | Renuka Pillutla | Insulin and IGF-1 receptor agonists and antagonists |
| US20030165502A1 (en) * | 2000-06-13 | 2003-09-04 | City Of Hope | Single-chain antibodies against human insulin-like growth factor I receptor: expression, purification, and effect on tumor growth |
| US20040086503A1 (en) * | 2001-01-05 | 2004-05-06 | Cohen Bruce D. | Antibodies to insulin-like growth factor I receptor |
Cited By (189)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7851181B2 (en) | 2002-05-24 | 2010-12-14 | Schering Corporation | Neutralizing human anti-IGFR antibody |
| US20040018191A1 (en) * | 2002-05-24 | 2004-01-29 | Schering Corporation | Neutralizing human anti-IGFR antibody |
| US7667021B2 (en) | 2002-05-24 | 2010-02-23 | Schering Corporation | Neutralizing human anti-IGFR antibody |
| US7847068B2 (en) | 2002-05-24 | 2010-12-07 | Schering Corporation | Neutralizing human anti-IGFR antibody |
| US20070059305A1 (en) * | 2002-05-24 | 2007-03-15 | Schering Corporation | Neutralizing human anti-IGFR antibody |
| US20070059241A1 (en) * | 2002-05-24 | 2007-03-15 | Schering Corporation | Neutralizing human anti-IGFR antibody |
| US7217796B2 (en) | 2002-05-24 | 2007-05-15 | Schering Corporation | Neutralizing human anti-IGFR antibody |
| US20080014197A1 (en) * | 2002-05-24 | 2008-01-17 | Yan Wang | Neutralizing human anti-igfr antibody |
| US7968093B2 (en) | 2003-05-01 | 2011-06-28 | Imclone Llc | Fully human antibodies directed against the human insulin-like growth factor-1 receptor |
| US20080025990A1 (en) * | 2003-05-01 | 2008-01-31 | Ludwig Dale L | Fully Human Antibodies Directed Against the Human Insulin-Like Growth Factor-1 Receptor |
| US7638605B2 (en) | 2003-05-01 | 2009-12-29 | ImClone, LLC | Fully human antibodies directed against the human insulin-like growth factor-1 receptor |
| US20100158920A1 (en) * | 2003-05-01 | 2010-06-24 | Imclone Llc | Fully human antibodies directed against the human insulin-like growth factor-1 receptor |
| US7326567B2 (en) | 2003-11-12 | 2008-02-05 | Schering Corporation | Plasmid system for multigene expression |
| US8062886B2 (en) | 2003-11-12 | 2011-11-22 | Schering Corporation | Plasmid system for multigene expression |
| US8017735B2 (en) | 2003-11-21 | 2011-09-13 | Schering Corporation | Anti-IGFR1 antibody therapeutic combinations |
| US20050136063A1 (en) * | 2003-11-21 | 2005-06-23 | Schering Corporation | Anti-IGFR antibody therapeutic combinations |
| US7811562B2 (en) | 2004-12-03 | 2010-10-12 | Schering Corporation | Biomarkers for pre-selection of patients for anti-IGF1R therapy |
| US7871611B2 (en) | 2004-12-22 | 2011-01-18 | Amgen Inc. | Compositions and methods relating to anti IGF-1 receptor antibodies |
| US8460662B2 (en) | 2004-12-22 | 2013-06-11 | Amgen Inc. | Compositions and methods relating to anti-IGF-1 receptor antibodies |
| US20090285824A1 (en) * | 2004-12-22 | 2009-11-19 | Amgen Inc. | Compositions and methods relating to anti IGF-1 receptor antibodies |
| US8895008B2 (en) | 2004-12-22 | 2014-11-25 | Amgen Inc. | Compositions and methods relating to anti-IGF-1 receptor antibodies |
| US8168409B2 (en) | 2004-12-22 | 2012-05-01 | Amgen Inc. | Compositions and methods relating to anti-IGF-1 receptor antibodies |
| US10035861B2 (en) | 2004-12-22 | 2018-07-31 | Amgen Inc. | Compositions and methods relating to anti-IGF-1 receptor antibodies |
| US20110070615A1 (en) * | 2004-12-22 | 2011-03-24 | Amgen Inc. | Compositions and Methods Relating to Anti-IGF-1 Receptor Antibodies |
| US20060233810A1 (en) * | 2005-04-15 | 2006-10-19 | Yaolin Wang | Methods and compositions for treating or preventing cancer |
| US20060286103A1 (en) * | 2005-06-15 | 2006-12-21 | Parag Kolhe | Stable antibody formulation |
| US8128929B2 (en) | 2005-06-17 | 2012-03-06 | Imclone Llc | Antibodies against PDGFRa |
| US20090110678A1 (en) * | 2005-06-17 | 2009-04-30 | Imclone Systems Incorporated | Receptor antagonists for treatment of metastatic bone cancer |
| US8425911B2 (en) | 2005-06-17 | 2013-04-23 | Imclone Llc | Methods of treating secondary bone tumors with antibodies against PDGFR alpha |
| US8574578B2 (en) | 2005-06-17 | 2013-11-05 | Imclone Llc | Antibodies against PDGFRα to inhibit tumor growth |
| US20090265797A1 (en) * | 2005-07-22 | 2009-10-22 | Pierre Fabre Medicament | Novel Anti-IGF-IR Antibodies and Uses Thereof |
| US8361461B2 (en) | 2005-07-22 | 2013-01-29 | Pierre Fabre Medicament | Anti-IGF-IR antibodies and uses thereof |
| US20090175868A1 (en) * | 2006-02-03 | 2009-07-09 | Ludwig Dale L | IGF-IR antagonists as adjuvants for treatment of prostate cancer |
| US7972600B2 (en) | 2006-02-03 | 2011-07-05 | Imclone Llc | IGF-IR antagonists as adjuvants for treatment of prostate cancer |
| US20100098710A1 (en) * | 2006-03-28 | 2010-04-22 | Biogen Idec Ma Inc. | Anti-IGF-1R Antibodies and Uses Thereof |
| US8147829B2 (en) | 2006-03-28 | 2012-04-03 | Biogen Idec Ma Inc. | Anti-IGR-1R antibodies and uses thereof |
| US20100166747A1 (en) * | 2007-03-02 | 2010-07-01 | Beltran Pedro J | Methods and compositions for treating tumor diseases |
| US20090117117A1 (en) * | 2007-04-12 | 2009-05-07 | The Brigham And Women's Hospital, Inc. | Targeting abcb5 for cancer therapy |
| US9855342B2 (en) | 2007-04-12 | 2018-01-02 | The Brigham And Women's Hospital, Inc. | Targeting ABCB5 for cancer therapy |
| US9266946B2 (en) | 2007-04-12 | 2016-02-23 | The Brigham And Women's Hospital, Inc. | Targeting ABCB5 for cancer therapy |
| US7928202B2 (en) | 2007-04-12 | 2011-04-19 | The Brigham And Women's Hospital, Inc. | Targeting ABCB5 for cancer therapy |
| US8697072B2 (en) | 2007-04-12 | 2014-04-15 | The Brigham And Women's Hospital, Inc. | Targeting ABCB5 for cancer therapy |
| US20090130105A1 (en) * | 2007-08-28 | 2009-05-21 | Biogen Idec Ma Inc. | Compositions that bind multiple epitopes of igf-1r |
| WO2009032782A3 (en) * | 2007-08-28 | 2009-05-28 | Biogen Idec Inc | Compositions that bind multiple epitopes of igf-1r |
| US20090092614A1 (en) * | 2007-08-28 | 2009-04-09 | Biogen Idec Ma Inc. | Anti-IGF-1R Antibodies and Uses Thereof |
| US20110097318A1 (en) * | 2007-08-31 | 2011-04-28 | Amgen Inc. | Solid-State Protein Formulation |
| US9320797B2 (en) | 2007-09-27 | 2016-04-26 | Amgen Inc. | Pharmaceutical formulations |
| US20100297106A1 (en) * | 2007-09-27 | 2010-11-25 | Christopher James Sloey | Pharmaceutical Formulations |
| US10653781B2 (en) | 2007-09-27 | 2020-05-19 | Amgen Inc. | Pharmaceutical formulations |
| US8383114B2 (en) | 2007-09-27 | 2013-02-26 | Amgen Inc. | Pharmaceutical formulations |
| EP3381445A2 (en) | 2007-11-15 | 2018-10-03 | Amgen Inc. | Aqueous formulation of antibody stablised by antioxidants for parenteral administration |
| WO2010146059A2 (en) | 2009-06-16 | 2010-12-23 | F. Hoffmann-La Roche Ag | Biomarkers for igf-1r inhibitor therapy |
| WO2011050333A1 (en) | 2009-10-23 | 2011-04-28 | Amgen Inc. | Vial adapter and system |
| WO2011143318A3 (en) * | 2010-05-11 | 2012-01-05 | Aveo Pharmaceuticals, Inc. | Anti-fgfr2 antibodies |
| US8481688B2 (en) | 2010-05-11 | 2013-07-09 | Aveo Pharmaceuticals, Inc. | Anti-FGFR2 antibodies |
| WO2011156373A1 (en) | 2010-06-07 | 2011-12-15 | Amgen Inc. | Drug delivery device |
| WO2012106556A2 (en) | 2011-02-02 | 2012-08-09 | Amgen Inc. | Methods and compositons relating to inhibition of igf-1r |
| WO2012135315A1 (en) | 2011-03-31 | 2012-10-04 | Amgen Inc. | Vial adapter and system |
| EP4074355A1 (en) | 2011-04-20 | 2022-10-19 | Amgen Inc. | Autoinjector apparatus |
| EP3498323A2 (en) | 2011-04-20 | 2019-06-19 | Amgen Inc. | Autoinjector apparatus |
| EP3045190A1 (en) | 2011-10-14 | 2016-07-20 | Amgen, Inc | Injector and method of assembly |
| EP3744371A1 (en) | 2011-10-14 | 2020-12-02 | Amgen, Inc | Injector and method of assembly |
| EP3335747A1 (en) | 2011-10-14 | 2018-06-20 | Amgen Inc. | Injector and method of assembly |
| WO2013055873A1 (en) | 2011-10-14 | 2013-04-18 | Amgen Inc. | Injector and method of assembly |
| EP3269413A1 (en) | 2011-10-14 | 2018-01-17 | Amgen, Inc | Injector and method of assembly |
| EP3045187A1 (en) | 2011-10-14 | 2016-07-20 | Amgen, Inc | Injector and method of assembly |
| EP3045189A1 (en) | 2011-10-14 | 2016-07-20 | Amgen, Inc | Injector and method of assembly |
| EP3045188A1 (en) | 2011-10-14 | 2016-07-20 | Amgen, Inc | Injector and method of assembly |
| US9931402B2 (en) | 2011-11-11 | 2018-04-03 | Duke University | Compositions for the treatment of solid tumors |
| US9700619B2 (en) | 2011-11-11 | 2017-07-11 | Duke University | Combination drug therapy for the treatment of solid tumors |
| WO2013071056A2 (en) | 2011-11-11 | 2013-05-16 | Duke University | Combination drug therapy for the treatment of solid tumors |
| WO2014015280A1 (en) | 2012-07-20 | 2014-01-23 | Novartis Pharma Ag | Combination therapy of inhibitors for igf1 r and pi3k |
| US12115341B2 (en) | 2012-11-21 | 2024-10-15 | Amgen Inc. | Drug delivery device |
| EP3656426A1 (en) | 2012-11-21 | 2020-05-27 | Amgen, Inc | Drug delivery device |
| EP4234694A2 (en) | 2012-11-21 | 2023-08-30 | Amgen Inc. | Drug delivery device |
| US10682474B2 (en) | 2012-11-21 | 2020-06-16 | Amgen Inc. | Drug delivery device |
| EP3072548A1 (en) | 2012-11-21 | 2016-09-28 | Amgen, Inc | Drug delivery device |
| EP3081249A1 (en) | 2012-11-21 | 2016-10-19 | Amgen, Inc | Drug delivery device |
| US12370304B2 (en) | 2012-11-21 | 2025-07-29 | Amgen Inc. | Drug delivery device |
| WO2014081780A1 (en) | 2012-11-21 | 2014-05-30 | Amgen Inc. | Drug delivery device |
| US11439745B2 (en) | 2012-11-21 | 2022-09-13 | Amgen Inc. | Drug delivery device |
| US11344681B2 (en) | 2012-11-21 | 2022-05-31 | Amgen Inc. | Drug delivery device |
| US11458247B2 (en) | 2012-11-21 | 2022-10-04 | Amgen Inc. | Drug delivery device |
| US11129854B2 (en) | 2013-02-19 | 2021-09-28 | Schepens Eye Research Institute | ABCB5(+) stem cells for treating ocular disease |
| US9801912B2 (en) | 2013-02-19 | 2017-10-31 | Va Boston Healthcare System | ABCB5(+) stem cells for treating ocular disease |
| WO2014144096A1 (en) | 2013-03-15 | 2014-09-18 | Amgen Inc. | Drug cassette, autoinjector, and autoinjector system |
| WO2014143770A1 (en) | 2013-03-15 | 2014-09-18 | Amgen Inc. | Body contour adaptable autoinjector device |
| EP3593839A1 (en) | 2013-03-15 | 2020-01-15 | Amgen Inc. | Drug cassette |
| EP3831427A1 (en) | 2013-03-22 | 2021-06-09 | Amgen Inc. | Injector and method of assembly |
| WO2014149357A1 (en) | 2013-03-22 | 2014-09-25 | Amgen Inc. | Injector and method of assembly |
| US11446331B2 (en) | 2013-05-10 | 2022-09-20 | The Brigham And Women's Hospital, Inc. | Wound healing and tissue engineering |
| EP3421066A1 (en) | 2013-10-24 | 2019-01-02 | Amgen, Inc | Injector and method of assembly |
| EP3957345A1 (en) | 2013-10-24 | 2022-02-23 | Amgen, Inc | Drug delivery system with temperature-sensitive control |
| EP3789064A1 (en) | 2013-10-24 | 2021-03-10 | Amgen, Inc | Injector and method of assembly |
| EP3501575A1 (en) | 2013-10-24 | 2019-06-26 | Amgen, Inc | Drug delivery system with temperature-sensitive-control |
| WO2015061386A1 (en) | 2013-10-24 | 2015-04-30 | Amgen Inc. | Injector and method of assembly |
| WO2015061389A1 (en) | 2013-10-24 | 2015-04-30 | Amgen Inc. | Drug delivery system with temperature-sensitive control |
| WO2015119906A1 (en) | 2014-02-05 | 2015-08-13 | Amgen Inc. | Drug delivery system with electromagnetic field generator |
| WO2015171777A1 (en) | 2014-05-07 | 2015-11-12 | Amgen Inc. | Autoinjector with shock reducing elements |
| EP3785749A1 (en) | 2014-05-07 | 2021-03-03 | Amgen Inc. | Autoinjector with shock reducing elements |
| US11213624B2 (en) | 2014-06-03 | 2022-01-04 | Amgen Inc. | Controllable drug delivery system and method of use |
| WO2015187799A1 (en) | 2014-06-03 | 2015-12-10 | Amgen Inc. | Systems and methods for remotely processing data collected by a drug delivery device |
| EP4362039A2 (en) | 2014-06-03 | 2024-05-01 | Amgen Inc. | Controllable drug delivery system and method of use |
| US11992659B2 (en) | 2014-06-03 | 2024-05-28 | Amgen Inc. | Controllable drug delivery system and method of use |
| EP4036924A1 (en) | 2014-06-03 | 2022-08-03 | Amgen, Inc | Devices and methods for assisting a user of a drug delivery device |
| US11738146B2 (en) | 2014-06-03 | 2023-08-29 | Amgen Inc. | Drug delivery system and method of use |
| WO2015187793A1 (en) | 2014-06-03 | 2015-12-10 | Amgen Inc. | Drug delivery system and method of use |
| WO2015187797A1 (en) | 2014-06-03 | 2015-12-10 | Amgen Inc. | Controllable drug delivery system and method of use |
| EP3943135A2 (en) | 2014-10-14 | 2022-01-26 | Amgen Inc. | Drug injection device with visual and audible indicators |
| WO2016061220A2 (en) | 2014-10-14 | 2016-04-21 | Amgen Inc. | Drug injection device with visual and audio indicators |
| WO2016100781A1 (en) | 2014-12-19 | 2016-06-23 | Amgen Inc. | Drug delivery device with proximity sensor |
| US12415039B2 (en) | 2014-12-19 | 2025-09-16 | Amgen Inc. | Drug delivery device with proximity sensor |
| US11357916B2 (en) | 2014-12-19 | 2022-06-14 | Amgen Inc. | Drug delivery device with live button or user interface field |
| EP3689394A1 (en) | 2014-12-19 | 2020-08-05 | Amgen Inc. | Drug delivery device with live button or user interface field |
| US10765801B2 (en) | 2014-12-19 | 2020-09-08 | Amgen Inc. | Drug delivery device with proximity sensor |
| US11944794B2 (en) | 2014-12-19 | 2024-04-02 | Amgen Inc. | Drug delivery device with proximity sensor |
| WO2016100055A1 (en) | 2014-12-19 | 2016-06-23 | Amgen Inc. | Drug delivery device with live button or user interface field |
| US10799630B2 (en) | 2014-12-19 | 2020-10-13 | Amgen Inc. | Drug delivery device with proximity sensor |
| EP3848072A1 (en) | 2014-12-19 | 2021-07-14 | Amgen Inc. | Drug delivery device with proximity sensor |
| WO2016133947A1 (en) | 2015-02-17 | 2016-08-25 | Amgen Inc. | Drug delivery device with vacuum assisted securement and/or feedback |
| EP3556411A1 (en) | 2015-02-17 | 2019-10-23 | Amgen Inc. | Drug delivery device with vacuum assisted securement and/or feedback |
| EP3981450A1 (en) | 2015-02-27 | 2022-04-13 | Amgen, Inc | Drug delivery device having a needle guard mechanism with a tunable threshold of resistance to needle guard movement |
| WO2016138434A1 (en) | 2015-02-27 | 2016-09-01 | Amgen Inc. | Drug delivery device having a needle guard mechanism with a tunable threshold of resistance to needle guard movement |
| WO2017039786A1 (en) | 2015-09-02 | 2017-03-09 | Amgen Inc. | Syringe assembly adapter for a syringe |
| WO2017100501A1 (en) | 2015-12-09 | 2017-06-15 | Amgen Inc. | Auto-injector with signaling cap |
| WO2017120178A1 (en) | 2016-01-06 | 2017-07-13 | Amgen Inc. | Auto-injector with signaling electronics |
| EP3721922A1 (en) | 2016-03-15 | 2020-10-14 | Amgen Inc. | Reducing probability of glass breakage in drug delivery devices |
| WO2017160799A1 (en) | 2016-03-15 | 2017-09-21 | Amgen Inc. | Reducing probability of glass breakage in drug delivery devices |
| EP4035711A1 (en) | 2016-03-15 | 2022-08-03 | Amgen Inc. | Reducing probability of glass breakage in drug delivery devices |
| WO2017189089A1 (en) | 2016-04-29 | 2017-11-02 | Amgen Inc. | Drug delivery device with messaging label |
| WO2017192287A1 (en) | 2016-05-02 | 2017-11-09 | Amgen Inc. | Syringe adapter and guide for filling an on-body injector |
| WO2017197222A1 (en) | 2016-05-13 | 2017-11-16 | Amgen Inc. | Vial sleeve assembly |
| WO2017200989A1 (en) | 2016-05-16 | 2017-11-23 | Amgen Inc. | Data encryption in medical devices with limited computational capability |
| WO2017209899A1 (en) | 2016-06-03 | 2017-12-07 | Amgen Inc. | Impact testing apparatuses and methods for drug delivery devices |
| WO2018004842A1 (en) | 2016-07-01 | 2018-01-04 | Amgen Inc. | Drug delivery device having minimized risk of component fracture upon impact events |
| WO2018034784A1 (en) | 2016-08-17 | 2018-02-22 | Amgen Inc. | Drug delivery device with placement detection |
| WO2018081234A1 (en) | 2016-10-25 | 2018-05-03 | Amgen Inc. | On-body injector |
| WO2018136398A1 (en) | 2017-01-17 | 2018-07-26 | Amgen Inc. | Injection devices and related methods of use and assembly |
| WO2018151890A1 (en) | 2017-02-17 | 2018-08-23 | Amgen Inc. | Drug delivery device with sterile fluid flowpath and related method of assembly |
| WO2018152073A1 (en) | 2017-02-17 | 2018-08-23 | Amgen Inc. | Insertion mechanism for drug delivery device |
| WO2018165143A1 (en) | 2017-03-06 | 2018-09-13 | Amgen Inc. | Drug delivery device with activation prevention feature |
| WO2018164829A1 (en) | 2017-03-07 | 2018-09-13 | Amgen Inc. | Needle insertion by overpressure |
| WO2018165499A1 (en) | 2017-03-09 | 2018-09-13 | Amgen Inc. | Insertion mechanism for drug delivery device |
| EP4512445A2 (en) | 2017-03-28 | 2025-02-26 | Amgen Inc. | Plunger rod and syringe assembly system |
| EP4241807A2 (en) | 2017-03-28 | 2023-09-13 | Amgen Inc. | Plunger rod and syringe assembly system and method |
| WO2018183039A1 (en) | 2017-03-28 | 2018-10-04 | Amgen Inc. | Plunger rod and syringe assembly system and method |
| WO2018226515A1 (en) | 2017-06-08 | 2018-12-13 | Amgen Inc. | Syringe assembly for a drug delivery device and method of assembly |
| WO2018226565A1 (en) | 2017-06-08 | 2018-12-13 | Amgen Inc. | Torque driven drug delivery device |
| WO2018236619A1 (en) | 2017-06-22 | 2018-12-27 | Amgen Inc. | REDUCING THE IMPACTS / IMPACTS OF ACTIVATION OF A DEVICE |
| WO2018237225A1 (en) | 2017-06-23 | 2018-12-27 | Amgen Inc. | ELECTRONIC DRUG DELIVERY DEVICE COMPRISING A CAP ACTIVATED BY A SWITCH ASSEMBLY |
| WO2019014014A1 (en) | 2017-07-14 | 2019-01-17 | Amgen Inc. | Needle insertion-retraction system having dual torsion spring system |
| WO2019018169A1 (en) | 2017-07-21 | 2019-01-24 | Amgen Inc. | Gas permeable sealing member for drug container and methods of assembly |
| EP4292576A2 (en) | 2017-07-21 | 2023-12-20 | Amgen Inc. | Gas permeable sealing member for drug container and methods of assembly |
| EP4085942A1 (en) | 2017-07-25 | 2022-11-09 | Amgen Inc. | Drug delivery device with gear module and related method of assembly |
| WO2019022951A1 (en) | 2017-07-25 | 2019-01-31 | Amgen Inc. | Drug delivery device with gear module and related method of assembly |
| WO2019022950A1 (en) | 2017-07-25 | 2019-01-31 | Amgen Inc. | Drug delivery device with container access system and related method of assembly |
| WO2019032482A2 (en) | 2017-08-09 | 2019-02-14 | Amgen Inc. | Hydraulic-pneumatic pressurized chamber drug delivery system |
| WO2019036181A1 (en) | 2017-08-18 | 2019-02-21 | Amgen Inc. | Wearable injector with sterile adhesive patch |
| WO2019040548A1 (en) | 2017-08-22 | 2019-02-28 | Amgen Inc. | Needle insertion mechanism for drug delivery device |
| WO2019070472A1 (en) | 2017-10-04 | 2019-04-11 | Amgen Inc. | Flow adapter for drug delivery device |
| WO2019070552A1 (en) | 2017-10-06 | 2019-04-11 | Amgen Inc. | Drug delivery device with interlock assembly and related method of assembly |
| EP4257164A2 (en) | 2017-10-06 | 2023-10-11 | Amgen Inc. | Drug delivery device with interlock assembly and related method of assembly |
| WO2019074579A1 (en) | 2017-10-09 | 2019-04-18 | Amgen Inc. | Drug delivery device with drive assembly and related method of assembly |
| WO2019090086A1 (en) | 2017-11-03 | 2019-05-09 | Amgen Inc. | Systems and approaches for sterilizing a drug delivery device |
| WO2019090079A1 (en) | 2017-11-03 | 2019-05-09 | Amgen Inc. | System and approaches for sterilizing a drug delivery device |
| WO2019090303A1 (en) | 2017-11-06 | 2019-05-09 | Amgen Inc. | Fill-finish assemblies and related methods |
| WO2019089178A1 (en) | 2017-11-06 | 2019-05-09 | Amgen Inc. | Drug delivery device with placement and flow sensing |
| WO2019094138A1 (en) | 2017-11-10 | 2019-05-16 | Amgen Inc. | Plungers for drug delivery devices |
| WO2019099324A1 (en) | 2017-11-16 | 2019-05-23 | Amgen Inc. | Door latch mechanism for drug delivery device |
| WO2019099322A1 (en) | 2017-11-16 | 2019-05-23 | Amgen Inc. | Autoinjector with stall and end point detection |
| WO2019231582A1 (en) | 2018-05-30 | 2019-12-05 | Amgen Inc. | Thermal spring release mechanism for a drug delivery device |
| WO2019231618A1 (en) | 2018-06-01 | 2019-12-05 | Amgen Inc. | Modular fluid path assemblies for drug delivery devices |
| WO2020023444A1 (en) | 2018-07-24 | 2020-01-30 | Amgen Inc. | Delivery devices for administering drugs |
| WO2020023451A1 (en) | 2018-07-24 | 2020-01-30 | Amgen Inc. | Delivery devices for administering drugs |
| WO2020023336A1 (en) | 2018-07-24 | 2020-01-30 | Amgen Inc. | Hybrid drug delivery devices with grip portion |
| WO2020023220A1 (en) | 2018-07-24 | 2020-01-30 | Amgen Inc. | Hybrid drug delivery devices with tacky skin attachment portion and related method of preparation |
| WO2020028009A1 (en) | 2018-07-31 | 2020-02-06 | Amgen Inc. | Fluid path assembly for a drug delivery device |
| WO2020068623A1 (en) | 2018-09-24 | 2020-04-02 | Amgen Inc. | Interventional dosing systems and methods |
| WO2020068476A1 (en) | 2018-09-28 | 2020-04-02 | Amgen Inc. | Muscle wire escapement activation assembly for a drug delivery device |
| WO2020072577A1 (en) | 2018-10-02 | 2020-04-09 | Amgen Inc. | Injection systems for drug delivery with internal force transmission |
| WO2020072846A1 (en) | 2018-10-05 | 2020-04-09 | Amgen Inc. | Drug delivery device having dose indicator |
| WO2020081479A1 (en) | 2018-10-15 | 2020-04-23 | Amgen Inc. | Drug delivery device having damping mechanism |
| WO2020081480A1 (en) | 2018-10-15 | 2020-04-23 | Amgen Inc. | Platform assembly process for drug delivery device |
| WO2020091981A1 (en) | 2018-11-01 | 2020-05-07 | Amgen Inc. | Drug delivery devices with partial drug delivery member retraction |
| WO2020092056A1 (en) | 2018-11-01 | 2020-05-07 | Amgen Inc. | Drug delivery devices with partial needle retraction |
| WO2020091956A1 (en) | 2018-11-01 | 2020-05-07 | Amgen Inc. | Drug delivery devices with partial drug delivery member retraction |
| WO2020219482A1 (en) | 2019-04-24 | 2020-10-29 | Amgen Inc. | Syringe sterilization verification assemblies and methods |
| WO2021041067A2 (en) | 2019-08-23 | 2021-03-04 | Amgen Inc. | Drug delivery device with configurable needle shield engagement components and related methods |
| WO2022246055A1 (en) | 2021-05-21 | 2022-11-24 | Amgen Inc. | Method of optimizing a filling recipe for a drug container |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2005061541A1 (en) | 2005-07-07 |
| AU2011201809A1 (en) | 2011-05-19 |
| US20050186203A1 (en) | 2005-08-25 |
| US8034904B2 (en) | 2011-10-11 |
| US20040265307A1 (en) | 2004-12-30 |
| US20100260678A1 (en) | 2010-10-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP1532174B1 (en) | Anti-igf-i receptor antibody | |
| US8034904B2 (en) | Anti-IGF-I receptor antibody | |
| US8933202B2 (en) | AXL antibodies | |
| AU2006236637B2 (en) | Methods and compositions for treating or preventing cancer | |
| AU2004303792A1 (en) | Anti-IGF-I receptor antibody | |
| HK1073470B (en) | Anti-igf-i receptor antibody | |
| US20150152193A1 (en) | Axl antibodies | |
| KR20050021001A (en) | Anti-igf-i receptor antibody |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STCB | Information on status: application discontinuation |
Free format text: EXPRESSLY ABANDONED -- DURING EXAMINATION |