US20050164222A1 - Optimization of immunomodulatory properties of genetic vaccines - Google Patents
Optimization of immunomodulatory properties of genetic vaccines Download PDFInfo
- Publication number
- US20050164222A1 US20050164222A1 US10/877,846 US87784604A US2005164222A1 US 20050164222 A1 US20050164222 A1 US 20050164222A1 US 87784604 A US87784604 A US 87784604A US 2005164222 A1 US2005164222 A1 US 2005164222A1
- Authority
- US
- United States
- Prior art keywords
- cells
- recombinant
- optimized
- polynucleotide
- immune response
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 230000002068 genetic effect Effects 0.000 title claims abstract description 114
- 229960005486 vaccine Drugs 0.000 title claims abstract description 108
- 230000002519 immonomodulatory effect Effects 0.000 title claims abstract description 30
- 238000005457 optimization Methods 0.000 title claims description 8
- 238000000034 method Methods 0.000 claims abstract description 264
- 230000028993 immune response Effects 0.000 claims abstract description 98
- 210000004027 cell Anatomy 0.000 claims description 194
- 108090000623 proteins and genes Proteins 0.000 claims description 166
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 157
- 102000040430 polynucleotide Human genes 0.000 claims description 150
- 108091033319 polynucleotide Proteins 0.000 claims description 150
- 239000002157 polynucleotide Substances 0.000 claims description 150
- 108090000695 Cytokines Proteins 0.000 claims description 141
- 102000004127 Cytokines Human genes 0.000 claims description 138
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 136
- 229920001184 polypeptide Polymers 0.000 claims description 108
- 239000013598 vector Substances 0.000 claims description 108
- 150000007523 nucleic acids Chemical class 0.000 claims description 99
- 230000000694 effects Effects 0.000 claims description 98
- 102000039446 nucleic acids Human genes 0.000 claims description 94
- 108020004707 nucleic acids Proteins 0.000 claims description 94
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 76
- 241000282414 Homo sapiens Species 0.000 claims description 73
- 102000003814 Interleukin-10 Human genes 0.000 claims description 73
- 108090000174 Interleukin-10 Proteins 0.000 claims description 73
- 238000012216 screening Methods 0.000 claims description 72
- 239000000427 antigen Substances 0.000 claims description 71
- 108091007433 antigens Proteins 0.000 claims description 71
- 102000036639 antigens Human genes 0.000 claims description 69
- 102000004169 proteins and genes Human genes 0.000 claims description 60
- 230000006798 recombination Effects 0.000 claims description 53
- 238000005215 recombination Methods 0.000 claims description 53
- 108010065805 Interleukin-12 Proteins 0.000 claims description 51
- 210000003719 b-lymphocyte Anatomy 0.000 claims description 48
- 102000005962 receptors Human genes 0.000 claims description 48
- 108020003175 receptors Proteins 0.000 claims description 48
- 102000004388 Interleukin-4 Human genes 0.000 claims description 46
- 108090000978 Interleukin-4 Proteins 0.000 claims description 45
- 239000005557 antagonist Substances 0.000 claims description 45
- 102000013462 Interleukin-12 Human genes 0.000 claims description 41
- 108010002616 Interleukin-5 Proteins 0.000 claims description 39
- 102000000743 Interleukin-5 Human genes 0.000 claims description 39
- 229940117681 interleukin-12 Drugs 0.000 claims description 39
- 108010074328 Interferon-gamma Proteins 0.000 claims description 38
- 150000001413 amino acids Chemical class 0.000 claims description 37
- 108010002350 Interleukin-2 Proteins 0.000 claims description 34
- 102000000588 Interleukin-2 Human genes 0.000 claims description 34
- 102100037850 Interferon gamma Human genes 0.000 claims description 33
- 230000001965 increasing effect Effects 0.000 claims description 33
- 230000004069 differentiation Effects 0.000 claims description 29
- 238000001727 in vivo Methods 0.000 claims description 29
- 230000001939 inductive effect Effects 0.000 claims description 29
- 230000024245 cell differentiation Effects 0.000 claims description 22
- 230000035755 proliferation Effects 0.000 claims description 22
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 claims description 21
- 108010047761 Interferon-alpha Proteins 0.000 claims description 21
- 108090000176 Interleukin-13 Proteins 0.000 claims description 21
- 102000003816 Interleukin-13 Human genes 0.000 claims description 21
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 claims description 21
- 230000003247 decreasing effect Effects 0.000 claims description 21
- 239000003446 ligand Substances 0.000 claims description 21
- 108010021064 CTLA-4 Antigen Proteins 0.000 claims description 20
- 229940045513 CTLA4 antagonist Drugs 0.000 claims description 20
- 102000006992 Interferon-alpha Human genes 0.000 claims description 20
- 102000004245 Proteasome Endopeptidase Complex Human genes 0.000 claims description 19
- 108090000708 Proteasome Endopeptidase Complex Proteins 0.000 claims description 19
- 239000002773 nucleotide Substances 0.000 claims description 19
- 125000003729 nucleotide group Chemical group 0.000 claims description 19
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 claims description 18
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 claims description 18
- 239000000556 agonist Substances 0.000 claims description 18
- 230000005847 immunogenicity Effects 0.000 claims description 18
- 108020004705 Codon Proteins 0.000 claims description 17
- 102000004889 Interleukin-6 Human genes 0.000 claims description 17
- 230000002950 deficient Effects 0.000 claims description 17
- 230000000897 modulatory effect Effects 0.000 claims description 17
- 238000002703 mutagenesis Methods 0.000 claims description 17
- 231100000350 mutagenesis Toxicity 0.000 claims description 17
- 108090001005 Interleukin-6 Proteins 0.000 claims description 16
- 108060008682 Tumor Necrosis Factor Proteins 0.000 claims description 16
- 206010020751 Hypersensitivity Diseases 0.000 claims description 15
- OHDXDNUPVVYWOV-UHFFFAOYSA-N n-methyl-1-(2-naphthalen-1-ylsulfanylphenyl)methanamine Chemical compound CNCC1=CC=CC=C1SC1=CC=CC2=CC=CC=C12 OHDXDNUPVVYWOV-UHFFFAOYSA-N 0.000 claims description 15
- 230000035772 mutation Effects 0.000 claims description 14
- 102000004890 Interleukin-8 Human genes 0.000 claims description 13
- 108090001007 Interleukin-8 Proteins 0.000 claims description 13
- 238000012360 testing method Methods 0.000 claims description 12
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 claims description 11
- 108090000172 Interleukin-15 Proteins 0.000 claims description 11
- 102000003812 Interleukin-15 Human genes 0.000 claims description 11
- 230000006052 T cell proliferation Effects 0.000 claims description 11
- 230000001413 cellular effect Effects 0.000 claims description 11
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 claims description 11
- 108040006870 interleukin-10 receptor activity proteins Proteins 0.000 claims description 10
- 108090000237 interleukin-24 Proteins 0.000 claims description 10
- 210000004962 mammalian cell Anatomy 0.000 claims description 10
- 108091026890 Coding region Proteins 0.000 claims description 9
- 102000004551 Interleukin-10 Receptors Human genes 0.000 claims description 9
- 102100029215 Signaling lymphocytic activation molecule Human genes 0.000 claims description 9
- 241000700605 Viruses Species 0.000 claims description 9
- 230000002163 immunogen Effects 0.000 claims description 9
- 108090000681 interleukin 20 Proteins 0.000 claims description 9
- 102000004114 interleukin 20 Human genes 0.000 claims description 9
- 102000003898 interleukin-24 Human genes 0.000 claims description 9
- 239000003550 marker Substances 0.000 claims description 9
- 108010057085 cytokine receptors Proteins 0.000 claims description 8
- 108040006852 interleukin-4 receptor activity proteins Proteins 0.000 claims description 8
- 230000002829 reductive effect Effects 0.000 claims description 8
- 101150013553 CD40 gene Proteins 0.000 claims description 7
- 108010017550 Interleukin-10 Receptors Proteins 0.000 claims description 7
- 241001465754 Metazoa Species 0.000 claims description 7
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 claims description 7
- 239000000430 cytokine receptor antagonist Substances 0.000 claims description 7
- 102000003675 cytokine receptors Human genes 0.000 claims description 7
- 230000004927 fusion Effects 0.000 claims description 7
- 239000001963 growth medium Substances 0.000 claims description 7
- 230000002401 inhibitory effect Effects 0.000 claims description 7
- 101000633780 Homo sapiens Signaling lymphocytic activation molecule Proteins 0.000 claims description 5
- -1 IL-14 Proteins 0.000 claims description 5
- 102000008070 Interferon-gamma Human genes 0.000 claims description 5
- 229960003130 interferon gamma Drugs 0.000 claims description 5
- 230000008569 process Effects 0.000 claims description 5
- 241001515965 unidentified phage Species 0.000 claims description 5
- 102100025074 C-C chemokine receptor-like 2 Human genes 0.000 claims description 4
- 101000716068 Homo sapiens C-C chemokine receptor type 6 Proteins 0.000 claims description 4
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 4
- 238000012217 deletion Methods 0.000 claims description 4
- 230000037430 deletion Effects 0.000 claims description 4
- 239000003623 enhancer Substances 0.000 claims description 4
- 239000012634 fragment Substances 0.000 claims description 4
- 208000002672 hepatitis B Diseases 0.000 claims description 4
- 102100032937 CD40 ligand Human genes 0.000 claims description 3
- 108010002352 Interleukin-1 Proteins 0.000 claims description 3
- 102000000589 Interleukin-1 Human genes 0.000 claims description 3
- 108090000177 Interleukin-11 Proteins 0.000 claims description 3
- 102000003815 Interleukin-11 Human genes 0.000 claims description 3
- 108010002386 Interleukin-3 Proteins 0.000 claims description 3
- 102000000646 Interleukin-3 Human genes 0.000 claims description 3
- 108010002335 Interleukin-9 Proteins 0.000 claims description 3
- 102000000585 Interleukin-9 Human genes 0.000 claims description 3
- 230000010076 replication Effects 0.000 claims description 3
- 102000014452 scavenger receptors Human genes 0.000 claims description 3
- 101000868215 Homo sapiens CD40 ligand Proteins 0.000 claims description 2
- 101800003050 Interleukin-16 Proteins 0.000 claims description 2
- 102000049772 Interleukin-16 Human genes 0.000 claims description 2
- 108050003558 Interleukin-17 Proteins 0.000 claims description 2
- 102000013691 Interleukin-17 Human genes 0.000 claims description 2
- 102000003810 Interleukin-18 Human genes 0.000 claims description 2
- 108090000171 Interleukin-18 Proteins 0.000 claims description 2
- 108010002586 Interleukin-7 Proteins 0.000 claims description 2
- 102000000704 Interleukin-7 Human genes 0.000 claims description 2
- 230000029662 T-helper 1 type immune response Effects 0.000 claims description 2
- 108091005485 macrophage scavenger receptors Proteins 0.000 claims description 2
- 230000029069 type 2 immune response Effects 0.000 claims description 2
- 102000009410 Chemokine receptor Human genes 0.000 claims 2
- 108050000299 Chemokine receptor Proteins 0.000 claims 2
- 230000036961 partial effect Effects 0.000 claims 2
- 102000008203 CTLA-4 Antigen Human genes 0.000 claims 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 claims 1
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 claims 1
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 claims 1
- 108090000467 Interferon-beta Proteins 0.000 claims 1
- 102000003996 Interferon-beta Human genes 0.000 claims 1
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 claims 1
- 108091023040 Transcription factor Proteins 0.000 claims 1
- 102000040945 Transcription factor Human genes 0.000 claims 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 claims 1
- 208000030961 allergic reaction Diseases 0.000 claims 1
- 230000015556 catabolic process Effects 0.000 claims 1
- 238000006731 degradation reaction Methods 0.000 claims 1
- 230000008030 elimination Effects 0.000 claims 1
- 238000003379 elimination reaction Methods 0.000 claims 1
- 229960001388 interferon-beta Drugs 0.000 claims 1
- 230000008488 polyadenylation Effects 0.000 claims 1
- 230000001976 improved effect Effects 0.000 description 78
- 229940076144 interleukin-10 Drugs 0.000 description 69
- 108020004414 DNA Proteins 0.000 description 64
- 235000018102 proteins Nutrition 0.000 description 55
- 230000014509 gene expression Effects 0.000 description 40
- 238000011282 treatment Methods 0.000 description 39
- 238000003786 synthesis reaction Methods 0.000 description 38
- 108010005939 Ciliary Neurotrophic Factor Proteins 0.000 description 37
- 230000015572 biosynthetic process Effects 0.000 description 37
- 235000001014 amino acid Nutrition 0.000 description 36
- 229940024606 amino acid Drugs 0.000 description 35
- 102100031614 Ciliary neurotrophic factor Human genes 0.000 description 33
- 241000699670 Mus sp. Species 0.000 description 31
- 238000009739 binding Methods 0.000 description 30
- 230000027455 binding Effects 0.000 description 29
- 230000004913 activation Effects 0.000 description 25
- 230000006870 function Effects 0.000 description 25
- 238000000338 in vitro Methods 0.000 description 25
- 239000000203 mixture Substances 0.000 description 25
- 230000003389 potentiating effect Effects 0.000 description 23
- 230000004044 response Effects 0.000 description 23
- 230000000890 antigenic effect Effects 0.000 description 22
- 238000004519 manufacturing process Methods 0.000 description 22
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 21
- 208000015181 infectious disease Diseases 0.000 description 21
- 239000000758 substrate Substances 0.000 description 21
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 19
- 201000010099 disease Diseases 0.000 description 19
- 102000019034 Chemokines Human genes 0.000 description 18
- 108010012236 Chemokines Proteins 0.000 description 18
- 210000001616 monocyte Anatomy 0.000 description 18
- 241000894007 species Species 0.000 description 18
- 239000013612 plasmid Substances 0.000 description 17
- 238000002255 vaccination Methods 0.000 description 17
- 108091028043 Nucleic acid sequence Proteins 0.000 description 16
- 230000006044 T cell activation Effects 0.000 description 16
- 208000035473 Communicable disease Diseases 0.000 description 15
- 108091054437 MHC class I family Proteins 0.000 description 15
- 241000124008 Mammalia Species 0.000 description 15
- 206010028980 Neoplasm Diseases 0.000 description 15
- 230000007815 allergy Effects 0.000 description 14
- 238000009396 hybridization Methods 0.000 description 14
- 239000002955 immunomodulating agent Substances 0.000 description 14
- 229940121354 immunomodulator Drugs 0.000 description 14
- 108010045634 B7 Antigens Proteins 0.000 description 13
- 102000005738 B7 Antigens Human genes 0.000 description 13
- 206010011968 Decreased immune responsiveness Diseases 0.000 description 13
- 102100040247 Tumor necrosis factor Human genes 0.000 description 13
- 239000002253 acid Substances 0.000 description 13
- 150000007513 acids Chemical class 0.000 description 13
- 208000026935 allergic disease Diseases 0.000 description 13
- 210000004443 dendritic cell Anatomy 0.000 description 13
- 238000001415 gene therapy Methods 0.000 description 13
- 210000000987 immune system Anatomy 0.000 description 13
- 230000006698 induction Effects 0.000 description 13
- 125000003275 alpha amino acid group Chemical group 0.000 description 12
- 230000036039 immunity Effects 0.000 description 12
- 210000002540 macrophage Anatomy 0.000 description 12
- 230000032258 transport Effects 0.000 description 12
- 208000023275 Autoimmune disease Diseases 0.000 description 11
- 210000000612 antigen-presenting cell Anatomy 0.000 description 11
- 238000003556 assay Methods 0.000 description 11
- 239000003153 chemical reaction reagent Substances 0.000 description 11
- 230000001225 therapeutic effect Effects 0.000 description 11
- 230000003612 virological effect Effects 0.000 description 11
- 108091034117 Oligonucleotide Proteins 0.000 description 10
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 10
- 239000002671 adjuvant Substances 0.000 description 10
- 238000006243 chemical reaction Methods 0.000 description 10
- 239000002299 complementary DNA Substances 0.000 description 10
- 230000016396 cytokine production Effects 0.000 description 10
- 238000009472 formulation Methods 0.000 description 10
- 230000003308 immunostimulating effect Effects 0.000 description 10
- 230000001404 mediated effect Effects 0.000 description 10
- 239000000047 product Substances 0.000 description 10
- 239000000523 sample Substances 0.000 description 10
- 108010041986 DNA Vaccines Proteins 0.000 description 9
- 229940021995 DNA vaccine Drugs 0.000 description 9
- 102000008949 Histocompatibility Antigens Class I Human genes 0.000 description 9
- 101000980827 Homo sapiens T-cell surface glycoprotein CD1a Proteins 0.000 description 9
- 101000716149 Homo sapiens T-cell surface glycoprotein CD1b Proteins 0.000 description 9
- 101000716124 Homo sapiens T-cell surface glycoprotein CD1c Proteins 0.000 description 9
- 102000016267 Leptin Human genes 0.000 description 9
- 108010092277 Leptin Proteins 0.000 description 9
- 241000699666 Mus <mouse, genus> Species 0.000 description 9
- 208000008589 Obesity Diseases 0.000 description 9
- 102100024219 T-cell surface glycoprotein CD1a Human genes 0.000 description 9
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 9
- 238000013459 approach Methods 0.000 description 9
- 230000001580 bacterial effect Effects 0.000 description 9
- 230000009286 beneficial effect Effects 0.000 description 9
- 230000004071 biological effect Effects 0.000 description 9
- 230000000139 costimulatory effect Effects 0.000 description 9
- 238000000684 flow cytometry Methods 0.000 description 9
- NRYBAZVQPHGZNS-ZSOCWYAHSA-N leptin Chemical compound O=C([C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC(C)C)CCSC)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CS)C(O)=O NRYBAZVQPHGZNS-ZSOCWYAHSA-N 0.000 description 9
- 229940039781 leptin Drugs 0.000 description 9
- 235000020824 obesity Nutrition 0.000 description 9
- 244000052769 pathogen Species 0.000 description 9
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 8
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 8
- 230000000172 allergic effect Effects 0.000 description 8
- 230000030741 antigen processing and presentation Effects 0.000 description 8
- 201000011510 cancer Diseases 0.000 description 8
- 230000002708 enhancing effect Effects 0.000 description 8
- 238000006467 substitution reaction Methods 0.000 description 8
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 8
- 238000001890 transfection Methods 0.000 description 8
- 102100030346 Antigen peptide transporter 1 Human genes 0.000 description 7
- 238000002965 ELISA Methods 0.000 description 7
- 108010023335 Member 2 Subfamily B ATP Binding Cassette Transporter Proteins 0.000 description 7
- 230000008901 benefit Effects 0.000 description 7
- 230000001419 dependent effect Effects 0.000 description 7
- 238000011161 development Methods 0.000 description 7
- 230000018109 developmental process Effects 0.000 description 7
- 230000006872 improvement Effects 0.000 description 7
- 230000031261 interleukin-10 production Effects 0.000 description 7
- 231100000518 lethal Toxicity 0.000 description 7
- 230000001665 lethal effect Effects 0.000 description 7
- 210000004698 lymphocyte Anatomy 0.000 description 7
- 230000003211 malignant effect Effects 0.000 description 7
- 230000007246 mechanism Effects 0.000 description 7
- 230000004048 modification Effects 0.000 description 7
- 238000012986 modification Methods 0.000 description 7
- 230000001717 pathogenic effect Effects 0.000 description 7
- 230000001105 regulatory effect Effects 0.000 description 7
- 102100030343 Antigen peptide transporter 2 Human genes 0.000 description 6
- 102000043129 MHC class I family Human genes 0.000 description 6
- 241001529936 Murinae Species 0.000 description 6
- 101800000849 Tachykinin-associated peptide 2 Proteins 0.000 description 6
- 230000001270 agonistic effect Effects 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- 230000003042 antagnostic effect Effects 0.000 description 6
- 208000010668 atopic eczema Diseases 0.000 description 6
- 239000003795 chemical substances by application Substances 0.000 description 6
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 6
- 230000005764 inhibitory process Effects 0.000 description 6
- 238000001990 intravenous administration Methods 0.000 description 6
- 239000012528 membrane Substances 0.000 description 6
- 210000000440 neutrophil Anatomy 0.000 description 6
- 238000012545 processing Methods 0.000 description 6
- 210000004881 tumor cell Anatomy 0.000 description 6
- 108020004635 Complementary DNA Proteins 0.000 description 5
- 108010038486 Interleukin-4 Receptors Proteins 0.000 description 5
- 108091054438 MHC class II family Proteins 0.000 description 5
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 5
- 239000004480 active ingredient Substances 0.000 description 5
- 208000022531 anorexia Diseases 0.000 description 5
- 230000001363 autoimmune Effects 0.000 description 5
- 230000000903 blocking effect Effects 0.000 description 5
- 230000003915 cell function Effects 0.000 description 5
- 230000001186 cumulative effect Effects 0.000 description 5
- 230000001086 cytosolic effect Effects 0.000 description 5
- 206010061428 decreased appetite Diseases 0.000 description 5
- 238000002825 functional assay Methods 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 238000002823 phage display Methods 0.000 description 5
- 239000008194 pharmaceutical composition Substances 0.000 description 5
- 230000000069 prophylactic effect Effects 0.000 description 5
- 230000001681 protective effect Effects 0.000 description 5
- 235000002639 sodium chloride Nutrition 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- 238000010186 staining Methods 0.000 description 5
- 239000006228 supernatant Substances 0.000 description 5
- 230000004083 survival effect Effects 0.000 description 5
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 4
- 206010006895 Cachexia Diseases 0.000 description 4
- 101710163595 Chaperone protein DnaK Proteins 0.000 description 4
- 238000011238 DNA vaccination Methods 0.000 description 4
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 4
- 108010010803 Gelatin Proteins 0.000 description 4
- 101710178376 Heat shock 70 kDa protein Proteins 0.000 description 4
- 101710152018 Heat shock cognate 70 kDa protein Proteins 0.000 description 4
- 241000282412 Homo Species 0.000 description 4
- 101001033233 Homo sapiens Interleukin-10 Proteins 0.000 description 4
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 4
- 102000014150 Interferons Human genes 0.000 description 4
- 108010050904 Interferons Proteins 0.000 description 4
- 102000010787 Interleukin-4 Receptors Human genes 0.000 description 4
- 102000043131 MHC class II family Human genes 0.000 description 4
- 108091005461 Nucleic proteins Proteins 0.000 description 4
- 241000288906 Primates Species 0.000 description 4
- 241000700584 Simplexvirus Species 0.000 description 4
- 108010009583 Transforming Growth Factors Proteins 0.000 description 4
- 102000009618 Transforming Growth Factors Human genes 0.000 description 4
- 206010002026 amyotrophic lateral sclerosis Diseases 0.000 description 4
- 238000010171 animal model Methods 0.000 description 4
- 230000033228 biological regulation Effects 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 210000001185 bone marrow Anatomy 0.000 description 4
- 210000004899 c-terminal region Anatomy 0.000 description 4
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 4
- 230000000295 complement effect Effects 0.000 description 4
- 150000001875 compounds Chemical class 0.000 description 4
- 235000018417 cysteine Nutrition 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 239000003814 drug Substances 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 108020001507 fusion proteins Proteins 0.000 description 4
- 102000037865 fusion proteins Human genes 0.000 description 4
- 239000008273 gelatin Substances 0.000 description 4
- 229920000159 gelatin Polymers 0.000 description 4
- 235000019322 gelatine Nutrition 0.000 description 4
- 235000011852 gelatine desserts Nutrition 0.000 description 4
- 238000011239 genetic vaccination Methods 0.000 description 4
- 230000012010 growth Effects 0.000 description 4
- 230000003053 immunization Effects 0.000 description 4
- 238000002649 immunization Methods 0.000 description 4
- 238000003018 immunoassay Methods 0.000 description 4
- 230000016784 immunoglobulin production Effects 0.000 description 4
- 230000002584 immunomodulator Effects 0.000 description 4
- 238000007912 intraperitoneal administration Methods 0.000 description 4
- 210000000265 leukocyte Anatomy 0.000 description 4
- 239000002502 liposome Substances 0.000 description 4
- 108020004999 messenger RNA Proteins 0.000 description 4
- 210000005259 peripheral blood Anatomy 0.000 description 4
- 239000011886 peripheral blood Substances 0.000 description 4
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 4
- 239000012071 phase Substances 0.000 description 4
- 230000028327 secretion Effects 0.000 description 4
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 4
- 210000001519 tissue Anatomy 0.000 description 4
- 230000001988 toxicity Effects 0.000 description 4
- 231100000419 toxicity Toxicity 0.000 description 4
- 208000030507 AIDS Diseases 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 3
- 238000011725 BALB/c mouse Methods 0.000 description 3
- 108010000063 Ciliary Neurotrophic Factor Receptor Proteins 0.000 description 3
- 102000016989 Ciliary Neurotrophic Factor Receptor Human genes 0.000 description 3
- 102100031615 Ciliary neurotrophic factor receptor subunit alpha Human genes 0.000 description 3
- 206010014950 Eosinophilia Diseases 0.000 description 3
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 3
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 3
- 102000002812 Heat-Shock Proteins Human genes 0.000 description 3
- 108010004889 Heat-Shock Proteins Proteins 0.000 description 3
- 101000993348 Homo sapiens Ciliary neurotrophic factor receptor subunit alpha Proteins 0.000 description 3
- 101001136986 Homo sapiens Proteasome subunit beta type-8 Proteins 0.000 description 3
- 101001136981 Homo sapiens Proteasome subunit beta type-9 Proteins 0.000 description 3
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 3
- 241000222732 Leishmania major Species 0.000 description 3
- 240000007472 Leucaena leucocephala Species 0.000 description 3
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 3
- 241000282560 Macaca mulatta Species 0.000 description 3
- 241000283973 Oryctolagus cuniculus Species 0.000 description 3
- 102100035760 Proteasome subunit beta type-8 Human genes 0.000 description 3
- 102100035764 Proteasome subunit beta type-9 Human genes 0.000 description 3
- 229930006000 Sucrose Natural products 0.000 description 3
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 3
- 230000017274 T cell anergy Effects 0.000 description 3
- 230000003213 activating effect Effects 0.000 description 3
- 238000007792 addition Methods 0.000 description 3
- 230000002411 adverse Effects 0.000 description 3
- 239000000443 aerosol Substances 0.000 description 3
- 239000013566 allergen Substances 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- 208000006673 asthma Diseases 0.000 description 3
- 210000004556 brain Anatomy 0.000 description 3
- 230000010261 cell growth Effects 0.000 description 3
- 230000003399 chemotactic effect Effects 0.000 description 3
- 230000009260 cross reactivity Effects 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 125000000151 cysteine group Chemical class N[C@@H](CS)C(=O)* 0.000 description 3
- 238000010586 diagram Methods 0.000 description 3
- 239000005090 green fluorescent protein Substances 0.000 description 3
- 239000003102 growth factor Substances 0.000 description 3
- 230000036737 immune function Effects 0.000 description 3
- 238000010348 incorporation Methods 0.000 description 3
- 230000002757 inflammatory effect Effects 0.000 description 3
- 108010085650 interferon gamma receptor Proteins 0.000 description 3
- 229940047124 interferons Drugs 0.000 description 3
- 230000004073 interleukin-2 production Effects 0.000 description 3
- 230000003834 intracellular effect Effects 0.000 description 3
- 238000007918 intramuscular administration Methods 0.000 description 3
- 230000003902 lesion Effects 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 230000036210 malignancy Effects 0.000 description 3
- 230000035800 maturation Effects 0.000 description 3
- 229930182817 methionine Natural products 0.000 description 3
- 238000010172 mouse model Methods 0.000 description 3
- 201000006417 multiple sclerosis Diseases 0.000 description 3
- 210000000822 natural killer cell Anatomy 0.000 description 3
- 238000004806 packaging method and process Methods 0.000 description 3
- 230000008506 pathogenesis Effects 0.000 description 3
- 230000037361 pathway Effects 0.000 description 3
- 230000001737 promoting effect Effects 0.000 description 3
- 238000011321 prophylaxis Methods 0.000 description 3
- 230000002797 proteolythic effect Effects 0.000 description 3
- 238000007423 screening assay Methods 0.000 description 3
- 230000003248 secreting effect Effects 0.000 description 3
- 238000002741 site-directed mutagenesis Methods 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 230000002269 spontaneous effect Effects 0.000 description 3
- 239000005720 sucrose Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 239000003826 tablet Substances 0.000 description 3
- 230000008685 targeting Effects 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- 102000003390 tumor necrosis factor Human genes 0.000 description 3
- 238000011179 visual inspection Methods 0.000 description 3
- 102000011767 Acute-Phase Proteins Human genes 0.000 description 2
- 108010062271 Acute-Phase Proteins Proteins 0.000 description 2
- 108700028369 Alleles Proteins 0.000 description 2
- 241000416162 Astragalus gummifer Species 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 208000003950 B-cell lymphoma Diseases 0.000 description 2
- 230000003844 B-cell-activation Effects 0.000 description 2
- 235000014469 Bacillus subtilis Nutrition 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 208000035143 Bacterial infection Diseases 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- 108050005711 C Chemokine Proteins 0.000 description 2
- 102000017483 C chemokine Human genes 0.000 description 2
- 102100021943 C-C motif chemokine 2 Human genes 0.000 description 2
- 101710155857 C-C motif chemokine 2 Proteins 0.000 description 2
- 102000001902 CC Chemokines Human genes 0.000 description 2
- 108010040471 CC Chemokines Proteins 0.000 description 2
- 108050006947 CXC Chemokine Proteins 0.000 description 2
- 102000019388 CXC chemokine Human genes 0.000 description 2
- 101710132601 Capsid protein Proteins 0.000 description 2
- 101710094648 Coat protein Proteins 0.000 description 2
- 108010061629 Dermatophagoides pteronyssinus antigen p 1 Proteins 0.000 description 2
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 108091029865 Exogenous DNA Proteins 0.000 description 2
- 241000724791 Filamentous phage Species 0.000 description 2
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 102100021181 Golgi phosphoprotein 3 Human genes 0.000 description 2
- 102000006354 HLA-DR Antigens Human genes 0.000 description 2
- 108010058597 HLA-DR Antigens Proteins 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- NTYJJOPFIAHURM-UHFFFAOYSA-N Histamine Chemical compound NCCC1=CN=CN1 NTYJJOPFIAHURM-UHFFFAOYSA-N 0.000 description 2
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 2
- 206010061598 Immunodeficiency Diseases 0.000 description 2
- 208000029462 Immunodeficiency disease Diseases 0.000 description 2
- 102000010789 Interleukin-2 Receptors Human genes 0.000 description 2
- 108010038453 Interleukin-2 Receptors Proteins 0.000 description 2
- 102000015696 Interleukins Human genes 0.000 description 2
- 108010063738 Interleukins Proteins 0.000 description 2
- 206010024229 Leprosy Diseases 0.000 description 2
- 108090000581 Leukemia inhibitory factor Proteins 0.000 description 2
- 102100032352 Leukemia inhibitory factor Human genes 0.000 description 2
- 102100021747 Leukemia inhibitory factor receptor Human genes 0.000 description 2
- 101710125418 Major capsid protein Proteins 0.000 description 2
- 102000018697 Membrane Proteins Human genes 0.000 description 2
- 108010052285 Membrane Proteins Proteins 0.000 description 2
- 101001044384 Mus musculus Interferon gamma Proteins 0.000 description 2
- 101001033265 Mus musculus Interleukin-10 Proteins 0.000 description 2
- 108010025020 Nerve Growth Factor Proteins 0.000 description 2
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 2
- 101710141454 Nucleoprotein Proteins 0.000 description 2
- 108700026244 Open Reading Frames Proteins 0.000 description 2
- 208000030852 Parasitic disease Diseases 0.000 description 2
- 208000037581 Persistent Infection Diseases 0.000 description 2
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 2
- 101710083689 Probable capsid protein Proteins 0.000 description 2
- ATUOYWHBWRKTHZ-UHFFFAOYSA-N Propane Chemical compound CCC ATUOYWHBWRKTHZ-UHFFFAOYSA-N 0.000 description 2
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 2
- 102000005886 STAT4 Transcription Factor Human genes 0.000 description 2
- 108010019992 STAT4 Transcription Factor Proteins 0.000 description 2
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 2
- 206010040047 Sepsis Diseases 0.000 description 2
- 206010040070 Septic Shock Diseases 0.000 description 2
- 108700005078 Synthetic Genes Proteins 0.000 description 2
- 108091008874 T cell receptors Proteins 0.000 description 2
- 230000005867 T cell response Effects 0.000 description 2
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 2
- 229920001615 Tragacanth Polymers 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- 241000700618 Vaccinia virus Species 0.000 description 2
- 208000036142 Viral infection Diseases 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 125000000539 amino acid group Chemical group 0.000 description 2
- 230000005875 antibody response Effects 0.000 description 2
- 230000003190 augmentative effect Effects 0.000 description 2
- 230000005784 autoimmunity Effects 0.000 description 2
- 208000022362 bacterial infectious disease Diseases 0.000 description 2
- 210000003651 basophil Anatomy 0.000 description 2
- 238000004166 bioassay Methods 0.000 description 2
- 230000008827 biological function Effects 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 238000009395 breeding Methods 0.000 description 2
- 230000001488 breeding effect Effects 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 239000006172 buffering agent Substances 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 230000004663 cell proliferation Effects 0.000 description 2
- 239000002975 chemoattractant Substances 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 239000012228 culture supernatant Substances 0.000 description 2
- 230000001461 cytolytic effect Effects 0.000 description 2
- 231100000433 cytotoxic Toxicity 0.000 description 2
- 230000001472 cytotoxic effect Effects 0.000 description 2
- 230000007547 defect Effects 0.000 description 2
- 230000006735 deficit Effects 0.000 description 2
- 206010012601 diabetes mellitus Diseases 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 208000035475 disorder Diseases 0.000 description 2
- 238000009510 drug design Methods 0.000 description 2
- 239000000428 dust Substances 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 210000002889 endothelial cell Anatomy 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 210000003979 eosinophil Anatomy 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 239000000796 flavoring agent Substances 0.000 description 2
- 230000005714 functional activity Effects 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 239000008187 granular material Substances 0.000 description 2
- 210000003714 granulocyte Anatomy 0.000 description 2
- 230000003394 haemopoietic effect Effects 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 102000052620 human IL10 Human genes 0.000 description 2
- 229930195733 hydrocarbon Natural products 0.000 description 2
- 150000002430 hydrocarbons Chemical class 0.000 description 2
- 230000007813 immunodeficiency Effects 0.000 description 2
- 230000001506 immunosuppresive effect Effects 0.000 description 2
- 230000028709 inflammatory response Effects 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 108040006859 interleukin-5 receptor activity proteins Proteins 0.000 description 2
- 229940047122 interleukins Drugs 0.000 description 2
- 230000009545 invasion Effects 0.000 description 2
- 238000011813 knockout mouse model Methods 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- 239000011159 matrix material Substances 0.000 description 2
- 208000037941 meningococcal disease Diseases 0.000 description 2
- 239000003471 mutagenic agent Substances 0.000 description 2
- 210000002569 neuron Anatomy 0.000 description 2
- 230000003472 neutralizing effect Effects 0.000 description 2
- 239000002853 nucleic acid probe Substances 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 239000012188 paraffin wax Substances 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 230000000770 proinflammatory effect Effects 0.000 description 2
- 230000009257 reactivity Effects 0.000 description 2
- 238000003259 recombinant expression Methods 0.000 description 2
- 238000011084 recovery Methods 0.000 description 2
- 210000003289 regulatory T cell Anatomy 0.000 description 2
- 230000001177 retroviral effect Effects 0.000 description 2
- 238000003757 reverse transcription PCR Methods 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 206010039073 rheumatoid arthritis Diseases 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 238000010187 selection method Methods 0.000 description 2
- 208000013223 septicemia Diseases 0.000 description 2
- 230000011664 signaling Effects 0.000 description 2
- 229910001415 sodium ion Inorganic materials 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- 230000004936 stimulating effect Effects 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 239000002511 suppository base Substances 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- 239000000196 tragacanth Substances 0.000 description 2
- 235000010487 tragacanth Nutrition 0.000 description 2
- 229940116362 tragacanth Drugs 0.000 description 2
- 230000005030 transcription termination Effects 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- 230000014616 translation Effects 0.000 description 2
- 150000003626 triacylglycerols Chemical class 0.000 description 2
- 239000013603 viral vector Substances 0.000 description 2
- AWNBSWDIOCXWJW-WTOYTKOKSA-N (2r)-n-[(2s)-1-[[(2s)-1-(2-aminoethylamino)-1-oxopropan-2-yl]amino]-3-naphthalen-2-yl-1-oxopropan-2-yl]-n'-hydroxy-2-(2-methylpropyl)butanediamide Chemical compound C1=CC=CC2=CC(C[C@H](NC(=O)[C@@H](CC(=O)NO)CC(C)C)C(=O)N[C@@H](C)C(=O)NCCN)=CC=C21 AWNBSWDIOCXWJW-WTOYTKOKSA-N 0.000 description 1
- VGONTNSXDCQUGY-RRKCRQDMSA-N 2'-deoxyinosine Chemical group C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC2=O)=C2N=C1 VGONTNSXDCQUGY-RRKCRQDMSA-N 0.000 description 1
- CYDQOEWLBCCFJZ-UHFFFAOYSA-N 4-(4-fluorophenyl)oxane-4-carboxylic acid Chemical compound C=1C=C(F)C=CC=1C1(C(=O)O)CCOCC1 CYDQOEWLBCCFJZ-UHFFFAOYSA-N 0.000 description 1
- 239000013607 AAV vector Substances 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 206010002556 Ankylosing Spondylitis Diseases 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- 206010003267 Arthritis reactive Diseases 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 206010003645 Atopy Diseases 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- 108020000946 Bacterial DNA Proteins 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- 102100023702 C-C motif chemokine 13 Human genes 0.000 description 1
- 101710112613 C-C motif chemokine 13 Proteins 0.000 description 1
- 102100032367 C-C motif chemokine 5 Human genes 0.000 description 1
- 102100032366 C-C motif chemokine 7 Human genes 0.000 description 1
- 101710155834 C-C motif chemokine 7 Proteins 0.000 description 1
- 102100034871 C-C motif chemokine 8 Human genes 0.000 description 1
- 101710155833 C-C motif chemokine 8 Proteins 0.000 description 1
- 108010017079 CCR6 Receptors Proteins 0.000 description 1
- 102000004288 CCR6 Receptors Human genes 0.000 description 1
- 102100027207 CD27 antigen Human genes 0.000 description 1
- 108010029697 CD40 Ligand Proteins 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 241001137864 Camelpox virus Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- CXRFDZFCGOPDTD-UHFFFAOYSA-M Cetrimide Chemical compound [Br-].CCCCCCCCCCCCCC[N+](C)(C)C CXRFDZFCGOPDTD-UHFFFAOYSA-M 0.000 description 1
- 108010055166 Chemokine CCL5 Proteins 0.000 description 1
- 101100007328 Cocos nucifera COS-1 gene Proteins 0.000 description 1
- 201000003874 Common Variable Immunodeficiency Diseases 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 102100031673 Corneodesmosin Human genes 0.000 description 1
- 101710139375 Corneodesmosin Proteins 0.000 description 1
- 241000557626 Corvus corax Species 0.000 description 1
- 206010011224 Cough Diseases 0.000 description 1
- 241000700626 Cowpox virus Species 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 229920002785 Croscarmellose sodium Polymers 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 230000004568 DNA-binding Effects 0.000 description 1
- 208000032131 Diabetic Neuropathies Diseases 0.000 description 1
- 206010012735 Diarrhoea Diseases 0.000 description 1
- 241000605721 Dichelobacter nodosus Species 0.000 description 1
- 239000004338 Dichlorodifluoromethane Substances 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 206010014824 Endotoxic shock Diseases 0.000 description 1
- 241000702374 Enterobacteria phage fd Species 0.000 description 1
- 101800001467 Envelope glycoprotein E2 Proteins 0.000 description 1
- 241001524679 Escherichia virus M13 Species 0.000 description 1
- 206010053172 Fatal outcomes Diseases 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 101710169915 General vesicular transport factor p115 Proteins 0.000 description 1
- 206010018364 Glomerulonephritis Diseases 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 241000282575 Gorilla Species 0.000 description 1
- 208000009329 Graft vs Host Disease Diseases 0.000 description 1
- 206010053759 Growth retardation Diseases 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 102000018713 Histocompatibility Antigens Class II Human genes 0.000 description 1
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 1
- 101000767151 Homo sapiens General vesicular transport factor p115 Proteins 0.000 description 1
- 101000746367 Homo sapiens Granulocyte colony-stimulating factor Proteins 0.000 description 1
- 101000599940 Homo sapiens Interferon gamma Proteins 0.000 description 1
- 101001002709 Homo sapiens Interleukin-4 Proteins 0.000 description 1
- 101001042362 Homo sapiens Leukemia inhibitory factor receptor Proteins 0.000 description 1
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 1
- 101001109800 Homo sapiens Pro-neuregulin-1, membrane-bound isoform Proteins 0.000 description 1
- 101001093919 Homo sapiens SEC14-like protein 2 Proteins 0.000 description 1
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 208000023105 Huntington disease Diseases 0.000 description 1
- 229940124753 IL-2 agonist Drugs 0.000 description 1
- 102000018682 Interleukin Receptor Common gamma Subunit Human genes 0.000 description 1
- 108010066719 Interleukin Receptor Common gamma Subunit Proteins 0.000 description 1
- 102000004559 Interleukin-13 Receptors Human genes 0.000 description 1
- 108010017511 Interleukin-13 Receptors Proteins 0.000 description 1
- 108010038501 Interleukin-6 Receptors Proteins 0.000 description 1
- 201000008225 Klebsiella pneumonia Diseases 0.000 description 1
- 241000588747 Klebsiella pneumoniae Species 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 102100031775 Leptin receptor Human genes 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 101710142062 Leukemia inhibitory factor receptor Proteins 0.000 description 1
- 241000186779 Listeria monocytogenes Species 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 102100035304 Lymphotactin Human genes 0.000 description 1
- 102000004083 Lymphotoxin-alpha Human genes 0.000 description 1
- 108090000542 Lymphotoxin-alpha Proteins 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102000007651 Macrophage Colony-Stimulating Factor Human genes 0.000 description 1
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 102000011202 Member 2 Subfamily B ATP Binding Cassette Transporter Human genes 0.000 description 1
- 102000012750 Membrane Glycoproteins Human genes 0.000 description 1
- 108010090054 Membrane Glycoproteins Proteins 0.000 description 1
- 208000034762 Meningococcal Infections Diseases 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 241000713869 Moloney murine leukemia virus Species 0.000 description 1
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 1
- 241000588622 Moraxella bovis Species 0.000 description 1
- 241000588655 Moraxella catarrhalis Species 0.000 description 1
- 101710159910 Movement protein Proteins 0.000 description 1
- 101000767152 Mus musculus General vesicular transport factor p115 Proteins 0.000 description 1
- 101001002703 Mus musculus Interleukin-4 Proteins 0.000 description 1
- 101001093920 Mus musculus SEC14-like protein 2 Proteins 0.000 description 1
- 241000700562 Myxoma virus Species 0.000 description 1
- 230000004988 N-glycosylation Effects 0.000 description 1
- 206010028851 Necrosis Diseases 0.000 description 1
- 241000588652 Neisseria gonorrhoeae Species 0.000 description 1
- 241000588650 Neisseria meningitidis Species 0.000 description 1
- 102000015336 Nerve Growth Factor Human genes 0.000 description 1
- 102000007072 Nerve Growth Factors Human genes 0.000 description 1
- 108090000742 Neurotrophin 3 Proteins 0.000 description 1
- 102000004230 Neurotrophin 3 Human genes 0.000 description 1
- 241001126259 Nippostrongylus brasiliensis Species 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 206010033645 Pancreatitis Diseases 0.000 description 1
- 241001631646 Papillomaviridae Species 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 206010035717 Pneumonia klebsiella Diseases 0.000 description 1
- 229920002565 Polyethylene Glycol 400 Polymers 0.000 description 1
- 101710193132 Pre-hexon-linking protein VIII Proteins 0.000 description 1
- 102100024147 Protein phosphatase 1 regulatory subunit 14A Human genes 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 241000700564 Rabbit fibroma virus Species 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 101000767150 Rattus norvegicus General vesicular transport factor p115 Proteins 0.000 description 1
- 101001093925 Rattus norvegicus SEC14-like protein 2 Proteins 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 101710188106 SEC14-like protein 2 Proteins 0.000 description 1
- 102100035174 SEC14-like protein 2 Human genes 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 102100021669 Stromal cell-derived factor 1 Human genes 0.000 description 1
- 101710088580 Stromal cell-derived factor 1 Proteins 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 101800001271 Surface protein Proteins 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 101800004564 Transforming growth factor alpha Proteins 0.000 description 1
- 102400001320 Transforming growth factor alpha Human genes 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 1
- 206010053613 Type IV hypersensitivity reaction Diseases 0.000 description 1
- 206010046865 Vaccinia virus infection Diseases 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 241000607626 Vibrio cholerae Species 0.000 description 1
- 101100398653 Yersinia pestis lamB1 gene Proteins 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 238000005903 acid hydrolysis reaction Methods 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 208000007502 anemia Diseases 0.000 description 1
- 230000003266 anti-allergic effect Effects 0.000 description 1
- 230000003110 anti-inflammatory effect Effects 0.000 description 1
- 230000001028 anti-proliverative effect Effects 0.000 description 1
- 230000008350 antigen-specific antibody response Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 230000005975 antitumor immune response Effects 0.000 description 1
- 239000008365 aqueous carrier Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 210000001130 astrocyte Anatomy 0.000 description 1
- 230000003305 autocrine Effects 0.000 description 1
- 230000006472 autoimmune response Effects 0.000 description 1
- 210000000649 b-lymphocyte subset Anatomy 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 238000001574 biopsy Methods 0.000 description 1
- 230000001851 biosynthetic effect Effects 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 235000011148 calcium chloride Nutrition 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 238000009566 cancer vaccine Methods 0.000 description 1
- 229940022399 cancer vaccine Drugs 0.000 description 1
- 210000000234 capsid Anatomy 0.000 description 1
- 238000012219 cassette mutagenesis Methods 0.000 description 1
- 238000000423 cell based assay Methods 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 239000013553 cell monolayer Substances 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000009614 chemical analysis method Methods 0.000 description 1
- 210000002987 choroid plexus Anatomy 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 229940075614 colloidal silicon dioxide Drugs 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 230000000536 complexating effect Effects 0.000 description 1
- 208000012696 congenital leptin deficiency Diseases 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 229940099112 cornstarch Drugs 0.000 description 1
- 201000003740 cowpox Diseases 0.000 description 1
- 229960001681 croscarmellose sodium Drugs 0.000 description 1
- 235000010947 crosslinked sodium carboxy methyl cellulose Nutrition 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- 108010004073 cysteinylcysteine Proteins 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 230000003413 degradative effect Effects 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 238000002716 delivery method Methods 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 238000009795 derivation Methods 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 230000000368 destabilizing effect Effects 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- PXBRQCKWGAHEHS-UHFFFAOYSA-N dichlorodifluoromethane Chemical compound FC(F)(Cl)Cl PXBRQCKWGAHEHS-UHFFFAOYSA-N 0.000 description 1
- 235000019404 dichlorodifluoromethane Nutrition 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 230000003467 diminishing effect Effects 0.000 description 1
- XEYBRNLFEZDVAW-ARSRFYASSA-N dinoprostone Chemical compound CCCCC[C@H](O)\C=C\[C@H]1[C@H](O)CC(=O)[C@@H]1C\C=C/CCCC(O)=O XEYBRNLFEZDVAW-ARSRFYASSA-N 0.000 description 1
- 229960002986 dinoprostone Drugs 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 230000004064 dysfunction Effects 0.000 description 1
- 230000000431 effect on proliferation Effects 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000003532 endogenous pyrogen Substances 0.000 description 1
- 230000030583 endoplasmic reticulum localization Effects 0.000 description 1
- 239000002158 endotoxin Substances 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 230000007071 enzymatic hydrolysis Effects 0.000 description 1
- 238000006047 enzymatic hydrolysis reaction Methods 0.000 description 1
- 230000003203 everyday effect Effects 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 235000019634 flavors Nutrition 0.000 description 1
- 108700014844 flt3 ligand Proteins 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 238000001476 gene delivery Methods 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 235000011187 glycerol Nutrition 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 208000024908 graft versus host disease Diseases 0.000 description 1
- 230000035876 healing Effects 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 229960001340 histamine Drugs 0.000 description 1
- 210000003630 histaminocyte Anatomy 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 238000002744 homologous recombination Methods 0.000 description 1
- 230000006801 homologous recombination Effects 0.000 description 1
- 102000055229 human IL4 Human genes 0.000 description 1
- 102000055650 human NRG1 Human genes 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 230000004727 humoral immunity Effects 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 208000013403 hyperactivity Diseases 0.000 description 1
- 210000003016 hypothalamus Anatomy 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000003832 immune regulation Effects 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 230000004957 immunoregulator effect Effects 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 238000012606 in vitro cell culture Methods 0.000 description 1
- 238000012750 in vivo screening Methods 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 210000004969 inflammatory cell Anatomy 0.000 description 1
- 230000004968 inflammatory condition Effects 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 239000003999 initiator Substances 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 230000008611 intercellular interaction Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 230000019697 interleukin-15 production Effects 0.000 description 1
- 108040006849 interleukin-2 receptor activity proteins Proteins 0.000 description 1
- 229940100602 interleukin-5 Drugs 0.000 description 1
- 229940100601 interleukin-6 Drugs 0.000 description 1
- 229940096397 interleukin-8 Drugs 0.000 description 1
- XKTZWUACRZHVAN-VADRZIEHSA-N interleukin-8 Chemical compound C([C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@@H](NC(C)=O)CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CCSC)C(=O)N1[C@H](CCC1)C(=O)N1[C@H](CCC1)C(=O)N[C@@H](C)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC=1C=CC(O)=CC=1)C(=O)N[C@H](CO)C(=O)N1[C@H](CCC1)C(N)=O)C1=CC=CC=C1 XKTZWUACRZHVAN-VADRZIEHSA-N 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 208000002551 irritable bowel syndrome Diseases 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 238000011005 laboratory method Methods 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 101150012518 lamB gene Proteins 0.000 description 1
- 210000001821 langerhans cell Anatomy 0.000 description 1
- 108010019813 leptin receptors Proteins 0.000 description 1
- 108010052620 leukocyte endogenous mediator Proteins 0.000 description 1
- 150000002617 leukotrienes Chemical class 0.000 description 1
- 229920006008 lipopolysaccharide Polymers 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 230000005923 long-lasting effect Effects 0.000 description 1
- 239000007937 lozenge Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 108010019677 lymphotactin Proteins 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- AEUKDPKXTPNBNY-XEYRWQBLSA-N mcp 2 Chemical compound C([C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)C(C)C)C1=CC=CC=C1 AEUKDPKXTPNBNY-XEYRWQBLSA-N 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 230000033607 mismatch repair Effects 0.000 description 1
- 210000002161 motor neuron Anatomy 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 206010028417 myasthenia gravis Diseases 0.000 description 1
- 208000009091 myxoma Diseases 0.000 description 1
- 210000004897 n-terminal region Anatomy 0.000 description 1
- 230000017074 necrotic cell death Effects 0.000 description 1
- 230000017066 negative regulation of growth Effects 0.000 description 1
- 239000003900 neurotrophic factor Substances 0.000 description 1
- 229940032018 neurotrophin 3 Drugs 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 238000007899 nucleic acid hybridization Methods 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 238000012261 overproduction Methods 0.000 description 1
- 239000003002 pH adjusting agent Substances 0.000 description 1
- 230000002023 papillomaviral effect Effects 0.000 description 1
- 244000045947 parasite Species 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 235000010603 pastilles Nutrition 0.000 description 1
- 230000007030 peptide scission Effects 0.000 description 1
- 108700010839 phage proteins Proteins 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 239000000902 placebo Substances 0.000 description 1
- 229940068196 placebo Drugs 0.000 description 1
- 210000004180 plasmocyte Anatomy 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 230000004983 pleiotropic effect Effects 0.000 description 1
- 230000036178 pleiotropy Effects 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 230000030786 positive chemotaxis Effects 0.000 description 1
- 239000001103 potassium chloride Substances 0.000 description 1
- 235000011164 potassium chloride Nutrition 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 229940116317 potato starch Drugs 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 230000001915 proofreading effect Effects 0.000 description 1
- 239000001294 propane Substances 0.000 description 1
- 239000003380 propellant Substances 0.000 description 1
- XEYBRNLFEZDVAW-UHFFFAOYSA-N prostaglandin E2 Natural products CCCCCC(O)C=CC1C(O)CC(=O)C1CC=CCCCC(O)=O XEYBRNLFEZDVAW-UHFFFAOYSA-N 0.000 description 1
- 201000009732 pulmonary eosinophilia Diseases 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 230000007420 reactivation Effects 0.000 description 1
- 208000002574 reactive arthritis Diseases 0.000 description 1
- 230000021207 regulation of T-helper cell differentiation Effects 0.000 description 1
- 230000012121 regulation of immune response Effects 0.000 description 1
- 208000015347 renal cell adenocarcinoma Diseases 0.000 description 1
- 230000008439 repair process Effects 0.000 description 1
- 230000032537 response to toxin Effects 0.000 description 1
- 230000004043 responsiveness Effects 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 108010078070 scavenger receptors Proteins 0.000 description 1
- 210000004116 schwann cell Anatomy 0.000 description 1
- 210000003497 sciatic nerve Anatomy 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 239000001540 sodium lactate Substances 0.000 description 1
- 229940005581 sodium lactate Drugs 0.000 description 1
- 235000011088 sodium lactate Nutrition 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 239000011593 sulfur Substances 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 230000008093 supporting effect Effects 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 230000008961 swelling Effects 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 101150095542 tap gene Proteins 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 230000004797 therapeutic response Effects 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 230000037317 transdermal delivery Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical class [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 230000004565 tumor cell growth Effects 0.000 description 1
- 230000006433 tumor necrosis factor production Effects 0.000 description 1
- 230000005951 type IV hypersensitivity Effects 0.000 description 1
- 208000027930 type IV hypersensitivity disease Diseases 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 229940035893 uracil Drugs 0.000 description 1
- 208000007089 vaccinia Diseases 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 229940118696 vibrio cholerae Drugs 0.000 description 1
- 230000029812 viral genome replication Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 208000016261 weight loss Diseases 0.000 description 1
- 230000004580 weight loss Effects 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C40—COMBINATORIAL TECHNOLOGY
- C40B—COMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
- C40B40/00—Libraries per se, e.g. arrays, mixtures
- C40B40/02—Libraries contained in or displayed by microorganisms, e.g. bacteria or animal cells; Libraries contained in or displayed by vectors, e.g. plasmids; Libraries containing only microorganisms or vectors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/24—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Enterobacteriaceae (F), e.g. Citrobacter, Serratia, Proteus, Providencia, Morganella, Yersinia
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/102—Mutagenizing nucleic acids
- C12N15/1027—Mutagenizing nucleic acids by DNA shuffling, e.g. RSR, STEP, RPR
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
- C12N15/1037—Screening libraries presented on the surface of microorganisms, e.g. phage display, E. coli display
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
- C12N15/1093—General methods of preparing gene libraries, not provided for in other subgroups
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/74—Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2730/00—Reverse transcribing DNA viruses
- C12N2730/00011—Details
- C12N2730/10011—Hepadnaviridae
- C12N2730/10111—Orthohepadnavirus, e.g. hepatitis B virus
- C12N2730/10122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16211—Human Immunodeficiency Virus, HIV concerning HIV gagpol
- C12N2740/16222—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
Definitions
- This invention pertains to the field of modulation of immune responses such as those induced by genetic vaccines.
- cytokines interleukins, interferons, chemokines, hematopoietic growth factors, tumor necrosis factors and transforming growth factors
- Characteristic features of cytokines are pleiotropy and redundancy; that is, one cytokine often has several functions and a given function is often mediated by more than one cytokine.
- cytokines have additive or synergistic effects with other cytokines, and a number of cytokines also share receptor components.
- cytokine networks Due to the complexity of the cytokine networks, studies on the physiological significance of a given cytokine have been difficult, although recent studies using cytokine gene-deficient mice have significantly improved our understanding on the functions of cytokines in vivo.
- membrane-bound costimulatory molecules play a fundamental role in the regulation of immune responses. These molecules include CD40, CD40 ligand, CD27, CD80, CD86 and CD150 (SLAM), and they are typically expressed on lymphoid cells after activation via antigen recognition or through cell-cell interactions.
- T helper (T H ) cells key regulators of the immune system, are capable of producing a large number of different cytokines, and based on their cytokine synthesis pattern T H cells are divided into two subsets (Paul and Seder (1994) Cell 76: 241-251).
- T H 1 cells produce high levels of IL-2 and IFN- ⁇ and no or minimal levels of IL-4, IL-5 and IL-13.
- T H 2 cells produce high levels of IL-4, IL-5 and IL-13, and IL-2 and IFN- ⁇ production is minimal or absent.
- T H 1 cells activate macrophages, dendritic cells and augment the cytolytic activity of CD8 + cytotoxic T lymphocytes and NK cells (Id.), whereas T H 2 cells provide efficient help for B cells and they also mediate allergic responses due to the capacity of T H 2 cells to induce IgE isotype switching and differentiation of B cells into IgE secreting cell (De Vries and Punnonen (1996) In Cytokine regulation of humoral immunity: basic and clinical aspects . Eds. Snapper, C. M., John Wiley & Sons, Ltd., West Wales, UK, p. 195-215). The exact mechanisms that regulate the differentiation of T helper cells are not fully understood, but cytokines are believed to play a major role.
- IL-4 has been shown to direct T H 2 differentiation, whereas IL-12 induces development of T H 1 cells (Paul and Seder, supra.).
- membrane bound costimulatory molecules such as CD80, CD86 and CD150, can direct T H 1 and/or T H 2 development, and the same molecules that regulate T H cell differentiation also affect activation, proliferation and differentiation of B cells into Ig-secreting plasma cells (Cocks et al. (1995) Nature 376: 260-263; Lenschow et al. (1996) Immunity 5: 285-293; Punnonen et al. (1993) Proc. Nat'l. Acad. Sci. USA. 90: 3730-3734; Punnonen et al. (1997) J. Exp. Med. 185: 993-1004).
- T H T helper
- T H 2-like cytokine synthesis profiles have been proposed to protect from AIDS (Maggi et al. (1994) J. Exp. Med. 180: 489-495).
- the survival from meningococcal septicemia is genetically determined based on the capacity of peripheral blood leukocytes to produce TNF- ⁇ and IL-10. Individuals from families with high production of IL-10 have increased risk of fatal meningococcal disease, whereas members of families with high TNF- ⁇ production were more likely to survive the infection (Westendorp et al. (1997) Lancet 349: 170-173).
- Cytokine treatments can dramatically influence T H 1/T H 2 cell differentiation and macrophage activation, and thereby the outcome of infectious diseases.
- BALB/c mice infected with Leishmania major generally develop a disseminated fatal disease with a T H 2 phenotype, but when treated with anti-IL-4 mAbs or IL-12, the frequency of T H 1 cells in the mice increases and they are able to counteract the pathogen invasion (Chatelain et al. (1992) J. Immunol. 148: 1182-1187).
- IFN- ⁇ protects mice from lethal Herpes Simplex Virus (HSV) infection
- MCP-1 prevents lethal infections by Pseudomonas aeruginosa or Salmonella typhimurium
- cytokine treatments such as recombinant IL-2, have shown beneficial effects in human common variable immunodeficiency (Cunningham-Rundles et al. (1994) N. Engl. J. Med. 331: 918-921).
- cytokines and other molecules to modulate immune responses in a manner most appropriate for treating a particular disease can provide a significant tool for the treatment of disease.
- presently available immunomodulator treatments can have several disadvantages, such as insufficient specific activity, induction of immune responses against, the immunomodulator that is administered, and other potential problems.
- the present invention fulfills this and other needs.
- the present invention provides methods of obtaining a polynucleotide that has a modulatory effect on an immune response that is induced by a genetic vaccine, either directly (i.e., as an immunomodulatory polynucleotide) or indirectly (i.e., upon translation of the polynucleotide to create an immunomodulatory polypeptide.
- the methods of the invention involve: creating a library of recombinant polynucleotides; and screening the library to identify at least one optimized recombinant polynucleotide that exhibits, either by itself or through the encoded polypeptide, an enhanced ability to modulate an immune response than a form of the nucleic acid from which the library was created.
- Examples include, for example, CpG-rich polynucleotide sequences, polynucleotide sequences that encode a costimulator (e.g., B7-1, B7-2, CD1, CD40, CD154 (ligand for CD40), CD150 (SLAM), or a cytokine.
- the screening step used in these methods can include, for example, introducing genetic vaccine vectors which comprise the library of recombinant nucleic acids into a cell, and identifying cells which exhibit an increased ability to modulate an immune response of interest or increased ability to express an immunomodulatory molecule.
- a library of recombinant cytokine-encoding nucleic acids can be screened by testing the ability of cytokines encoded by the nucleic acids to activate cells which contain a receptor for the cytokine.
- the receptor for the cytokine can be native to the cell, or can be expressed from a heterologous nucleic acid that encodes the cytokine receptor.
- the optimized costimulators can be tested to identify those for which the cells or culture medium are capable of inducing a predominantly T H 2 immune response, or a predominantly T H 1 immune response.
- the polynucleotide that has a modulatory effect on an immune response is obtained by: (1) recombining at least first and second forms of a nucleic acid that is, or encodes a molecule that is, involved in modulating an immune response, wherein the first and second forms differ from each other in two or more nucleotides, to produce a library of recombinant polynucleotides; and (2) screening the library to identify at least one optimized recombinant polynucleotide that exhibits, either by itself or through the encoded polypeptide, an enhanced ability to modulate an immune response than a form of the nucleic acid from which the library was created.
- the method can further involve: (3) recombining at least one optimized recombinant polynucleotide with a further form of the nucleic acid, which is the same or different from the first and second forms, to produce a further library of recombinant polynucleotides; (4) screening the further library to identify at least one further optimized recombinant polynucleotide that exhibits an enhanced ability to modulate an immune response than a form of the nucleic acid from which the library was created.; and (5) repeating (3) and (4), as necessary, until the further optimized recombinant polynucleotide exhibits an further enhanced ability to modulate an immune response than a form of the nucleic acid from which the library was created.
- the library of recombinant polynucleotides is screened by: expressing the recombinant polynucleotides so that the encoded peptides or polypeptides are produced as fusions with a protein displayed on the surface of a replicable genetic package; contacting the replicable genetic packages with a plurality of cells that display the receptor; and identifying cells that exhibit a modulation of an immune response mediated by the receptor.
- the invention also provides methods for obtaining a polynucleotide that encodes an accessory molecule that improves the transport or presentation of antigens by a cell. These methods involve creating a library of recombinant polynucleotides by subjecting to recombination nucleic acids that encode all or part of the accessory molecule; and screening the library to identify an optimized recombinant polynucleotide that encodes a recombinant accessory molecule that confers upon a cell an increased or decreased ability to transport or present an antigen on a surface of the cell compared to an accessory molecule encoded by the non-recombinant nucleic acids.
- the screening step involves: introducing the library of recombinant polynucleotides into a genetic vaccine vector that encodes an antigen to form a library of vectors; introducing the library of vectors into mammalian cells; and identifying mammalian cells that exhibit increased or decreased immunogenicity to the antigen.
- the cytokine that is optimized is interleukin-12 and the screening is performed by growing mammalian cells which contain the genetic vaccine vector in a culture medium, and detecting whether T cell proliferation or T cell differentiation is induced by contact with the culture medium.
- the cytokine is interferon- ⁇ and the screening is performed by expressing the recombinant vector module as a fusion protein which is displayed on the surface of a bacteriophage to form a phage display library, and identifying phage library members which are capable of inhibiting proliferation of a B cell line.
- Another embodiment utilizes B7-1 (CD80) or B7-2 (CD86) as the costimulator and the cell or culture medium is tested for ability to modulate an immune response.
- the invention provides methods of using DNA shuffling to obtain optimized recombinant vector modules that encode cytokines and other costimulators that exhibit reduced immunogenicity compared to a corresponding polypeptide encoded by a non-optimized vector module.
- the reduced immunogenicity can be detected by introducing a cytokine or costimulator encoded by the recombinant vector module into a mammal and determining whether an immune response is induced against the cytokine.
- the invention also provides methods of obtaining optimized immunomodulatory sequences that encode a cytokine antagonist.
- suitable cytokine agonists include a soluble cytokine receptor and a transmembrane cytokine receptor having a defective signal sequence. Examples include ⁇ IL-10R and ⁇ IL-4R, and the like.
- FIG. 1 shows an example of a cytotoxic T-cell inducing sequence (CTIS) obtained from HBsAg polypeptide (PreS2 plus S regions).
- CIS cytotoxic T-cell inducing sequence
- FIG. 2 shows a CTIS having heterologous epitopes attached to the cytoplasmic portion.
- FIG. 3 shows the derivation of immunogenic agonistic sequences (IAS) as described in Example 3. Specific killing (percent) is shown for an effector: target (E:T) ratio of five.
- FIG. 4 shows a method for preparing immunogenic agonist sequences (IAS). Wild-type (WT) and mutated forms of nucleic acids encoding a polypeptide of interest are assembled and subjected to DNA shuffling to obtain a nucleic acid encoding a poly-epitope region that contains potential agonist sequences.
- WT Wild-type
- mutated forms of nucleic acids encoding a polypeptide of interest are assembled and subjected to DNA shuffling to obtain a nucleic acid encoding a poly-epitope region that contains potential agonist sequences.
- FIG. 5 shows a scheme for improving immunostimulatory sequences by DNA shuffling.
- FIG. 6 is a diagram of a procedure by which recombinant libraries of human IL-12 genes can be screened to identify shuffled IL-12 genes that encode recombinant IL-12 having increased ability to induce T cell proliferation.
- FIG. 7 shows the results of a high-throughput functional assay for vectors that encode variants of IL-12 obtained using the methods of the invention.
- FIG. 8 shows the induction of T cell proliferation upon transfection of the T ells by individual vectors that encode IL-12 variants.
- FIG. 9 shows results of an experiment which demonstrates that a shuffled IL-12 chimera obtained using the methods of the invention exhibits improved ability to activate human T cells.
- FIG. 10 shows a model of how T cell activation or anergy can be induced by genetic vaccine vectors that encode different B7-1 (CD80) and/or B7-2 (CD86) variants.
- FIG. 11 shows a method for using DNA shuffling to obtain CD80/CD86 variants that have improved capacity to induce T cell activation or anergy.
- FIG. 12 shows results obtained in a screening assay for altered function of B7.
- FIG. 13 provides experimental results which demonstrate that shuffled B7 chimeras provide potent T cell activation.
- FIG. 14 presents an alignment of the nucleotide sequences for human and mouse IL-10 receptor sequences.
- FIG. 15 shows an alignment of the nucleotide sequences of B7-1 (CD80) genes from human, rhesus monkey, and rabbit.
- cytokine includes, for example, interleukins, interferons, chemokines, hematopoietic growth factors, tumor necrosis factors and transforming growth factors. In general these are small molecular weight proteins that regulate maturation, activation, proliferation and differentiation of the cells of the immune system.
- screening describes, in general, a process that identifies optimal immunomodulatory molecules.
- properties of the respective molecules can be used in selection and screening including, for example, ability to induce a desired immune response in a test system.
- Selection is a form of screening in which identification and physical separation are achieved simultaneously by expression of a selection marker, which, in some genetic circumstances, allows cells expressing the marker to survive while other cells die (or vice versa).
- Screening markers include, for example, luciferase, beta-galactosidase and green fluorescent protein. Selection markers include drug and toxin resistance genes, and the like. Because of limitations in studying primary immune responses in vitro, in vivo studies are particularly useful screening methods.
- the genetic vaccines that include immunomodulatory molecules are first introduced to test animals, and the immune responses are subsequently studied by analyzing protective immune responses or by studying the quality or strength of the induced immune response using lymphoid cells derived from the immunized animal.
- spontaneous selection can and does occur in the course of natural evolution, in the present methods selection is performed by man.
- a “exogenous DNA segment”, “heterologous sequence” or a “heterologous nucleic acid”, as used herein, is one that originates from a source foreign to the particular host cell, or, if from the same source, is modified from its original form.
- a heterologous gene in a host cell includes a gene that is endogenous to the particular host cell, but has been modified. Modification of a heterologous sequence in the applications described herein typically occurs through the use of DNA shuffling.
- the terms refer to a DNA segment which is foreign or heterologous to the cell, or homologous to the cell but in a position within the host cell nucleic acid in which the element is not ordinarily found. Exogenous DNA segments are expressed to yield exogenous polypeptides.
- genes are used broadly to refer to any segment of DNA associated with a biological function. Thus, genes include coding sequences and/or the regulatory sequences required for their expression. Genes also include nonexpressed DNA segments that, for example, form recognition sequences for other proteins. Genes can be obtained from a variety of sources, including cloning from a source of interest or synthesizing from known or predicted sequence information, and may include sequences designed to have desired parameters.
- nucleic acid or protein when applied to a nucleic acid or protein, denotes that the nucleic acid or protein is essentially free of other cellular components with which it is associated in the natural state. It is preferably in a homogeneous state although it can be in either a dry or aqueous solution. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. A protein which is the predominant species present in a preparation is substantially purified. In particular, an isolated gene is separated from open reading frames which flank the gene and encode a protein other than the gene of interest.
- purified denotes that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel. Particularly, it means that the nucleic acid or protein is at least about 50% pure, more preferably at least about 85% pure, and most preferably at least about 99% pure.
- naturally-occurring is used to describe an object that can be found in nature as distinct from being artificially produced by man.
- a polypeptide or polynucleotide sequence that is present in an organism including viruses, bacteria, protozoa, insects, plants or mammalian tissue
- an organism including viruses, bacteria, protozoa, insects, plants or mammalian tissue
- nucleic acid refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides which have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g. degenerate codon substitutions) and complementary sequences and as well as the sequence explicitly indicated.
- degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al. (1991) Nucleic Acid Res. 19: 5081; Ohtsuka et al. (1985) J. Biol. Chem. 260: 2605-2608; Cassol et al. (1992); Rossolini et al. (1994) Mol. Cell. Probes 8: 91-98).
- nucleic acid is used interchangeably with gene, cDNA, and mRNA encoded by a gene.
- Nucleic acid derived from a gene refers to a nucleic acid for whose synthesis the gene, or a subsequence thereof, has ultimately served as a template.
- an mRNA, a cDNA reverse transcribed from an mRNA, an RNA transcribed from that cDNA, a DNA amplified from the cDNA, an RNA transcribed from the amplified DNA, etc. are all derived from the gene and detection of such derived products is indicative of the presence and/or abundance of the original gene and/or gene transcript in a sample.
- a nucleic acid is “operably linked” when it is placed into a functional relationship with another nucleic acid sequence.
- a promoter or enhancer is operably linked to a coding sequence if it increases the transcription of the coding sequence.
- Operably linked means that the DNA sequences being linked are typically contiguous and, where necessary to join two protein coding regions, contiguous and in reading frame.
- enhancers generally function when separated from the promoter by several kilobases and intronic sequences may be of variable lengths, some polynucleotide elements may be operably linked but not contiguous.
- a specific binding affinity between two molecules means a preferential binding of one molecule for another in a mixture of molecules.
- the binding of the molecules can be considered specific if the binding affinity is about 1 ⁇ 10 4 M ⁇ 1 to about 1 ⁇ 10 6 M ⁇ 1 or greater.
- Recombinant when used with reference to a cell indicates that the cell replicates a heterologous nucleic acid, or expresses a peptide or protein encoded by a heterologous nucleic acid.
- Recombinant cells can contain genes that are not found within the native (non-recombinant) form of the cell.
- Recombinant cells can also contain genes found in the native form of the cell wherein the genes are modified and re-introduced into the cell by artificial means.
- the term also encompasses cells that contain a nucleic acid endogenous to the cell that has been modified without removing the nucleic acid from the cell; such modifications include those obtained by gene replacement, site-specific mutation, and related techniques.
- a “recombinant expression cassette” or simply an “expression cassette” is a nucleic acid construct, generated recombinantly or synthetically, with nucleic acid elements that are capable of effecting expression of a structural gene in hosts compatible with such sequences.
- Expression cassettes include at least promoters and optionally, transcription termination signals.
- the recombinant expression cassette includes a nucleic acid to be transcribed (e.g., a nucleic acid encoding a desired polypeptide), and a promoter. Additional factors necessary or helpful in effecting expression may also be used as described herein.
- an expression cassette can also include nucleotide sequences that encode a signal sequence that directs secretion of an expressed protein from the host cell. Transcription termination signals, enhancers, and other nucleic acid sequences that influence gene expression, can also be included in an expression cassette.
- a “recombinant polynucleotide” or a “recombinant polypeptide” is a non-naturally occurring polynucleotide or polypeptide that includes nucleic acid or amino acid sequences, respectively, from more than one source nucleic acid or polypeptide, which source nucleic acid or polypeptide can be a naturally occurring nucleic acid or polypeptide, or can itself have been subjected to mutagenesis or other type of modification.
- the source polynucleotides or polypeptides from which the different nucleic acid or amino acid sequences are derived are sometimes homologous (i.e., have, or encode a polypeptide that encodes, the same or a similar structure and/or function), and are often from different isolates, serotypes, strains, species, of organism or from different disease states, for example.
- nucleic acid or polypeptide sequences refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection.
- substantially identical in the context of two nucleic acids or polypeptides, refers to two or more sequences or subsequences that have at least 60%, preferably 80%, most preferably 90-95% nucleotide or amino acid residue identity, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection.
- the substantial identity exists over a region of the sequences that is at least about 50 residues in length, more preferably over a region of at least about 100 residues, and most preferably the sequences are substantially identical over at least about 150 residues.
- the sequences are substantially identical over the entire length of the coding regions.
- sequence comparison typically one sequence acts as a reference sequence to which test sequences are compared.
- test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
- sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
- Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2: 482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48: 443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85: 2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by visual inspection (see generally Ausubel et al., infra).
- HSPs high scoring sequence pairs
- initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them.
- the word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always>0) and N (penalty score for mismatching residues; always ⁇ 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
- the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
- the BLASTP program uses as defaults a wordlength (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff (1989) Proc. Natl. Acad. Sci. USA 89: 10915).
- the BLAST algorithm In addition to calculating percent sequence identity, the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul (1993) Proc. Nat'l. Acad. Sci. USA 90: 5873-5787).
- One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
- P(N) the smallest sum probability
- a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001.
- hybridizing specifically to refers to the binding, duplexing, or hybridizing of a molecule only to a particular nucleotide sequence under stringent conditions when that sequence is present in a complex mixture (e.g., total cellular) DNA or RNA.
- Bod(s) substantially refers to complementary hybridization between a probe nucleic acid and a target nucleic acid and embraces minor mismatches that can be accommodated by reducing the stringency of the hybridization media to achieve the desired detection of the target polynucleotide sequence.
- “Stringent hybridization conditions” and “stringent hybridization wash conditions” in the context of nucleic acid hybridization experiments such as Southern and northern hybridizations are sequence dependent, and are different under different environmental parameters. Longer sequences hybridize specifically at higher temperatures. An extensive guide to the hybridization of nucleic acids is found in Tijssen (1993) Laboratory Techniques in Biochemistry and Molecular Biology—Hybridization with Nucleic Acid Probes part I chapter 2 “Overview of principles of hybridization and the strategy of nucleic acid probe assays”, Elsevier, N.Y.
- highly stringent hybridization and wash conditions are selected to be about 5° C. lower than the thermal melting point (T m ) for the specific sequence at a defined ionic strength and pH.
- T m thermal melting point
- a probe will hybridize to its target subsequence, but to no other sequences.
- the T m is the temperature (under defined ionic strength and pH) at which 50% of the target sequence hybridizes to a perfectly matched probe.
- Very stringent conditions are selected to be equal to the T m for a particular probe.
- An example of stringent hybridization conditions for hybridization of complementary nucleic acids which have more than 100 complementary residues on a filter in a Southern or northern blot is 50% formamide with 1 mg of heparin at 42° C., with the hybridization being carried out overnight.
- An example of highly stringent wash conditions is 0.1 SM NaCl at 72° C. for about 15 minutes.
- An example of stringent wash conditions is a 0.2 ⁇ SSC wash at 65° C. for 15 minutes (see, Sambrook, infra., for a description of SSC buffer).
- a high stringency wash is preceded by a low stringency wash to remove background probe signal.
- An example medium stringency wash for a duplex of, e.g., more than 100 nucleotides, is 1 ⁇ SSC at 45° C. for 15 minutes.
- An example low stringency wash for a duplex of, e.g., more than 100 nucleotides is 4-6 ⁇ SSC at 40° C. for 15 minutes.
- stringent conditions typically involve salt concentrations of less than about 1.0 M Na + ion, typically about 0.01 to 1.0 M Na + ion concentration (or other salts) at pH 7.0 to 8.3, and the temperature is typically at least about 30° C.
- Stringent conditions can also be achieved with the addition of destabilizing agents such as formamide.
- destabilizing agents such as formamide.
- a signal to noise ratio of 2 ⁇ (or higher) than that observed for an unrelated probe in the particular hybridization assay indicates detection of a specific hybridization.
- Nucleic acids which do not hybridize to each other under stringent conditions are still substantially identical if the polypeptides which they encode are substantially identical. This occurs, e.g., when a copy of a nucleic acid is created using the maximum codon degeneracy permitted by the genetic code.
- a further indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with, or specifically binds to, the polypeptide encoded by the second nucleic acid.
- a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions.
- the specified antibodies bind to a particular protein and do not bind in a significant amount to other proteins present in the sample.
- the antibodies raised against a multivalent antigenic polypeptide will generally bind to the proteins from which one or more of the epitopes were obtained. Specific binding to an antibody under such conditions may require an antibody that is selected for its specificity for a particular protein.
- immunoassay formats may be used to select antibodies specifically immunoreactive with a particular protein.
- solid-phase ELISA immunoassays, Western blots, or immunohistochemistry are routinely used to select monoclonal antibodies specifically immunoreactive with a protein. See Harlow and Lane (1988) Antibodies, A Laboratory Manual , Cold Spring Harbor Publications, New York “Harlow and Lane”), for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity.
- a specific or selective reaction will be at least twice background signal or noise and more typically more than 10 to 100 times background.
- “Conservatively modified variations” of a particular polynucleotide sequence refers to those polynucleotides that encode identical or essentially identical amino acid sequences, or where the polynucleotide does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given polypeptide. For instance, the codons CGU, CGC, CGA, CGG, AGA, and AGG all encode the amino acid arginine. Thus, at every position where an arginine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide.
- nucleic acid variations are “silent variations,” which are one species of “conservatively modified variations.” Every polynucleotide sequence described herein which encodes a polypeptide also describes every possible silent variation, except where otherwise noted.
- each codon in a nucleic acid except AUG, which is ordinarily the only codon for methionine
- each “silent variation” of a nucleic acid which encodes a polypeptide is implicit in each described sequence.
- a “subsequence” refers to a sequence of nucleic acids or amino acids that comprise a part of a longer sequence of nucleic acids or amino acids (e.g., polypeptide) respectively.
- the present invention provides methods for obtaining polynucleotide sequences that, either directly or indirectly (i.e., through encoding a polypeptide), can modulate an immune response when present on a genetic vaccine vector.
- the invention provides methods for optimizing the transport and presentation of antigens.
- the optimized immunomodulatory polynucleotides obtained using the methods of the invention are particularly suited for use in conjunction with vaccines, including genetic vaccines.
- One of the advantages of genetic vaccines is that one can incorporate genes encoding immunomodulatory molecules, such as cytokines, costimulatory molecules, and molecules that improve antigen transport and presentation into the genetic vaccine vectors. This provides opportunities to modulate immune responses that are induced against the antigens expressed by the genetic vaccines.
- the invention involves creating recombinant libraries of polynucleotides that are then screened to identify those library members that exhibit a desired property.
- the recombinant libraries can be created using any of various methods.
- the substrate nucleic acids used for the recombination can vary depending upon the particular application. For example, where a polynucleotide that encodes a cytokine, chemokine, or other accessory molecule is to be optimized, different forms of nucleic acids that encode all or part of the cytokine, chemokine, or other accessory molecule are subjected to recombination.
- the methods require at least two variant forms of a starting substrate.
- the variant forms of candidate substrates can show substantial sequence or secondary structural similarity with each other, but they should also differ in at least two positions.
- the initial diversity between forms can be the result of natural variation, e.g., the different variant forms (homologs) are obtained from different individuals or strains of an organism (including geographic variants) or constitute related sequences from the same organism (e.g., allelic variations).
- the initial diversity can be induced, e.g., the second variant form can be generated by error-prone transcription, such as an error-prone PCR or use of a polymerase which lacks proof-reading activity (see Liao (1990) Gene 88: 107-111), of the first variant form, or, by replication of the first form in a mutator strain (mutator host cells are discussed in further detail below).
- the initial diversity between substrates is greatly augmented in subsequent steps of recursive sequence recombination.
- Recursive sequence recombination can be employed to achieve still further improvements in a desired property. Sequence recombination can be achieved in many different formats and permutations of formats, as described in further detail below. These formats share some common principles. Recursive sequence recombination entails successive cycles of recombination to generate molecular diversity. That is, one creates a family of nucleic acid molecules showing some sequence identity to each other but differing in the presence of mutations. In any given cycle, recombination can occur in vivo or in vitro, intracellular or extracellular.
- diversity resulting from recombination can be augmented in any cycle by applying prior methods of mutagenesis (e.g., error-prone PCR or cassette mutagenesis) to either the substrates or products for recombination.
- mutagenesis e.g., error-prone PCR or cassette mutagenesis
- a new or improved property or characteristic can be achieved after only a single cycle of in vivo or in vitro recombination, as when using different, variant forms of the sequence, as homologs from different individuals or strains of an organism, or relate d sequences from the same organism, as allelic variations.
- the recombinant libraries are prepared using DNA shuffling.
- the shuffling and screening or selection can be used to “evolve” individual genes, whole plasmids or viruses, multigene clusters, or even whole genomes (Stemmer (1995) Bio/Technology 13: 549-553). Reiterative cycles of recombination and screening/selection can be performed to further evolve the nucleic acids of interest. Such techniques do not require the extensive analysis and computation required by conventional methods for polypeptide engineering. Shuffling allows the recombination of large numbers of mutations in a minimum number of selection cycles, in contrast to traditional, pairwise recombination events.
- sequence recombination techniques described herein provide particular advantages in that they provide recombination between mutations in any or all of these, thereby providing a very fast way of exploring the manner in which different combinations of mutations can affect a desired result. In some instances, however, structural and/or functional information is available which, although not required for sequence recombination, provides opportunities for modification of the technique.
- Kits for mutagenesis are commercially available (e.g., Bio-Rad, Amersham International, Yalen Biotechnology).
- a recombination cycle is usually followed by at least one cycle of screening or selection for molecules having a desired property or characteristic.
- a recombination cycle is performed in vitro, the products of recombination, i.e., recombinant segments, are sometimes introduced into cells before the screening step.
- Recombinant segments can also be linked to an appropriate vector or other regulatory sequences before screening.
- products of recombination generated in vitro are sometimes packaged as viruses before screening.
- recombination products can sometimes be screened in the cells in which recombination occurred.
- recombinant segments are extracted from the cells, and optionally packaged as viruses, before screening.
- a genetic vaccine vector can have many component sequences each having a different intended role (e.g., coding sequence, regulatory sequences, targeting sequences, stability-conferring sequences, immunomodulatory sequences, sequences affecting antigen presentation, and sequences affecting integration). Each of these component sequences can be varied and recombined simultaneously. Screening/selection can then be performed, for example, for recombinant segments that have increased episomal maintenance in a target cell without the need to attribute such improvement to any of the individual component sequences of the vector.
- initial round(s) of screening can sometimes be performed in bacterial cells due to high transfection efficiencies and ease of culture.
- Later rounds, and other types of screening which are not amenable to screening in bacterial cells are performed in mammalian cells to optimize recombinant segments for use in an environment close to that of their intended use.
- Final rounds of screening can be performed in the precise cell type of intended use (e.g., a human antigen-presenting cell). In some instances, this cell can be obtained from a patient to be treated with a view, for example, to minimizing problems of immunogenicity in this patient.
- the screening or selection step identifies a subpopulation of recombinant segments that have evolved toward acquisition of a new or improved desired property or properties useful in genetic vaccination.
- the recombinant segments can be identified as components of cells, components of viruses or in free form. More than one round of screening or selection can be performed after each round of recombination.
- At least one and usually a collection of recombinant segments surviving a first round of screening/selection are subject to a further round of recombination.
- These recombinant segments can be recombined with each other or with exogenous segments representing the original substrates or further variants thereof. Again, recombination can proceed in vitro or in vivo. If the previous screening step identifies desired recomibinant segments as components of cells, the components can be subjected to further recombination in vivo, or can be subjected to further recombination in vitro, or can be isolated before performing a round of in vitro recombination.
- the previous screening step identifies desired recombinant segments in naked form or as components of viruses, these segments can be introduced into cells to perform a round of in vivo recombination.
- the second round of recombination irrespective how performed, generates further recombinant segments which encompass additional diversity than is present in recombinant segments resulting from previous rounds.
- the second round of recombination can be followed by a further round of screening/selection according to the principles discussed above for the first round.
- the stringency of screening/selection can be increased between rounds.
- the nature of the screen and the property being screened for can vary between rounds if improvement in more than one property is desired or if acquiring more than one new property is desired. Additional rounds of recombination and screening can then be performed until the recombinant segments have sufficiently evolved to acquire the desired new or improved property or function.
- screening involves expressing the recombinant peptides or polypeptides encoded by the recombinant polynucleotides of the library as fusions with a protein that is displayed on the surface of a replicable genetic package.
- phage display can be used. See, e.g, Cwirla et al., Proc. Natl. Acad. Sci. USA 87: 6378-6382 (1990); Devlin et al., Science. 249: 404-406 (1990), Scott & Smith, Science 249: 386-388 (1990); Ladner et al., U.S. Pat. No. 5,571,698.
- Other replicable genetic packages include, for example, bacteria, eukaryotic viruses, yeast, and spores.
- the genetic packages most frequently used for display libraries are bacteriophage, particularly filamentous phage, and especially phage M13, Fd and F1.
- Such a fusion protein comprises a signal sequence, usually but not necessarily, from the phage coat protein, a polypeptide to be displayed and either the gene III or gene VIII protein or a fragment thereof. Exogenous coding sequences are often inserted at or near the N-terminus of gene III or gene VIII although other insertion sites are possible.
- Eukaryotic viruses can be used to display polypeptides in an analogous manner. For example, display of human heregulin fused to gp70 of Moloney murine leukemia virus has been reported by Han et al., Proc. Natl. Acad. Sci. USA 92: 9747-9751 (1995). Spores can also be used as replicable genetic packages. In this case, polypeptides are displayed from the outer surface of the spore. For example, spores from B. subtilis have been reported to be suitable. Sequences of coat proteins of these spores are provided by Donovan et al., J. Mol. Biol. 196, 1-10 (1987). Cells can also be used as replicable genetic packages.
- Polypeptides to be displayed are inserted into a gene encoding a cell protein that is expressed on the cells surface.
- Bacterial cells including Salmonella typhimurium, Bacillus subtilis, Pseudomonas aeruginosa, Vibrio cholerae, Klebsiella pneumonia, Neisseria gonorrhoeae, Neisseria meningitidis, Bacteroides nodosus, Moraxella bovis , and especially Escherichia coli are preferred. Details of outer surface proteins are discussed by Ladner et al., U.S. Pat. No. 5,571,698 and references cited therein. For example, the lamB protein of E. coli is suitable.
- a basic concept of display methods that use phage or other replicable genetic package is the establishment of a physical association between DNA encoding a polypeptide to be screened and the polypeptide. This physical association is provided by the replicable genetic package, which displays a polypeptide as part of a capsid enclosing the genome of the phage or other package, wherein the polypeptide is encoded by the genome.
- the establishment of a physical association between polypeptides and their genetic material allows simultaneous mass screening of very large numbers of phage bearing different polypeptides. Phage displaying a polypeptide with affinity to a target, e.g., a receptor, bind to the target and these phage are enriched by affinity screening to the target.
- polypeptides displayed from these phage can be determined from their respective genomes. Using these methods a polypeptide identified as having a binding affinity for a desired target can then be synthesized in bulk by conventional means, or the polynucleotide that encodes the peptide or polypeptide can be used as part of a genetic vaccine.
- Cytokines can dramatically influence macrophage activation and T H 1/T H 2 cell differentiation, and thereby the outcome of infectious diseases.
- DNA itself can act as adjuvant by activating the cells of the immune system.
- unmethylated CpG-rich DNA sequences were shown to enhance T H 1 cell differentiation, activate cytokine synthesis by monocytes and induce proliferation of B lymphocytes.
- the invention thus provides methods for enhancing the immunomodulatory properties of genetic vaccines (a) by evolving the stimulatory properties of DNA itself and (b) by evolving genes encoding cytokines and related molecules that are involved in immune system regulation. These genes are then used in genetic vaccine vectors.
- IFN- ⁇ and IL-12 which skew immune responses towards a T helper 1 (T H 1) cell phenotype and, thereby, improve the host's capacity to counteract pathogen invasions.
- T H 1 T helper 1
- methods of obtaining improved immunomodulatory nucleic acids that are capable of inhibiting or enhancing activation, differentiation, or anergy of antigen-specific T cells. Because of the limited information about the structures and mechanisms that regulate these events, molecular breeding techniques of the invention provide much faster solutions than rational design.
- the methods of the invention typically involve the use of DNA shuffling or other methods to create a library of recombinant polynucleotides.
- the library is then screened to identify recombinant polynucleotides in the library, when included in a genetic vaccine vector or administered in conjunction with a genetic vaccine, are capable of enhancing or otherwise altering an immune response induced by the vector.
- the screening step in some embodiments, can involve introducing a genetic vaccine vector that includes the recombinant polynucleotides into mammalian cells and determining whether the cells, or culture medium obtained by growing the cells, is capable of modulating an immune response.
- Optimized recombinant vector modules obtained through polynucleotide recombination are useful not only as components of genetic vaccine vectors, but also for production of polypeptides, e.g., modified cytokines and the like, that can be administered to a mammal to enhance or shift an immune response.
- Polynucleotide sequences obtained using the DNA shuffling methods of the invention can be used as a component of a genetic vaccine, or can be used for production of cytokines and other immunomodulatory polypeptides that are themselves used as therapeutic or prophylactic reagents.
- the sequence of the optimized immunomodulatory polypeptide-encoding polynucleotides can be determined and the deduced amino acid sequence used to produce polypeptides using methods known to those of skill in the art.
- the invention provides methods of obtaining polynucleotides that are immunostimulatory when introduced into a mammal.
- Oligonucleotides that contain hexamers with a central CpG flanked by two 5′ purines (GpA or ApA) and two 3′ pyrimidines (TpC or TpT) efficiently induce cytokine synthesis and B cell proliferation (Krieg et al. (1995) Nature 374: 546; Klinman et al. (1996) Proc. Nat l. Acad. Sci. USA 93: 2879; Pisetsky (1.996) Immunity 5: 303-10) in vitro and act as adjuvants in vivo.
- ISS oligonucleotide for functional activity in vitro The minimal length of an ISS oligonucleotide for functional activity in vitro is eight (Klinman et al., supra.). Twenty-mers with three CG motifs were found to be significantly more efficient in inducing cytokine synthesis than a 15-mer with two CG motifs (Id.). GGGG tetrads have been suggested to be involved in binding of DNA to cell surfaces (macrophages express receptors for example scavenger receptors, that bind DNA) (Pisetsky et al., supra.).
- a library is generated by subjecting to recombination random DNA (e.g., fragments of human, murine, or other genomic DNA), oligonucleotides that contain known ISS, poly A, C, G or T sequences, or combinations thereof.
- the DNA which includes at least first and second forms which differ from each other in two or more nucleotides, are recombined to produce a library of recombinant polynucleotides.
- the library is then screened to identify those recombinant polynucleotides that exhibit immunostimulatory properties.
- the library can be screened for induction cytokine production in vitro upon introduction of the library into an appropriate cell type. A diagram of this procedure is shown in FIG. 5 .
- cytokines that can be used as an indicator of immunostimulatory activity are, for example, IL-2, IL-4, IL-5, IL-6, IL-10, IL-12, IL-13, IL-15, and IFN- ⁇ .
- An alternative screening method is the determination of the ability to induce proliferation of cells involved in immune responses, such as B cells, T cells, monocytes/macrophages, total PBL, and the like.
- Other screens include detecting induction of APC activation based on changes in expression levels of surface antigens, such as B7-1 (CD80), B7-2 (CD86), MHC class I and II, and CD14.
- T cell proliferation identifying recombinant polynucleotides that induce T cell proliferation. Because ISS sequences induce B cell activation, and because of several homologies between surface antigens expressed by T cells and B cells, polynucleotides can be obtained that have stimulatory activities on T cells.
- Libraries of recombinant polynucleotides can also be screened for imp roved CTL and antibody responses in vivo and for improved protection from infection, cancer, allergy or autoimmunity.
- Recombinant polynucleotides that exhibit the desired property can be recovered from the cell and, if further improvement is desired, the shuffling and screening can be repeated.
- Optimized ISS sequences can used as an adjuvant separately from an actual vaccine, or the DNA sequence of interest can be fused to a genetic vaccine vector.
- the invention also provides methods for obtaining optimized cytokines, cytokine antagonists, chemokines, and other accessory molecules that direct, inhibit, or enhance immune responses.
- the methods of the invention can be used to obtain genetic vaccines and other reagents (e.g., optimized cytokines, and the like) that, when administered to a mammal, improve or alter an immune response.
- optimized immunomodulators are useful for treating infectious diseases, as well as other conditions such as inflammatory disorders, in an antigen non-specific manner.
- the methods of the invention can be used to develop optimized immunomodulatory molecules for treating allergies.
- the optimized immunomodulatory molecules can be used alone or in conjunction with antigen-specific-genetic vaccines to prevent or treat allergy.
- Four basic mechanisms are available by which one can achieve specific immunotherapy of allergy. First, one can administer a reagent that causes a decrease in allergen-specific T H 2 cells. Second, a reagent can be administered that causes an increase in allergen-specific T H 1 cells. Third, one can direct an increase in suppressive CD8 + T cells. Finally, allergy can be treated by inducing anergy of allergen-specific T cells.
- cytokines are optimized using the methods of the invention to obtain reagents that are effective in achieving one or more of these immunuotherapeutic goals.
- the methods of the invention are used to obtain anti-allergic cytokines that have one or more properties such as improved specific activity, improved secretion after introduction into target cells, are effective at a lower dose than natural cytokines, and fewer side effects.
- Targets of particular interest include interferon- ⁇ / ⁇ , IL-10, IL-12, and antagonists of IL-4 and IL-13.
- the optimized immunomodulators or optimized recombinant polynucleotides that encode the immunomodulators, can be administered alone, or in combination with other accessory molecules. Inclusion of optimal concentrations of the appropriate molecules can enhance a desired immune response, and/or direct the induction or repression of a particular type of immune response.
- the polynucleotides that encode the optimized molecules can be included in a genetic vaccine vector, or the optimized molecules encoded by the genes can be administered as polypeptides.
- a library of recombinant polynucleotides that encode immunomodulators is created by subjecting substrate nucleic acids to a recombination protocol, such as DNA shuffling or other method known to those of skill in the art.
- the substrate nucleic acids are typically two or more forms of a nucleic acid that encodes an immunomodulator of interest.
- Cytokines are among the immunomodulators that can be improved using the methods of the invention. Cytokine synthesis profiles play a crucial role in the capacity of the host to counteract viral, bacterial and parasitic infections, and cytokines can dramatically influence the efficacy of genetic vaccines and the outcome of infectious diseases.
- cytokines for example IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, G-CSF, GM-CSF, IFN- ⁇ , IFN- ⁇ , TGF- ⁇ , TNF- ⁇ , TNF- ⁇ , IL-20 (MDA-7), and flt-3 ligand have been shown stimulate immune responses in vitro or in vivo.
- Immune functions that can be enhanced using appropriate cytokines include, for example, B cell proliferation, Ig synthesis, Ig isotype switching, T cell proliferation and cytokine synthesis, differentiation of T H 1 and T H 2 cells, activation and proliferation of CTLs, activation and cytokine production by monocytes/macrophages/dendritic cells, and differentiation of dendritic cells from monocytes/macrophages.
- the invention provides methods of obtaining optimized immunomodulators that can direct an immune response towards a T H 1 or a T H 2 response.
- the ability to influence the direction of immune responses in this manner is of great importance in development of genetic vaccines. Altering the type of T H response can fundamentally change the outcome of an infectious disease.
- a high frequency of T H 1 cells generally protects from lethal infections with intracellular pathogens, whereas a dominant T H 2 phenotype often results in disseminated, chronic infections.
- the T H 1 phenotype is present in the tuberculoid (resistant) form of leprosy, while the T H 2 phenotype is found in lepromatous, multibacillary (susceptible) lesions (Yamamura et al. (1991) Science 254: 277).
- Late-stage AIDS patients have the T H 2 phenotype.
- Studies in family members indicate that survival from meningococcal septicemia depends on the cytokine synthesis profile of PBL, with high IL-10 synthesis being associated with a high risk of lethal outcome and high TNF- ⁇ being associated with a low risk. Similar examples are found in mice.
- BALB/c mice are susceptible to Leishmania major infection; these mice develop a disseminated fatal disease with a T H 2 phenotype.
- Treatment with anti-IL-4 monoclonal antibodies or with IL-12 induces a T H 1 response, resulting in healing.
- Anti-interferon- ⁇ monoclonal antibodies exacerbate the disease.
- it is preferable to direct an immune response in the direction of a T H 2 response For example, where increased mucosal immunity is desired, including protective immunity, enhancing the T H 2 response can lead to increased antibody production, particularly IgA.
- T helper (T H ) cells are probably the most important regulators of the immune system. T H cells are divided into two subsets, based on their cytokine synthesis pattern (Mosmann and Coffman (1989) Adv. Immunol. 46: 111). T H 1 cells produce high levels of the cytokines IL-2 and IFN- ⁇ and no or minimal levels of IL-4, IL-5 and IL-13. In contrast, T H 2 cells produce high levels of IL-4, IL-5 and IL-13, and IL-2 and IFN- ⁇ production is minimal or absent.
- T H 1 cells activate macrophages, dendritic cells and augment the cytolytic activity of CD8 + cytotoxic T lymphocytes and natural killer (NK) cells (Paul and Seder (1994) Cell 76: 241), whereas T H 2 cells provide efficient help for B cells and also mediate allergic responses due to the capacity of T H 2 cells to induce IgE isotype switching and differentiation of B cells into IgE secreting cells (Punnonen et al. (1993) Proc. Nat'l. Acad. Sci. USA 90: 3730).
- the screening methods for improved cytokines, chemokines, and other accessory molecules are generally based on identification of modified molecules that exhibit improved specific activity on target cells that are sensitive to the respective cytokine, chemokine, or other accessory molecules.
- a library of recombinant cytokine, chemokine, or accessory molecule nucleic acids can be expressed on phage or as purified protein and tested using in vitro cell culture assays, for example.
- in vitro cell culture assays for example.
- the recombinant nucleic acids as components of DNA vaccines, one can identify the most optimal DNA sequences (in addition to the functions of the protein products) in terms of their immunostimulatory properties, transfection efficiency, and their capacity to improve the stabilities of the vectors.
- the identified optimized recombinant nucleic acids can then be subjected to new rounds of shuffling and selection.
- cytokines are evolved that direct differentiation of T H 1 cells. Because of their capacities to skew immune responses towards a T H 1 phenotype, the genes encoding interferon- ⁇ (IFN- ⁇ ) and interleukin-12 (IL-12) are preferred substrates for recombination and selection in order to obtain maximal specific activity and capacity to act as adjuvants in genetic vaccinations.
- IFN- ⁇ is a particularly preferred target for optimization using the methods of the invention because of its effects on the immune system, tumor cells growth and viral replication. Due to these activities, IFN- ⁇ was the first cytokine to be used in clinical practice. Today, IFN- ⁇ is used for a wide variety of applications, including several types of cancers and viral diseases.
- IFN- ⁇ also efficiently directs differentiation of human T cells into T H 1 phenotype (Parronchi et al. (1992) J. Immunol. 149: 2977). However, it has not been thoroughly investigated in vaccination models, because, in contrast to human systems, it does not affect T H 1 differentiation in mice. The species difference was recently explained by data indicating that, like IL-12, IFN- ⁇ induces STAT4 activation in human cells but not in murine cells, and STAT4 has been shown to be required in IL-12 mediated T H 1 differentiation (Thierfelder et al. (1996) Nature 382: 171).
- Family DNA shuffling is a preferred method for optimizing IFN- ⁇ , using as substrates the mammalian IFN- ⁇ genes, which are 85%-97% homologous. Greater than 10 26 distinct recombinants can be generated from the natural diversity in these genes.
- To allow rapid parallel analysis of recombinant interferons one can employ high throughput methods for their expression and biological assay as fusion proteins on bacteriophage. Recombinants with improved potency and selectivity profiles are being selectively bred for improved activity.
- Variants which demonstrate improved binding to IFN- ⁇ receptors can be selected for further analysis using a screen for mutants with optimal capacity to direct THI differentiation. More specifically, the capacities of IFN- ⁇ mutants to induce IL-2 and IFN- ⁇ production in in vitro human T lymphocyte cultures can be studied by cytokine-specific ELISA and cytoplasmic cytokine staining and flow cytometry.
- IL-12 is perhaps the most potent cytokine that directs T H 1 responses, and it has also been shown to act as an adjuvant and enhance T H 1 responses following genetic vaccinations (Kim et al. (1997) J. Immunol. 158: 816). IL-12 is both structurally and functionally a unique cytokine. It is the only heterodimeric cytokine known to date, composed of a 35 kD light chain (p35) and a 40 kD heavy chain (p40) (Kobayashi et al (1989) J. Exp. Med. 170: 827; Stern et al. (1990) Proc. Nat'l. Acad. Sci. USA 87: 6808). Recently Lieschke et al.
- IL-12 mutants can be expressed in CHO cells, for example, and the ability of the supernatants to induce T cell proliferation determined ( FIG. 6 ). The concentrations of IL-12 in the supernatants can be normalized based on a specific ELISA that detects a tag fused to the shuffled IL-12 molecules.
- IFN- ⁇ and/or IL-12 genes into genetic vaccine vectors is expected to be safe.
- the safety of IFN- ⁇ has been demonstrated in numerous clinical studies and in everyday hospital practice.
- a Phase II trial of IL-12 in the treatment of patients with renal cell cancer resulted in several unexpected adverse effects (Tahara et al. (1995) Human Gene Therapy 6: 1607).
- IL-12 gene as a component of genetic vaccines aims at high local expression levels, whereas the levels observed in circulation are minimal compared to those observed after systemic bolus injections.
- some of the adverse effects of systemic IL-12 treatments are likely to be related to its unusually long half-life (up to 48 hours in monkeys). DNA shuffling may allow selection for a shorter half-life, thereby reducing the toxicity even after high bolus doses.
- T H 2 responses are preferred, especially when improved antibody production is desired.
- IL-4 has been shown to direct differentiation of T H 2 cells (which produce high levels of IL-4, IL-5 and IL-13, and mediate allergic immune responses). Immune responses that are skewed towards T H 2 phenotype are preferred when genetic vaccines are used to immunize against autoimmune diseases prophylactically. T H 1 responses are also preferred when the vaccines are used to treat and modulate existing autoimmune responses, because autoreactive T cells are generally of T H 1 phenotype (Liblau et al. (1995) Immunol. Today 16: 34-38).
- IL-4 is also the most potent cytokine in induction of IgE synthesis; IL-4 deficient mice are unable to produce IgE. Asthma and allergies are associated with an increased frequency of IL-4 producing cells, and are genetically linked to the locus encoding IL-4, which is on chromosome 5 (in close proximity to genes encoding IL-3, IL-5, IL-9, IL-13 and GM-CSF).
- IL-4 which is produced by activated T cells, basophils and mast cells, is a protein that has 153 amino acids and two potential N-glycosylation sites. Human IL-4 is only approximately 50% identical to mouse IL-4, and IL-4 activity is species-specific. In human, IL-13 has activities similar to those of IL-4, but IL-13 is less potent than IL-4 in inducing IgE synthesis.
- IL-4 is the only cytokine known to direct T H 2 differentiation.
- Improved IL-2 agonists are also useful in directing T H 2 cell differentiation, whereas improved IL-4 antagonists can direct T H 1 cell differentiation.
- Improved IL-4 agonists and antagonists can be generated by shuffling of IL-4 or soluble IL-4 receptor.
- the IL-4 receptor consists of an IL-4R ⁇ -chain (140 kD high-affinity binding unit) and an IL-2R ⁇ -chain (these cytokine receptors share a common ⁇ -chain).
- the IL-4R ⁇ -chain is shared by IL-4 and IL-13 receptor complexes.
- Both IL-4 and IL-13 induce phosphorylation of the IL-4R ⁇ -chain, but expression of IL-4R ⁇ -chain alone on transfectants is not sufficient to provide a functional IL-4R.
- Soluble IL-4 receptor currently in clinical trials for the treatment of allergies. Using the DNA shuffling methods of the invention, one can evolve a soluble IL-4 receptor that has improved affinity for IL-4. Such receptors are useful for the treatment of asthma and other T H 2 cell mediated diseases, such as severe allergies.
- the shuffling reactions can take advantage of natural diversity present in cDNA libraries from activated T cells from human and other primates.
- a shuffled IL-4R ⁇ -chain library is expressed on a phage, and mutants that bind to IL-4 with improved affinity are identified. The biological activity of the selected mutants is then assayed using cell-based assays.
- IL-2 and IL-15 are also of particular interest for use in genetic vaccines.
- IL-2 acts as a growth factor for activated B and T cells, and it also modulates the functions of NK-cells.
- IL-2 is predominantly produced by T H 1-like T cell clones, and, therefore, it is considered mainly to function in delayed type hypersensitivity reactions.
- IL-2 also has potent, direct effects on proliferation and Ig-synthesis by B cells.
- the complex immunoregulatory properties of IL-2 are reflected in the phenotype of IL-2 deficient mice, which have high mortality at young age and multiple defects in their immune functions including spontaneous development of inflammatory bowel disease.
- IL-15 is a more recently identified cytokine produced by multiple cell types.
- IL-15 shares several, but not all, activities with IL-2. Both IL-2 and IL-15 induce B cell growth and differentiation. However, assuming that IL-15 production in IL-2 deficient mice is normal, it is clear that IL-15 cannot substitute for the function of IL-2 in vivo, since these mice have multiple immunodeficiencies. IL-2 has been shown to synergistically enhance IL-10-induced human Ig production in the presence of anti-CD40 mAbs, but it antagonized the effects of IL-4. IL-2 also enhances IL-4-dependent IgE synthesis by purified B cells. On the other hand, IL-2 was shown to inhibit IL-4-dependent murine IgG1 and IgE synthesis both in vitro and in vivo.
- IL-2 inhibited IL-4-dependent human IgE synthesis by unfractionated human PBMC, but the effects were less significant than those of IFN- ⁇ or IFN- ⁇ . Due to their capacities to activate both B and T cells, IL-2 and IL-15 are useful in vaccinations. In fact, IL-2, as protein and as a component of genetic vaccines, has been shown to improve the efficacy of the vaccinations. Improving the specific activity and/or expression levels/kinetics of IL-2 and IL-15 through use of the DNA shuffling methods of the invention increases the advantageous effects compared to wild-type IL-2 and IL-15.
- IL-6 is a monocyte-derived cytokine that was originally described as a B cell differentiation factor or B cell stimulatory factor-2 because of its ability to enhance Ig levels secreted by activated B cells. IL-6 has also been shown to enhance IL-4-induced IgE synthesis. It has also been suggested that IL-6 is an obligatory factor for human IgE synthesis, because neutralizing anti-IL-6 mAbs completely blocked IL-4-induced IgE synthesis. IL-6 deficient mice have impaired 6 can enhance the levels of specific antibodies produced following vaccination.
- IL-6 with improved specific activity and/or with improved expression levels, obtained by DNA shuffling, will have more beneficial effects than the wild-type IL-6.
- Interleukin-8 is another example of a cytokine that, when modified according to the methods of the invention, is useful in genetic vaccines
- IL-8 was originally identified as a monocyte-derived neutrophil chemotactic and activating factor. Subsequently, IL-8 was also shown to be chemotactic for T cells and to activate basophils resulting in enhanced histamine and leukotriene release from these cells. Furthermore, IL-8 inhibits adhesion of neutrophils to cytokine-activated endothelial cell monolayers, and it protects these cells from neutrophil-mediated damage. Therefore, endothelial cell derived IL-8 was suggested to attenuate inflammatory events occurring in the proximity of blood vessel walls.
- IL-8 also modulates immunoglobulin production, and inhibits IL-4-induced IgG4 and IgE synthesis by both unfractionated human PBMC and purified B cells in vitro. This inhibitory effect was independent of IFN- ⁇ , IFN- ⁇ or prostaglandin E2.
- IL-8 inhibited spontaneous IgE synthesis by PBMC derived from atopic patients. Due to its capacity to attract inflammatory cells, IL-8, like other chemotactic agents, is useful in potentiating the functional properties of vaccines, including DNA vaccines (acting as an adjuvant).
- the beneficial effects of IL-8 can be improved by using the DNA shuffling methods of the invention to obtain IL-8 with improved specific activity and/or with improved expression in target cells.
- Interleukin-5 and antagonists thereof, can also be optimized using the methods of the invention for use in genetic vaccines.
- IL-5 is primarily produced by T H 2-type T cells and appears to play an important role in the pathogenesis of allergic disorders because of its ability to induce eosinophilia.
- IL-5 acts as an eosinophil differentiation and survival factor in both mouse and man.
- Blocking IL-5 activity by use of neutralizing monoclonal antibodies strongly inhibits pulmonary eosinophilia and hyperactivity in mouse models, and IL-5 deficient mice do not develop eosinophilia.
- IL-5 has also been shown to enhance both proliferation of, and Ig synthesis by, activated mouse and human B cells.
- IL-5 has no effect on proliferation of human B cells, whereas it activated eosinophils.
- IL-5 apparently is not crucial for maturation or differentiation of conventional B cells, because antibody responses in IL-5 deficient mice are normal.
- these mice have a developmental defect in their CD5 + B cells indicating that IL-5 is required for normal differentiation of this B cell subset in mice.
- IL-5 was shown to enhance IgE synthesis by human B cells in vitro.
- a recent study suggested that the effects of IL-5 on human B cells depend on the mode of B cell stimulation.
- IL-5 significantly enhanced IgM synthesis by B cells stimulated with Moraxella catarrhalis.
- IL-5 synergized with suboptimal concentrations of IL-2, but had no effect on Ig synthesis by SAC-activated B cells.
- Activated human B cells also expressed IL-5 mRNA suggesting that IL-5 may also regulate B cell function, including IgE synthesis, by autocrine mechanisms.
- the invention provides methods of evolving an IL-5 antagonist that efficiently binds to and neutralizes IL-5 or its receptor. These antagonists are useful as a component of vaccines used for prophylaxis and treatment of allergies.
- Nucleic acids encoding IL-5 for example, from human and other mammalian species, are shuffled and screened for binding to immobilized IL-5R for the initial screening. Polypeptides that exhibit the desired effect in the initial screening assays can then be screened for the highest biological activity using assays such as inhibition of growth of IL-5 dependent cells lines cultured in the presence of recombinant wild-type IL-5. Alternatively, shuffled IL-5R ⁇ -chains are screened for improved binding to IL-5.
- TNF- ⁇ Tumor necrosis factors ( ⁇ and ⁇ ) and their receptors are also suitable targets for modification and use in genetic vaccines.
- TNF- ⁇ which was originally described as cachectin because of its ability to cause necrosis of tumors, is a 17 kDa protein that is produced in low quantities by almost all cells in the human body following activation. TNF- ⁇ acts as an endogenous pyrogen and induces the synthesis of several proinflammatory cytokines, stimulates the production of acute phase proteins, and induces proliferation of fibroblasts. TNF- ⁇ plays a major role in the pathogenesis of endotoxin shock.
- TNF- ⁇ A membrane-bound form of TNF- ⁇ (mTNF- ⁇ ), which is involved in interactions between B- and T-cells, is rapidly upregulated within four hours of T cell activation.
- mTNF- ⁇ plays a role in the polyclonal B cell activation observed in patients infected with HIV.
- Monoclonal antibodies specific for mTNF- ⁇ or the p55 TNF- ⁇ receptor strongly inhibit IgE synthesis induced by activated CD4 + T cell clones or their membranes.
- Mice deficient for p55 TNF- ⁇ R are resistant to endotoxic shock, and soluble TNF- ⁇ R prevents autoimmune diabetes mellitus in NOD mice.
- Phase III trials using sTNF- ⁇ R in the treatment of rheumatoid arthritis are in progress, after promising results obtained in the phase II trials.
- the methods of the invention can be used to, for example, evolve a soluble TNF- ⁇ R that has improved affinity, and thus is capable of acting as an antagonist for TNF activity.
- Nucleic acids that encode TNF- ⁇ R and exhibit sequence diversity, such as the natural diversity observed in cDNA libraries from activated T cells of human and other primates, are shuffled.
- the shuffled nucleic acids are expressed, e.g., on phage, after which mutants are selected that bind to TNF- ⁇ with improved affinity.
- the improved mutants can be subjected to further assays using biological activity, and the shuffled genes can be subjected to one or more rounds of shuffling and screening.
- the receptor for IFN- ⁇ consists of a binding component glycoprotein of 90 kD, a 228 amino acid extracellular portion, a transmembrane region, and a 222 amino acid intracellular region. Glycosylation is not required for functional activity.
- a single chain provides high affinity binding (10 ⁇ 9 -10 ⁇ 10 M), but is not sufficient for signaling. Receptor components dimerize upon ligand binding.
- the mouse IFN- ⁇ receptor is 53% identical to that of mouse at the amino acid level. The human and mouse receptors only bind human and mouse IFN- ⁇ , respectively.
- Vaccinia, cowpox and camelpox viruses have homologues of sIFN- ⁇ R, which have relatively low amino acid sequence similarity ( ⁇ 20%), but are capable of efficient neutralization of IFN- ⁇ in vitro. These homologues bind human, bovine, rat (but not mouse) IFN- ⁇ , and may have in vivo activity as IFN- ⁇ antagonists. All eight cysteines are conserved in human, mouse, myxoma and Shope fibroma virus (6 in vaccinia virus) IFN- ⁇ R polypeptides, indicating similar 3-D structures. An extracellular portion of mIFN- ⁇ R with a kD of 100-300 pM has been expressed in insect cells.
- mice a mouse model of human SLE
- msIFN- ⁇ receptor 100 mg/three times a week i.p.
- All mice treated with sIFN- ⁇ or anti-IFN- ⁇ mAbs were alive 4 weeks after the treatment was discontinued, compared with 50% in a placebo group, and 78% of IFN- ⁇ -treated mice died.
- the methods of the invention can be used to evolve soluble IFN- ⁇ R receptor polypeptides with improved affinity, and to evolve IFN- ⁇ with improved specific activity and improved capacity to activate cellular immune responses.
- nucleic acids encoding the respective polypeptide, and which exhibit sequence diversity e.g., that observed in cDNA libraries from activated T cells from human and other primates
- sequence diversity e.g., that observed in cDNA libraries from activated T cells from human and other primates
- the library of shuffled nucleic acids can be expressed on phage, which are screened to identify mutants that bind to IFN- ⁇ with improved affinity.
- the shuffled library is analyzed for improved specific activity and improved activation of the immune system, for example, by using activation of monocytes/macrophages as an assay.
- the evolved IFN- ⁇ molecules can improve the efficacy of vaccinations (e.g. when used as adjuvants).
- Diseases that can be treated using high-affinity sIFN- ⁇ R polypeptides obtained using the methods of the invention include, for example, multiple sclerosis, systemic lupus erythematosus (SLE), organ rejection after treatment, and graft versus host disease.
- Multiple sclerosis for example, is characterized by increased expression of IFN- ⁇ in the brain of the patients, and increased production of IFN- ⁇ by patients' T cells in vitro. IFN- ⁇ treatment has been shown to significantly exacerbate the disease (in contrast to EAE in mice).
- Transforming growth factor (TGF)- ⁇ is another cytokine that can be optimized for use in genetic vaccines using the methods of the invention.
- TGF- ⁇ has growth regulatory activities on essentially all cell types, and it has also been shown to have complex modulatory effects on the cells of the immune system.
- TGF- ⁇ inhibits proliferation of both B and T cells, and it also suppresses development of and differentiation of cytotoxic T cells and NK cells.
- TGF- ⁇ has been shown to direct IgA switching in both murine and human B cells. It was also shown to induce germline a transcription in murine and human B cells, supporting the conclusion that TGF- ⁇ can specifically induce IgA switching.
- TGF- ⁇ Due to its capacity to direct IgA switching, TGF- ⁇ is useful as a component of DNA vaccines which aim at inducing potent mucosal immunity, e.g. vaccines for diarrhea. Also, because of its potent anti-proliferative effects TGF- ⁇ is useful as a component of therapeutical cancer vaccines. TGF- ⁇ with improved specific activity and/or with improved expression levels/kinetics will have increased beneficial effects compared to the wild-type TGF- ⁇ .
- Cytokines that can be optimized using the methods of the invention also include granulocyte colony stimulating factor (G-CSF) and granulocyte/macrophage colony stimulating factor (GM-CSF). These cytokines induce differentiation of bone marrow stem cell into granulocytes/macrophages.
- G-CSF granulocyte colony stimulating factor
- GM-CSF granulocyte/macrophage colony stimulating factor
- G-CSF has a homodimeric receptor (dimeric with kD of ⁇ 200 pM, monomeric ⁇ 2-4 nM), and the receptor for GM-CSF is a three subunit complex.
- G-CSF is nontoxic and is presently working very well as a drug. However, the treatment is expensive, and more potent G-CSF might reduce the cost for patients and to the health care. Treatments with these cytokines are typically short-lasting and the patients are likely to never need the same treatment again reducing likelihood of problems with immunogenicity.
- the methods of the invention are useful for evolving G-CSF and/or GM-CSF which have improved specific activity, as well as other polypeptides that have G-CSF and/or GM-CSF activity.
- G-CSF and/or GM-CSF nucleic acids having sequence diversity e.g., those obtained from cDNA libraries from diverse species, are shuffled to create a library of shuffled G-CSF and/or GM-CSF genes.
- These libraries can be screened by, for example, picking colonies, transfecting the plasmids into a suitable host cell (e.g., CHO cells), and assaying the supernatants using receptor-positive cell lines.
- phage display or related techniques can be used, again using receptor-positive cell lines.
- Yet another screening method involves transfecting the shuffled genes into G-CSF/GM-CSF-dependent cell lines. The cells are grown one cell per well and/or at very low density in large flasks, and the cells that grow fastest are selected. Shuffled genes from these cells are isolated; if desired, these genes can be used for additional rounds of shuffling and selection.
- Ciliary neurotrophic factor is another suitable target for application of the methods of the invention.
- CNTF has 200 amino acids which exhibit 80% sequence identity between rat and rabbit CNTF polypeptides.
- CNTF has IL-6-like inflammatory effects, and induces synthesis of acute phase proteins.
- CNTF is a cytosolic protein which belongs to the IL-6/IL-11/LIF/oncostatin M-family, and becomes biologically active only after becoming available either by cellular lesion or by an unknown release mechanism.
- CNTF is expressed by myelinating Schwann cells, astrocytes and sciatic nerves. Structurally, CNTF is a dimeric protein, with a novel anti-parallel arrangement of the subunits.
- Each subunit adopts a double crossover four-helix bundle fold, in which two helices contribute to the dimer interface. Lys-155 mutants lose activity, and some Glu-153 mutants have 5-10 higher biological activity.
- the receptor for CNTF consists of a specific CNTF receptor chain, gp130, and a LIF- ⁇ receptor.
- the CNTFR ⁇ -chain lacks a transmembrane domain portion, instead being GPI-anchored.
- CNTF can mediate CNTFR-independent responses. Soluble CNTFR binds CNTF and thereafter can bind to LIFR and induce signaling through gp130.
- CNTF enhances survival of several types of neurons, and protects neurons in an animal model of Huntington disease (in contrast to NGF, neurotrophic factor, and neurotrophin-3).
- CNTF receptor knockout mice have severe motor neuron deficits at birth, and CNTF knockout mice exhibit such deficits postnatally.
- CNTF also reduces obesity in mouse models. Decreased expression of CNTF is sometimes observed in psychiatric patients.
- Phase I studies in patients with ALS annual incidence ⁇ 1/100 000, 5% familiar cases, 90% die within 6 years
- found significant side effects after doses higher than 5 mg/kg/day subcutaneously including anorexia, weight loss, reactivation of herpes simplex virus (HSV1), cough, increased oral secretions).
- Antibodies against CNTF were detected in almost all patients, thus illustrating the need for alternative CNTF with different immunological properties.
- the recombination and screening methods of the invention can be used to obtain modified CNTF polypeptides that exhibit decreased immunogenicity in vivo; higher specific activity is also obtainable using the methods.
- Shuffling is conducted using nucleic acids encoding CNTF.
- an IL-6/LIF/(CNTF) hybrid is obtained by shuffling using an excess of oligonucleotides that encode to the receptor binding sites of CNTF.
- Phage display can then be used to test for lack of binding to the IL-6/LIF receptor. This initial screen is followed by a test for high affinity binding to the CNTF receptor, and, if desired, functional assays using CNTF responsive cell lines.
- the shuffled CNTF polypeptides can be tested to identify those that exhibit reduced immunogenicity upon administration to a mammal.
- Another way in which the recombination and screening methods of the invention can be used to optimize CNTF is to improve secretion of the polypeptide.
- a CNTF cDNA is operably linked to a leader sequence of hNGF, only 35-40 percent of the total CNTF produced is secreted.
- Target diseases for treatment with optimized CNTF include obesity, amyotrophic lateral sclerosis (ALS, Lou Gehrig's disease), diabetic neuropathy, stroke, and brain surgery.
- ALS amyotrophic lateral sclerosis
- ALS Lou Gehrig's disease
- diabetic neuropathy stroke, and brain surgery.
- chemokines can also be optimized using the methods of the invention and included in a genetic vaccine vector.
- At least three classes of chemokines are known, based on structure: C chemokines (such as lymphotactin), C—C chemokines (such as MCP-1, MCP-2, MCP-3, MCP-4, MIP-1a, MIP-1b, RANTES), C—X—C chemokines (such as IL-8, SDF-1, ELR, Mig, IP10) (Premack and Schall (1996) Nature Med. 2: 1174).
- Chemokines can attract other cells that mediate immune and inflammatory functions, thereby potentiating the immune response.
- Cells that are attracted by different types of chemokines include, for example, lymphocytes, monocytes and neutrophils.
- C—X—C chemokines are chemoattractants for neutrophils but not for monocytes
- C—C chemokines attract monocytes and lymphocytes but not neutrophils
- C chemokine attracts lymphocytes.
- Genetic vaccine vectors can also include optimized recombinant polynucleotides that encode surface-bound accessory molecules, such as those that are involved in modulation and potentiation of immune responses. These molecules, which include, for example, B7-1 (CD80), B7-2 (CD86), CD40, ligand for CD40, CTLA-4, CD28, and CD150 (SLAM), can be subjected to DNA shuffling to obtain variants have altered and/or improved activities.
- B7-1 CD80
- B7-2 CD86
- CD40 ligand for CD40
- CTLA-4 CTLA-4
- CD28 CD150
- CD1 are nonpolymorphic molecules that are structurally and functionally related to MHC molecules. Importantly, CD1 has MHC-like activities, and it can function as an antigen presenting molecule (Porcelli (1995) Adv. Immunol. 59: 1). CD1 is highly expressed on dendritic cells, which are very efficient antigen presenting cells. Simultaneous transfection of target cells with DNA vaccine vectors encoding CD1 and an antigen of interest is likely to boost the immune response.
- CD1 cells in contrast to MHC molecules, exhibit limited allelic diversity in an outbred population (Porcelli, supra.), large populations of individuals with different genetic backgrounds can be vaccinated with one CD1 allele.
- the functional properties of CD1 molecules can be improved by the DNA shuffling methods of the invention.
- HSP70 heat shock proteins
- HSP70 has been shown to act as adjuvant for induction of CD8 + T cell activation and it enhances immunogenicity of specific antigenic peptides (Blachere et al. (1997) J. Exp. Med. 186: 1315-22).
- DNA shuffling can be used to further improve the properties, including adjuvant activity, of heat shock proteins, such as HSP70.
- cytokine, chemokine, and accessory molecule polypeptides can be used to influence the type of immune response to a given stimulus.
- administration of polypeptides sometimes has shortcomings, including short half life, high expense, difficult to store (must be stored at 4° C.), and a requirement for large volumes. Also, bolus injections can sometimes cause side effects.
- Administration of polynucleotides that encode the recombinant cytokines or other molecules overcomes most or all of these problems.
- DNA for example, can be prepared in high purity, is stable, temperature resistant, noninfectious, easy to manufacture.
- polynucleotide-mediated administration of cytokines can provide long-lasting, consistent expression, and administration of polynucleotides in general is regarded as being safe.
- cytokines, chemokines and accessory molecules are redundant and pleiotropic, and therefore can be difficult to determine which cytokines or cytokine combinations are the most potent in inducing and enhancing antigen specific immune responses following vaccination. Furthermore, the most useful combination of cytokines and accessory molecules is typically different depending on the type of immune response that is desired following vaccination.
- IL-4 has been shown to direct differentiation of T H 2 cells (which produce high levels of IL-4, IL-5 and IL-13, and mediate allergic immune responses), whereas IFN- ⁇ and IL-12 direct differentiation of T H 1 cells (which produce high levels of IL-2 and IFN- ⁇ ), and mediate delayed type immune responses.
- cytokines and accessory molecules are also likely to depend on the antigen used in the vaccination.
- the invention provides a solution to this problem of obtaining an optimized genetic vaccine cocktail. Different combinations of cytokines, chemokines and accessory molecules are assembled into vectors using the methods described herein. These vectors are then screened for their capacity to induce immune responses in vivo and in vitro.
- a library of different vectors can be generated by assembling different evolved promoters, (evolved) cytokines, (evolved) cytokine antagonists, (evolved) chemokines, (evolved) accessory molecules and immunostimulatory sequences, each of which can be prepared using methods described herein. DNA sequences and compounds that facilitate the transfection and expression can be included. If the pathogen(s) is known, specific DNA sequences encoding immunogenic antigens from the pathogen can be incorporated into these vectors providing protective immunity against the pathogen(s) (as in genetic vaccines).
- Initial screening is preferably carried out in vitro.
- the library can be introduced into cells which are tested for ability to induce differentiation of T cells capable of producing cytokines that are indicative of the type of immune response desired.
- the library is screened to identify recombinant polynucleotides that are capable of inducing T cells to produce IL-2 and IFN- ⁇ , while screening for induction of T cell production of IL-4, IL-5, and IL-13 is performed to identify recombinant polynucleotides that favor a T H 2 response.
- Screening can also be conducted in vivo, using animal models.
- vectors produced using the methods of the invention can be tested for ability to protect against a lethal infection.
- Another screening method involves injection of Leishmania major parasites into footpads of BALB/c mice (nonhealer). Pools of plasmids are injected i.v., i.p. or into footpads of these mice and the size of the footpad swelling is followed.
- Yet another in vivo screening method involves detection of IgE levels after infection with Nippostrongylus brasiliensis . High levels indicate a T H 2 response, while low levels of IgE indicate a T H 1 response.
- In vitro screening can be conducted to test for human T H 1 or T H 2 phenotype, or for other desired immune response.
- Vectors can also be tested for ability to induce protection against infection in humans.
- immunostimulating DNA vaccine vectors may not only be useful in the treatment of a number of infectious diseases but also in prevention of the infections, when the vectors are delivered to the sites of the entry of the pathogen (e.g., the lung or gut).
- pathogen e.g., the lung or gut
- the invention also provides methods for obtaining optimized recombinant polynucleotides that encode a peptide or polypeptide that can interact with a cellular receptor that is involved in mediating an immune response.
- the optimized recombinant polynucleotides can act as an agonist or an antagonist of the receptor.
- Cytokine antagonists can be used as components of genetic vaccine cocktails. Blocking immunosuppressive cytokines, rather than adding single proinflammatory cytokines, is likely to potentiate the immune response in a more general manner, because several pathways are potentiated at the same time. By appropriate choice of antagonist, one can tailor the immune response induced by a genetic vaccine in order to obtain the response that is most effective in achieving the desired effect. Antagonists against any cytokine can be used as appropriate; particular cytokines of interest for blocking include, for example, IL-4, IL-13, IL-0, and the like.
- the invention provides methods of obtaining cytokine antagonists that exhibit greater effectiveness in blocking the action of the respective cytokine.
- Polynucleotides that encode improved cytokine antagonists can be obtained by using gene shuffling to generate a recombinant library of polynucleotides which are then screened to identify those that encode an improved antagonist.
- substrates for the DNA shuffling one can use, for example, polynucleotides that encode receptors for the respective cytokine. At least two forms of the substrate will be present in the recombination reaction, with each form differing from the other in at least one nucleotide position.
- the different forms of the polynucleotide are homologous cytokine receptor genes from different organisms.
- the resulting library of recombinant polynucleotides is then screened to identify those that encode cytokine antagonists with the desired affinity and biological activity.
- IL-10 is discussed. The same rationale can be applied to obtaining and using antagonists of other cytokines.
- Interleukin-10 (IL-10) is perhaps the most potent anti-inflammatory cytokine known to date. IL-10 inhibits a number of pathways that potentiate inflammatory responses.
- the biological activities of IL-10 include inhibition of MHC class II expression on monocytes, inhibition of production of IL-1, IL-6, IL-12, TNF- ⁇ by monocytes/macrophages, and inhibition of proliferation and IL-2 production by T lymphocytes.
- IL-10 deficient mice These mice are growth-retarded, anemic and spontaneously develop an inflammatory bowel disease (Kuhn et al. (1993) Cell 75: 263). In addition, both innate and acquired immunity to Listeria monocytogenes were shown to be elevated in IL-10 deficient mice (Dai et al. (1997) J. Immunol. 158: 2259). It has also been suggested that genetic differences in the levels of IL-10 production may affect the risk of patients to die from complications meningococcal infection. Families with high IL-0 production had 20-fold increased risk of fatal outcome of meningococcal disease (Westendorp et al. (1997) Lancet 349: 170).
- IL-10 has been shown to activate normal and malignant B cells in vitro, but it does not appear to be a major growth promoting cytokine for normal B cells in vivo, because IL-10 deficient mice have normal levels of B lymphocytes and Ig in their circulation. In fact, there is evidence that IL-10 can indirectly downregulate B cell function through inhibition of the accessory cell function of monocytes. However, IL-10 appears to play a role in the growth and expansion of malignant B cells. Anti-IL-10 monoclonal antibodies and IL-10 antisense oligonucleotides have been shown to inhibit transformation of B cells by EBV in vitro.
- B cell lymphomas are associated with EBV and most EBV + lymphomas produce high levels of IL-10, which is derived both from the human gene and the homologue of IL-10 encoded by EBV. AIDS-related B cell lymphomas also secrete high levels of IL-10. Furthermore, patients with detectable serum IL-0 at the time of diagnosis of intermediate/high-grade non-Hodgkin's lymphoma have short survival, further suggesting a role for IL-10 in the pathogenesis of B cell malignancies.
- Antagonizing IL-10 in vivo can be beneficial in several infectious and malignant diseases, and in vaccination.
- the effect of blocking of IL-10 is an enhancement of immune responses that is independent of the specificity of the response. This is useful in vaccinations and in the treatment of serious infectious diseases.
- an IL-10 antagonist is useful in the treatment of B cell malignancies which exhibit overproduction of IL-10 and viral IL-10, and it may also be useful in boosting general anti-tumor immune response in cancer patients.
- Combining an IL-10 antagonist with gene therapy vectors may be useful in gene therapy of tumor cells in order to obtain maximal immune response against the tumor cells.
- IL-10 with improved specific activity would have potential in the treatment of autoimmune diseases and inflammatory bowel diseases.
- IL-10 with improved specific activity may also be useful as a component of gene therapy vectors in reducing the immune response against vectors which are recognized by memory cells and it may also reduce the immunogenicity of these vectors.
- IL-10R soluble form of IL-10 receptor
- Kd Kd
- surface-bound receptor has affinity of 35-200 pM. Consequently, 150-fold molar excess of sIL-10R is required for half-maximal inhibition of biological function of IL-10.
- affinity of viral IL-10 (IL-10 homologue encoded by Epstein-Barr virus) to sIL-10R is more than 1000 fold less than that of hIL-10, and in some situations, such as when treating EBV-associated B cell malignancies, it may be beneficial if one can also block the function of viral IL-10. Taken together, this soluble form of IL-10R is unlikely to be effective in antagonizing IL-10 in vivo.
- DNA shuffling can be performed using polynucleotides that encode IL-10 receptor.
- IL-10 receptor with higher than normal affinity will function as an IL-10 antagonist, because it strongly reduces the amount of IL-10 available for binding to functional, wild-type IL-10R.
- IL-10R is shuffled using homologous cDNAs encoding IL-10R derived from human and other mammalian species. An alignment of human and mouse IL-10 receptor sequences is shown in FIG. 14 to illustrate the feasibility of family DNA shuffling when evolving IL-10 receptors with improved affinity.
- a phage library of IL-10 receptor recombinants can be screened for improved binding of shuffled IL-10R to human or viral IL-10. Wild-type IL-10 and/or viral IL-10 are added at increasing concentrations to demand for higher affinity. Phage bound to IL-10 can be recovered using anti-IL-10 monoclonal antibodies. If desired, the shuffling can be repeated one or more times, after which the evolved soluble IL-10R is analyzed in functional assays for its capacity to neutralize the biological activities of IL-10/viral IL-10.
- evolved soluble IL-10R is studied for its capacity to block the inhibitory effects of IL-10 on cytokine synthesis and MHC class II expression by monocytes, proliferation by T cells, and for its capacity to inhibit the enhancing effects of IL-10 on proliferation of B cells activated by anti-CD40 monoclonal antibodies.
- An IL-10 antagonist can also be generated by evolving IL-10 to obtain variants that bind to IL-10R with higher than wild-type affinity, but without receptor activation.
- the advantage of this approach is that one can evolve an IL-10 molecule with improved specific activity using the same methods.
- IL-10 is shuffled using homologous cDNAs encoding IL-10 derived from human and other mammalian species.
- a gene encoding viral IL-10 can be included in the shuffling.
- a library of IL-10 recombinants is screened for improved binding to human IL-10 receptor. Library members bound to IL-10R can be recovered by anti-IL-10R monoclonal antibodies.
- This screening protocol is likely to result in IL-10 molecules with both antagonistic and agonistic activities. Because initial screen demands for higher affinity, a proportion of the agonists are likely to have improved specific activity when compared to wild-type human IL-10.
- the functional properties of the mutant IL-10 molecules are determined in biological assays similar to those described above for ultrahigh-affinity IL-10 receptors (cytokine synthesis and MHC class II expression by monocytes, proliferation of B and T cells).
- An antagonistic IL-4 mutant has been previously generated illustrating the general feasibility of the approach (Kruse et al. (1992) EMBO J. 11: 3237-3244).
- One amino acid mutation in IL-4 resulted in a molecule that efficiently binds to IL-4R ⁇ -chain but has minimal IL-4-like agonistic activity.
- IL-20/mda-7 is a 206 amino acid secreted protein. This protein was originally characterized as mda-7, which is a melanoma cell-derived negative regulator of tumor cell growth (Jiang et al. (1995) Oncogene 11: 2477; (1996) Proc. Nat'l. Acad. Sci. USA 93: 9160).
- IL-20/mda-7 is structurally related to IL-10, and it antagonizes several functions of IL-10 (Abstract of the 13th European Immunology Meeting, Amsterdam, 22-25 June 1997).
- IL-20/mda-7 enhances expression of CD80 (B7-0.1) and CD86 (B7-2) on human monocytes and it upregulates production of TNF- ⁇ and IL-6.
- IL-20/mda-7 also enhances production of IFN- ⁇ by PHA-activated PBMC.
- the invention provides methods of improving genetic vaccines by incorporation of IL-20/mda-7 genes into the genetic vaccine vectors. The methods of the invention can be used to obtain IL-20/mda-7 variants that exhibit improved ability to antagonize IL-10 activity.
- a transmembrane form of the antagonist can be generated.
- the soluble form can be given in purified polypeptide form to patients by, for example, intravenous injection.
- a polynucleotide encoding the cytokine antagonist can be used as a component as a component of a genetic vaccine or a gene therapy vector.
- either or both of the soluble and transmembrane forms can be used.
- both soluble and transmembrane forms of the antagonist are encoded by the same vector, the target cells express both forms, resulting in maximal inhibition of cytokine function on the target cell surface and in their immediate vicinity.
- the peptides or polypeptides obtained using these methods can substitute for the natural ligands of the receptors, such as cytokines or other costimulatory molecules in their ability to exert an effect on the immune system via the receptor.
- cytokines or other costimulatory molecules themselves is that an autoimmune reaction could be induced against the natural molecule, either due to breaking tolerance (if using a natural cytokine or other molecule) or by inducing cross-reactive immunity (humoral or cellular) when using related but distinct molecules.
- the optimized agonist or antagonist obtained using the methods of the invention is about 50 amino acids or length or less, more preferably about 30 amino acids or less, and most preferably is about 20 amino acids in length, or less.
- the agonist or antagonist peptide is preferably at least about 4 amino acids in length, and more preferably at least about 8 amino acids in length.
- Polynucleotides that flank the coding sequence of the mimetic peptide can also be optimized using the methods of the invention in order to optimize the expression, conformation, or activity of the mimetic peptide.
- the optimized agonist or antagonist peptides or polypeptides are obtained by generating a library of recombinant polynucleotides and screening the library to identify those that encode a peptide or polypeptide that exhibits an enhanced ability to modulate an immune response.
- the library can be produced using methods such as DNA shuffling or other methods described herein or otherwise known to those of skill in the art. Screening is conveniently conducted by expressing the peptides encoded by the library members on the surface of a population of replicable genetic packages and identifying those members that bind to a target of interest, e.g., a receptor.
- the optimized recombinant polynucleotides that are obtained using the methods of the invention can be used in several ways.
- the polynucleotide can be placed in a genetic vaccine vector, under the control of appropriate expression control sequences, so that the mimetic peptide is expressed upon introduction of the vector into a mammal.
- the poly nucleotide can be placed in the vector embedded in the coding sequence of the surface protein (e.g., geneIII or geneVIII) in order to preserve the conformation of the mimetic.
- the mimetic-encoding polynucleotide can be inserted directly into the antigen-encoding sequence of the genetic vaccine to form a coding sequence for a “mimotope-on-antigen” structure.
- the polynucleotide that encodes the mimotope-on-antigen structure can be used within a genetic vaccine, or can be used to express a protein that is itself administered as a vaccine.
- a coding sequence of a mimetic peptide is introduced into a polynucleotide that encodes the “M-loop” of the hepatitis B surface antigen (HBsAg) protein.
- the M-loop is a six amino acid peptide sequence bounded by cysteine residues, which is found at amino acids 139-147 (numbering within the S protein sequence).
- the M-loop in the natural HBsAg protein is recognized by the monoclonal antibody RFHB7 (Chen et al., Proc. Nat'l. Acad. Sci. USA, 93: 1997-2001 (1996)). According to Chen et al., the M-loop forms an epitope of the HBsAg that is non-overlapping and separate from at least four other HBsAg epitopes.
- amino acids 139-147 are likely in a cyclic conformation. This structure is therefore similar to that found in the regions of the filamentous phage proteins pIII and pVIII where mimotope sequences are placed. Therefore, one can insert a mimotope obtained using the methods of the invention into this region of the HBsAg amino acid sequence.
- the chemokine receptor CCR6 is an example of a suitable target for a peptide mimetic obtained using the methods.
- the CCR6 receptor is a 7-transmembrane domain protein (Dieu et al., Biochem. Biophys. Res. Comm. 236: 212-217 (1997) and J. Biol. Chem. 272: 14893-14898 (1997)) that is involved in the chemoattraction of immature dendritic cells, which are found in the blood and migrate to sites of antigen uptake (Dieu et al., J. Exp. Med. 188: 373-386 (1998)).
- CCR6 binds the chemokine MIP-3 ⁇ , so a mimetic peptide that is capable of activating CCR6 can provide a further chemoattractant function to a given antigen and thus promote uptake by dendritic cells after immunization with the antigen antigen-mimetic fusion or a DNA vector that expresses the antigen.
- Another application of this method of the invention is to obtain molecules that can act as an agonist for the macrophage scavenger receptor (MSR; see, Wloch et al., Hum. Gene Ther. 9: 1439-1447 (1998)).
- MSR macrophage scavenger receptor
- the MSR is involved in mediating the effects of various immunomodulators.
- bacterial DNA including the plasmids used in DNA vaccination, and oligonucleotides, which are often potent immunostimulators.
- Oligonucleotides of certain chemical structure e.g., phosphothio-oligonucleotides
- bacterial or plasmid DNA must be used in relatively large quantities to produce an effect.
- MSR Also mediated by the MSR is the ability of oligonucleotides that contain dG residues to stimulate B cells and enhance the activity of immunostimulatory CpG motifs, and of lipopolysaccharides to activate macrophages. Some of these activities are toxic.
- the methods of the invention can be used to obtain mimetics of one or ore of these immunomodulators that bind to the MSR with high affinity but are devoid of oxic properties. Such mimetic peptides are useful as immunostimulators or adjuvants.
- the MSR is a trimeric integral membrane glycoprotein.
- the three extracellular C-terminal cysteine-rich regions are connected to the transmembrane domain by a fibrous region that is composed of an ⁇ -helical coil and a collagen-like triple helix (see, Kodama et al, Nature 343: 531-535 (1990)). Therefore, screening of the library of recombinant polynucleotides can be accomplished by expressing the extracellular receptor structure and artificially attaching it to plastic surfaces.
- the libraries can be expressed, e.g., by phage display, and screened to identify those that bind to the receptors with high affinity.
- the optimized recombinant polynucleotides identified by this method can be incorporated into antigen-encoding sequences to evaluate their modulatory effect on the immune response.
- T cell activation is initiated when T cells recognize their specific antigenic peptides in the context of MHC molecules on the plasma membrane of antigen presenting cells (APC), such as monocytes, dendritic cells (DC), Langerhans cells or B cells.
- APC antigen presenting cells
- CD4 + T cells requires recognition by the T cell receptor (TCR) of an antigenic peptide in the context of MHC class II molecules, whereas CD8 + T cells recognize peptides in the context of MHC class I molecules.
- the costimulatory signal is mediated via CD28, which binds to its ligands B7-1 (CD80) or B7-2 (CD86), typically expressed on the antigen presenting cells. In the absence of the costimulatory signal, no T cell activation occurs, or T cells are rendered anergic.
- CTLA-4 CD152
- CTLA-4 CD152
- CTLA-4 mediates a negative regulatory signal to T cells and/or to induce anergy and tolerance (Walunas et al. (1994) Immunity 1: 405; Karandikar et al. (1996) J. Exp. Med. 184: 783).
- B7-1 and B7-2 have been shown to be able to regulate several immunological responses, and they have been implicated to be of importance in the immune regulation in vaccinations, allergy, autoimmunity and cancer.
- Gene therapy and genetic vaccine vectors expressing B7-1 and/or B7-2 have also been shown to have therapeutic potential in the treatment of the above mentioned diseases and in improving the efficacy of genetic vaccines.
- FIG. 10 illustrates interaction of APC and CD4 + T cells, but the same principle is true with CD8 + T cells, with the exception that the T cells recognize the antigenic peptides in the context of MHC class I molecules.
- Both B7-1 and B7-2 bind to CD28 and CTLA-4, even though the sequence similarities between these four molecules are very limited (20-30%). It is desirable to obtain mutations in B7-1 and B7-2 that only influence binding to one ligand but not to the other, or improve activity through one ligand while decreasing the activity through the other. Moreover, because the affinities of B7 molecules to their ligands appear to be relatively low, it would also be desirable to find mutations that improve/alter the activities of the molecules. However, rational design does not enable predictions of useful mutations because of the complexity of the molecules.
- the invention provides methods of overcoming these difficulties, enabling one to generate and identify functionally different B7 molecules with altered relative capacities to induce T cell activation, differentiation, cytokine production, anergy and/or tolerance.
- the methods of the invention provide methods of overcoming these difficulties, enabling one to generate and identify functionally different B7 molecules with altered relative capacities to induce T cell activation, differentiation, cytokine production, anergy and/or tolerance.
- DNA shuffling is likely to be the most powerful method in discovering new B7 variants with altered relative binding capacities to CD28 and CTLA-4.
- B7 variants which act through CD28 with improved activity (and with decreased activity through CTLA-4) are expected to have improved capacity to induce activation of T cells.
- B7 variants which bind and act through CTLA-4 with improved activity (and with decreased activity through CD28) are expected to be potent negative regulators of T cell functions and to induce tolerance and anergy.
- DNA shuffling or other recombination method is used to generate B7 (e.g., B7-1/CD80 and B7-2/CD86) variants which have altered relative capacity to act through CD28 and CTLA-4 when compared to wild-type B7 molecules.
- B7 e.g., B7-1/CD80 and B7-2/CD86
- the different forms of substrate used in the recombination reaction are B7 cDNAs from various species. Such cDNAs can be obtained by methods known to those of skill in the art, including RT-PCR.
- genes encoding these variant B7 molecules are incorporated into genetic vaccine vectors encoding an antigen, so that one the vectors can be used to modify antigen-specific T cell responses.
- Vectors that harbor B7 genes that efficiently act through CD28 are useful in inducing, for example, protective immune responses
- vectors that harbor genes encoding B7 genes that efficiently act through CTLA-4 are useful in inducing, for example, tolerance and anergy of allergen- or autoantigen-specific T cells.
- the antigen may already be present on the surface of the target cell, and the variant B7 molecules may be transfected in the absence of additional exogenous antigen gene.
- FIG. 11 illustrates a screening protocol that one can use to identify B7-1 (CD80) and/or B7-2 (CD86) variants that have increased capacity to induce T cell activation or anergy, and the application of this strategy is described in more detail in Example 1.
- B7-1 and B7-2 molecules are transfected into cells that normally do not express these molecules (e.g., COS-7 cells or any cell line from a different species with limited or no cross-reactivity with man regarding B7 ligand binding).
- An internal marker gene can be incorporated in order to analyze the copy number per cell.
- Soluble CTLA-4 and CD28 molecules can be generated to for use in the flow cytometry experiments. Typically, these will be fused with the Fc portion of IgG molecule to improve the stability of the molecules and to enable easy staining by labeled anti-IgG mAbs, as described by van der Merwe et al.
- the cells transfected with the library of B7 molecules are then stained with the soluble CTLA-4 and CD28 molecules. Cells demonstrating increased or decreased CTLA-4/CD28 binding ratio will be sorted. The plasmids are then recovered and the shuffled B7 variant-encoding sequences identified. These selected B7 variants can then be subjected to new rounds of shuffling and selection, and/or they can be further analyzed using functional assays as described below.
- the B7 variants can also be directly selected based on their functional properties.
- the B7 molecules can also be evolved to function on mouse cells. Bacterial colonies with plasmids with mutant B7 molecules are picked and the plasmids are isolated. These plasmids are then transfected into antigen presenting cells, such as dendritic cells, and the capacities of these mutants to activate T cells is analyzed.
- antigen presenting cells such as dendritic cells
- T cell activation can be analyzed by methods known to those of skill in the art, including, for example, measuring proliferation, cytokine production, CTL activity or expression of activation antigens such as IL-2 receptor, CD69 or HLA-DR molecules.
- T cell clones such as T cells specific for house dust mite antigen Der p I, will allow analysis of antigen-specific T cell activation (Yssel et al. (1992) J. Immunol.
- Mutants are identified that can enhance or inhibit T cell proliferation or enhance or inhibit CTL responses. Similarly variants that have altered capacity to induce cytokine production or expression of activation antigens as measured by, for example, cytokine-specific ELISAs or flow cytometry can be identified.
- the B7 variants are useful in modulating immune responses in autoimmune diseases, allergy, cancer, infectious disease and vaccination.
- B7 variants which act through CD28 with improved activity (and with decreased activity through CTLA-4) will have improved capacity to induce activation of T cells.
- B7 variants which bind and act through CTLA-4 with improved activity (and with decreased activity through CD28) will be potent negative regulators of T cell functions and to induce tolerance and anergy.
- genes encoding these variant B7 molecules into genetic vaccine vectors encoding an antigen, it is possible to modify antigen-specific T cell responses.
- Vectors that harbor B7 genes that efficiently act through CD28 are useful in inducing, for example, protective immune responses, whereas vectors that harbor genes encoding B7 genes that efficiently act through CTLA-4 are useful in inducing, for example, tolerance and anergy of allergen- or autoantigen-specific T cells.
- the antigen may already be present on the surface of the target cell, and the variant B7 molecules may be transfected in the absence of additional exogenous antigen gene.
- the methods of the invention are also useful for obtaining B7 variants that have increased effectiveness in directing either T H 1 or T H 2 cell differentiation.
- Differential roles have been observed for B7-1 and B7-2 molecules in the regulation of T helper (T H ) cell differentiation (Freeman et al. (1995) Immunity 2: 523; Kuchroo et al. (1995) Cell 80: 707).
- T H cell differentiation can be measured by analyzing the cytokine production profiles induced by each particular variant. High levels of IL-4, IL-5 and/or IL-13 are an indication of efficient T H 2 cell differentiation whereas high levels of IFN- ⁇ or IL-2 production can be used as a marker of T H 1 cell differentiation.
- B7 variants with altered capacity to induce T H 1 or T H 2 cell differentiation are useful, for example, in the treatment of allergic, malignant, autoimmune and infectious diseases and in vaccination.
- the invention also provides methods of obtaining genetic vaccines and accessory molecules that can improve the transport and presentation of antigenic peptides.
- a library of recombinant polynucleotides is created and screened to identify those that encode molecules that have improved properties compared to the wild-type counterparts.
- the polynucleotides themselves can be used in genetic vaccines, or the gene products of the polynucleotides can be utilized for therapeutic or prophylactic applications.
- the class I peptides presented on major histocompatibility complex molecules are generated by cellular proteasomes.
- Interferon-gamma can stimulate antigen presentation, and part of the mechanism of action of interferon may be due to induction of the proteasome beta-subunits LMP2 and LMP7, which replace the homologous beta-subunits Y (delta) and X (epsilon).
- Such a replacement changes the peptide cleavage specificity of the proteasome and can enhance class I epitope immunogenicity.
- the Y (delta) and X (epsilon) subunits, as well as other recently discovered proteasome subunits such as the MECL-1 homologue MC14, are characteristic of cells which are not specialized in antigen presentation.
- the incorporation into cells by DNA transfer of LMP2, LMP7, MECL-1 and/or other epitope presentation-specific and potentially interferon-inducible subunits can enhance epitope presentation. It is likely that the peptides generated by the proteasome containing the interferon-inducible subunits are transported to the endoplasmic reticulum by the TAP molecules.
- the invention provides methods of obtaining proteasomes that exhibit increased or decreased ability to specifically process MHC class I epitopes.
- DNA shuffling is used to obtain evolved proteins that can either have new specificities which might enhance the immunogenicity of some proteins and/or enhance the activity of the subunits once they are bound to the proteasome. Because the transition from a non-specific proteasome to a class I epitope-specific proteasome can pass through several states (in which some but not all of the interferon-inducible subunits are associated with the proteasome), many different proteolytic specificities can potentially be achieved. Evolving the specific LMP-like subunits can therefore create new proteasome compositions which have enhanced functionality for the presentation of epitopes.
- the methods involve performing DNA shuffling using as substrates two or more forms of polynucleotides which encode proteasome components, where the forms of polynucleotides differ in at least one nucleotide.
- Shuffling is performed as described herein, using polynucleotides that encode any one or more of the various proteasome components, including, for example, LMP2, LMP7, MECL-1 and other individual proteasome components that are specifically involved in class I epitope presentation.
- suitable substrates are described in, e.g., Stohwasser et al. (1997) Eur. J. Immunol. 27: 1182-1187 and Gaczynska et al. (1996) J. Biol. Chem. 271: 17275-17280.
- family shuffling is used, in which the different substrates are proteasome component-encoding polynucleotides from different species.
- the resulting library of recombinant polynucleotides is screened to identify those which encode proteasome components having the desired effect on class I epitope production.
- the recombinant polynucleotides can be introduced into a genetic vaccine vector which also encodes a particular antigen of interest.
- the library of vectors can then be introduced into mammalian cells which are then screened to identify cells which exhibit increased antigen-specific immunogenicity. Methods of analyzing proteasome activity are described in, for example, Groettrup et al. (1997) Proc. Nat'l. Acad. Sci. USA 94: 8970-8975 and Groettrup er al. (1997) Eur. J. Immunol. 26: 863-869.
- Such molecules can be applied to gene therapy protocols in which it is desirable to lower the immunogenicity of exogenous proteins expressed in the cells as a result of the gene therapy, and which would otherwise be processed for class I presentation allowing the cell to be recognized by the immune system.
- Such high-affinity low-activity LMP-like subunits will demonstrate immunosuppressive effects which are also of use in other therapeutic protocols where cells expressing a non-self protein need to be protected from an immune response.
- a further aspect of the invention involves performing DNA shuffling simultaneously on the two gene families followed by random combinations of the two in order to discover appropriate matched proteolytic and transport specificities.
- the invention provides methods of improving transport of antigenic peptides from the cytosolic compartment to the endoplasmic reticulum and thereby to the cell surface in the context of MHC class I molecules.
- Enhanced expression of antigenic peptides results in enhanced immune response, particularly in improved activation of CD8 + cytotoxic lymphocytes. This is useful in the development of DNA vaccines and in gene therapy.
- the invention involves evolving TAP-genes (transporters associated with antigen processing) to obtain genes that exhibit improved antigen presentation.
- TAP genes are members of ATP-binding cassette family of membrane translocators. These proteins transport antigenic peptides to MHC class I molecules and are involved in the expression and stability of MHC class I molecules on the cell surface.
- TAP1 and TAP2 Two TAP genes, TAP1 and TAP2, have been cloned to date (Powis et al. (1996) Proc. Nat'l. Acad. Sci. USA 89: 1463-1467; Koopman et al. (1997) Curr. Opin. Immunol. 9: 80-88; Monaco (1995) J Leukocyte Biol. 57: 543-57).
- TAP1 and TAP2 form a heterodimer and these genes are required for transport of peptides into the endoplasmic reticulum, where they bind to MHC class I molecules.
- the essential role of TAP gene products in presentation of antigenic peptides was demonstrated in mice with disrupted TAP genes.
- TAP1-deficient mice have drastically reduced levels of surface expression of MHC class I, and positive selection of CD8 + T cells in the thymus is strongly reduced. Therefore, the number of CD8 + T lymphocytes in the periphery of TAP-deficient mice is extremely low. Transfection of TAP genes back into these cells restores the level of MHC class I expression.
- TAP genes are a good target for gene shuffling because of natural polymorphism and because these genes of several mammalian species have been cloned and sequenced, including human (Beck et al. (1992) J. Mol. Biol. 228: 433-441; Genbank Accession No. Y13582; Powis et al., supra.), gorilla TAP1 (Laud et al. (1996) Human Immunol. 50: 91-102), mouse (Reiser et al. (1988) Proc. Nat'l. Acad. Sci. USA 85: 2255-2259; Marusina et al. (1997) J. Immunol. 158: 5251-5256, TAP1: Genbank Accession Nos.
- TAP2 Genbank Accession Nos. U60087, U60088, U6089, U60090, U60091 and U60092), hamster (TAP 1, Genbank Accession Nos. AF001154 and AF001157; TAP2, Genbank Accession Nos. AF001156 and AF001155). Furthermore, it has been shown that point mutations in TAP genes may result in altered peptide specificity and peptide presentation. Also, functional differences in TAP genes derived from different species have been observed.
- human TAP and rat TAP containing the rTAP2a allele are rather promiscuous, whereas mouse TAP is restrictive and select against peptides with C-terminal small polar/hydrophobic or positively charged amino acids. The basis for this selectivity is unknown.
- the methods of the invention involve performing DNA shuffling of TAP1 and TAP2 genes using as substrates at least two forms of TAP1 and/or TAP2 polynucleotide sequences which differ in at least one nucleotide position.
- TAP sequences derived from several mammalian species are used as the substrates for shuffling. Natural polymorphism of the genes can provide additional diversity of substrate.
- optimized TAP genes obtained from one round of shuffling and screening can be subjected to additional shuffling/screening rounds to obtain further optimized TAP-encoding polynucleotides.
- the genes can be expressed on the same plasmid as a target antigen of interest. If this step is limiting the extent of antigen presentation, then enhanced presentation to CD8 + CTL will result. Mutants of TAPs may act selectively to increase expression of a particular antigen peptide fragment for which levels of expression are otherwise limiting, or to cause transport of a peptide that would normally never be transferred into the RER and made available to bind to MHC Class I.
- evolved TAP genes When used in the context of gene therapy vectors in cancer treatment, evolved TAP genes provide a means to enhance expression of MHC class I molecules on tumor cells and obtain efficient presentation of antigenic tumor-specific peptides.
- vectors that contain the evolved TAP genes can induce potent immune responses against the malignant cells.
- Shuffled TAP genes can be transfected into malignant cell lines that express low levels of MHC class I molecules using retroviral vectors or electroporation. Transfection efficiency can be monitored using marker genes, such as green fluorescent protein, encoded by the same vector as the TAP genes.
- Cells expressing equal levels of green fluorescent protein but the highest levels of MHC class I molecules, as a marker of efficient TAP genes, are then sorted using flow cytometry, and the evolved TAP genes are then recovered from these cells by, for example, PCR or by recovering the entire vectors. These sequences can then subjected into new rounds of shuffling, selection and recovery, if further optimization is desired.
- TAP genes can be combined with simultaneous evolution of the desired antigen. Simultaneous evolution of the desired antigen can further improve the efficacy of presentation of antigenic peptides following DNA vaccination.
- the antigen can be evolved, using gene shuffling, to contain structures that allow optimal presentation of desired antigenic peptides when optimal TAP genes are expressed. TAP genes that are optimal for presentation of antigenic peptides of one given antigen may be different from TAP genes that are optimal for presentation of antigenic peptide of another antigen. Gene shuffling technique is ideal, and perhaps the only, method to solve this type of problems. Efficient presentation of desired antigenic peptides can be analyzed using specific cytotoxic T lymphocytes, for example, by measuring the cytokine production or CTL activity of the T lymphocytes using methods known to those of skill in the art.
- Certain proteins are better able than others to carry MHC class I epitopes because they are more readily used by the cellular machinery involved in the necessary processing for class I epitope presentation.
- the invention provides methods of identifying expressed polypeptides that are particularly efficient in traversing the various biosynthetic and degradative steps leading to class I epitope presentation and the use of these polypeptides to enhance presentation of CTL epitopes from other proteins.
- the invention provides Cytotoxic T-cell Inducing Sequences (CTIS), which can be used to carry heterologous class I epitopes for the purpose of vaccinating against the pathogen from which the heterologous epitopes are derived.
- CTIS Cytotoxic T-cell Inducing Sequences
- HBsAg hepatitis B surface antigen
- DNA immunization with plasmids expressing the HBsAg also induces high levels of CTL activity.
- the invention provides a shorter, truncated fragment of the HBsAg polypeptide which functions very efficiently in inducing CTL activity, and attains CTL induction levels that are higher than with the HBsAg protein or with the plasmids encoding the full-length HBsAg polypeptide.
- Synthesis of a CTIS derived from HBsAg is described in Example 3; and a diagram of a CTIS is shown in FIG. 1 .
- the ER localization of the truncated polypeptide may be important in achieving suitable proteolytic liberation of the peptide(s) containing the CTL epitopes (see Cresswell & Hughes (1997) Curr. Biol. 7: R552-R555; Craiu et al. (1997) Proc. Nat'l. Acad. Sci. USA 94: 10850-10855).
- the preS2 region and the transmembrane region provide T-helper epitopes which may be important for the induction of a strong cytotoxic immune response. Because the truncated CTIS polypeptide has a simple structure (see FIG.
- the invention also provides methods of obtaining Immununogenic Agonist Sequences (IAS) which induce CTLs capable of specific lysis of cells expressing the natural epitope sequence.
- IAS Immununogenic Agonist Sequences
- Such IAS-induced CTL may be drawn from a T-cell repertoire different from that induced by the natural sequence. In this way, poor responsiveness to a given epitope can be overcome by recruiting T cells from a larger pool.
- the amino acid at each position of a CTL-inducing peptide (excluding perhaps the positions of the so-called anchor residues) can be varied over the range of the 19 amino acids not normally present at the position. DNA shuffling methodology can be used to scan a large range of sequence possibilities.
- a synthetic gene segment containing multiple copies of the original epitope sequence can be prepared such that each copy possesses a small number of nucleotide changes.
- the gene segment can be shuffled to create a diverse range of CTL epitope sequences, some of which should function as IAS. This process is illustrated in FIG. 4 .
- oligonucleotides are typically constructed in accordance with the above design and polymerized enzymatically to form the synthetic gene segment of the concatenated epitopes. Restriction sites can be incorporated into a fraction of the oligonucleotides to allow for cleavage and selection of given size ranges of the concatenated epitopes, most of which will have different sequences and thus will be potential IAS.
- the epitope-containing gene segment can be joined by appropriate cloning methods to a CTIS, such as that of HBsAg.
- the resulting plasmid constructions can be used for DNA-based immunization and CTL induction.
- the improved immunomodulatory polynucleotides and polypeptides of the invention are useful for treating and/or preventing the various diseases and conditions with which the respective antigens are associated.
- genetic vaccines that employ the reagents obtained according to the methods of the invention are useful in both prophylaxis and therapy of infectious diseases, including those caused by any bacterial, fungal, viral, or other pathogens of mammals.
- the reagents obtained using the invention can also be used for treatment of autoimmune diseases including, for example, rheumatoid arthritis, SLE, diabetes mellitus, myasthenia gravis, reactive arthritis, ankylosing spondylitis, and multiple sclerosis.
- genetic vaccines that include vectors and other components obtained using the methods of the invention.
- Genetic vaccine vectors and other reagents obtained using the methods of the invention can be used to treat allergies and asthma.
- the use of genetic vaccines have great promise for the treatment of cancer and prevention of metastasis. By inducing an immune response against cancerous cells, the body's immune system can be enlisted to reduce or eliminate cancer.
- the reagents obtained using the invention are used in conjunction with a genetic vaccine vector.
- the choice of vector and components can also be optimized for the particular purpose of treating allergy or other conditions.
- an antigen associated with treating a particular condition can be optimized using recombination and selection methods analogous to those described herein.
- Such methods, and antigens appropriate for various conditions are described in copending, commonly assigned U.S. patent application Ser. No. ______, entitled “Antigen Library Immunization,” which was filed on Feb. 10, 1999 as TTC Attorney Docket No. 18097-028710US.
- the polynucleotide that encodes the recombinant antigenic polypeptide can be placed under the control of a promoter, e.g., a high activity or tissue-specific promoter.
- the promoter used to express the antigenic polypeptide can itself be optimized using recombination and selection methods analogous to those described herein, as described in International Application No. PCT/US97/17300 (International Publication No. WO 98/13487).
- the reagents obtained using the methods of the invention can also be used in conjunction with multicomponent genetic vaccines, which are capable of tailoring an immune response as is most appropriate to achieve a desired effect (see, e.g., copending, commonly assigned U.S. patent application Ser. No.
- ______ entitled “Genetic Vaccine Vector Engineering,” filed on Feb. 10, 1999 as TTC Attorney Docket No. 18097-030100US. It is sometimes advantageous to employ a genetic vaccine that is targeted for a particular target cell type (e.g., an antigen presenting cell or an antigen processing cell); suitable targeting methods are described in copending, commonly assigned U.S. patent application Ser. No. ______, entitled “Targeting of Genetic Vaccine Vectors,” filed on Feb. 10, 1999 as TTC Attorney Docket No. 18097-030200US.
- a target cell type e.g., an antigen presenting cell or an antigen processing cell
- Genetic vaccine vectors that include the optimized recombinant polynucleotides obtained as described herein can be delivered to a mammal (including humans) to induce a therapeutic or prophylactic immune response.
- Vaccine delivery vehicles can be delivered in vivo by administration to an individual patient, typically by systemic administration (e.g., intravenous, intraperitoneal, intramuscular, subdermal, intracranial, anal, vaginal, oral, buccal route or they can be inhaled) or they can be administered by topical application.
- vectors can be delivered to cells ex vivo, such as cells explanted from an individual patient (e.g., lymphocytes, bone marrow aspirates, tissue biopsy) or universal donor hematopoietic stem cells, followed by reimplantation of the cells into a patient, usually after selection for cells which have incorporated the vector.
- cells explanted from an individual patient e.g., lymphocytes, bone marrow aspirates, tissue biopsy
- tissue biopsy e.g., lymphocytes, bone marrow aspirates, tissue biopsy
- universal donor hematopoietic stem cells e.g., hematopoietic stem cells
- a large number of delivery methods are well known to those of skill in the art. Such methods include, for example liposome-based gene delivery (Debs and Zhu (1993) WO 93/24640; Mannino and Gould-Fogerite (1988) BioTechniques 6(7): 682-691; Rose U.S. Pat. No. 5,279,833; Brigham (1991) WO 91/06309; and Felgner et al. (1987) Proc. Natl. Acad. Sci. USA 84: 7413-7414), as well as use of viral vectors (e.g., adenoviral (see, e.g., Berns et al. (1995) Ann. NY Acad. Sci.
- adenoviral see, e.g., Berns et al. (1995) Ann. NY Acad. Sci.
- DNA and/or RNA that comprises a genetic vaccine can be introduced directly into a tissue, such as muscle. See, e.g., U.S. Pat. No. 5,580,859.
- Other methods such as “biolistic” or particle-mediated transformation (see, e.g., Sanford et al., U.S. Pat. No. 4,945,050; U.S. Pat. No. 5,036,006) are also suitable for introduction of genetic vaccines into cells of a mammal according to the invention. These methods are useful not only for in vivo introduction of DNA into a mammal, but also for ex vivo modification of cells for reintroduction into a mammal. As for other methods of delivering genetic vaccines, if necessary, vaccine administration is repeated in order to maintain the desired level of immunomodulation.
- Genetic vaccine vectors can be administered directly to the mammal for transduction of cells in vivo.
- the genetic vaccines obtained using the methods of the invention can be formulated as pharmaceutical compositions for administration in any suitable manner, including parenteral (e.g., subcutaneous, intramuscular, intradermal, or intravenous), topical, oral, rectal, intrathecal, buccal (e.g., sublingual), or local administration, such as by aerosol or transdermally, for prophylactic and/or therapeutic treatment.
- Pretreatment of skin for example, by use of hair-removing agents, may be useful in transdermal delivery.
- Suitable methods of administering such packaged nucleic acids are available and well known to those of skill in the art, and, although more than one route can be used to administer a particular composition, a particular route can often provide a more immediate and more effective reaction than another route.
- compositions of the present invention are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition. Accordingly, there is a wide variety of suitable formulations of pharmaceutical compositions of the present invention.
- aqueous carriers can be used, e.g., buffered saline and the like. These solutions are sterile and generally free of undesirable matter.
- These compositions may be sterilized by conventional, well known sterilization techniques.
- the compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like.
- concentration of genetic vaccine vector in these formulations can vary widely, and will be selected primarily based on fluid volumes, viscosities, body weight and the like in accordance with the particular mode of administration selected and the patient's needs.
- Formulations suitable for oral administration can consist of (a) liquid solutions, such as an effective amount of the packaged nucleic acid suspended in diluents, such as water, saline or PEG 400; (b) capsules, sachets or tablets, each containing a predetermined amount of the active ingredient, as liquids, solids, granules or gelatin; (c) suspensions in an appropriate liquid; and (d) suitable emulsions.
- liquid solutions such as an effective amount of the packaged nucleic acid suspended in diluents, such as water, saline or PEG 400
- capsules, sachets or tablets each containing a predetermined amount of the active ingredient, as liquids, solids, granules or gelatin
- suspensions in an appropriate liquid such as water, saline or PEG 400
- Tablet forms can include one or more of lactose, sucrose, mannitol, sorbitol, calcium phosphates, corn starch, potato starch, tragacanth, microcrystalline cellulose, acacia, gelatin, colloidal silicon dioxide, croscarmellose sodium, talc, magnesium stearate, stearic acid, and other excipients, colorants, fillers, binders, diluents, buffering agents, moistening agents, preservatives, flavoring agents, dyes, disintegrating agents, and pharmaceutically compatible carriers.
- Lozenge forms can comprise the active ingredient in a flavor, usually sucrose and acacia or tragacanth, as well as pastilles comprising the active ingredient in an inert base, such as gelatin and glycerin or sucrose and acacia emulsions, gels, and the like containing, in addition to the active ingredient, carriers known in the art.
- an inert base such as gelatin and glycerin or sucrose and acacia emulsions, gels, and the like containing, in addition to the active ingredient, carriers known in the art.
- the genetic vaccines when administered orally, must be protected from digestion. This is typically accomplished either by complexing the vaccine vector with a composition to render it resistant to acidic and enzymatic hydrolysis or by packaging the vector in an appropriately resistant carrier such as a liposome. Means of protecting vectors from digestion are well known in the art.
- the pharmaceutical compositions can be encapsulated, e.g., in liposomes, or in a formulation
- the packaged nucleic acids can be made into aerosol formulations (e.g., they can be “nebulized”) to be administered via inhalation. Aerosol formulations can be placed into pressurized acceptable propellants, such as dichlorodifluoromethane, propane, nitrogen, and the like.
- Suitable formulations for rectal administration include, for example; suppositories, which consist of the packaged nucleic acid with a suppository base.
- Suitable suppository bases include natural or synthetic triglycerides or paraffin hydrocarbons.
- gelatin rectal capsules which consist of a combination of the packaged nucleic acid with a base, including, for example, liquid triglycerides, polyethylene glycols, and paraffin hydrocarbons.
- Formulations suitable for parenteral administration include aqueous and non-aqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives.
- compositions can be administered, for example, by intravenous infusion, orally, topically, intraperitoneally, intravesically or intrathecally.
- Parenteral administration and intravenous administration are the preferred methods of administration.
- the formulations of packaged nucleic acid can be presented in unit-dose or multi-dose sealed containers, such as ampoules and vials.
- Injection solutions and suspensions can be prepared from sterile powders, granules, and tablets of the kind previously described. Cells transduced by the packaged nucleic acid can also be administered intravenously or parenterally.
- the dose administered to a patient should be sufficient to effect a beneficial therapeutic response in the patient over time.
- the dose will be determined by the efficacy of the particular vector employed and the condition of the patient, as well as the body weight or vascular surface area of the patient to be treated.
- the size of the dose also will be determined by the existence, nature, and extent of any adverse side-effects that accompany the administration of a particular vector, or transduced cell type in a particular patient.
- the physician evaluates vector toxicities, progression of the disease, and the production of anti-vector antibodies, if any.
- the dose equivalent of a naked nucleic acid from a vector is from about 1 ⁇ g to 1 mg for a typical 70 kilogram patient, and doses of vectors used to deliver the nucleic acid are calculated to yield an equivalent amount of therapeutic nucleic acid. Administration can be accomplished via single or divided doses.
- compositions are administered to a patient suffering from a disease (e.g., an infectious disease or autoimmune disorder) in an amount sufficient to cure or at least partially arrest the disease and its complications.
- a disease e.g., an infectious disease or autoimmune disorder
- An amount adequate to accomplish this is defined as a “therapeutically effective dose.” Amounts effective for this use will depend upon the severity of the disease and the general state of the patient's health.
- Single or multiple administrations of the compositions may be administered depending on the dosage and frequency as required and tolerated by the patient.
- the composition should provide a sufficient quantity of the proteins of this invention to effectively treat the patient.
- compositions are administered to a human or other mammal to induce an immune response that can help protect against the establishment of an infectious disease or other condition.
- the toxicity and therapeutic efficacy of the genetic vaccine vectors provided by the invention are determined using standard pharmaceutical procedures in cell cultures or experimental animals.
- a typical pharmaceutical composition for intravenous administration would be about 0.1 to 10 mg per patient per day. Dosages from 0.1 up to about 100 mg per patient per day may be used, particularly when the drug is administered to a secluded site and not into the blood stream, such as into a body cavity or into a lumen of an organ. Substantially higher dosages are possible in topical administration. Actual methods for preparing parenterally administrable compositions will be known or apparent to those skilled in the art and are described in more detail in such publications as Remington's Pharmaceutical Science, 15th ed., Mack Publishing Company, Easton, Pa. (1980).
- the multivalent antigenic polypeptides of the invention, and genetic vaccines that express the polypeptides can be packaged in packs, dispenser devices, and kits for administering genetic vaccines to a mammal.
- packs or dispenser devices that contain one or more unit dosage forms are provided.
- instructions for administration of the compounds will be provided with the packaging, along with a suitable indication on the label that the compound is suitable for treatment of an indicated condition.
- the label may state that the active compound within the packaging is useful for treating a particular infectious disease, autoimmune disorder, tumor, or for preventing or treating other diseases or conditions that are mediated by, or potentially susceptible to, a mammalian immune response.
- This Example describes the use of the DNA shuffling methods of the invention to obtain B7-1 and B7-2 polypeptides that have altered biological activities.
- DNA shuffling is used to generate a library of B7 (B7-1/CD80 and B7-2/CD86) variants that have altered relative capacity to act through CD28 and CTLA-4 when compared to wild-type B17 molecules.
- B7 cDNAs from various species are generated by RT-PCR, and these sequences are shuffled using family DNA shuffling. Alignments of human, rhesus monkey and rabbit B7-1 nucleotide sequences are shown in FIG. 15 , demonstrating that family DNA shuffling is a feasible approach when evolving B7 molecules.
- the library is then screened to identify those variants that are useful in modulating immune responses in autoimmune diseases, allergy, cancer, infectious disease and vaccination. Any of several approaches for screening of the variants can be used:
- the library of B7-1 and B7-2 molecules is transfected into cells that normally do not express these molecules (e.g., COS-7 cells or any cell line from different species with limited or no cross-reactivity with man regarding B7 ligand binding).
- An internal marker gene can be incorporated in order to analyze the copy number per cell.
- Soluble CTLA-4 and CD28 molecules are generated to facilitate the flow cytometry experiments.
- these soluble polypeptides are fused with the Fc portion of IgG molecule to improve the stability of the molecules and to enable easy staining by labeled anti-IgG monoclonal antibodies, as described by van der Merwe et al. ((1997) J. Exp. Med. 185: 393).
- the cells transfected with the library of B7 molecules are then stained with the soluble CTLA-4 and CD28 molecules. Cells demonstrating increased or decreased CTLA-4/CD28 binding ratio are sorted.
- the plasmids are then recovered and the shuffled sequences identified.
- Bacterial colonies that contain plasmids that include mutant B7 molecules are picked and the plasmids are isolated. These plasmids are then transfected into antigen presenting cells, such as dendritic cells, and the capacities of these mutants to activate T cells is analyzed.
- antigen presenting cells such as dendritic cells
- T cell activation can be analyzed by measuring proliferation, cytokine production, CTL activity or expression of activation antigens such as IL-2 receptor, CD69 or HLA-DR molecules.
- activation antigens such as IL-2 receptor, CD69 or HLA-DR molecules.
- T H cell differentiation can be measured by analyzing the cytokine production profiles induced by each particular variant. High levels of IL-4, IL-5 and/or IL-13 are an indication of efficient T H 2 cell differentiation whereas high levels of IFN- ⁇ or IL-2 production can be used as a marker of T H 1 cell differentiation.
- B7 variants that altered capacity to induce T H 1 or T H 2 cell differentiation are likely to be useful in the treatment of allergic, malignant, autoimmune and infectious diseases and in vaccination.
- Elevated production of IL-10 is a characteristic of regulatory T cells, which can suppress proliferation of antigen-specific CD4 + T cells (Groux et al. (1997) Nature 389: 737). Therefore, B7 variants can be screened to identify those that have enhanced capacity to induce IL-10 production by antigen-specific T cells. IL-10 production can be measured, for example, by ELISA or flow cytometry using intracytoplasmic cytokine stainings. The variants that induce high levels of IL-10 production are useful in the treatment of allergic and autoimmune diseases.
- IL-12 is the most potent cytokine directing T H 1 responses, and it improves the efficacy of genetic vaccinations. Evolved IL-12 molecules are useful as components of genetic vaccines.
- IL-0.12 is a heterodimeric cytokine composed of a 35 kD light chain (p35) and a 40 kD heavy chain (p40) (Kobayashi et al. (1989) J. Exp. Med. 170: 827; Stern et al. (1990) Proc. Nat'l. Acad. Sci. USA 87: 6808).
- an IL-12 gene is shuffled as one entity that encodes both subunits, which is beneficial in designing the shuffling protocol.
- the subunits of IL-12 can also be expressed separately in the same expression vector, or the subunits can be expressed separately and screened using cotransfections of the two vectors, providing additional shuffling strategies.
- IL-12 plays several roles in the regulation of allergic responses. For example, IL-12 induces T H 1 cell differentiation and downregulates the T H 2 response. IL-12 inhibits IgE synthesis both in vivo and in vitro, and also induces IFN- ⁇ production. Accordingly, it is desirable to obtain an optimized IL-12 that better able to carry out these functions upon administration to a mammal.
- Cytokine genes including IL-12 genes, from humans and nonhuman primates are generally 93-99% homologous (Villinger et al. (1995) J. Immunol. 155: 3946-3954), providing a good starting point for family shuffling.
- a library of shuffled IL-12 genes was obtained by shuffling p35 and p40 subunits derived from human, rhesus monkey, cat, dog, cow, pig, and goat, and incorporated into vectors and the supernatants of these transfectants are analyzed for biological activity as shown in FIG. 6 . Because of its T cell growth promoting activities, it is possible to use normal human peripheral blood T cells in the selection of the most active IL-12 genes, enabling directly to select IL-12 mutants with the most potent activities on human T cells.
- FIG. 7 a functional screening assay has been successfully established.
- COS-7 cells were first transfected with vectors encoding IL-12 subunits. Forty-eight hours after transfection, the capacity of these culture supernatants to induce proliferation of activated human peripheral blood T cells was studied.
- FIG. 8 indicates the consistency of the level of T cell proliferation induced in this assay, indicating that the assay can be used to distinguish the activities between supernatants that have different capacities to induce T cell activation.
- the assay provides means to screen for improved IL-12-like activities in culture supernatants of transfected cells.
- a vector with an optimized IL-12-encoding polynucleotide was tested for ability to induce human T cell activation.
- Results, shown in FIG. 9 show that the shuffled IL-12 has an significantly increased ability to induce T cell activation compared to wild-type IL-12.
- FIG. 6 illustrates a general strategy for screening of evolved cytokine genes.
- the specific example is given for IL-12 but similar approach applies to all cytokines when using cell types sensitive for each cytokine.
- GM-CSF can be evolved by the same approach by using the GM-CSF sensitive cell line TF-1 in the screening.
- the vectors are transfected into CHO cells, any mammalian cell that can be transfected in vitro can be used as host cells.
- other good host cells include cell lines WI-26, COS-1, COS-7, 293, U937 and freshly isolated human antigen presenting cells, such as monocytes, B cells and dendritic cells.
- This Example describes the preparation of a polypeptide sequence capable of efficient presentation of T cell epitopes and a strategy for the application of DNA shuffling to discover strongly immunogenic agonistic T cell epitopes.
- the HBsAg polypeptide (PreS2 plus S regions) was truncated by the introduction of a stop codon at amino acid position 103 (counting from the beginning of the PreS2 initiator methionine), transforming a cysteine codon TGT into the Stop codon TGA.
- the amino acid sequence of the truncated protein was therefore: M QWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG DPALN M ENITSGFLGPLLVLQAGFFLLTRILT IPQSLDSWWTSL NFLGGTTV* where the standard single-letter code for amino acids is used.
- the methionine residues at the start of the PreS2 and S regions are underlined, and the mouse L d -restricted CTL epitope is double-underlined; the asterisk (*) represents the artificially introduced Stop codon.
- FIG. 1 A likely structure for this truncated polypeptide is shown in FIG. 1 .
- the N-terminal region of the HBsAg polypeptide is transported through the membrane of the endoplasmic reticulum (ER).
- the first part of the S region is a transmembrane structure which locks the polypeptide into the ER.
- the remaining C-terminal region of the polypeptide is located in the cytoplasmic compartment where it can be accessed by the epitope processing mechanism of the cell.
- This structure forms what is referred to as the Cytotoxic T-cell Inducing Sequence (CTIS).
- CTIIS Cytotoxic T-cell Inducing Sequence
- a CTIS is preferably used in conjunction with an immunogenic agonistic sequence (IAS).
- IAS immunogenic agonistic sequence
- each position of a 12 amino acid L d -restricted class I epitope from HBsAg was replaced with an alanine-encoding codon in the DNA sequence of the epitope.
- the results demonstrate that, in some cases, the reactivity is greater than if the CTL response is induced by the natural epitope ( FIG. 3 ).
- Optimized immunomodulatory molecules that are obtained using the methods of the invention find use in a wide variety of applications, in addition to use in vaccination. For example, there is increasing evidence that certain forms of obesity are associated with dysfunction of the immune system, and that molecules which regulate immune responses, e.g. cytokines, can induce or inhibit obesity.
- the invention provides methods of optimizing immune regulatory molecules for the treatment of obesity, anorexia and cachexia.
- Leptin and ciliary neurotrophic factor are examples of cytokines that have been shown to play a role in the development of obesity.
- Congenital leptin deficiency results in severe early-onset obesity in human (Montague et al. (1997) Nature 387: 903-908), and CNTF has been shown to correct obesity and diabetes associated with leptin deficiency and resistance (Gloaguen et al. (1997) Proc. Nat'l. Acad. Sci. USA 94: 6456-6461).
- Antagonists of CNTF and/or leptin may be useful in the treatment of anorexia and/or cachexia.
- the methods of the invention are used to generate leptin and/or CNTF molecules that have improved specific activity.
- the methods are also useful for obtaining improved cytokines that exhibit reduced immunogenicity in vivo; immunogenicity is a particular concern for CNTF, because the wild-type CNTF is highly antigenic, which results in the production of high levels of anti-CNTF antibodies when administered to a human.
- Improved cytokine molecules prepared using the methods of the invention are administered as polypeptides, or the shuffled nucleic acids that encode improved leptin and/or CNTF polypeptides are used in genetic vaccine vectors.
- the invention also provides methods of generating vectors that induce production of increased levels of leptin and/or CNTF.
- the methods of the invention can also be used to obtain reagents that are useful for the treatment of anorexia, cachexia, and related disorders.
- antagonists of leptin and/or CNTF are evolved using the DNA shuffling methods.
- a leptin receptor can be evolved to obtain a soluble form that has an enhanced affinity for leptin.
- the receptor for leptin in mice is found in the hypothalamus (Mercer et al. (1996). FEBS Lett. 387: 113), a region known to be involved in maintenance of energy balance, and in the choroid plexus and leptomeninges, which form part of the blood/brain barrier.
Abstract
This invention provides methods for obtaining molecules that can modulate an immune response, and immunomodulatory molecules obtained using the methods. The molecules find use, for example, in the tailoring of an immune response induced by a genetic vaccine for a desired purpose.
Description
- This application claims benefit of U.S. Provisional Application No. 60/074,294, filed Feb. 11, 1998, which application is incorporated herein by reference for all purposes.
- This invention was made with Government support under Grant No. N65236-98-1-5401, awarded by the Defense Advanced Projects Agency. The Government has certain rights in this invention.
- 1. Field of the Invention
- This invention pertains to the field of modulation of immune responses such as those induced by genetic vaccines.
- 2. Background
- Antigen processing and presentation is only one factor which determines the effectiveness of vaccination, whether performed with genetic vaccines or more classical methods. Other molecules involved in determining vaccine effectiveness include cytokines (interleukins, interferons, chemokines, hematopoietic growth factors, tumor necrosis factors and transforming growth factors), which are small molecular weight proteins that regulate maturation, activation, proliferation and differentiation of the cells of the immune system. Characteristic features of cytokines are pleiotropy and redundancy; that is, one cytokine often has several functions and a given function is often mediated by more than one cytokine. In addition, several cytokines have additive or synergistic effects with other cytokines, and a number of cytokines also share receptor components.
- Due to the complexity of the cytokine networks, studies on the physiological significance of a given cytokine have been difficult, although recent studies using cytokine gene-deficient mice have significantly improved our understanding on the functions of cytokines in vivo. In addition to soluble proteins, several membrane-bound costimulatory molecules play a fundamental role in the regulation of immune responses. These molecules include CD40, CD40 ligand, CD27, CD80, CD86 and CD150 (SLAM), and they are typically expressed on lymphoid cells after activation via antigen recognition or through cell-cell interactions.
- T helper (TH) cells, key regulators of the immune system, are capable of producing a large number of different cytokines, and based on their cytokine synthesis pattern TH cells are divided into two subsets (Paul and Seder (1994) Cell 76: 241-251).
T H1 cells produce high levels of IL-2 and IFN-γ and no or minimal levels of IL-4, IL-5 and IL-13. In contrast,T H2 cells produce high levels of IL-4, IL-5 and IL-13, and IL-2 and IFN-γ production is minimal or absent.T H1 cells activate macrophages, dendritic cells and augment the cytolytic activity of CD8+ cytotoxic T lymphocytes and NK cells (Id.), whereasT H2 cells provide efficient help for B cells and they also mediate allergic responses due to the capacity ofT H2 cells to induce IgE isotype switching and differentiation of B cells into IgE secreting cell (De Vries and Punnonen (1996) In Cytokine regulation of humoral immunity: basic and clinical aspects. Eds. Snapper, C. M., John Wiley & Sons, Ltd., West Sussex, UK, p. 195-215). The exact mechanisms that regulate the differentiation of T helper cells are not fully understood, but cytokines are believed to play a major role. IL-4 has been shown to directT H2 differentiation, whereas IL-12 induces development ofT H1 cells (Paul and Seder, supra.). In addition, it has been suggested that membrane bound costimulatory molecules, such as CD80, CD86 and CD150, can directT H1 and/orT H2 development, and the same molecules that regulate TH cell differentiation also affect activation, proliferation and differentiation of B cells into Ig-secreting plasma cells (Cocks et al. (1995) Nature 376: 260-263; Lenschow et al. (1996) Immunity 5: 285-293; Punnonen et al. (1993) Proc. Nat'l. Acad. Sci. USA. 90: 3730-3734; Punnonen et al. (1997) J. Exp. Med. 185: 993-1004). - Studies in both man and mice have demonstrated that the cytokine synthesis profile of T helper (TH) cells plays a crucial role in determining the outcome of several viral, bacterial and parasitic infections. High frequency of
T H1 cells generally protects from lethal infections, whereasdominant T H2 phenotype often results in disseminated, chronic infections. For example,T H1 phenotype is observed in tuberculoid (resistant) form of leprosy andT H2 phenotype in lepromatous, multibacillary (susceptible) lesions (Yamamura et al. (1991) Science 254: 277-279). Similarly, late-stage HIV patients have TH2-like cytokine synthesis profiles, andT H1 phenotype has been proposed to protect from AIDS (Maggi et al. (1994) J. Exp. Med. 180: 489-495). Furthermore, the survival from meningococcal septicemia is genetically determined based on the capacity of peripheral blood leukocytes to produce TNF-α and IL-10. Individuals from families with high production of IL-10 have increased risk of fatal meningococcal disease, whereas members of families with high TNF-α production were more likely to survive the infection (Westendorp et al. (1997) Lancet 349: 170-173). - Cytokine treatments can dramatically influence
T H1/T H2 cell differentiation and macrophage activation, and thereby the outcome of infectious diseases. For example, BALB/c mice infected with Leishmania major generally develop a disseminated fatal disease with aT H2 phenotype, but when treated with anti-IL-4 mAbs or IL-12, the frequency ofT H1 cells in the mice increases and they are able to counteract the pathogen invasion (Chatelain et al. (1992) J. Immunol. 148: 1182-1187). Similarly, IFN-γ protects mice from lethal Herpes Simplex Virus (HSV) infection, and MCP-1 prevents lethal infections by Pseudomonas aeruginosa or Salmonella typhimurium. In addition, cytokine treatments, such as recombinant IL-2, have shown beneficial effects in human common variable immunodeficiency (Cunningham-Rundles et al. (1994) N. Engl. J. Med. 331: 918-921). - The administration of cytokines and other molecules to modulate immune responses in a manner most appropriate for treating a particular disease can provide a significant tool for the treatment of disease. However, presently available immunomodulator treatments can have several disadvantages, such as insufficient specific activity, induction of immune responses against, the immunomodulator that is administered, and other potential problems. Thus, a need exists for immunomodulators that exhibit improved properties relative to those currently available. The present invention fulfills this and other needs.
- The present invention provides methods of obtaining a polynucleotide that has a modulatory effect on an immune response that is induced by a genetic vaccine, either directly (i.e., as an immunomodulatory polynucleotide) or indirectly (i.e., upon translation of the polynucleotide to create an immunomodulatory polypeptide. The methods of the invention involve: creating a library of recombinant polynucleotides; and screening the library to identify at least one optimized recombinant polynucleotide that exhibits, either by itself or through the encoded polypeptide, an enhanced ability to modulate an immune response than a form of the nucleic acid from which the library was created. Examples include, for example, CpG-rich polynucleotide sequences, polynucleotide sequences that encode a costimulator (e.g., B7-1, B7-2, CD1, CD40, CD154 (ligand for CD40), CD150 (SLAM), or a cytokine. The screening step used in these methods can include, for example, introducing genetic vaccine vectors which comprise the library of recombinant nucleic acids into a cell, and identifying cells which exhibit an increased ability to modulate an immune response of interest or increased ability to express an immunomodulatory molecule. For example, a library of recombinant cytokine-encoding nucleic acids can be screened by testing the ability of cytokines encoded by the nucleic acids to activate cells which contain a receptor for the cytokine. The receptor for the cytokine can be native to the cell, or can be expressed from a heterologous nucleic acid that encodes the cytokine receptor. For example, the optimized costimulators can be tested to identify those for which the cells or culture medium are capable of inducing a predominantly
T H2 immune response, or a predominantlyT H1 immune response. - In some embodiments, the polynucleotide that has a modulatory effect on an immune response is obtained by: (1) recombining at least first and second forms of a nucleic acid that is, or encodes a molecule that is, involved in modulating an immune response, wherein the first and second forms differ from each other in two or more nucleotides, to produce a library of recombinant polynucleotides; and (2) screening the library to identify at least one optimized recombinant polynucleotide that exhibits, either by itself or through the encoded polypeptide, an enhanced ability to modulate an immune response than a form of the nucleic acid from which the library was created. If additional optimization is desired, the method can further involve: (3) recombining at least one optimized recombinant polynucleotide with a further form of the nucleic acid, which is the same or different from the first and second forms, to produce a further library of recombinant polynucleotides; (4) screening the further library to identify at least one further optimized recombinant polynucleotide that exhibits an enhanced ability to modulate an immune response than a form of the nucleic acid from which the library was created.; and (5) repeating (3) and (4), as necessary, until the further optimized recombinant polynucleotide exhibits an further enhanced ability to modulate an immune response than a form of the nucleic acid from which the library was created.
- In some embodiments of the invention, the library of recombinant polynucleotides is screened by: expressing the recombinant polynucleotides so that the encoded peptides or polypeptides are produced as fusions with a protein displayed on the surface of a replicable genetic package; contacting the replicable genetic packages with a plurality of cells that display the receptor; and identifying cells that exhibit a modulation of an immune response mediated by the receptor.
- The invention also provides methods for obtaining a polynucleotide that encodes an accessory molecule that improves the transport or presentation of antigens by a cell. These methods involve creating a library of recombinant polynucleotides by subjecting to recombination nucleic acids that encode all or part of the accessory molecule; and screening the library to identify an optimized recombinant polynucleotide that encodes a recombinant accessory molecule that confers upon a cell an increased or decreased ability to transport or present an antigen on a surface of the cell compared to an accessory molecule encoded by the non-recombinant nucleic acids. In some embodiments, the screening step involves: introducing the library of recombinant polynucleotides into a genetic vaccine vector that encodes an antigen to form a library of vectors; introducing the library of vectors into mammalian cells; and identifying mammalian cells that exhibit increased or decreased immunogenicity to the antigen.
- In some embodiments of the invention, the cytokine that is optimized is interleukin-12 and the screening is performed by growing mammalian cells which contain the genetic vaccine vector in a culture medium, and detecting whether T cell proliferation or T cell differentiation is induced by contact with the culture medium. In another embodiment, the cytokine is interferon-α and the screening is performed by expressing the recombinant vector module as a fusion protein which is displayed on the surface of a bacteriophage to form a phage display library, and identifying phage library members which are capable of inhibiting proliferation of a B cell line. Another embodiment utilizes B7-1 (CD80) or B7-2 (CD86) as the costimulator and the cell or culture medium is tested for ability to modulate an immune response.
- The invention provides methods of using DNA shuffling to obtain optimized recombinant vector modules that encode cytokines and other costimulators that exhibit reduced immunogenicity compared to a corresponding polypeptide encoded by a non-optimized vector module. The reduced immunogenicity can be detected by introducing a cytokine or costimulator encoded by the recombinant vector module into a mammal and determining whether an immune response is induced against the cytokine.
- The invention also provides methods of obtaining optimized immunomodulatory sequences that encode a cytokine antagonist. For example, suitable cytokine agonists include a soluble cytokine receptor and a transmembrane cytokine receptor having a defective signal sequence. Examples include ΔIL-10R and ΔIL-4R, and the like.
-
FIG. 1 shows an example of a cytotoxic T-cell inducing sequence (CTIS) obtained from HBsAg polypeptide (PreS2 plus S regions). -
FIG. 2 shows a CTIS having heterologous epitopes attached to the cytoplasmic portion. -
FIG. 3 shows the derivation of immunogenic agonistic sequences (IAS) as described in Example 3. Specific killing (percent) is shown for an effector: target (E:T) ratio of five. -
FIG. 4 shows a method for preparing immunogenic agonist sequences (IAS). Wild-type (WT) and mutated forms of nucleic acids encoding a polypeptide of interest are assembled and subjected to DNA shuffling to obtain a nucleic acid encoding a poly-epitope region that contains potential agonist sequences. -
FIG. 5 shows a scheme for improving immunostimulatory sequences by DNA shuffling. -
FIG. 6 is a diagram of a procedure by which recombinant libraries of human IL-12 genes can be screened to identify shuffled IL-12 genes that encode recombinant IL-12 having increased ability to induce T cell proliferation. -
FIG. 7 shows the results of a high-throughput functional assay for vectors that encode variants of IL-12 obtained using the methods of the invention. -
FIG. 8 shows the induction of T cell proliferation upon transfection of the T ells by individual vectors that encode IL-12 variants. -
FIG. 9 shows results of an experiment which demonstrates that a shuffled IL-12 chimera obtained using the methods of the invention exhibits improved ability to activate human T cells. -
FIG. 10 shows a model of how T cell activation or anergy can be induced by genetic vaccine vectors that encode different B7-1 (CD80) and/or B7-2 (CD86) variants. -
FIG. 11 shows a method for using DNA shuffling to obtain CD80/CD86 variants that have improved capacity to induce T cell activation or anergy. -
FIG. 12 shows results obtained in a screening assay for altered function of B7. -
FIG. 13 provides experimental results which demonstrate that shuffled B7 chimeras provide potent T cell activation. -
FIG. 14 presents an alignment of the nucleotide sequences for human and mouse IL-10 receptor sequences. -
FIG. 15 shows an alignment of the nucleotide sequences of B7-1 (CD80) genes from human, rhesus monkey, and rabbit. - Definitions
- The term “cytokine” includes, for example, interleukins, interferons, chemokines, hematopoietic growth factors, tumor necrosis factors and transforming growth factors. In general these are small molecular weight proteins that regulate maturation, activation, proliferation and differentiation of the cells of the immune system.
- The term “screening” describes, in general, a process that identifies optimal immunomodulatory molecules. Several properties of the respective molecules can be used in selection and screening including, for example, ability to induce a desired immune response in a test system. Selection is a form of screening in which identification and physical separation are achieved simultaneously by expression of a selection marker, which, in some genetic circumstances, allows cells expressing the marker to survive while other cells die (or vice versa). Screening markers include, for example, luciferase, beta-galactosidase and green fluorescent protein. Selection markers include drug and toxin resistance genes, and the like. Because of limitations in studying primary immune responses in vitro, in vivo studies are particularly useful screening methods. In these studies, the genetic vaccines that include immunomodulatory molecules are first introduced to test animals, and the immune responses are subsequently studied by analyzing protective immune responses or by studying the quality or strength of the induced immune response using lymphoid cells derived from the immunized animal. Although spontaneous selection can and does occur in the course of natural evolution, in the present methods selection is performed by man.
- A “exogenous DNA segment”, “heterologous sequence” or a “heterologous nucleic acid”, as used herein, is one that originates from a source foreign to the particular host cell, or, if from the same source, is modified from its original form. Thus, a heterologous gene in a host cell includes a gene that is endogenous to the particular host cell, but has been modified. Modification of a heterologous sequence in the applications described herein typically occurs through the use of DNA shuffling. Thus, the terms refer to a DNA segment which is foreign or heterologous to the cell, or homologous to the cell but in a position within the host cell nucleic acid in which the element is not ordinarily found. Exogenous DNA segments are expressed to yield exogenous polypeptides.
- The term “gene” is used broadly to refer to any segment of DNA associated with a biological function. Thus, genes include coding sequences and/or the regulatory sequences required for their expression. Genes also include nonexpressed DNA segments that, for example, form recognition sequences for other proteins. Genes can be obtained from a variety of sources, including cloning from a source of interest or synthesizing from known or predicted sequence information, and may include sequences designed to have desired parameters.
- The term “isolated”, when applied to a nucleic acid or protein, denotes that the nucleic acid or protein is essentially free of other cellular components with which it is associated in the natural state. It is preferably in a homogeneous state although it can be in either a dry or aqueous solution. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. A protein which is the predominant species present in a preparation is substantially purified. In particular, an isolated gene is separated from open reading frames which flank the gene and encode a protein other than the gene of interest. The term “purified” denotes that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel. Particularly, it means that the nucleic acid or protein is at least about 50% pure, more preferably at least about 85% pure, and most preferably at least about 99% pure.
- The term “naturally-occurring” is used to describe an object that can be found in nature as distinct from being artificially produced by man. For example, a polypeptide or polynucleotide sequence that is present in an organism (including viruses, bacteria, protozoa, insects, plants or mammalian tissue) that can be isolated from a source in nature and which has not been intentionally modified by man in the laboratory is naturally-occurring.
- The term “nucleic acid” refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides which have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g. degenerate codon substitutions) and complementary sequences and as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al. (1991) Nucleic Acid Res. 19: 5081; Ohtsuka et al. (1985) J. Biol. Chem. 260: 2605-2608; Cassol et al. (1992); Rossolini et al. (1994) Mol. Cell. Probes 8: 91-98). The term nucleic acid is used interchangeably with gene, cDNA, and mRNA encoded by a gene.
- “Nucleic acid derived from a gene” refers to a nucleic acid for whose synthesis the gene, or a subsequence thereof, has ultimately served as a template. Thus, an mRNA, a cDNA reverse transcribed from an mRNA, an RNA transcribed from that cDNA, a DNA amplified from the cDNA, an RNA transcribed from the amplified DNA, etc., are all derived from the gene and detection of such derived products is indicative of the presence and/or abundance of the original gene and/or gene transcript in a sample.
- A nucleic acid is “operably linked” when it is placed into a functional relationship with another nucleic acid sequence. For instance, a promoter or enhancer is operably linked to a coding sequence if it increases the transcription of the coding sequence. Operably linked means that the DNA sequences being linked are typically contiguous and, where necessary to join two protein coding regions, contiguous and in reading frame. However, since enhancers generally function when separated from the promoter by several kilobases and intronic sequences may be of variable lengths, some polynucleotide elements may be operably linked but not contiguous.
- A specific binding affinity between two molecules, for example, a ligand and a receptor, means a preferential binding of one molecule for another in a mixture of molecules. The binding of the molecules can be considered specific if the binding affinity is about 1×104 M−1 to about 1×106M−1 or greater.
- The term “recombinant” when used with reference to a cell indicates that the cell replicates a heterologous nucleic acid, or expresses a peptide or protein encoded by a heterologous nucleic acid. Recombinant cells can contain genes that are not found within the native (non-recombinant) form of the cell. Recombinant cells can also contain genes found in the native form of the cell wherein the genes are modified and re-introduced into the cell by artificial means. The term also encompasses cells that contain a nucleic acid endogenous to the cell that has been modified without removing the nucleic acid from the cell; such modifications include those obtained by gene replacement, site-specific mutation, and related techniques.
- A “recombinant expression cassette” or simply an “expression cassette” is a nucleic acid construct, generated recombinantly or synthetically, with nucleic acid elements that are capable of effecting expression of a structural gene in hosts compatible with such sequences. Expression cassettes include at least promoters and optionally, transcription termination signals. Typically, the recombinant expression cassette includes a nucleic acid to be transcribed (e.g., a nucleic acid encoding a desired polypeptide), and a promoter. Additional factors necessary or helpful in effecting expression may also be used as described herein. For example, an expression cassette can also include nucleotide sequences that encode a signal sequence that directs secretion of an expressed protein from the host cell. Transcription termination signals, enhancers, and other nucleic acid sequences that influence gene expression, can also be included in an expression cassette.
- A “recombinant polynucleotide” or a “recombinant polypeptide” is a non-naturally occurring polynucleotide or polypeptide that includes nucleic acid or amino acid sequences, respectively, from more than one source nucleic acid or polypeptide, which source nucleic acid or polypeptide can be a naturally occurring nucleic acid or polypeptide, or can itself have been subjected to mutagenesis or other type of modification. The source polynucleotides or polypeptides from which the different nucleic acid or amino acid sequences are derived are sometimes homologous (i.e., have, or encode a polypeptide that encodes, the same or a similar structure and/or function), and are often from different isolates, serotypes, strains, species, of organism or from different disease states, for example.
- The terms “identical” or percent “identity,” in the context of two or more nucleic acid or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection.
- The phrase “substantially identical,” in the context of two nucleic acids or polypeptides, refers to two or more sequences or subsequences that have at least 60%, preferably 80%, most preferably 90-95% nucleotide or amino acid residue identity, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection. Preferably, the substantial identity exists over a region of the sequences that is at least about 50 residues in length, more preferably over a region of at least about 100 residues, and most preferably the sequences are substantially identical over at least about 150 residues. In some embodiments, the sequences are substantially identical over the entire length of the coding regions.
- For sequence comparison, typically one sequence acts as a reference sequence to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
- Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2: 482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48: 443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85: 2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by visual inspection (see generally Ausubel et al., infra).
- One example of an algorithm that is suitable for determining percent sequence identity and sequence similarity is the BLAST algorithm, which is described in Altschul et al., J. Mol. Biol. 215: 403-410 (1990). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/). This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al., supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always>0) and N (penalty score for mismatching residues; always<0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) of 10, a cutoff of 100, M=5, N=−4, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff (1989) Proc. Natl. Acad. Sci. USA 89: 10915).
- In addition to calculating percent sequence identity, the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul (1993) Proc. Nat'l. Acad. Sci. USA 90: 5873-5787). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001.
- Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions. The phrase “hybridizing specifically to”, refers to the binding, duplexing, or hybridizing of a molecule only to a particular nucleotide sequence under stringent conditions when that sequence is present in a complex mixture (e.g., total cellular) DNA or RNA. “Bind(s) substantially” refers to complementary hybridization between a probe nucleic acid and a target nucleic acid and embraces minor mismatches that can be accommodated by reducing the stringency of the hybridization media to achieve the desired detection of the target polynucleotide sequence.
- “Stringent hybridization conditions” and “stringent hybridization wash conditions” in the context of nucleic acid hybridization experiments such as Southern and northern hybridizations are sequence dependent, and are different under different environmental parameters. Longer sequences hybridize specifically at higher temperatures. An extensive guide to the hybridization of nucleic acids is found in Tijssen (1993) Laboratory Techniques in Biochemistry and Molecular Biology—Hybridization with Nucleic Acid Probes
part I chapter 2 “Overview of principles of hybridization and the strategy of nucleic acid probe assays”, Elsevier, N.Y. Generally, highly stringent hybridization and wash conditions are selected to be about 5° C. lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. Typically, under “stringent conditions” a probe will hybridize to its target subsequence, but to no other sequences. - The Tm is the temperature (under defined ionic strength and pH) at which 50% of the target sequence hybridizes to a perfectly matched probe. Very stringent conditions are selected to be equal to the Tm for a particular probe. An example of stringent hybridization conditions for hybridization of complementary nucleic acids which have more than 100 complementary residues on a filter in a Southern or northern blot is 50% formamide with 1 mg of heparin at 42° C., with the hybridization being carried out overnight. An example of highly stringent wash conditions is 0.1 SM NaCl at 72° C. for about 15 minutes. An example of stringent wash conditions is a 0.2×SSC wash at 65° C. for 15 minutes (see, Sambrook, infra., for a description of SSC buffer). Often, a high stringency wash is preceded by a low stringency wash to remove background probe signal. An example medium stringency wash for a duplex of, e.g., more than 100 nucleotides, is 1×SSC at 45° C. for 15 minutes. An example low stringency wash for a duplex of, e.g., more than 100 nucleotides, is 4-6×SSC at 40° C. for 15 minutes. For short probes (e.g., about 10 to 50 nucleotides), stringent conditions typically involve salt concentrations of less than about 1.0 M Na+ ion, typically about 0.01 to 1.0 M Na+ ion concentration (or other salts) at pH 7.0 to 8.3, and the temperature is typically at least about 30° C. Stringent conditions can also be achieved with the addition of destabilizing agents such as formamide. In general, a signal to noise ratio of 2× (or higher) than that observed for an unrelated probe in the particular hybridization assay indicates detection of a specific hybridization. Nucleic acids which do not hybridize to each other under stringent conditions are still substantially identical if the polypeptides which they encode are substantially identical. This occurs, e.g., when a copy of a nucleic acid is created using the maximum codon degeneracy permitted by the genetic code.
- A further indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with, or specifically binds to, the polypeptide encoded by the second nucleic acid. Thus, a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions.
- The phrase “specifically (or selectively) binds to an antibody” or “specifically (or selectively) immunoreactive with”, when referring to a protein or peptide, refers to a binding reaction which is determinative of the presence of the protein, or an epitope from the protein, in the presence of a heterogeneous population of proteins and other biologics. Thus, under designated immunoassay conditions, the specified antibodies bind to a particular protein and do not bind in a significant amount to other proteins present in the sample. The antibodies raised against a multivalent antigenic polypeptide will generally bind to the proteins from which one or more of the epitopes were obtained. Specific binding to an antibody under such conditions may require an antibody that is selected for its specificity for a particular protein. A variety of immunoassay formats may be used to select antibodies specifically immunoreactive with a particular protein. For example, solid-phase ELISA immunoassays, Western blots, or immunohistochemistry are routinely used to select monoclonal antibodies specifically immunoreactive with a protein. See Harlow and Lane (1988) Antibodies, A Laboratory Manual, Cold Spring Harbor Publications, New York “Harlow and Lane”), for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity. Typically a specific or selective reaction will be at least twice background signal or noise and more typically more than 10 to 100 times background.
- “Conservatively modified variations” of a particular polynucleotide sequence refers to those polynucleotides that encode identical or essentially identical amino acid sequences, or where the polynucleotide does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given polypeptide. For instance, the codons CGU, CGC, CGA, CGG, AGA, and AGG all encode the amino acid arginine. Thus, at every position where an arginine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are “silent variations,” which are one species of “conservatively modified variations.” Every polynucleotide sequence described herein which encodes a polypeptide also describes every possible silent variation, except where otherwise noted. One of skill will recognize that each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine) can be modified to yield a functionally identical molecule by standard techniques. Accordingly, each “silent variation” of a nucleic acid which encodes a polypeptide is implicit in each described sequence.
- Furthermore, one of skill will recognize that individual substitutions, deletions or additions which alter, add or delete a single amino acid or a small percentage of amino acids (typically less than 5%, more typically less than 1%) in an encoded sequence are “conservatively modified variations” where the alterations result in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. The following five groups each contain amino acids that are conservative substitutions for one another:
-
- Aliphatic: Glycine (G), Alanine (A), Valine (V), Leucine (L), Isoleucine (I);
- Aromatic: Phenylalanine (F), Tyrosine (Y), Tryptophan (W);
- Sulfur-containing: Methionine (M), Cysteine (C);
- Basic: Arginine (R), Lysine (K), Histidine (H);
- Acidic: Aspartic acid (D), Glutamic acid (E), Asparagine (N), Glutamine (Q).
See also, Creighton (1984) Proteins, W.H. Freeman and Company, for additional groupings of amino acids. In addition, individual substitutions, deletions or additions which alter, add or delete a single amino acid or a small percentage of amino acids in an encoded sequence are also “conservatively modified variations”.
- A “subsequence” refers to a sequence of nucleic acids or amino acids that comprise a part of a longer sequence of nucleic acids or amino acids (e.g., polypeptide) respectively.
- The present invention provides methods for obtaining polynucleotide sequences that, either directly or indirectly (i.e., through encoding a polypeptide), can modulate an immune response when present on a genetic vaccine vector. In another embodiment, the invention provides methods for optimizing the transport and presentation of antigens. The optimized immunomodulatory polynucleotides obtained using the methods of the invention are particularly suited for use in conjunction with vaccines, including genetic vaccines. One of the advantages of genetic vaccines is that one can incorporate genes encoding immunomodulatory molecules, such as cytokines, costimulatory molecules, and molecules that improve antigen transport and presentation into the genetic vaccine vectors. This provides opportunities to modulate immune responses that are induced against the antigens expressed by the genetic vaccines.
- A. Creation of Recombinant Libraries
- The invention involves creating recombinant libraries of polynucleotides that are then screened to identify those library members that exhibit a desired property. The recombinant libraries can be created using any of various methods.
- The substrate nucleic acids used for the recombination can vary depending upon the particular application. For example, where a polynucleotide that encodes a cytokine, chemokine, or other accessory molecule is to be optimized, different forms of nucleic acids that encode all or part of the cytokine, chemokine, or other accessory molecule are subjected to recombination. The methods require at least two variant forms of a starting substrate. The variant forms of candidate substrates can show substantial sequence or secondary structural similarity with each other, but they should also differ in at least two positions. The initial diversity between forms can be the result of natural variation, e.g., the different variant forms (homologs) are obtained from different individuals or strains of an organism (including geographic variants) or constitute related sequences from the same organism (e.g., allelic variations). Alternatively, the initial diversity can be induced, e.g., the second variant form can be generated by error-prone transcription, such as an error-prone PCR or use of a polymerase which lacks proof-reading activity (see Liao (1990) Gene 88: 107-111), of the first variant form, or, by replication of the first form in a mutator strain (mutator host cells are discussed in further detail below). The initial diversity between substrates is greatly augmented in subsequent steps of recursive sequence recombination.
- Often, improvements are achieved after one round of recombination and selection. However, recursive sequence recombination can be employed to achieve still further improvements in a desired property. Sequence recombination can be achieved in many different formats and permutations of formats, as described in further detail below. These formats share some common principles. Recursive sequence recombination entails successive cycles of recombination to generate molecular diversity. That is, one creates a family of nucleic acid molecules showing some sequence identity to each other but differing in the presence of mutations. In any given cycle, recombination can occur in vivo or in vitro, intracellular or extracellular. Furthermore, diversity resulting from recombination can be augmented in any cycle by applying prior methods of mutagenesis (e.g., error-prone PCR or cassette mutagenesis) to either the substrates or products for recombination. In some instances, a new or improved property or characteristic can be achieved after only a single cycle of in vivo or in vitro recombination, as when using different, variant forms of the sequence, as homologs from different individuals or strains of an organism, or relate d sequences from the same organism, as allelic variations.
- In a presently preferred embodiment, the recombinant libraries are prepared using DNA shuffling. The shuffling and screening or selection can be used to “evolve” individual genes, whole plasmids or viruses, multigene clusters, or even whole genomes (Stemmer (1995) Bio/Technology 13: 549-553). Reiterative cycles of recombination and screening/selection can be performed to further evolve the nucleic acids of interest. Such techniques do not require the extensive analysis and computation required by conventional methods for polypeptide engineering. Shuffling allows the recombination of large numbers of mutations in a minimum number of selection cycles, in contrast to traditional, pairwise recombination events. Thus, the sequence recombination techniques described herein provide particular advantages in that they provide recombination between mutations in any or all of these, thereby providing a very fast way of exploring the manner in which different combinations of mutations can affect a desired result. In some instances, however, structural and/or functional information is available which, although not required for sequence recombination, provides opportunities for modification of the technique.
- Exemplary formats and examples for sequence recombination, sometimes referred to as DNA shuffling, evolution, or molecular breeding, have been described by the present inventors and co-workers in co-pending applications U.S. patent application Ser. No. 08/198,431, filed Feb. 17, 1994, Serial No. PCT/US95/02126, filed, Feb. 17, 1995, Ser. No. 08/425,684, filed Apr. 18, 1995, Ser. No. 08/537,874, filed Oct. 30, 1995, Ser. No. 08/564,955, filed Nov. 30, 1995, Ser. No. 08/621,859, filed Mar. 25, 1996, Ser. No. 08/621,430, filed Mar. 25, 1996, Serial No. PCT/US96/05480, filed Apr. 18, 1996, Ser. No. 08/650,400, filed May 20, 1996, Ser. No. 08/675,502, filed Jul. 3, 1996, Ser. No. 08/721, 824, filed Sep. 27, 1996, Serial No. PCT/US97/17300, filed Sep. 26, 1997, and Serial No. PCT/US97/24239, filed Dec. 17, 1997; Stemmer, Science 270: 1510 (1995); Stemmer et al., Gene 164: 49-53 (1995); Stemmer, Bio/Technology 13: 549-553 (1995); Stemmer, Proc. Natl. Acad. Sci. U.S.A. 91: 10747-10751 (1994); Stemmer, Nature 370: 389-391 (1994); Crameri et al., Nature Medicine 2(1): 1-3 (1996); Crameri et al., Nature Biotechnology 14: 315-319 (1996), each of which is incorporated by reference in its entirety for all purposes.
- Other methods for obtaining recombinant polynucleotides and/or for obtaining diversity in nucleic acids used as the substrates for shuffling include, for example, homologous recombination (PCT/US98/05223; Publ. No. WO98/42727); oligonucleotide-directed mutagenesis (for review see, Smith, Ann. Rev. Genet. 19: 423-462 (1985); Botstein and Shortle, Science 229: 1193-1201 (1985); Carter, Biochem. J. 237: 1-7 (1986); Kunkel, “The efficiency of oligonucleotide directed mutagenesis” in Nucleic acids & Molecular Biology, Eckstein and Lilley, eds., Springer Verlag, Berlin (1987)). Included among these methods are oligonucleotide-directed mutagenesis (Zoller and Smith, Nucl. Acids Res. 10: 6487-6500 (1982), Methods in Enzymol. 100: 468-500 (1983), and Methods in Enzymol. 154: 329-350 (1987)) phosphothioate-modified DNA mutagenesis (Taylor et al., Nucl. Acids Res. 13: 8749-8764 (1985); Taylor et al., Nucl. Acids Res. 13: 8765-8787 (1985); Nakamaye and Eckstein, Nucl. Acids Res. 14: 9679-9698 (1986); Sayers et al., Nucl. Acids Res. 16: 791-802 (1988); Sayers et al, Nucl. Acids Res. 16: 803-814 (1988)), mutagenesis using uracil-containing templates (Kunkel, Proc. Nat'l. Acad. Sci. USA 82: 488-492 (1985) and Kunkel et al., Methods in Enzymol. 154: 367-382)); mutagenesis using gapped duplex DNA (Kramer et al., Nucl. Acids Res. 12: 9441-9456 (1984); Kramer and Fritz, Methods in Enzymol. 154: 350-367 (1987); Kramer et al., Nucl. Acids Res. 16: 7207 (1988)); and Fritz et al., Nucl. Acids Res. 16: 6987-6999 (1988)). Additional suitable methods include point mismatch repair (Kramer et al., Cell 38: 879-887 (1984)), mutagenesis using repair-deficient host strains (Carter et al., Nucl. Acids Res. 13: 4431-4443 (1985); Carter, Methods in Enzymol. 154: 382-403 (1987)), deletion mutagenesis (Eghtedarzadeh and Henikoff, Nucl. Acids Res. 14: 5115 (1986)), restriction-selection and restriction-purification (Wells et al., Phil. Trans. R. Soc. Lond. A 317: 415-423 (1986)), mutagenesis by total gene synthesis (Nambiar et al., Science 223: 1299-1301 (1984); Sakamar and Khorana, Nucl. Acids Res. 14: 6361-6372 (1988); Wells et al., Gene 34: 315-323 (1985); and Grundström et al., Nucl. Acids Res. 13: 3305-3316 (1985). Kits for mutagenesis are commercially available (e.g., Bio-Rad, Amersham International, Anglian Biotechnology).
- B. Screening Methods
- A recombination cycle is usually followed by at least one cycle of screening or selection for molecules having a desired property or characteristic. If a recombination cycle is performed in vitro, the products of recombination, i.e., recombinant segments, are sometimes introduced into cells before the screening step. Recombinant segments can also be linked to an appropriate vector or other regulatory sequences before screening. Alternatively, products of recombination generated in vitro are sometimes packaged as viruses before screening. If recombination is performed in vivo, recombination products can sometimes be screened in the cells in which recombination occurred. In other applications, recombinant segments are extracted from the cells, and optionally packaged as viruses, before screening.
- The nature of screening or selection depends on what property or characteristic is to be acquired or the property or characteristic for which improvement is sought, and many examples are discussed below. It is not usually necessary to understand the molecular basis by which particular products of recombination (recombinant segments) have acquired new or improved properties or characteristics relative to the starting substrates. For example, a genetic vaccine vector can have many component sequences each having a different intended role (e.g., coding sequence, regulatory sequences, targeting sequences, stability-conferring sequences, immunomodulatory sequences, sequences affecting antigen presentation, and sequences affecting integration). Each of these component sequences can be varied and recombined simultaneously. Screening/selection can then be performed, for example, for recombinant segments that have increased episomal maintenance in a target cell without the need to attribute such improvement to any of the individual component sequences of the vector.
- Depending on the particular screening protocol used for a desired property, initial round(s) of screening can sometimes be performed in bacterial cells due to high transfection efficiencies and ease of culture. Later rounds, and other types of screening which are not amenable to screening in bacterial cells, are performed in mammalian cells to optimize recombinant segments for use in an environment close to that of their intended use. Final rounds of screening can be performed in the precise cell type of intended use (e.g., a human antigen-presenting cell). In some instances, this cell can be obtained from a patient to be treated with a view, for example, to minimizing problems of immunogenicity in this patient.
- The screening or selection step identifies a subpopulation of recombinant segments that have evolved toward acquisition of a new or improved desired property or properties useful in genetic vaccination. Depending on the screen, the recombinant segments can be identified as components of cells, components of viruses or in free form. More than one round of screening or selection can be performed after each round of recombination.
- If further improvement in a property is desired, at least one and usually a collection of recombinant segments surviving a first round of screening/selection are subject to a further round of recombination. These recombinant segments can be recombined with each other or with exogenous segments representing the original substrates or further variants thereof. Again, recombination can proceed in vitro or in vivo. If the previous screening step identifies desired recomibinant segments as components of cells, the components can be subjected to further recombination in vivo, or can be subjected to further recombination in vitro, or can be isolated before performing a round of in vitro recombination. Conversely, if the previous screening step identifies desired recombinant segments in naked form or as components of viruses, these segments can be introduced into cells to perform a round of in vivo recombination. The second round of recombination, irrespective how performed, generates further recombinant segments which encompass additional diversity than is present in recombinant segments resulting from previous rounds.
- The second round of recombination can be followed by a further round of screening/selection according to the principles discussed above for the first round. The stringency of screening/selection can be increased between rounds. Also, the nature of the screen and the property being screened for can vary between rounds if improvement in more than one property is desired or if acquiring more than one new property is desired. Additional rounds of recombination and screening can then be performed until the recombinant segments have sufficiently evolved to acquire the desired new or improved property or function.
- Various screening methods for particular applications are described herein. In several instances, screening involves expressing the recombinant peptides or polypeptides encoded by the recombinant polynucleotides of the library as fusions with a protein that is displayed on the surface of a replicable genetic package. For example, phage display can be used. See, e.g, Cwirla et al., Proc. Natl. Acad. Sci. USA 87: 6378-6382 (1990); Devlin et al., Science. 249: 404-406 (1990), Scott & Smith, Science 249: 386-388 (1990); Ladner et al., U.S. Pat. No. 5,571,698. Other replicable genetic packages include, for example, bacteria, eukaryotic viruses, yeast, and spores.
- The genetic packages most frequently used for display libraries are bacteriophage, particularly filamentous phage, and especially phage M13, Fd and F1. Most work has involved inserting libraries encoding polypeptides to be displayed into either gIII or gVIII of these phage forming a fusion protein. See, e.g., Dower, WO 91/19818; Devlin, WO91/18989; MacCafferty, WO 92/01047 (gene III); Huse, WO92/06204; Kang, WO 92/18619 (gene VIII). Such a fusion protein comprises a signal sequence, usually but not necessarily, from the phage coat protein, a polypeptide to be displayed and either the gene III or gene VIII protein or a fragment thereof. Exogenous coding sequences are often inserted at or near the N-terminus of gene III or gene VIII although other insertion sites are possible.
- Eukaryotic viruses can be used to display polypeptides in an analogous manner. For example, display of human heregulin fused to gp70 of Moloney murine leukemia virus has been reported by Han et al., Proc. Natl. Acad. Sci. USA 92: 9747-9751 (1995). Spores can also be used as replicable genetic packages. In this case, polypeptides are displayed from the outer surface of the spore. For example, spores from B. subtilis have been reported to be suitable. Sequences of coat proteins of these spores are provided by Donovan et al., J. Mol. Biol. 196, 1-10 (1987). Cells can also be used as replicable genetic packages. Polypeptides to be displayed are inserted into a gene encoding a cell protein that is expressed on the cells surface. Bacterial cells including Salmonella typhimurium, Bacillus subtilis, Pseudomonas aeruginosa, Vibrio cholerae, Klebsiella pneumonia, Neisseria gonorrhoeae, Neisseria meningitidis, Bacteroides nodosus, Moraxella bovis, and especially Escherichia coli are preferred. Details of outer surface proteins are discussed by Ladner et al., U.S. Pat. No. 5,571,698 and references cited therein. For example, the lamB protein of E. coli is suitable.
- A basic concept of display methods that use phage or other replicable genetic package is the establishment of a physical association between DNA encoding a polypeptide to be screened and the polypeptide. This physical association is provided by the replicable genetic package, which displays a polypeptide as part of a capsid enclosing the genome of the phage or other package, wherein the polypeptide is encoded by the genome. The establishment of a physical association between polypeptides and their genetic material allows simultaneous mass screening of very large numbers of phage bearing different polypeptides. Phage displaying a polypeptide with affinity to a target, e.g., a receptor, bind to the target and these phage are enriched by affinity screening to the target. The identity of polypeptides displayed from these phage can be determined from their respective genomes. Using these methods a polypeptide identified as having a binding affinity for a desired target can then be synthesized in bulk by conventional means, or the polynucleotide that encodes the peptide or polypeptide can be used as part of a genetic vaccine.
- C. Evolution of Improved Immunomodulatory Sequences
- Cytokines can dramatically influence macrophage activation and
T H1/T H2 cell differentiation, and thereby the outcome of infectious diseases. In addition, recent studies strongly suggest that DNA itself can act as adjuvant by activating the cells of the immune system. Specifically, unmethylated CpG-rich DNA sequences were shown to enhanceT H1 cell differentiation, activate cytokine synthesis by monocytes and induce proliferation of B lymphocytes. The invention thus provides methods for enhancing the immunomodulatory properties of genetic vaccines (a) by evolving the stimulatory properties of DNA itself and (b) by evolving genes encoding cytokines and related molecules that are involved in immune system regulation. These genes are then used in genetic vaccine vectors. - Of particular interest are IFN-α and IL-12, which skew immune responses towards a T helper 1 (TH1) cell phenotype and, thereby, improve the host's capacity to counteract pathogen invasions. Also provided are methods of obtaining improved immunomodulatory nucleic acids that are capable of inhibiting or enhancing activation, differentiation, or anergy of antigen-specific T cells. Because of the limited information about the structures and mechanisms that regulate these events, molecular breeding techniques of the invention provide much faster solutions than rational design.
- The methods of the invention typically involve the use of DNA shuffling or other methods to create a library of recombinant polynucleotides. The library is then screened to identify recombinant polynucleotides in the library, when included in a genetic vaccine vector or administered in conjunction with a genetic vaccine, are capable of enhancing or otherwise altering an immune response induced by the vector. The screening step, in some embodiments, can involve introducing a genetic vaccine vector that includes the recombinant polynucleotides into mammalian cells and determining whether the cells, or culture medium obtained by growing the cells, is capable of modulating an immune response.
- Optimized recombinant vector modules obtained through polynucleotide recombination are useful not only as components of genetic vaccine vectors, but also for production of polypeptides, e.g., modified cytokines and the like, that can be administered to a mammal to enhance or shift an immune response. Polynucleotide sequences obtained using the DNA shuffling methods of the invention can be used as a component of a genetic vaccine, or can be used for production of cytokines and other immunomodulatory polypeptides that are themselves used as therapeutic or prophylactic reagents. If desired, the sequence of the optimized immunomodulatory polypeptide-encoding polynucleotides can be determined and the deduced amino acid sequence used to produce polypeptides using methods known to those of skill in the art.
- 1. Immunostimulatory DNA Sequences
- The invention provides methods of obtaining polynucleotides that are immunostimulatory when introduced into a mammal. Oligonucleotides that contain hexamers with a central CpG flanked by two 5′ purines (GpA or ApA) and two 3′ pyrimidines (TpC or TpT) efficiently induce cytokine synthesis and B cell proliferation (Krieg et al. (1995) Nature 374: 546; Klinman et al. (1996) Proc. Nat l. Acad. Sci. USA 93: 2879; Pisetsky (1.996) Immunity 5: 303-10) in vitro and act as adjuvants in vivo. Genetic vaccine vectors in which immunostimulatory sequence-(ISS) containing oligos are inserted have increased capacity to enhance antigen-specific antibody responses after DNA vaccination. The minimal length of an ISS oligonucleotide for functional activity in vitro is eight (Klinman et al., supra.). Twenty-mers with three CG motifs were found to be significantly more efficient in inducing cytokine synthesis than a 15-mer with two CG motifs (Id.). GGGG tetrads have been suggested to be involved in binding of DNA to cell surfaces (macrophages express receptors for example scavenger receptors, that bind DNA) (Pisetsky et al., supra.).
- According to the invention, a library is generated by subjecting to recombination random DNA (e.g., fragments of human, murine, or other genomic DNA), oligonucleotides that contain known ISS, poly A, C, G or T sequences, or combinations thereof. The DNA, which includes at least first and second forms which differ from each other in two or more nucleotides, are recombined to produce a library of recombinant polynucleotides.
- The library is then screened to identify those recombinant polynucleotides that exhibit immunostimulatory properties. For example, the library can be screened for induction cytokine production in vitro upon introduction of the library into an appropriate cell type. A diagram of this procedure is shown in
FIG. 5 . Among the cytokines that can be used as an indicator of immunostimulatory activity are, for example, IL-2, IL-4, IL-5, IL-6, IL-10, IL-12, IL-13, IL-15, and IFN-γ. One can also test for changes in ratios of IL-4/IFN-γ, IL-4/IL-2, IL-5/IFN-γ, IL-5/IL-2, IL-13/IFN-γ, IL-13/IL-2. An alternative screening method is the determination of the ability to induce proliferation of cells involved in immune responses, such as B cells, T cells, monocytes/macrophages, total PBL, and the like. Other screens include detecting induction of APC activation based on changes in expression levels of surface antigens, such as B7-1 (CD80), B7-2 (CD86), MHC class I and II, and CD14. - Other useful screens include identifying recombinant polynucleotides that induce T cell proliferation. Because ISS sequences induce B cell activation, and because of several homologies between surface antigens expressed by T cells and B cells, polynucleotides can be obtained that have stimulatory activities on T cells.
- Libraries of recombinant polynucleotides can also be screened for imp roved CTL and antibody responses in vivo and for improved protection from infection, cancer, allergy or autoimmunity. Recombinant polynucleotides that exhibit the desired property can be recovered from the cell and, if further improvement is desired, the shuffling and screening can be repeated. Optimized ISS sequences can used as an adjuvant separately from an actual vaccine, or the DNA sequence of interest can be fused to a genetic vaccine vector.
- 2. Cytokines, Chemokines, and Accessory Molecules
- The invention also provides methods for obtaining optimized cytokines, cytokine antagonists, chemokines, and other accessory molecules that direct, inhibit, or enhance immune responses. For example, the methods of the invention can be used to obtain genetic vaccines and other reagents (e.g., optimized cytokines, and the like) that, when administered to a mammal, improve or alter an immune response. These optimized immunomodulators are useful for treating infectious diseases, as well as other conditions such as inflammatory disorders, in an antigen non-specific manner.
- For example, the methods of the invention can be used to develop optimized immunomodulatory molecules for treating allergies. The optimized immunomodulatory molecules can be used alone or in conjunction with antigen-specific-genetic vaccines to prevent or treat allergy. Four basic mechanisms are available by which one can achieve specific immunotherapy of allergy. First, one can administer a reagent that causes a decrease in allergen-
specific T H2 cells. Second, a reagent can be administered that causes an increase in allergen-specific T H1 cells. Third, one can direct an increase in suppressive CD8+ T cells. Finally, allergy can be treated by inducing anergy of allergen-specific T cells. In this Example, cytokines are optimized using the methods of the invention to obtain reagents that are effective in achieving one or more of these immunuotherapeutic goals. The methods of the invention are used to obtain anti-allergic cytokines that have one or more properties such as improved specific activity, improved secretion after introduction into target cells, are effective at a lower dose than natural cytokines, and fewer side effects. Targets of particular interest include interferon-α/γ, IL-10, IL-12, and antagonists of IL-4 and IL-13. - The optimized immunomodulators, or optimized recombinant polynucleotides that encode the immunomodulators, can be administered alone, or in combination with other accessory molecules. Inclusion of optimal concentrations of the appropriate molecules can enhance a desired immune response, and/or direct the induction or repression of a particular type of immune response. The polynucleotides that encode the optimized molecules can be included in a genetic vaccine vector, or the optimized molecules encoded by the genes can be administered as polypeptides.
- In the methods of the invention, a library of recombinant polynucleotides that encode immunomodulators is created by subjecting substrate nucleic acids to a recombination protocol, such as DNA shuffling or other method known to those of skill in the art. The substrate nucleic acids are typically two or more forms of a nucleic acid that encodes an immunomodulator of interest.
- Cytokines are among the immunomodulators that can be improved using the methods of the invention. Cytokine synthesis profiles play a crucial role in the capacity of the host to counteract viral, bacterial and parasitic infections, and cytokines can dramatically influence the efficacy of genetic vaccines and the outcome of infectious diseases. Several cytokines, for example IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, G-CSF, GM-CSF, IFN-α, IFN-γ, TGF-α, TNF-α, TNF-β, IL-20 (MDA-7), and flt-3 ligand have been shown stimulate immune responses in vitro or in vivo. Immune functions that can be enhanced using appropriate cytokines include, for example, B cell proliferation, Ig synthesis, Ig isotype switching, T cell proliferation and cytokine synthesis, differentiation of
T H1 andT H2 cells, activation and proliferation of CTLs, activation and cytokine production by monocytes/macrophages/dendritic cells, and differentiation of dendritic cells from monocytes/macrophages. - In some embodiments, the invention provides methods of obtaining optimized immunomodulators that can direct an immune response towards a
T H1 or aT H2 response. The ability to influence the direction of immune responses in this manner is of great importance in development of genetic vaccines. Altering the type of TH response can fundamentally change the outcome of an infectious disease. A high frequency ofT H1 cells generally protects from lethal infections with intracellular pathogens, whereas adominant T H2 phenotype often results in disseminated, chronic infections. For example, in human, theT H1 phenotype is present in the tuberculoid (resistant) form of leprosy, while theT H2 phenotype is found in lepromatous, multibacillary (susceptible) lesions (Yamamura et al. (1991) Science 254: 277). Late-stage AIDS patients have theT H2 phenotype. Studies in family members indicate that survival from meningococcal septicemia depends on the cytokine synthesis profile of PBL, with high IL-10 synthesis being associated with a high risk of lethal outcome and high TNF-α being associated with a low risk. Similar examples are found in mice. For example, BALB/c mice are susceptible to Leishmania major infection; these mice develop a disseminated fatal disease with aT H2 phenotype. Treatment with anti-IL-4 monoclonal antibodies or with IL-12 induces aT H1 response, resulting in healing. Anti-interferon-γ monoclonal antibodies exacerbate the disease. For some applications, it is preferable to direct an immune response in the direction of aT H2 response For example, where increased mucosal immunity is desired, including protective immunity, enhancing theT H2 response can lead to increased antibody production, particularly IgA. - T helper (TH) cells are probably the most important regulators of the immune system. TH cells are divided into two subsets, based on their cytokine synthesis pattern (Mosmann and Coffman (1989) Adv. Immunol. 46: 111).
T H1 cells produce high levels of the cytokines IL-2 and IFN-γ and no or minimal levels of IL-4, IL-5 and IL-13. In contrast,T H2 cells produce high levels of IL-4, IL-5 and IL-13, and IL-2 and IFN-γ production is minimal or absent.T H1 cells activate macrophages, dendritic cells and augment the cytolytic activity of CD8+ cytotoxic T lymphocytes and natural killer (NK) cells (Paul and Seder (1994) Cell 76: 241), whereasT H2 cells provide efficient help for B cells and also mediate allergic responses due to the capacity ofT H2 cells to induce IgE isotype switching and differentiation of B cells into IgE secreting cells (Punnonen et al. (1993) Proc. Nat'l. Acad. Sci. USA 90: 3730). - The screening methods for improved cytokines, chemokines, and other accessory molecules are generally based on identification of modified molecules that exhibit improved specific activity on target cells that are sensitive to the respective cytokine, chemokine, or other accessory molecules. A library of recombinant cytokine, chemokine, or accessory molecule nucleic acids can be expressed on phage or as purified protein and tested using in vitro cell culture assays, for example. Importantly, when analyzing the recombinant nucleic acids as components of DNA vaccines, one can identify the most optimal DNA sequences (in addition to the functions of the protein products) in terms of their immunostimulatory properties, transfection efficiency, and their capacity to improve the stabilities of the vectors. The identified optimized recombinant nucleic acids can then be subjected to new rounds of shuffling and selection.
- In one embodiment of the invention, cytokines are evolved that direct differentiation of
T H1 cells. Because of their capacities to skew immune responses towards aT H1 phenotype, the genes encoding interferon-α (IFN-α) and interleukin-12 (IL-12) are preferred substrates for recombination and selection in order to obtain maximal specific activity and capacity to act as adjuvants in genetic vaccinations. IFN-α is a particularly preferred target for optimization using the methods of the invention because of its effects on the immune system, tumor cells growth and viral replication. Due to these activities, IFN-α was the first cytokine to be used in clinical practice. Today, IFN-α is used for a wide variety of applications, including several types of cancers and viral diseases. IFN-α also efficiently directs differentiation of human T cells intoT H1 phenotype (Parronchi et al. (1992) J. Immunol. 149: 2977). However, it has not been thoroughly investigated in vaccination models, because, in contrast to human systems, it does not affectT H1 differentiation in mice. The species difference was recently explained by data indicating that, like IL-12, IFN-α induces STAT4 activation in human cells but not in murine cells, and STAT4 has been shown to be required in IL-12 mediatedT H1 differentiation (Thierfelder et al. (1996) Nature 382: 171). - Family DNA shuffling is a preferred method for optimizing IFN-α, using as substrates the mammalian IFN-α genes, which are 85%-97% homologous. Greater than 1026 distinct recombinants can be generated from the natural diversity in these genes. To allow rapid parallel analysis of recombinant interferons, one can employ high throughput methods for their expression and biological assay as fusion proteins on bacteriophage. Recombinants with improved potency and selectivity profiles are being selectively bred for improved activity. Variants which demonstrate improved binding to IFN-α receptors can be selected for further analysis using a screen for mutants with optimal capacity to direct THI differentiation. More specifically, the capacities of IFN-α mutants to induce IL-2 and IFN-γ production in in vitro human T lymphocyte cultures can be studied by cytokine-specific ELISA and cytoplasmic cytokine staining and flow cytometry.
- IL-12 is perhaps the most potent cytokine that directs
T H1 responses, and it has also been shown to act as an adjuvant and enhanceT H1 responses following genetic vaccinations (Kim et al. (1997) J. Immunol. 158: 816). IL-12 is both structurally and functionally a unique cytokine. It is the only heterodimeric cytokine known to date, composed of a 35 kD light chain (p35) and a 40 kD heavy chain (p40) (Kobayashi et al (1989) J. Exp. Med. 170: 827; Stern et al. (1990) Proc. Nat'l. Acad. Sci. USA 87: 6808). Recently Lieschke et al. ((1997) Nature Biotech. 15: 35) demonstrated that a fusion between p35 and p40 genes results in a single gene that has activity comparable to that of the two genes expressed separately. These data indicate that it is possible to shuffle IL-12 genes as one entity, which is beneficial in designing the shuffling protocol. Because of its T cell growth promoting activities, one can use normal human peripheral blood T cells in the selection of the most active IL-12 genes, enabling direct selection of IL-12 mutants with the most potent activities on human T cells. IL-12 mutants can be expressed in CHO cells, for example, and the ability of the supernatants to induce T cell proliferation determined (FIG. 6 ). The concentrations of IL-12 in the supernatants can be normalized based on a specific ELISA that detects a tag fused to the shuffled IL-12 molecules. - Incorporation of evolved IFN-α and/or IL-12 genes into genetic vaccine vectors is expected to be safe. The safety of IFN-α has been demonstrated in numerous clinical studies and in everyday hospital practice. A Phase II trial of IL-12 in the treatment of patients with renal cell cancer resulted in several unexpected adverse effects (Tahara et al. (1995) Human Gene Therapy 6: 1607). However, IL-12 gene as a component of genetic vaccines aims at high local expression levels, whereas the levels observed in circulation are minimal compared to those observed after systemic bolus injections. In addition, some of the adverse effects of systemic IL-12 treatments are likely to be related to its unusually long half-life (up to 48 hours in monkeys). DNA shuffling may allow selection for a shorter half-life, thereby reducing the toxicity even after high bolus doses.
- In other cases, genetic vaccines that can induce
T H2 responses are preferred, especially when improved antibody production is desired. As an example, IL-4 has been shown to direct differentiation ofT H2 cells (which produce high levels of IL-4, IL-5 and IL-13, and mediate allergic immune responses). Immune responses that are skewed towardsT H2 phenotype are preferred when genetic vaccines are used to immunize against autoimmune diseases prophylactically.T H1 responses are also preferred when the vaccines are used to treat and modulate existing autoimmune responses, because autoreactive T cells are generally ofT H1 phenotype (Liblau et al. (1995) Immunol. Today 16: 34-38). IL-4 is also the most potent cytokine in induction of IgE synthesis; IL-4 deficient mice are unable to produce IgE. Asthma and allergies are associated with an increased frequency of IL-4 producing cells, and are genetically linked to the locus encoding IL-4, which is on chromosome 5 (in close proximity to genes encoding IL-3, IL-5, IL-9, IL-13 and GM-CSF). IL-4, which is produced by activated T cells, basophils and mast cells, is a protein that has 153 amino acids and two potential N-glycosylation sites. Human IL-4 is only approximately 50% identical to mouse IL-4, and IL-4 activity is species-specific. In human, IL-13 has activities similar to those of IL-4, but IL-13 is less potent than IL-4 in inducing IgE synthesis. IL-4 is the only cytokine known to directT H2 differentiation. - Improved IL-2 agonists are also useful in directing
T H2 cell differentiation, whereas improved IL-4 antagonists can directT H1 cell differentiation. Improved IL-4 agonists and antagonists can be generated by shuffling of IL-4 or soluble IL-4 receptor. The IL-4 receptor consists of an IL-4R α-chain (140 kD high-affinity binding unit) and an IL-2R γ-chain (these cytokine receptors share a common γ-chain). The IL-4R α-chain is shared by IL-4 and IL-13 receptor complexes. Both IL-4 and IL-13 induce phosphorylation of the IL-4R α-chain, but expression of IL-4R α-chain alone on transfectants is not sufficient to provide a functional IL-4R. Soluble IL-4 receptor currently in clinical trials for the treatment of allergies. Using the DNA shuffling methods of the invention, one can evolve a soluble IL-4 receptor that has improved affinity for IL-4. Such receptors are useful for the treatment of asthma andother T H2 cell mediated diseases, such as severe allergies. The shuffling reactions can take advantage of natural diversity present in cDNA libraries from activated T cells from human and other primates. In a typical embodiment, a shuffled IL-4R α-chain library is expressed on a phage, and mutants that bind to IL-4 with improved affinity are identified. The biological activity of the selected mutants is then assayed using cell-based assays. - IL-2 and IL-15 are also of particular interest for use in genetic vaccines. IL-2 acts as a growth factor for activated B and T cells, and it also modulates the functions of NK-cells. IL-2 is predominantly produced by TH1-like T cell clones, and, therefore, it is considered mainly to function in delayed type hypersensitivity reactions. However, IL-2 also has potent, direct effects on proliferation and Ig-synthesis by B cells. The complex immunoregulatory properties of IL-2 are reflected in the phenotype of IL-2 deficient mice, which have high mortality at young age and multiple defects in their immune functions including spontaneous development of inflammatory bowel disease. IL-15 is a more recently identified cytokine produced by multiple cell types. IL-15 shares several, but not all, activities with IL-2. Both IL-2 and IL-15 induce B cell growth and differentiation. However, assuming that IL-15 production in IL-2 deficient mice is normal, it is clear that IL-15 cannot substitute for the function of IL-2 in vivo, since these mice have multiple immunodeficiencies. IL-2 has been shown to synergistically enhance IL-10-induced human Ig production in the presence of anti-CD40 mAbs, but it antagonized the effects of IL-4. IL-2 also enhances IL-4-dependent IgE synthesis by purified B cells. On the other hand, IL-2 was shown to inhibit IL-4-dependent murine IgG1 and IgE synthesis both in vitro and in vivo. Similarly, IL-2 inhibited IL-4-dependent human IgE synthesis by unfractionated human PBMC, but the effects were less significant than those of IFN-α or IFN-γ. Due to their capacities to activate both B and T cells, IL-2 and IL-15 are useful in vaccinations. In fact, IL-2, as protein and as a component of genetic vaccines, has been shown to improve the efficacy of the vaccinations. Improving the specific activity and/or expression levels/kinetics of IL-2 and IL-15 through use of the DNA shuffling methods of the invention increases the advantageous effects compared to wild-type IL-2 and IL-15.
- Another cytokine of particular interest for optimization and use in genetic vaccines according to the methods of the invention is interleukin-6. IL-6 is a monocyte-derived cytokine that was originally described as a B cell differentiation factor or B cell stimulatory factor-2 because of its ability to enhance Ig levels secreted by activated B cells. IL-6 has also been shown to enhance IL-4-induced IgE synthesis. It has also been suggested that IL-6 is an obligatory factor for human IgE synthesis, because neutralizing anti-IL-6 mAbs completely blocked IL-4-induced IgE synthesis. IL-6 deficient mice have impaired 6 can enhance the levels of specific antibodies produced following vaccination. It is particularly useful as a component of DNA vaccines because high local concentrations can be achieved, thereby providing the most potent effects on the cells adjacent to the transfected cells expressing the immunogenic antigen. IL-6 with improved specific activity and/or with improved expression levels, obtained by DNA shuffling, will have more beneficial effects than the wild-type IL-6.
- Interleukin-8 is another example of a cytokine that, when modified according to the methods of the invention, is useful in genetic vaccines IL-8 was originally identified as a monocyte-derived neutrophil chemotactic and activating factor. Subsequently, IL-8 was also shown to be chemotactic for T cells and to activate basophils resulting in enhanced histamine and leukotriene release from these cells. Furthermore, IL-8 inhibits adhesion of neutrophils to cytokine-activated endothelial cell monolayers, and it protects these cells from neutrophil-mediated damage. Therefore, endothelial cell derived IL-8 was suggested to attenuate inflammatory events occurring in the proximity of blood vessel walls. IL-8 also modulates immunoglobulin production, and inhibits IL-4-induced IgG4 and IgE synthesis by both unfractionated human PBMC and purified B cells in vitro. This inhibitory effect was independent of IFN-α, IFN-γ or prostaglandin E2. In addition, IL-8 inhibited spontaneous IgE synthesis by PBMC derived from atopic patients. Due to its capacity to attract inflammatory cells, IL-8, like other chemotactic agents, is useful in potentiating the functional properties of vaccines, including DNA vaccines (acting as an adjuvant). The beneficial effects of IL-8 can be improved by using the DNA shuffling methods of the invention to obtain IL-8 with improved specific activity and/or with improved expression in target cells.
- Interleukin-5, and antagonists thereof, can also be optimized using the methods of the invention for use in genetic vaccines. IL-5 is primarily produced by TH2-type T cells and appears to play an important role in the pathogenesis of allergic disorders because of its ability to induce eosinophilia. IL-5 acts as an eosinophil differentiation and survival factor in both mouse and man. Blocking IL-5 activity by use of neutralizing monoclonal antibodies strongly inhibits pulmonary eosinophilia and hyperactivity in mouse models, and IL-5 deficient mice do not develop eosinophilia. These data also suggest that IL-5 antagonists may have therapeutic potential in the treatment of allergic eosinophilia.
- IL-5 has also been shown to enhance both proliferation of, and Ig synthesis by, activated mouse and human B cells. However, other studies suggested that IL-5 has no effect on proliferation of human B cells, whereas it activated eosinophils. IL-5 apparently is not crucial for maturation or differentiation of conventional B cells, because antibody responses in IL-5 deficient mice are normal. However, these mice have a developmental defect in their CD5+ B cells indicating that IL-5 is required for normal differentiation of this B cell subset in mice. At suboptimal concentrations of IL-4, IL-5 was shown to enhance IgE synthesis by human B cells in vitro. Furthermore, a recent study suggested that the effects of IL-5 on human B cells depend on the mode of B cell stimulation. IL-5 significantly enhanced IgM synthesis by B cells stimulated with Moraxella catarrhalis. In addition, IL-5 synergized with suboptimal concentrations of IL-2, but had no effect on Ig synthesis by SAC-activated B cells. Activated human B cells also expressed IL-5 mRNA suggesting that IL-5 may also regulate B cell function, including IgE synthesis, by autocrine mechanisms.
- The invention provides methods of evolving an IL-5 antagonist that efficiently binds to and neutralizes IL-5 or its receptor. These antagonists are useful as a component of vaccines used for prophylaxis and treatment of allergies. Nucleic acids encoding IL-5, for example, from human and other mammalian species, are shuffled and screened for binding to immobilized IL-5R for the initial screening. Polypeptides that exhibit the desired effect in the initial screening assays can then be screened for the highest biological activity using assays such as inhibition of growth of IL-5 dependent cells lines cultured in the presence of recombinant wild-type IL-5. Alternatively, shuffled IL-5R α-chains are screened for improved binding to IL-5.
- Tumor necrosis factors (α and β) and their receptors are also suitable targets for modification and use in genetic vaccines. TNF-α, which was originally described as cachectin because of its ability to cause necrosis of tumors, is a 17 kDa protein that is produced in low quantities by almost all cells in the human body following activation. TNF-α acts as an endogenous pyrogen and induces the synthesis of several proinflammatory cytokines, stimulates the production of acute phase proteins, and induces proliferation of fibroblasts. TNF-α plays a major role in the pathogenesis of endotoxin shock. A membrane-bound form of TNF-α (mTNF-α), which is involved in interactions between B- and T-cells, is rapidly upregulated within four hours of T cell activation. mTNF-α plays a role in the polyclonal B cell activation observed in patients infected with HIV. Monoclonal antibodies specific for mTNF-α or the p55 TNF-α receptor strongly inhibit IgE synthesis induced by activated CD4+ T cell clones or their membranes. Mice deficient for p55 TNF-αR are resistant to endotoxic shock, and soluble TNF-αR prevents autoimmune diabetes mellitus in NOD mice. Phase III trials using sTNF-αR in the treatment of rheumatoid arthritis are in progress, after promising results obtained in the phase II trials.
- The methods of the invention can be used to, for example, evolve a soluble TNF-αR that has improved affinity, and thus is capable of acting as an antagonist for TNF activity. Nucleic acids that encode TNF-αR and exhibit sequence diversity, such as the natural diversity observed in cDNA libraries from activated T cells of human and other primates, are shuffled. The shuffled nucleic acids are expressed, e.g., on phage, after which mutants are selected that bind to TNF-α with improved affinity. If desired, the improved mutants can be subjected to further assays using biological activity, and the shuffled genes can be subjected to one or more rounds of shuffling and screening.
- Another target of interest for application of the methods of the invention is interferon-γ, and the evolution of antagonists of this cytokine. The receptor for IFN-γ consists of a binding component glycoprotein of 90 kD, a 228 amino acid extracellular portion, a transmembrane region, and a 222 amino acid intracellular region. Glycosylation is not required for functional activity. A single chain provides high affinity binding (10−9-10−10 M), but is not sufficient for signaling. Receptor components dimerize upon ligand binding. The mouse IFN-γ receptor is 53% identical to that of mouse at the amino acid level. The human and mouse receptors only bind human and mouse IFN-γ, respectively. Vaccinia, cowpox and camelpox viruses have homologues of sIFN-γR, which have relatively low amino acid sequence similarity (˜20%), but are capable of efficient neutralization of IFN-γ in vitro. These homologues bind human, bovine, rat (but not mouse) IFN-γ, and may have in vivo activity as IFN-γ antagonists. All eight cysteines are conserved in human, mouse, myxoma and Shope fibroma virus (6 in vaccinia virus) IFN-γR polypeptides, indicating similar 3-D structures. An extracellular portion of mIFN-γR with a kD of 100-300 pM has been expressed in insect cells. Treatment of NZB/W mice (a mouse model of human SLE) with msIFN-γ receptor (100 mg/three times a week i.p.) inhibits the onset of glomerulonephritis. All mice treated with sIFN-γ or anti-IFN-γ mAbs were alive 4 weeks after the treatment was discontinued, compared with 50% in a placebo group, and 78% of IFN-γ-treated mice died.
- The methods of the invention can be used to evolve soluble IFN-γR receptor polypeptides with improved affinity, and to evolve IFN-γ with improved specific activity and improved capacity to activate cellular immune responses. In each case nucleic acids encoding the respective polypeptide, and which exhibit sequence diversity (e.g., that observed in cDNA libraries from activated T cells from human and other primates), are subjected to recombination and screened to identify those recombinant nucleic acids that encode a polypeptide having improved activity. In the case of shuffled IFN-γR, the library of shuffled nucleic acids can be expressed on phage, which are screened to identify mutants that bind to IFN-γ with improved affinity. In the case of IFN-γ, the shuffled library is analyzed for improved specific activity and improved activation of the immune system, for example, by using activation of monocytes/macrophages as an assay. The evolved IFN-γ molecules can improve the efficacy of vaccinations (e.g. when used as adjuvants).
- Diseases that can be treated using high-affinity sIFN-γR polypeptides obtained using the methods of the invention include, for example, multiple sclerosis, systemic lupus erythematosus (SLE), organ rejection after treatment, and graft versus host disease. Multiple sclerosis, for example, is characterized by increased expression of IFN-γ in the brain of the patients, and increased production of IFN-γ by patients' T cells in vitro. IFN-γ treatment has been shown to significantly exacerbate the disease (in contrast to EAE in mice).
- Transforming growth factor (TGF)-β is another cytokine that can be optimized for use in genetic vaccines using the methods of the invention. TGF-β has growth regulatory activities on essentially all cell types, and it has also been shown to have complex modulatory effects on the cells of the immune system. TGF-β inhibits proliferation of both B and T cells, and it also suppresses development of and differentiation of cytotoxic T cells and NK cells. TGF-β has been shown to direct IgA switching in both murine and human B cells. It was also shown to induce germline a transcription in murine and human B cells, supporting the conclusion that TGF-β can specifically induce IgA switching.
- Due to its capacity to direct IgA switching, TGF-β is useful as a component of DNA vaccines which aim at inducing potent mucosal immunity, e.g. vaccines for diarrhea. Also, because of its potent anti-proliferative effects TGF-β is useful as a component of therapeutical cancer vaccines. TGF-β with improved specific activity and/or with improved expression levels/kinetics will have increased beneficial effects compared to the wild-type TGF-β.
- Cytokines that can be optimized using the methods of the invention also include granulocyte colony stimulating factor (G-CSF) and granulocyte/macrophage colony stimulating factor (GM-CSF). These cytokines induce differentiation of bone marrow stem cell into granulocytes/macrophages. Administration of G-CSF and GM-CSF significantly improve recovery from bone marrow (BM) transplantation and radiotherapy, reducing infections and time the patients have to spend in hospitals. GM-CSF enhances antibody production following DNA vaccination. G-CSF is a 175 amino acid protein, while GM-CSF has 127 amino acids. Human G-CSF is 73% identical at the amino acid level to murine G-CSF and the two proteins show species cross-reactivity. G-CSF has a homodimeric receptor (dimeric with kD of ˜200 pM, monomeric ˜2-4 nM), and the receptor for GM-CSF is a three subunit complex. Cell lines transfected with cDNA encoding G-CSF R proliferate in response to G-CSF. Cell lines dependent of GM-CSF available (such as TF-1). G-CSF is nontoxic and is presently working very well as a drug. However, the treatment is expensive, and more potent G-CSF might reduce the cost for patients and to the health care. Treatments with these cytokines are typically short-lasting and the patients are likely to never need the same treatment again reducing likelihood of problems with immunogenicity.
- The methods of the invention are useful for evolving G-CSF and/or GM-CSF which have improved specific activity, as well as other polypeptides that have G-CSF and/or GM-CSF activity. G-CSF and/or GM-CSF nucleic acids having sequence diversity, e.g., those obtained from cDNA libraries from diverse species, are shuffled to create a library of shuffled G-CSF and/or GM-CSF genes. These libraries can be screened by, for example, picking colonies, transfecting the plasmids into a suitable host cell (e.g., CHO cells), and assaying the supernatants using receptor-positive cell lines. Alternatively, phage display or related techniques can be used, again using receptor-positive cell lines. Yet another screening method involves transfecting the shuffled genes into G-CSF/GM-CSF-dependent cell lines. The cells are grown one cell per well and/or at very low density in large flasks, and the cells that grow fastest are selected. Shuffled genes from these cells are isolated; if desired, these genes can be used for additional rounds of shuffling and selection.
- Ciliary neurotrophic factor (CNTF) is another suitable target for application of the methods of the invention. CNTF has 200 amino acids which exhibit 80% sequence identity between rat and rabbit CNTF polypeptides. CNTF has IL-6-like inflammatory effects, and induces synthesis of acute phase proteins. CNTF is a cytosolic protein which belongs to the IL-6/IL-11/LIF/oncostatin M-family, and becomes biologically active only after becoming available either by cellular lesion or by an unknown release mechanism. CNTF is expressed by myelinating Schwann cells, astrocytes and sciatic nerves. Structurally, CNTF is a dimeric protein, with a novel anti-parallel arrangement of the subunits. Each subunit adopts a double crossover four-helix bundle fold, in which two helices contribute to the dimer interface. Lys-155 mutants lose activity, and some Glu-153 mutants have 5-10 higher biological activity. The receptor for CNTF consists of a specific CNTF receptor chain, gp130, and a LIF-β receptor. The CNTFR α-chain lacks a transmembrane domain portion, instead being GPI-anchored. At high concentration, CNTF can mediate CNTFR-independent responses. Soluble CNTFR binds CNTF and thereafter can bind to LIFR and induce signaling through gp130. CNTF enhances survival of several types of neurons, and protects neurons in an animal model of Huntington disease (in contrast to NGF, neurotrophic factor, and neurotrophin-3). CNTF receptor knockout mice have severe motor neuron deficits at birth, and CNTF knockout mice exhibit such deficits postnatally. CNTF also reduces obesity in mouse models. Decreased expression of CNTF is sometimes observed in psychiatric patients. Phase I studies in patients with ALS (annual incidence ˜1/100 000, 5% familiar cases, 90% die within 6 years) found significant side effects after doses higher than 5 mg/kg/day subcutaneously (including anorexia, weight loss, reactivation of herpes simplex virus (HSV1), cough, increased oral secretions). Antibodies against CNTF were detected in almost all patients, thus illustrating the need for alternative CNTF with different immunological properties.
- The recombination and screening methods of the invention can be used to obtain modified CNTF polypeptides that exhibit decreased immunogenicity in vivo; higher specific activity is also obtainable using the methods. Shuffling is conducted using nucleic acids encoding CNTF. In a preferred embodiment, an IL-6/LIF/(CNTF) hybrid is obtained by shuffling using an excess of oligonucleotides that encode to the receptor binding sites of CNTF. Phage display can then be used to test for lack of binding to the IL-6/LIF receptor. This initial screen is followed by a test for high affinity binding to the CNTF receptor, and, if desired, functional assays using CNTF responsive cell lines. The shuffled CNTF polypeptides can be tested to identify those that exhibit reduced immunogenicity upon administration to a mammal.
- Another way in which the recombination and screening methods of the invention can be used to optimize CNTF is to improve secretion of the polypeptide. When a CNTF cDNA is operably linked to a leader sequence of hNGF, only 35-40 percent of the total CNTF produced is secreted.
- Target diseases for treatment with optimized CNTF, using either the shuffled gene in an expression vector as in DNA vaccines, or a purified protein, include obesity, amyotrophic lateral sclerosis (ALS, Lou Gehrig's disease), diabetic neuropathy, stroke, and brain surgery.
- Polynucleotides that encode chemokines can also be optimized using the methods of the invention and included in a genetic vaccine vector. At least three classes of chemokines are known, based on structure: C chemokines (such as lymphotactin), C—C chemokines (such as MCP-1, MCP-2, MCP-3, MCP-4, MIP-1a, MIP-1b, RANTES), C—X—C chemokines (such as IL-8, SDF-1, ELR, Mig, IP10) (Premack and Schall (1996) Nature Med. 2: 1174). Chemokines can attract other cells that mediate immune and inflammatory functions, thereby potentiating the immune response. Cells that are attracted by different types of chemokines include, for example, lymphocytes, monocytes and neutrophils. Generally, C—X—C chemokines are chemoattractants for neutrophils but not for monocytes, C—C chemokines attract monocytes and lymphocytes but not neutrophils, C chemokine attracts lymphocytes.
- Genetic vaccine vectors can also include optimized recombinant polynucleotides that encode surface-bound accessory molecules, such as those that are involved in modulation and potentiation of immune responses. These molecules, which include, for example, B7-1 (CD80), B7-2 (CD86), CD40, ligand for CD40, CTLA-4, CD28, and CD150 (SLAM), can be subjected to DNA shuffling to obtain variants have altered and/or improved activities.
- Optimized recombinant polynucleotides that encode CD1 molecules are also useful in a genetic vaccine vector for certain applications. CD1 are nonpolymorphic molecules that are structurally and functionally related to MHC molecules. Importantly, CD1 has MHC-like activities, and it can function as an antigen presenting molecule (Porcelli (1995) Adv. Immunol. 59: 1). CD1 is highly expressed on dendritic cells, which are very efficient antigen presenting cells. Simultaneous transfection of target cells with DNA vaccine vectors encoding CD1 and an antigen of interest is likely to boost the immune response. Because CD1 cells, in contrast to MHC molecules, exhibit limited allelic diversity in an outbred population (Porcelli, supra.), large populations of individuals with different genetic backgrounds can be vaccinated with one CD1 allele. The functional properties of CD1 molecules can be improved by the DNA shuffling methods of the invention.
- Optimized recombinant TAP genes and/or gene products can also be included in a genetic vaccine vector. TAP genes and their optimization for various purposes are discussed in more detail below. Moreover, heat shock proteins (HSP), such as HSP70, can also be evolved for improved presentation and processing of antigens. HSP70 has been shown to act as adjuvant for induction of CD8+ T cell activation and it enhances immunogenicity of specific antigenic peptides (Blachere et al. (1997) J. Exp. Med. 186: 1315-22). When HSP70 is encoded by a genetic vaccine vector, it is likely to enhance presentation and processing of antigenic peptides and thereby improve the efficacy of the genetic vaccines. DNA shuffling can be used to further improve the properties, including adjuvant activity, of heat shock proteins, such as HSP70.
- Recombinantly produced cytokine, chemokine, and accessory molecule polypeptides, as well as antagonists of these molecules, can be used to influence the type of immune response to a given stimulus. However, the administration of polypeptides sometimes has shortcomings, including short half life, high expense, difficult to store (must be stored at 4° C.), and a requirement for large volumes. Also, bolus injections can sometimes cause side effects. Administration of polynucleotides that encode the recombinant cytokines or other molecules overcomes most or all of these problems. DNA, for example, can be prepared in high purity, is stable, temperature resistant, noninfectious, easy to manufacture. In addition, polynucleotide-mediated administration of cytokines can provide long-lasting, consistent expression, and administration of polynucleotides in general is regarded as being safe.
- The functions of cytokines, chemokines and accessory molecules are redundant and pleiotropic, and therefore can be difficult to determine which cytokines or cytokine combinations are the most potent in inducing and enhancing antigen specific immune responses following vaccination. Furthermore, the most useful combination of cytokines and accessory molecules is typically different depending on the type of immune response that is desired following vaccination. As an example, IL-4 has been shown to direct differentiation of
T H2 cells (which produce high levels of IL-4, IL-5 and IL-13, and mediate allergic immune responses), whereas IFN-γ and IL-12 direct differentiation ofT H1 cells (which produce high levels of IL-2 and IFN-γ), and mediate delayed type immune responses. Moreover, the most useful combination of cytokines and accessory molecules is also likely to depend on the antigen used in the vaccination. The invention provides a solution to this problem of obtaining an optimized genetic vaccine cocktail. Different combinations of cytokines, chemokines and accessory molecules are assembled into vectors using the methods described herein. These vectors are then screened for their capacity to induce immune responses in vivo and in vitro. - Large libraries of vectors, generated by gene shuffling and combinatorial molecular biology, are screened for maximal capacity to direct immune responses towards, for example, a
T H1 orT H2 phenotype, as desired. A library of different vectors can be generated by assembling different evolved promoters, (evolved) cytokines, (evolved) cytokine antagonists, (evolved) chemokines, (evolved) accessory molecules and immunostimulatory sequences, each of which can be prepared using methods described herein. DNA sequences and compounds that facilitate the transfection and expression can be included. If the pathogen(s) is known, specific DNA sequences encoding immunogenic antigens from the pathogen can be incorporated into these vectors providing protective immunity against the pathogen(s) (as in genetic vaccines). - Initial screening is preferably carried out in vitro. For example, the library can be introduced into cells which are tested for ability to induce differentiation of T cells capable of producing cytokines that are indicative of the type of immune response desired. For a
T H1 response, for example, the library is screened to identify recombinant polynucleotides that are capable of inducing T cells to produce IL-2 and IFN-γ, while screening for induction of T cell production of IL-4, IL-5, and IL-13 is performed to identify recombinant polynucleotides that favor aT H2 response. - Screening can also be conducted in vivo, using animal models. For example, vectors produced using the methods of the invention can be tested for ability to protect against a lethal infection. Another screening method involves injection of Leishmania major parasites into footpads of BALB/c mice (nonhealer). Pools of plasmids are injected i.v., i.p. or into footpads of these mice and the size of the footpad swelling is followed. Yet another in vivo screening method involves detection of IgE levels after infection with Nippostrongylus brasiliensis. High levels indicate a
T H2 response, while low levels of IgE indicate aT H1 response. - Successful results in animal models are easy to verify in humans. In vitro screening can be conducted to test for
human T H1 orT H2 phenotype, or for other desired immune response. Vectors can also be tested for ability to induce protection against infection in humans. - Because the principles of immune functions are similar in a wide variety of infections, immunostimulating DNA vaccine vectors may not only be useful in the treatment of a number of infectious diseases but also in prevention of the infections, when the vectors are delivered to the sites of the entry of the pathogen (e.g., the lung or gut).
- 3. Agonists or Antagonists of Cellular Receptors
- The invention also provides methods for obtaining optimized recombinant polynucleotides that encode a peptide or polypeptide that can interact with a cellular receptor that is involved in mediating an immune response. The optimized recombinant polynucleotides can act as an agonist or an antagonist of the receptor.
- Cytokine antagonists can be used as components of genetic vaccine cocktails. Blocking immunosuppressive cytokines, rather than adding single proinflammatory cytokines, is likely to potentiate the immune response in a more general manner, because several pathways are potentiated at the same time. By appropriate choice of antagonist, one can tailor the immune response induced by a genetic vaccine in order to obtain the response that is most effective in achieving the desired effect. Antagonists against any cytokine can be used as appropriate; particular cytokines of interest for blocking include, for example, IL-4, IL-13, IL-0, and the like.
- The invention provides methods of obtaining cytokine antagonists that exhibit greater effectiveness in blocking the action of the respective cytokine. Polynucleotides that encode improved cytokine antagonists can be obtained by using gene shuffling to generate a recombinant library of polynucleotides which are then screened to identify those that encode an improved antagonist. As substrates for the DNA shuffling, one can use, for example, polynucleotides that encode receptors for the respective cytokine. At least two forms of the substrate will be present in the recombination reaction, with each form differing from the other in at least one nucleotide position. In a preferred embodiment, the different forms of the polynucleotide are homologous cytokine receptor genes from different organisms. The resulting library of recombinant polynucleotides is then screened to identify those that encode cytokine antagonists with the desired affinity and biological activity.
- As one example of the type of effect that one can achieve by including a cytokine antagonist in a genetic vaccine cocktail, as well as how the effect can be improved using the DNA shuffling methods of the invention, IL-10 is discussed. The same rationale can be applied to obtaining and using antagonists of other cytokines. Interleukin-10 (IL-10) is perhaps the most potent anti-inflammatory cytokine known to date. IL-10 inhibits a number of pathways that potentiate inflammatory responses. The biological activities of IL-10 include inhibition of MHC class II expression on monocytes, inhibition of production of IL-1, IL-6, IL-12, TNF-α by monocytes/macrophages, and inhibition of proliferation and IL-2 production by T lymphocytes. The significance of IL-10 as a regulatory molecule of immune and inflammatory responses was clearly demonstrated in IL-10 deficient mice. These mice are growth-retarded, anemic and spontaneously develop an inflammatory bowel disease (Kuhn et al. (1993) Cell 75: 263). In addition, both innate and acquired immunity to Listeria monocytogenes were shown to be elevated in IL-10 deficient mice (Dai et al. (1997) J. Immunol. 158: 2259). It has also been suggested that genetic differences in the levels of IL-10 production may affect the risk of patients to die from complications meningococcal infection. Families with high IL-0 production had 20-fold increased risk of fatal outcome of meningococcal disease (Westendorp et al. (1997) Lancet 349: 170).
- IL-10 has been shown to activate normal and malignant B cells in vitro, but it does not appear to be a major growth promoting cytokine for normal B cells in vivo, because IL-10 deficient mice have normal levels of B lymphocytes and Ig in their circulation. In fact, there is evidence that IL-10 can indirectly downregulate B cell function through inhibition of the accessory cell function of monocytes. However, IL-10 appears to play a role in the growth and expansion of malignant B cells. Anti-IL-10 monoclonal antibodies and IL-10 antisense oligonucleotides have been shown to inhibit transformation of B cells by EBV in vitro. In addition, B cell lymphomas are associated with EBV and most EBV+ lymphomas produce high levels of IL-10, which is derived both from the human gene and the homologue of IL-10 encoded by EBV. AIDS-related B cell lymphomas also secrete high levels of IL-10. Furthermore, patients with detectable serum IL-0 at the time of diagnosis of intermediate/high-grade non-Hodgkin's lymphoma have short survival, further suggesting a role for IL-10 in the pathogenesis of B cell malignancies.
- Antagonizing IL-10 in vivo can be beneficial in several infectious and malignant diseases, and in vaccination. The effect of blocking of IL-10 is an enhancement of immune responses that is independent of the specificity of the response. This is useful in vaccinations and in the treatment of serious infectious diseases. Moreover, an IL-10 antagonist is useful in the treatment of B cell malignancies which exhibit overproduction of IL-10 and viral IL-10, and it may also be useful in boosting general anti-tumor immune response in cancer patients. Combining an IL-10 antagonist with gene therapy vectors may be useful in gene therapy of tumor cells in order to obtain maximal immune response against the tumor cells. If shuffling of IL-10 results in IL-10 with improved specific activity, this IL-10 molecule would have potential in the treatment of autoimmune diseases and inflammatory bowel diseases. IL-10 with improved specific activity may also be useful as a component of gene therapy vectors in reducing the immune response against vectors which are recognized by memory cells and it may also reduce the immunogenicity of these vectors.
- An antagonist of IL-10 has been made by generating a soluble form of IL-10 receptor (sIL-10R; Tan et al. (1995) J. Biol. Chem. 270: 12906). However, sIL-10R binds IL-10 with Kd of 560 pM, whereas the wild-type, surface-bound receptor has affinity of 35-200 pM. Consequently, 150-fold molar excess of sIL-10R is required for half-maximal inhibition of biological function of IL-10. Moreover, affinity of viral IL-10 (IL-10 homologue encoded by Epstein-Barr virus) to sIL-10R is more than 1000 fold less than that of hIL-10, and in some situations, such as when treating EBV-associated B cell malignancies, it may be beneficial if one can also block the function of viral IL-10. Taken together, this soluble form of IL-10R is unlikely to be effective in antagonizing IL-10 in vivo.
- To obtain an IL-10 antagonist that has sufficient affinity and antagonistic activity to function in viva, DNA shuffling can be performed using polynucleotides that encode IL-10 receptor. IL-10 receptor with higher than normal affinity will function as an IL-10 antagonist, because it strongly reduces the amount of IL-10 available for binding to functional, wild-type IL-10R. In a preferred embodiment, IL-10R is shuffled using homologous cDNAs encoding IL-10R derived from human and other mammalian species. An alignment of human and mouse IL-10 receptor sequences is shown in
FIG. 14 to illustrate the feasibility of family DNA shuffling when evolving IL-10 receptors with improved affinity. A phage library of IL-10 receptor recombinants can be screened for improved binding of shuffled IL-10R to human or viral IL-10. Wild-type IL-10 and/or viral IL-10 are added at increasing concentrations to demand for higher affinity. Phage bound to IL-10 can be recovered using anti-IL-10 monoclonal antibodies. If desired, the shuffling can be repeated one or more times, after which the evolved soluble IL-10R is analyzed in functional assays for its capacity to neutralize the biological activities of IL-10/viral IL-10. More specifically, evolved soluble IL-10R is studied for its capacity to block the inhibitory effects of IL-10 on cytokine synthesis and MHC class II expression by monocytes, proliferation by T cells, and for its capacity to inhibit the enhancing effects of IL-10 on proliferation of B cells activated by anti-CD40 monoclonal antibodies. - An IL-10 antagonist can also be generated by evolving IL-10 to obtain variants that bind to IL-10R with higher than wild-type affinity, but without receptor activation. The advantage of this approach is that one can evolve an IL-10 molecule with improved specific activity using the same methods. In a preferred embodiment, IL-10 is shuffled using homologous cDNAs encoding IL-10 derived from human and other mammalian species. In addition, a gene encoding viral IL-10 can be included in the shuffling. A library of IL-10 recombinants is screened for improved binding to human IL-10 receptor. Library members bound to IL-10R can be recovered by anti-IL-10R monoclonal antibodies. This screening protocol is likely to result in IL-10 molecules with both antagonistic and agonistic activities. Because initial screen demands for higher affinity, a proportion of the agonists are likely to have improved specific activity when compared to wild-type human IL-10. The functional properties of the mutant IL-10 molecules are determined in biological assays similar to those described above for ultrahigh-affinity IL-10 receptors (cytokine synthesis and MHC class II expression by monocytes, proliferation of B and T cells). An antagonistic IL-4 mutant has been previously generated illustrating the general feasibility of the approach (Kruse et al. (1992) EMBO J. 11: 3237-3244). One amino acid mutation in IL-4 resulted in a molecule that efficiently binds to IL-4R α-chain but has minimal IL-4-like agonistic activity.
- Another example of an IL-10 antagonist is IL-20/mda-7, which is a 206 amino acid secreted protein. This protein was originally characterized as mda-7, which is a melanoma cell-derived negative regulator of tumor cell growth (Jiang et al. (1995) Oncogene 11: 2477; (1996) Proc. Nat'l. Acad. Sci. USA 93: 9160). IL-20/mda-7 is structurally related to IL-10, and it antagonizes several functions of IL-10 (Abstract of the 13th European Immunology Meeting, Amsterdam, 22-25 June 1997). In contrast to IL-10, IL-20/mda-7 enhances expression of CD80 (B7-0.1) and CD86 (B7-2) on human monocytes and it upregulates production of TNF-α and IL-6. IL-20/mda-7 also enhances production of IFN-γ by PHA-activated PBMC. The invention provides methods of improving genetic vaccines by incorporation of IL-20/mda-7 genes into the genetic vaccine vectors. The methods of the invention can be used to obtain IL-20/mda-7 variants that exhibit improved ability to antagonize IL-10 activity.
- When a cytokine antagonist is used as a component of DNA vaccine or gene therapy vectors, maximal local effect is desirable. Therefore, in addition to a soluble form of a cytokine antagonist, a transmembrane form of the antagonist can be generated. The soluble form can be given in purified polypeptide form to patients by, for example, intravenous injection. Alternatively, a polynucleotide encoding the cytokine antagonist can be used as a component as a component of a genetic vaccine or a gene therapy vector. In this case, either or both of the soluble and transmembrane forms can be used. Where both soluble and transmembrane forms of the antagonist are encoded by the same vector, the target cells express both forms, resulting in maximal inhibition of cytokine function on the target cell surface and in their immediate vicinity.
- The peptides or polypeptides obtained using these methods can substitute for the natural ligands of the receptors, such as cytokines or other costimulatory molecules in their ability to exert an effect on the immune system via the receptor. A potential disadvantage of administering cytokines or other costimulatory molecules themselves is that an autoimmune reaction could be induced against the natural molecule, either due to breaking tolerance (if using a natural cytokine or other molecule) or by inducing cross-reactive immunity (humoral or cellular) when using related but distinct molecules. Through using the methods of the invention, one can obtain agonists or antagonists that avoid these potential drawbacks. For example, one can use relatively small peptides as agonists that can mimic the activity of the natural immunomodulator, or antagonize the activity, without inducing cross-reactive immunity to the natural molecule. In a presently preferred embodiment, the optimized agonist or antagonist obtained using the methods of the invention is about 50 amino acids or length or less, more preferably about 30 amino acids or less, and most preferably is about 20 amino acids in length, or less. The agonist or antagonist peptide is preferably at least about 4 amino acids in length, and more preferably at least about 8 amino acids in length. Polynucleotides that flank the coding sequence of the mimetic peptide can also be optimized using the methods of the invention in order to optimize the expression, conformation, or activity of the mimetic peptide.
- The optimized agonist or antagonist peptides or polypeptides are obtained by generating a library of recombinant polynucleotides and screening the library to identify those that encode a peptide or polypeptide that exhibits an enhanced ability to modulate an immune response. The library can be produced using methods such as DNA shuffling or other methods described herein or otherwise known to those of skill in the art. Screening is conveniently conducted by expressing the peptides encoded by the library members on the surface of a population of replicable genetic packages and identifying those members that bind to a target of interest, e.g., a receptor.
- The optimized recombinant polynucleotides that are obtained using the methods of the invention can be used in several ways. For example, the polynucleotide can be placed in a genetic vaccine vector, under the control of appropriate expression control sequences, so that the mimetic peptide is expressed upon introduction of the vector into a mammal. If desired, the poly nucleotide can be placed in the vector embedded in the coding sequence of the surface protein (e.g., geneIII or geneVIII) in order to preserve the conformation of the mimetic. Alternatively, the mimetic-encoding polynucleotide can be inserted directly into the antigen-encoding sequence of the genetic vaccine to form a coding sequence for a “mimotope-on-antigen” structure. The polynucleotide that encodes the mimotope-on-antigen structure can be used within a genetic vaccine, or can be used to express a protein that is itself administered as a vaccine. As one example of this type of application, a coding sequence of a mimetic peptide is introduced into a polynucleotide that encodes the “M-loop” of the hepatitis B surface antigen (HBsAg) protein. The M-loop is a six amino acid peptide sequence bounded by cysteine residues, which is found at amino acids 139-147 (numbering within the S protein sequence). The M-loop in the natural HBsAg protein is recognized by the monoclonal antibody RFHB7 (Chen et al., Proc. Nat'l. Acad. Sci. USA, 93: 1997-2001 (1996)). According to Chen et al., the M-loop forms an epitope of the HBsAg that is non-overlapping and separate from at least four other HBsAg epitopes.
- Because of the probable Cys-Cys disulfide bond in this hydrophilic part of the protein, amino acids 139-147 are likely in a cyclic conformation. This structure is therefore similar to that found in the regions of the filamentous phage proteins pIII and pVIII where mimotope sequences are placed. Therefore, one can insert a mimotope obtained using the methods of the invention into this region of the HBsAg amino acid sequence.
- The chemokine receptor CCR6 is an example of a suitable target for a peptide mimetic obtained using the methods. The CCR6 receptor is a 7-transmembrane domain protein (Dieu et al., Biochem. Biophys. Res. Comm. 236: 212-217 (1997) and J. Biol. Chem. 272: 14893-14898 (1997)) that is involved in the chemoattraction of immature dendritic cells, which are found in the blood and migrate to sites of antigen uptake (Dieu et al., J. Exp. Med. 188: 373-386 (1998)). CCR6 binds the chemokine MIP-3α, so a mimetic peptide that is capable of activating CCR6 can provide a further chemoattractant function to a given antigen and thus promote uptake by dendritic cells after immunization with the antigen antigen-mimetic fusion or a DNA vector that expresses the antigen.
- Another application of this method of the invention is to obtain molecules that can act as an agonist for the macrophage scavenger receptor (MSR; see, Wloch et al., Hum. Gene Ther. 9: 1439-1447 (1998)). The MSR is involved in mediating the effects of various immunomodulators. Among these are bacterial DNA, including the plasmids used in DNA vaccination, and oligonucleotides, which are often potent immunostimulators. Oligonucleotides of certain chemical structure (e.g., phosphothio-oligonucleotides) are particularly potent, while bacterial or plasmid DNA must be used in relatively large quantities to produce an effect. Also mediated by the MSR is the ability of oligonucleotides that contain dG residues to stimulate B cells and enhance the activity of immunostimulatory CpG motifs, and of lipopolysaccharides to activate macrophages. Some of these activities are toxic. Each of these immunomodulators, along with a variety of polyanionic ligands, binds to the MSR. The methods of the invention can be used to obtain mimetics of one or ore of these immunomodulators that bind to the MSR with high affinity but are devoid of oxic properties. Such mimetic peptides are useful as immunostimulators or adjuvants.
- The MSR is a trimeric integral membrane glycoprotein. The three extracellular C-terminal cysteine-rich regions are connected to the transmembrane domain by a fibrous region that is composed of an α-helical coil and a collagen-like triple helix (see, Kodama et al, Nature 343: 531-535 (1990)). Therefore, screening of the library of recombinant polynucleotides can be accomplished by expressing the extracellular receptor structure and artificially attaching it to plastic surfaces. The libraries can be expressed, e.g., by phage display, and screened to identify those that bind to the receptors with high affinity. The optimized recombinant polynucleotides identified by this method can be incorporated into antigen-encoding sequences to evaluate their modulatory effect on the immune response.
- 4. Costimulatory Molecules Capable of Inhibiting or Enhancing Activation, Differentiation, or Anergy of Antigen-Specific T Cells
- Also provided are methods of obtaining optimized recombinant polynucleotides that, when expressed, are capable of inhibiting or enhancing the activation, differentiation, or anergy of antigen-specific T cells. T cell activation is initiated when T cells recognize their specific antigenic peptides in the context of MHC molecules on the plasma membrane of antigen presenting cells (APC), such as monocytes, dendritic cells (DC), Langerhans cells or B cells. Activation of CD4+ T cells requires recognition by the T cell receptor (TCR) of an antigenic peptide in the context of MHC class II molecules, whereas CD8+ T cells recognize peptides in the context of MHC class I molecules. Importantly, however, recognition of the antigenic peptides is not sufficient for induction of T cell proliferation and cytokine synthesis. An additional costimulatory signal, “the second signal”, is required. The costimulatory signal is mediated via CD28, which binds to its ligands B7-1 (CD80) or B7-2 (CD86), typically expressed on the antigen presenting cells. In the absence of the costimulatory signal, no T cell activation occurs, or T cells are rendered anergic. In addition to CD28, CTLA-4 (CD152) also functions as a ligand for B7-1 and B7-2. However, in contrast to CD28, CTLA-4 mediates a negative regulatory signal to T cells and/or to induce anergy and tolerance (Walunas et al. (1994) Immunity 1: 405; Karandikar et al. (1996) J. Exp. Med. 184: 783).
- B7-1 and B7-2 have been shown to be able to regulate several immunological responses, and they have been implicated to be of importance in the immune regulation in vaccinations, allergy, autoimmunity and cancer. Gene therapy and genetic vaccine vectors expressing B7-1 and/or B7-2 have also been shown to have therapeutic potential in the treatment of the above mentioned diseases and in improving the efficacy of genetic vaccines.
-
FIG. 10 illustrates interaction of APC and CD4+ T cells, but the same principle is true with CD8+ T cells, with the exception that the T cells recognize the antigenic peptides in the context of MHC class I molecules. Both B7-1 and B7-2 bind to CD28 and CTLA-4, even though the sequence similarities between these four molecules are very limited (20-30%). It is desirable to obtain mutations in B7-1 and B7-2 that only influence binding to one ligand but not to the other, or improve activity through one ligand while decreasing the activity through the other. Moreover, because the affinities of B7 molecules to their ligands appear to be relatively low, it would also be desirable to find mutations that improve/alter the activities of the molecules. However, rational design does not enable predictions of useful mutations because of the complexity of the molecules. - The invention provides methods of overcoming these difficulties, enabling one to generate and identify functionally different B7 molecules with altered relative capacities to induce T cell activation, differentiation, cytokine production, anergy and/or tolerance. Through use of the methods of the invention, one can find mutations in B7-1 and B7-2 that only influence binding to one ligand but not to the other, or that improve activity through one ligand while decreasing the activity through the other. DNA shuffling is likely to be the most powerful method in discovering new B7 variants with altered relative binding capacities to CD28 and CTLA-4. B7 variants which act through CD28 with improved activity (and with decreased activity through CTLA-4) are expected to have improved capacity to induce activation of T cells. In contrast, B7 variants which bind and act through CTLA-4 with improved activity (and with decreased activity through CD28) are expected to be potent negative regulators of T cell functions and to induce tolerance and anergy.
- DNA shuffling or other recombination method is used to generate B7 (e.g., B7-1/CD80 and B7-2/CD86) variants which have altered relative capacity to act through CD28 and CTLA-4 when compared to wild-type B7 molecules. In a preferred embodiment, the different forms of substrate used in the recombination reaction are B7 cDNAs from various species. Such cDNAs can be obtained by methods known to those of skill in the art, including RT-PCR.
- Typically, genes encoding these variant B7 molecules are incorporated into genetic vaccine vectors encoding an antigen, so that one the vectors can be used to modify antigen-specific T cell responses. Vectors that harbor B7 genes that efficiently act through CD28 are useful in inducing, for example, protective immune responses, whereas vectors that harbor genes encoding B7 genes that efficiently act through CTLA-4 are useful in inducing, for example, tolerance and anergy of allergen- or autoantigen-specific T cells. In some situations, such as in tumor cells or cells inducing autoimmune reactions, the antigen may already be present on the surface of the target cell, and the variant B7 molecules may be transfected in the absence of additional exogenous antigen gene.
FIG. 11 illustrates a screening protocol that one can use to identify B7-1 (CD80) and/or B7-2 (CD86) variants that have increased capacity to induce T cell activation or anergy, and the application of this strategy is described in more detail in Example 1. - Several approaches for screening of the variants can be taken. For example, one can use a flow cytometry-based selection systems. The library of B7-1 and B7-2 molecules is transfected into cells that normally do not express these molecules (e.g., COS-7 cells or any cell line from a different species with limited or no cross-reactivity with man regarding B7 ligand binding). An internal marker gene can be incorporated in order to analyze the copy number per cell. Soluble CTLA-4 and CD28 molecules can be generated to for use in the flow cytometry experiments. Typically, these will be fused with the Fc portion of IgG molecule to improve the stability of the molecules and to enable easy staining by labeled anti-IgG mAbs, as described by van der Merwe et al. (J. Exp. Med 185: 393, 1997). The cells transfected with the library of B7 molecules are then stained with the soluble CTLA-4 and CD28 molecules. Cells demonstrating increased or decreased CTLA-4/CD28 binding ratio will be sorted. The plasmids are then recovered and the shuffled B7 variant-encoding sequences identified. These selected B7 variants can then be subjected to new rounds of shuffling and selection, and/or they can be further analyzed using functional assays as described below.
- The B7 variants can also be directly selected based on their functional properties. For in vivo studies, the B7 molecules can also be evolved to function on mouse cells. Bacterial colonies with plasmids with mutant B7 molecules are picked and the plasmids are isolated. These plasmids are then transfected into antigen presenting cells, such as dendritic cells, and the capacities of these mutants to activate T cells is analyzed. One of the advantages of this approach is that no assumptions on the binding affinities or specificities to the known ligands are made, and possibly new activities through yet to be identified ligands can be found. In addition to dendritic cells, other cells that are relatively easy to transfect (e.g., U937 or COS-7) can be used in the screening, provided that the “first T cell signal” is induced by, for example, anti-CD3 monoclonal antibodies. T cell activation can be analyzed by methods known to those of skill in the art, including, for example, measuring proliferation, cytokine production, CTL activity or expression of activation antigens such as IL-2 receptor, CD69 or HLA-DR molecules. Usage of antigen-specific T cell clones, such as T cells specific for house dust mite antigen Der p I, will allow analysis of antigen-specific T cell activation (Yssel et al. (1992) J. Immunol. 148: 738-745). Mutants are identified that can enhance or inhibit T cell proliferation or enhance or inhibit CTL responses. Similarly variants that have altered capacity to induce cytokine production or expression of activation antigens as measured by, for example, cytokine-specific ELISAs or flow cytometry can be identified.
- The B7 variants are useful in modulating immune responses in autoimmune diseases, allergy, cancer, infectious disease and vaccination. B7 variants which act through CD28 with improved activity (and with decreased activity through CTLA-4) will have improved capacity to induce activation of T cells. In contrast, B7 variants which bind and act through CTLA-4 with improved activity (and with decreased activity through CD28) will be potent negative regulators of T cell functions and to induce tolerance and anergy. Thus, by incorporating genes encoding these variant B7 molecules into genetic vaccine vectors encoding an antigen, it is possible to modify antigen-specific T cell responses. Vectors that harbor B7 genes that efficiently act through CD28 are useful in inducing, for example, protective immune responses, whereas vectors that harbor genes encoding B7 genes that efficiently act through CTLA-4 are useful in inducing, for example, tolerance and anergy of allergen- or autoantigen-specific T cells. In some situations, such as in tumor cells or cells inducing autoimmune reactions, the antigen may already be present on the surface of the target cell, and the variant B7 molecules may be transfected in the absence of additional exogenous antigen gene.
- The methods of the invention are also useful for obtaining B7 variants that have increased effectiveness in directing either
T H1 orT H2 cell differentiation. Differential roles have been observed for B7-1 and B7-2 molecules in the regulation of T helper (TH) cell differentiation (Freeman et al. (1995) Immunity 2: 523; Kuchroo et al. (1995) Cell 80: 707). TH cell differentiation can be measured by analyzing the cytokine production profiles induced by each particular variant. High levels of IL-4, IL-5 and/or IL-13 are an indication ofefficient T H2 cell differentiation whereas high levels of IFN-γ or IL-2 production can be used as a marker ofT H1 cell differentiation. B7 variants with altered capacity to induceT H1 orT H2 cell differentiation are useful, for example, in the treatment of allergic, malignant, autoimmune and infectious diseases and in vaccination. - Also provided by the invention are methods of obtaining B7 variants that have enhanced capacity to induce IL-10 production by antigen-specific T cells. Elevated production of IL-10 is a characteristic of regulatory T cells, which can suppress proliferation of antigen-specific CD4+ T cells (Groux et al. (1997) Nature 389: 737). DNA shuffling is performed as described above, after which recombinant nucleic acids encoding B7 variants having enhanced capability of inducing IL-10 can be identified by, for example, ELISA or flow cytometry using intracytoplasmic cytokine staining. The variants that induce high levels of IL-10 production are useful in the treatment of allergic and autoimmune diseases.
- D. Optimization of Transport and Presentation of Antigens
- The invention also provides methods of obtaining genetic vaccines and accessory molecules that can improve the transport and presentation of antigenic peptides. A library of recombinant polynucleotides is created and screened to identify those that encode molecules that have improved properties compared to the wild-type counterparts. The polynucleotides themselves can be used in genetic vaccines, or the gene products of the polynucleotides can be utilized for therapeutic or prophylactic applications.
- 1. Proteasomes
- The class I peptides presented on major histocompatibility complex molecules are generated by cellular proteasomes. Interferon-gamma can stimulate antigen presentation, and part of the mechanism of action of interferon may be due to induction of the proteasome beta-subunits LMP2 and LMP7, which replace the homologous beta-subunits Y (delta) and X (epsilon). Such a replacement changes the peptide cleavage specificity of the proteasome and can enhance class I epitope immunogenicity. The Y (delta) and X (epsilon) subunits, as well as other recently discovered proteasome subunits such as the MECL-1 homologue MC14, are characteristic of cells which are not specialized in antigen presentation. Thus, the incorporation into cells by DNA transfer of LMP2, LMP7, MECL-1 and/or other epitope presentation-specific and potentially interferon-inducible subunits can enhance epitope presentation. It is likely that the peptides generated by the proteasome containing the interferon-inducible subunits are transported to the endoplasmic reticulum by the TAP molecules.
- The invention provides methods of obtaining proteasomes that exhibit increased or decreased ability to specifically process MHC class I epitopes. According to the methods, DNA shuffling is used to obtain evolved proteins that can either have new specificities which might enhance the immunogenicity of some proteins and/or enhance the activity of the subunits once they are bound to the proteasome. Because the transition from a non-specific proteasome to a class I epitope-specific proteasome can pass through several states (in which some but not all of the interferon-inducible subunits are associated with the proteasome), many different proteolytic specificities can potentially be achieved. Evolving the specific LMP-like subunits can therefore create new proteasome compositions which have enhanced functionality for the presentation of epitopes.
- The methods involve performing DNA shuffling using as substrates two or more forms of polynucleotides which encode proteasome components, where the forms of polynucleotides differ in at least one nucleotide. Shuffling is performed as described herein, using polynucleotides that encode any one or more of the various proteasome components, including, for example, LMP2, LMP7, MECL-1 and other individual proteasome components that are specifically involved in class I epitope presentation. Examples of suitable substrates are described in, e.g., Stohwasser et al. (1997) Eur. J. Immunol. 27: 1182-1187 and Gaczynska et al. (1996) J. Biol. Chem. 271: 17275-17280. In a preferred embodiment, family shuffling is used, in which the different substrates are proteasome component-encoding polynucleotides from different species.
- After the recombination reaction is completed, the resulting library of recombinant polynucleotides is screened to identify those which encode proteasome components having the desired effect on class I epitope production. For example, the recombinant polynucleotides can be introduced into a genetic vaccine vector which also encodes a particular antigen of interest. The library of vectors can then be introduced into mammalian cells which are then screened to identify cells which exhibit increased antigen-specific immunogenicity. Methods of analyzing proteasome activity are described in, for example, Groettrup et al. (1997) Proc. Nat'l. Acad. Sci. USA 94: 8970-8975 and Groettrup er al. (1997) Eur. J. Immunol. 26: 863-869.
- Alternatively, one can use the methods of the invention to evolve proteins which bind strongly to the proteasome but have decreased or no activity, thus antagonizing the proteasome activity and diminishing a cells ability to present class I molecules. Such molecules can be applied to gene therapy protocols in which it is desirable to lower the immunogenicity of exogenous proteins expressed in the cells as a result of the gene therapy, and which would otherwise be processed for class I presentation allowing the cell to be recognized by the immune system. Such high-affinity low-activity LMP-like subunits will demonstrate immunosuppressive effects which are also of use in other therapeutic protocols where cells expressing a non-self protein need to be protected from an immune response.
- The specificity of the proteasome and the TAP molecules (discussed below) may have co-evolved naturally. Thus it may be important that the two pathways of the class I processing system be functionally matched. A further aspect of the invention involves performing DNA shuffling simultaneously on the two gene families followed by random combinations of the two in order to discover appropriate matched proteolytic and transport specificities.
- 2. Antigen Transport
- The invention provides methods of improving transport of antigenic peptides from the cytosolic compartment to the endoplasmic reticulum and thereby to the cell surface in the context of MHC class I molecules. Enhanced expression of antigenic peptides results in enhanced immune response, particularly in improved activation of CD8+ cytotoxic lymphocytes. This is useful in the development of DNA vaccines and in gene therapy.
- In one embodiment, the invention involves evolving TAP-genes (transporters associated with antigen processing) to obtain genes that exhibit improved antigen presentation. TAP genes are members of ATP-binding cassette family of membrane translocators. These proteins transport antigenic peptides to MHC class I molecules and are involved in the expression and stability of MHC class I molecules on the cell surface. Two TAP genes, TAP1 and TAP2, have been cloned to date (Powis et al. (1996) Proc. Nat'l. Acad. Sci. USA 89: 1463-1467; Koopman et al. (1997) Curr. Opin. Immunol. 9: 80-88; Monaco (1995) J Leukocyte Biol. 57: 543-57). TAP1 and TAP2 form a heterodimer and these genes are required for transport of peptides into the endoplasmic reticulum, where they bind to MHC class I molecules. The essential role of TAP gene products in presentation of antigenic peptides was demonstrated in mice with disrupted TAP genes. TAP1-deficient mice have drastically reduced levels of surface expression of MHC class I, and positive selection of CD8+ T cells in the thymus is strongly reduced. Therefore, the number of CD8+ T lymphocytes in the periphery of TAP-deficient mice is extremely low. Transfection of TAP genes back into these cells restores the level of MHC class I expression.
- TAP genes are a good target for gene shuffling because of natural polymorphism and because these genes of several mammalian species have been cloned and sequenced, including human (Beck et al. (1992) J. Mol. Biol. 228: 433-441; Genbank Accession No. Y13582; Powis et al., supra.), gorilla TAP1 (Laud et al. (1996) Human Immunol. 50: 91-102), mouse (Reiser et al. (1988) Proc. Nat'l. Acad. Sci. USA 85: 2255-2259; Marusina et al. (1997) J. Immunol. 158: 5251-5256, TAP1: Genbank Accession Nos. U60018, U60019, U60020, U60021, U60022, and L76468-L67470; TAP2: Genbank Accession Nos. U60087, U60088, U6089, U60090, U60091 and U60092), hamster (
TAP 1, Genbank Accession Nos. AF001154 and AF001157; TAP2, Genbank Accession Nos. AF001156 and AF001155). Furthermore, it has been shown that point mutations in TAP genes may result in altered peptide specificity and peptide presentation. Also, functional differences in TAP genes derived from different species have been observed. For example, human TAP and rat TAP containing the rTAP2a allele are rather promiscuous, whereas mouse TAP is restrictive and select against peptides with C-terminal small polar/hydrophobic or positively charged amino acids. The basis for this selectivity is unknown. - The methods of the invention involve performing DNA shuffling of TAP1 and TAP2 genes using as substrates at least two forms of TAP1 and/or TAP2 polynucleotide sequences which differ in at least one nucleotide position. In a preferred embodiment, TAP sequences derived from several mammalian species are used as the substrates for shuffling. Natural polymorphism of the genes can provide additional diversity of substrate. If desired, optimized TAP genes obtained from one round of shuffling and screening can be subjected to additional shuffling/screening rounds to obtain further optimized TAP-encoding polynucleotides.
- To identify optimized TAP-encoding polynucleotides from a library of recombinant TAP genes, the genes can be expressed on the same plasmid as a target antigen of interest. If this step is limiting the extent of antigen presentation, then enhanced presentation to CD8+ CTL will result. Mutants of TAPs may act selectively to increase expression of a particular antigen peptide fragment for which levels of expression are otherwise limiting, or to cause transport of a peptide that would normally never be transferred into the RER and made available to bind to MHC Class I.
- When used in the context of gene therapy vectors in cancer treatment, evolved TAP genes provide a means to enhance expression of MHC class I molecules on tumor cells and obtain efficient presentation of antigenic tumor-specific peptides. Thus, vectors that contain the evolved TAP genes can induce potent immune responses against the malignant cells. Shuffled TAP genes can be transfected into malignant cell lines that express low levels of MHC class I molecules using retroviral vectors or electroporation. Transfection efficiency can be monitored using marker genes, such as green fluorescent protein, encoded by the same vector as the TAP genes. Cells expressing equal levels of green fluorescent protein but the highest levels of MHC class I molecules, as a marker of efficient TAP genes, are then sorted using flow cytometry, and the evolved TAP genes are then recovered from these cells by, for example, PCR or by recovering the entire vectors. These sequences can then subjected into new rounds of shuffling, selection and recovery, if further optimization is desired.
- Molecular evolution of TAP genes can be combined with simultaneous evolution of the desired antigen. Simultaneous evolution of the desired antigen can further improve the efficacy of presentation of antigenic peptides following DNA vaccination. The antigen can be evolved, using gene shuffling, to contain structures that allow optimal presentation of desired antigenic peptides when optimal TAP genes are expressed. TAP genes that are optimal for presentation of antigenic peptides of one given antigen may be different from TAP genes that are optimal for presentation of antigenic peptide of another antigen. Gene shuffling technique is ideal, and perhaps the only, method to solve this type of problems. Efficient presentation of desired antigenic peptides can be analyzed using specific cytotoxic T lymphocytes, for example, by measuring the cytokine production or CTL activity of the T lymphocytes using methods known to those of skill in the art.
- 3. Cytotoxic T-Cell Inducing Sequences and Immunogenic Agonist Sequences
- Certain proteins are better able than others to carry MHC class I epitopes because they are more readily used by the cellular machinery involved in the necessary processing for class I epitope presentation. The invention provides methods of identifying expressed polypeptides that are particularly efficient in traversing the various biosynthetic and degradative steps leading to class I epitope presentation and the use of these polypeptides to enhance presentation of CTL epitopes from other proteins.
- In one embodiment, the invention provides Cytotoxic T-cell Inducing Sequences (CTIS), which can be used to carry heterologous class I epitopes for the purpose of vaccinating against the pathogen from which the heterologous epitopes are derived. One example of a CTIS is obtained from the hepatitis B surface antigen (HBsAg), which has been shown to be an effective carrier for its own CTL epitopes when delivered as a protein under certain conditions. DNA immunization with plasmids expressing the HBsAg also induces high levels of CTL activity. The invention provides a shorter, truncated fragment of the HBsAg polypeptide which functions very efficiently in inducing CTL activity, and attains CTL induction levels that are higher than with the HBsAg protein or with the plasmids encoding the full-length HBsAg polypeptide. Synthesis of a CTIS derived from HBsAg is described in Example 3; and a diagram of a CTIS is shown in
FIG. 1 . - The ER localization of the truncated polypeptide may be important in achieving suitable proteolytic liberation of the peptide(s) containing the CTL epitopes (see Cresswell & Hughes (1997) Curr. Biol. 7: R552-R555; Craiu et al. (1997) Proc. Nat'l. Acad. Sci. USA 94: 10850-10855). The preS2 region and the transmembrane region provide T-helper epitopes which may be important for the induction of a strong cytotoxic immune response. Because the truncated CTIS polypeptide has a simple structure (see
FIG. 1 ), it is possible to attach one or more heterologous class I epitope sequences to the C-terminal end of the polypeptide without having to maintain any specific protein conformation. Such sequences are then available to the class I epitope processing mechanisms. The size of the polypeptide is not subject to the normal constraints of the native HBsAg structure. Therefore the length of the heterologous sequence and thus the number of included CTL epitopes is flexible. This is shown schematically inFIG. 2 . The ability to include a long sequence containing either multiple and distinct class I sequences, or alternatively different variations of a single CTL sequence, allows DNA shuffling methodology to be applied. - The invention also provides methods of obtaining Immununogenic Agonist Sequences (IAS) which induce CTLs capable of specific lysis of cells expressing the natural epitope sequence. In some cases, the reactivity is greater than if the CTL response is induced by the natural epitope (see, Example 3 and
FIG. 3 ). Such IAS-induced CTL may be drawn from a T-cell repertoire different from that induced by the natural sequence. In this way, poor responsiveness to a given epitope can be overcome by recruiting T cells from a larger pool. In order to discover such IAS, the amino acid at each position of a CTL-inducing peptide (excluding perhaps the positions of the so-called anchor residues) can be varied over the range of the 19 amino acids not normally present at the position. DNA shuffling methodology can be used to scan a large range of sequence possibilities. - A synthetic gene segment containing multiple copies of the original epitope sequence can be prepared such that each copy possesses a small number of nucleotide changes. The gene segment can be shuffled to create a diverse range of CTL epitope sequences, some of which should function as IAS. This process is illustrated in
FIG. 4 . - In practice, oligonucleotides are typically constructed in accordance with the above design and polymerized enzymatically to form the synthetic gene segment of the concatenated epitopes. Restriction sites can be incorporated into a fraction of the oligonucleotides to allow for cleavage and selection of given size ranges of the concatenated epitopes, most of which will have different sequences and thus will be potential IAS. The epitope-containing gene segment can be joined by appropriate cloning methods to a CTIS, such as that of HBsAg. The resulting plasmid constructions can be used for DNA-based immunization and CTL induction.
- E. Genetic Vaccine Pharmaceutical Compositions and Methods of Administration
- The improved immunomodulatory polynucleotides and polypeptides of the invention are useful for treating and/or preventing the various diseases and conditions with which the respective antigens are associated. For example, genetic vaccines that employ the reagents obtained according to the methods of the invention are useful in both prophylaxis and therapy of infectious diseases, including those caused by any bacterial, fungal, viral, or other pathogens of mammals. The reagents obtained using the invention can also be used for treatment of autoimmune diseases including, for example, rheumatoid arthritis, SLE, diabetes mellitus, myasthenia gravis, reactive arthritis, ankylosing spondylitis, and multiple sclerosis. These and other inflammatory conditions, including IBD, psoriasis, pancreatitis, and various immunodeficiencies, can be treated using genetic vaccines that include vectors and other components obtained using the methods of the invention. Genetic vaccine vectors and other reagents obtained using the methods of the invention can be used to treat allergies and asthma. Moreover, the use of genetic vaccines have great promise for the treatment of cancer and prevention of metastasis. By inducing an immune response against cancerous cells, the body's immune system can be enlisted to reduce or eliminate cancer.
- In presently preferred embodiments, the reagents obtained using the invention are used in conjunction with a genetic vaccine vector. The choice of vector and components can also be optimized for the particular purpose of treating allergy or other conditions. For example, an antigen associated with treating a particular condition can be optimized using recombination and selection methods analogous to those described herein. Such methods, and antigens appropriate for various conditions, are described in copending, commonly assigned U.S. patent application Ser. No. ______, entitled “Antigen Library Immunization,” which was filed on Feb. 10, 1999 as TTC Attorney Docket No. 18097-028710US. The polynucleotide that encodes the recombinant antigenic polypeptide can be placed under the control of a promoter, e.g., a high activity or tissue-specific promoter. The promoter used to express the antigenic polypeptide can itself be optimized using recombination and selection methods analogous to those described herein, as described in International Application No. PCT/US97/17300 (International Publication No. WO 98/13487). The reagents obtained using the methods of the invention can also be used in conjunction with multicomponent genetic vaccines, which are capable of tailoring an immune response as is most appropriate to achieve a desired effect (see, e.g., copending, commonly assigned U.S. patent application Ser. No. ______, entitled “Genetic Vaccine Vector Engineering,” filed on Feb. 10, 1999 as TTC Attorney Docket No. 18097-030100US). It is sometimes advantageous to employ a genetic vaccine that is targeted for a particular target cell type (e.g., an antigen presenting cell or an antigen processing cell); suitable targeting methods are described in copending, commonly assigned U.S. patent application Ser. No. ______, entitled “Targeting of Genetic Vaccine Vectors,” filed on Feb. 10, 1999 as TTC Attorney Docket No. 18097-030200US.
- Genetic vaccine vectors that include the optimized recombinant polynucleotides obtained as described herein can be delivered to a mammal (including humans) to induce a therapeutic or prophylactic immune response. Vaccine delivery vehicles can be delivered in vivo by administration to an individual patient, typically by systemic administration (e.g., intravenous, intraperitoneal, intramuscular, subdermal, intracranial, anal, vaginal, oral, buccal route or they can be inhaled) or they can be administered by topical application. Alternatively, vectors can be delivered to cells ex vivo, such as cells explanted from an individual patient (e.g., lymphocytes, bone marrow aspirates, tissue biopsy) or universal donor hematopoietic stem cells, followed by reimplantation of the cells into a patient, usually after selection for cells which have incorporated the vector.
- A large number of delivery methods are well known to those of skill in the art. Such methods include, for example liposome-based gene delivery (Debs and Zhu (1993) WO 93/24640; Mannino and Gould-Fogerite (1988) BioTechniques 6(7): 682-691; Rose U.S. Pat. No. 5,279,833; Brigham (1991) WO 91/06309; and Felgner et al. (1987) Proc. Natl. Acad. Sci. USA 84: 7413-7414), as well as use of viral vectors (e.g., adenoviral (see, e.g., Berns et al. (1995) Ann. NY Acad. Sci. 772: 95-104; Ali et al. (1994) Gene Ther. 1: 367-384; and Haddada et al. (1995) Curr. Top. Microbiol. Immunol. 199 (Pt 3): 297-306 for review), papillomaviral, retroviral (see, e.g., Buchscher et al. (1992) J. Virol. 66(5) 2731-2739; Johann et al. (1992) J. Virol. 66 (5): 1635-1640 (1992); Sommerfelt et al., (1990) Virol. 176: 58-59; Wilson et al. (1989) J. Virol. 63: 2374-2378; Miller et al., J. Virol. 65: 2220-2224 (1991); Wong-Staal et al., PCT/US94/05700, and Rosenburg and Fauci (1993) in Fundamental immunology, Third Edition Paul (ed) Raven Press, Ltd., New York and the references therein, and Yu et al., Gene Therapy (1994) supra.), and adeno-associated viral vectors (see, West et al. (1987) Virology 160: 38-47; Carter et al. (1989) U.S. Pat. No. 4,797,368; Carter et al. WO 93/24641 (1993); Kotin (1994) Human Gene Therapy 5: 793-801; Muzyczka (1994) J. Clin. Invst. 94: 1351 and Samulski (supra) for an overview of AAV vectors; see also, Lebkowski, U.S. Pat. No. 5,173,414; Tratschin et al. (1985) Mol. Cell. Biol. 5(11): 3251-3260; Tratschin, et al. (1984) Mol. Cell. Biol., 4: 2072-2081; Hermonat and Muzyczka (1984) Proc. Natl. Acad. Sci. USA, 81: 6466-6470; McLaughlin et al. (1988) and Samulski et al. (1989) J. Virol., 63: 03822-3828), and the like.
- “Naked” DNA and/or RNA that comprises a genetic vaccine can be introduced directly into a tissue, such as muscle. See, e.g., U.S. Pat. No. 5,580,859. Other methods such as “biolistic” or particle-mediated transformation (see, e.g., Sanford et al., U.S. Pat. No. 4,945,050; U.S. Pat. No. 5,036,006) are also suitable for introduction of genetic vaccines into cells of a mammal according to the invention. These methods are useful not only for in vivo introduction of DNA into a mammal, but also for ex vivo modification of cells for reintroduction into a mammal. As for other methods of delivering genetic vaccines, if necessary, vaccine administration is repeated in order to maintain the desired level of immunomodulation.
- Genetic vaccine vectors (e.g., adenoviruses, liposomes, papillomaviruses, retroviruses, etc.) can be administered directly to the mammal for transduction of cells in vivo. The genetic vaccines obtained using the methods of the invention can be formulated as pharmaceutical compositions for administration in any suitable manner, including parenteral (e.g., subcutaneous, intramuscular, intradermal, or intravenous), topical, oral, rectal, intrathecal, buccal (e.g., sublingual), or local administration, such as by aerosol or transdermally, for prophylactic and/or therapeutic treatment. Pretreatment of skin, for example, by use of hair-removing agents, may be useful in transdermal delivery. Suitable methods of administering such packaged nucleic acids are available and well known to those of skill in the art, and, although more than one route can be used to administer a particular composition, a particular route can often provide a more immediate and more effective reaction than another route.
- Pharmaceutically acceptable carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition. Accordingly, there is a wide variety of suitable formulations of pharmaceutical compositions of the present invention. A variety of aqueous carriers can be used, e.g., buffered saline and the like. These solutions are sterile and generally free of undesirable matter. These compositions may be sterilized by conventional, well known sterilization techniques. The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like. The concentration of genetic vaccine vector in these formulations can vary widely, and will be selected primarily based on fluid volumes, viscosities, body weight and the like in accordance with the particular mode of administration selected and the patient's needs.
- Formulations suitable for oral administration can consist of (a) liquid solutions, such as an effective amount of the packaged nucleic acid suspended in diluents, such as water, saline or PEG 400; (b) capsules, sachets or tablets, each containing a predetermined amount of the active ingredient, as liquids, solids, granules or gelatin; (c) suspensions in an appropriate liquid; and (d) suitable emulsions. Tablet forms can include one or more of lactose, sucrose, mannitol, sorbitol, calcium phosphates, corn starch, potato starch, tragacanth, microcrystalline cellulose, acacia, gelatin, colloidal silicon dioxide, croscarmellose sodium, talc, magnesium stearate, stearic acid, and other excipients, colorants, fillers, binders, diluents, buffering agents, moistening agents, preservatives, flavoring agents, dyes, disintegrating agents, and pharmaceutically compatible carriers. Lozenge forms can comprise the active ingredient in a flavor, usually sucrose and acacia or tragacanth, as well as pastilles comprising the active ingredient in an inert base, such as gelatin and glycerin or sucrose and acacia emulsions, gels, and the like containing, in addition to the active ingredient, carriers known in the art. It is recognized that the genetic vaccines, when administered orally, must be protected from digestion. This is typically accomplished either by complexing the vaccine vector with a composition to render it resistant to acidic and enzymatic hydrolysis or by packaging the vector in an appropriately resistant carrier such as a liposome. Means of protecting vectors from digestion are well known in the art. The pharmaceutical compositions can be encapsulated, e.g., in liposomes, or in a formulation that provides for slow release of the active ingredient.
- The packaged nucleic acids, alone or in combination with other suitable components, can be made into aerosol formulations (e.g., they can be “nebulized”) to be administered via inhalation. Aerosol formulations can be placed into pressurized acceptable propellants, such as dichlorodifluoromethane, propane, nitrogen, and the like.
- Suitable formulations for rectal administration include, for example; suppositories, which consist of the packaged nucleic acid with a suppository base. Suitable suppository bases include natural or synthetic triglycerides or paraffin hydrocarbons. In addition, it is also possible to use gelatin rectal capsules which consist of a combination of the packaged nucleic acid with a base, including, for example, liquid triglycerides, polyethylene glycols, and paraffin hydrocarbons.
- Formulations suitable for parenteral administration, such as, for example, by intraarticular (in the joints), intravenous, intramuscular, intradermal, intraperitoneal, and subcutaneous routes, include aqueous and non-aqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives. In the practice of this invention, compositions can be administered, for example, by intravenous infusion, orally, topically, intraperitoneally, intravesically or intrathecally. Parenteral administration and intravenous administration are the preferred methods of administration. The formulations of packaged nucleic acid can be presented in unit-dose or multi-dose sealed containers, such as ampoules and vials.
- Injection solutions and suspensions can be prepared from sterile powders, granules, and tablets of the kind previously described. Cells transduced by the packaged nucleic acid can also be administered intravenously or parenterally.
- The dose administered to a patient, in the context of the present invention should be sufficient to effect a beneficial therapeutic response in the patient over time. The dose will be determined by the efficacy of the particular vector employed and the condition of the patient, as well as the body weight or vascular surface area of the patient to be treated. The size of the dose also will be determined by the existence, nature, and extent of any adverse side-effects that accompany the administration of a particular vector, or transduced cell type in a particular patient.
- In determining the effective amount of the vector to be administered in the treatment or prophylaxis of an infection or other condition, the physician evaluates vector toxicities, progression of the disease, and the production of anti-vector antibodies, if any. In general, the dose equivalent of a naked nucleic acid from a vector is from about 1 μg to 1 mg for a typical 70 kilogram patient, and doses of vectors used to deliver the nucleic acid are calculated to yield an equivalent amount of therapeutic nucleic acid. Administration can be accomplished via single or divided doses.
- In therapeutic applications, compositions are administered to a patient suffering from a disease (e.g., an infectious disease or autoimmune disorder) in an amount sufficient to cure or at least partially arrest the disease and its complications. An amount adequate to accomplish this is defined as a “therapeutically effective dose.” Amounts effective for this use will depend upon the severity of the disease and the general state of the patient's health. Single or multiple administrations of the compositions may be administered depending on the dosage and frequency as required and tolerated by the patient. In any event, the composition should provide a sufficient quantity of the proteins of this invention to effectively treat the patient.
- In prophylactic applications, compositions are administered to a human or other mammal to induce an immune response that can help protect against the establishment of an infectious disease or other condition.
- The toxicity and therapeutic efficacy of the genetic vaccine vectors provided by the invention are determined using standard pharmaceutical procedures in cell cultures or experimental animals. One can determine the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population) using procedures presented herein and those otherwise known to those of skill in the art.
- A typical pharmaceutical composition for intravenous administration would be about 0.1 to 10 mg per patient per day. Dosages from 0.1 up to about 100 mg per patient per day may be used, particularly when the drug is administered to a secluded site and not into the blood stream, such as into a body cavity or into a lumen of an organ. Substantially higher dosages are possible in topical administration. Actual methods for preparing parenterally administrable compositions will be known or apparent to those skilled in the art and are described in more detail in such publications as Remington's Pharmaceutical Science, 15th ed., Mack Publishing Company, Easton, Pa. (1980).
- The multivalent antigenic polypeptides of the invention, and genetic vaccines that express the polypeptides, can be packaged in packs, dispenser devices, and kits for administering genetic vaccines to a mammal. For example, packs or dispenser devices that contain one or more unit dosage forms are provided. Typically, instructions for administration of the compounds will be provided with the packaging, along with a suitable indication on the label that the compound is suitable for treatment of an indicated condition. For example, the label may state that the active compound within the packaging is useful for treating a particular infectious disease, autoimmune disorder, tumor, or for preventing or treating other diseases or conditions that are mediated by, or potentially susceptible to, a mammalian immune response.
- The following examples are offered to illustrate, but not to limit the present invention.
- This Example describes the use of the DNA shuffling methods of the invention to obtain B7-1 and B7-2 polypeptides that have altered biological activities.
- DNA Shuffling
- DNA shuffling is used to generate a library of B7 (B7-1/CD80 and B7-2/CD86) variants that have altered relative capacity to act through CD28 and CTLA-4 when compared to wild-type B17 molecules. Typically, B7 cDNAs from various species are generated by RT-PCR, and these sequences are shuffled using family DNA shuffling. Alignments of human, rhesus monkey and rabbit B7-1 nucleotide sequences are shown in
FIG. 15 , demonstrating that family DNA shuffling is a feasible approach when evolving B7 molecules. - Screening of B7 Variants
- The library is then screened to identify those variants that are useful in modulating immune responses in autoimmune diseases, allergy, cancer, infectious disease and vaccination. Any of several approaches for screening of the variants can be used:
- A. Flow Cytometry-Based Selection System.
- The library of B7-1 and B7-2 molecules is transfected into cells that normally do not express these molecules (e.g., COS-7 cells or any cell line from different species with limited or no cross-reactivity with man regarding B7 ligand binding). An internal marker gene can be incorporated in order to analyze the copy number per cell.
- Soluble CTLA-4 and CD28 molecules are generated to facilitate the flow cytometry experiments. Typically, these soluble polypeptides are fused with the Fc portion of IgG molecule to improve the stability of the molecules and to enable easy staining by labeled anti-IgG monoclonal antibodies, as described by van der Merwe et al. ((1997) J. Exp. Med. 185: 393). The cells transfected with the library of B7 molecules are then stained with the soluble CTLA-4 and CD28 molecules. Cells demonstrating increased or decreased CTLA-4/CD28 binding ratio are sorted. The plasmids are then recovered and the shuffled sequences identified. These selected B7 variants can then be subjected to new rounds of shuffling and selection, and can be further analyzed using functional assays as described below.
- B. Selection Based on Functional Properties.
- Bacterial colonies that contain plasmids that include mutant B7 molecules are picked and the plasmids are isolated. These plasmids are then transfected into antigen presenting cells, such as dendritic cells, and the capacities of these mutants to activate T cells is analyzed. One of the advantages of this approach is that no assumptions are made as to the binding affinities or specificities to the known ligands, and possibly new activities through yet to be identified ligands can be found.
- T cell activation can be analyzed by measuring proliferation, cytokine production, CTL activity or expression of activation antigens such as IL-2 receptor, CD69 or HLA-DR molecules. Usage of antigen-specific T cell clones, such as T cells specific for house dust mite
antigen Der p 1, allows analysis of antigen-specific T cell activation. Mutants are identified that can enhance or inhibit T cell proliferation or enhance or inhibit CTL responses. Similarly variants that have altered capacity to induce cytokine production or expression of activation antigens as measured by, for example, cytokine-specific ELISAs or flow cytometry can be selected. Results obtained using a proliferation-based assay is shown are shown inFIG. 13 . - C. Ability to Direct Either
T H1 orT H2 Cell Differentiation. - Because differential roles for B7-1 and B7-2 molecules in the regulation of T helper cell differentiation have been identified (Freeman et al. (1995) Immunity 2: 523; Kuchroo et al. (1995) Cell 80: 707), one can screen for B7 variants that are the most effective in directing either
T H1 orT H2 cell differentiation. TH cell differentiation can be measured by analyzing the cytokine production profiles induced by each particular variant. High levels of IL-4, IL-5 and/or IL-13 are an indication ofefficient T H2 cell differentiation whereas high levels of IFN-γ or IL-2 production can be used as a marker ofT H1 cell differentiation. B7 variants that altered capacity to induceT H1 orT H2 cell differentiation are likely to be useful in the treatment of allergic, malignant, autoimmune and infectious diseases and in vaccination. - D. Enhanced IL-10 Production.
- Elevated production of IL-10 is a characteristic of regulatory T cells, which can suppress proliferation of antigen-specific CD4+ T cells (Groux et al. (1997) Nature 389: 737). Therefore, B7 variants can be screened to identify those that have enhanced capacity to induce IL-10 production by antigen-specific T cells. IL-10 production can be measured, for example, by ELISA or flow cytometry using intracytoplasmic cytokine stainings. The variants that induce high levels of IL-10 production are useful in the treatment of allergic and autoimmune diseases.
- This example describes a method to evolve a cytokine for improved specific activity and/or improved expression levels when the genetic vaccine is transfected into mammalian cells. IL-12 is the most potent
cytokine directing T H1 responses, and it improves the efficacy of genetic vaccinations. Evolved IL-12 molecules are useful as components of genetic vaccines. IL-0.12 is a heterodimeric cytokine composed of a 35 kD light chain (p35) and a 40 kD heavy chain (p40) (Kobayashi et al. (1989) J. Exp. Med. 170: 827; Stern et al. (1990) Proc. Nat'l. Acad. Sci. USA 87: 6808). Recently Lieschke et al. (Nature Biotechnol. (1997) 15: 35) demonstrated that a fusion between p35 and p40 genes results in a single gene that has activity comparable to that of the two genes expressed separately. Accordingly, an IL-12 gene is shuffled as one entity that encodes both subunits, which is beneficial in designing the shuffling protocol. The subunits of IL-12 can also be expressed separately in the same expression vector, or the subunits can be expressed separately and screened using cotransfections of the two vectors, providing additional shuffling strategies. - IL-12 plays several roles in the regulation of allergic responses. For example, IL-12 induces
T H1 cell differentiation and downregulates theT H2 response. IL-12 inhibits IgE synthesis both in vivo and in vitro, and also induces IFN-γ production. Accordingly, it is desirable to obtain an optimized IL-12 that better able to carry out these functions upon administration to a mammal. - Cytokine genes, including IL-12 genes, from humans and nonhuman primates are generally 93-99% homologous (Villinger et al. (1995) J. Immunol. 155: 3946-3954), providing a good starting point for family shuffling. A library of shuffled IL-12 genes was obtained by shuffling p35 and p40 subunits derived from human, rhesus monkey, cat, dog, cow, pig, and goat, and incorporated into vectors and the supernatants of these transfectants are analyzed for biological activity as shown in
FIG. 6 . Because of its T cell growth promoting activities, it is possible to use normal human peripheral blood T cells in the selection of the most active IL-12 genes, enabling directly to select IL-12 mutants with the most potent activities on human T cells. - As shown in
FIG. 7 , a functional screening assay has been successfully established. In this assay, COS-7 cells were first transfected with vectors encoding IL-12 subunits. Forty-eight hours after transfection, the capacity of these culture supernatants to induce proliferation of activated human peripheral blood T cells was studied.FIG. 8 indicates the consistency of the level of T cell proliferation induced in this assay, indicating that the assay can be used to distinguish the activities between supernatants that have different capacities to induce T cell activation. In other words, the assay provides means to screen for improved IL-12-like activities in culture supernatants of transfected cells. A vector with an optimized IL-12-encoding polynucleotide was tested for ability to induce human T cell activation. Results, shown inFIG. 9 , show that the shuffled IL-12 has an significantly increased ability to induce T cell activation compared to wild-type IL-12. -
FIG. 6 illustrates a general strategy for screening of evolved cytokine genes. The specific example is given for IL-12 but similar approach applies to all cytokines when using cell types sensitive for each cytokine. For example, GM-CSF can be evolved by the same approach by using the GM-CSF sensitive cell line TF-1 in the screening. In addition, although in this example the vectors are transfected into CHO cells, any mammalian cell that can be transfected in vitro can be used as host cells. In addition to CHO cell, other good host cells include cell lines WI-26, COS-1, COS-7, 293, U937 and freshly isolated human antigen presenting cells, such as monocytes, B cells and dendritic cells. - This Example describes the preparation of a polypeptide sequence capable of efficient presentation of T cell epitopes and a strategy for the application of DNA shuffling to discover strongly immunogenic agonistic T cell epitopes.
- The HBsAg polypeptide (PreS2 plus S regions) was truncated by the introduction of a stop codon at amino acid position 103 (counting from the beginning of the PreS2 initiator methionine), transforming a cysteine codon TGT into the Stop codon TGA. The amino acid sequence of the truncated protein was therefore:
MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSL NFLGGTTV*
where the standard single-letter code for amino acids is used. The methionine residues at the start of the PreS2 and S regions are underlined, and the mouse Ld-restricted CTL epitope is double-underlined; the asterisk (*) represents the artificially introduced Stop codon. - A likely structure for this truncated polypeptide is shown in
FIG. 1 . During protein biosynthesis, the N-terminal region of the HBsAg polypeptide is transported through the membrane of the endoplasmic reticulum (ER). The first part of the S region is a transmembrane structure which locks the polypeptide into the ER. The remaining C-terminal region of the polypeptide is located in the cytoplasmic compartment where it can be accessed by the epitope processing mechanism of the cell. This structure forms what is referred to as the Cytotoxic T-cell Inducing Sequence (CTIS). - A CTIS is preferably used in conjunction with an immunogenic agonistic sequence (IAS). As an example of an LAS, each position of a 12 amino acid Ld-restricted class I epitope from HBsAg was replaced with an alanine-encoding codon in the DNA sequence of the epitope. The results demonstrate that, in some cases, the reactivity is greater than if the CTL response is induced by the natural epitope (
FIG. 3 ). - Optimized immunomodulatory molecules that are obtained using the methods of the invention find use in a wide variety of applications, in addition to use in vaccination. For example, there is increasing evidence that certain forms of obesity are associated with dysfunction of the immune system, and that molecules which regulate immune responses, e.g. cytokines, can induce or inhibit obesity. The invention provides methods of optimizing immune regulatory molecules for the treatment of obesity, anorexia and cachexia.
- Leptin and ciliary neurotrophic factor (CNTF) are examples of cytokines that have been shown to play a role in the development of obesity. Congenital leptin deficiency results in severe early-onset obesity in human (Montague et al. (1997) Nature 387: 903-908), and CNTF has been shown to correct obesity and diabetes associated with leptin deficiency and resistance (Gloaguen et al. (1997) Proc. Nat'l. Acad. Sci. USA 94: 6456-6461). Antagonists of CNTF and/or leptin may be useful in the treatment of anorexia and/or cachexia.
- The methods of the invention are used to generate leptin and/or CNTF molecules that have improved specific activity. The methods are also useful for obtaining improved cytokines that exhibit reduced immunogenicity in vivo; immunogenicity is a particular concern for CNTF, because the wild-type CNTF is highly antigenic, which results in the production of high levels of anti-CNTF antibodies when administered to a human. Improved cytokine molecules prepared using the methods of the invention are administered as polypeptides, or the shuffled nucleic acids that encode improved leptin and/or CNTF polypeptides are used in genetic vaccine vectors. The invention also provides methods of generating vectors that induce production of increased levels of leptin and/or CNTF.
- The methods of the invention can also be used to obtain reagents that are useful for the treatment of anorexia, cachexia, and related disorders. In this embodiment, antagonists of leptin and/or CNTF are evolved using the DNA shuffling methods. For example, a leptin receptor can be evolved to obtain a soluble form that has an enhanced affinity for leptin. The receptor for leptin in mice is found in the hypothalamus (Mercer et al. (1996). FEBS Lett. 387: 113), a region known to be involved in maintenance of energy balance, and in the choroid plexus and leptomeninges, which form part of the blood/brain barrier.
- It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference for all purposes.
Claims (81)
1-46. (canceled)
47. A method of providing an immunomodulatory polynucleotide that has an optimized modulatory effect on an immune response, or encodes a polypeptide that has an optimized modulatory effect on an immune response, the method comprising creating a library of recombinant or non-stochastically generated progeny polynucleotides from a parental polynucleotide set, thereby providing an immunomodulatory polynucleotide.
48. The method of claim 47 , wherein the library of recombinant or non-stochastically generated progeny polynucleotides is optimized by directed evolution of the parental polynucleotides, such that polypeptides encoded by the optimized progeny polynucleotides are enhanced in their modulatory effect on an immune response.
49. The method of claim 48 , wherein said progeny polynucleotide whose modulatory effect on an immune response is optimized by directed evolution is introduced into a genetic vaccine vector.
50. The method of claim 48 , wherein said method of directed evolution is selected from the group consisting of codon site-saturation mutagenesis, amino acid site-saturation mutagenesis, gene site saturation mutagenesis, introduction of mutations by recombinant or non-stochastic polynucleotide reassembly methods, synthetic ligation polynucleotide reassembly, gene reassembly, oligonucleotide-directed saturation mutagenesis, in vivo reassortment of polynucleotide sequences having partial homology, naturally occurring recombination processes which reduce sequence complexity, and any combination thereof.
51. The method of claim 50 , wherein the method of directed evolution introduces at least at least one point mutation, addition, deletion, or chimerization, from one or more parental polynucleotides.
52. The method of claim 47 , further comprising screening said library for progeny polynucleotides which encode polypeptides optimized for their immunomodulatory effect as compared to the parental polynucleotides.
53. The method of claim 47 , wherein the optimized recombinant or non-stochastically generated polynucleotide encodes a polypeptide that interacts with a cellular receptor.
54. The method of claim 53 , wherein the cellular receptor is a macrophage scavenger receptor.
55. The method of claim 53 , wherein the cellular receptor is selected from the group consisting of a cytokine receptor and a chemokine receptor.
56. The method of claim 55 , wherein the chemokine receptor is CCR6.
57. The method of claim 53 , wherein the polypeptide acts as an agonist or antagonist of the receptor.
58. The method of claim 47 , wherein the library is screened by contacting replicable genetic packages, which express the encoded polypeptides of the optimized progeny polynucleotides as fusions with proteins displayed on the surface, with a plurality of cells that display the receptor.
59. The method of claim 58 , further comprising identifying cells that exhibit a modulation of an immune response by the receptor.
60. The method of claim 58 , wherein the replicable genetic package is selected from the group consisting of a bacteriophage, a cell, a spore, and a virus.
61. The method of claim 60 , wherein the replicable genetic package is an M13 bacteriophage and the protein is encoded by geneIII or geneVIII.
62. The method of claim 47 , further comprising introducing the optimized recombinant or non-stochastically generated polynucleotide into a genetic vaccine vector and administering the vector to a subject.
63. The method of claim 62 , wherein the peptide or polypeptide is an agonist or antagonist of the receptor.
64. The method of claim 47 , wherein the optimized recombinant or non-stochastically generated polynucleotide is inserted into an antigen-encoding nucleotide sequence of a genetic vaccine vector.
65. The method of claim 64 , wherein the optimized recombinant or non-stochastically generated polypeptide is introduced into a nucleotide sequence that encodes an HBsAg polypeptide.
66. The method of claim 47 , wherein the optimized recombinant or non-stochastically generated polynucleotide comprises a nucleotide sequence rich in unmethylated CpG.
67. The method of claim 47 , wherein the optimized recombinant or non-stochastically generated polynucleotide encodes a polypeptide that inhibits an allergic reaction.
68. The method of claim 67 , wherein the polypeptide is selected from the group consisting of interferon-alpha, interferon-beta, IL-10, IL-12, an antagonist of IL-4, an antagonist of IL-5, and an antagonist of IL-13.
69. The method of claim 47 , wherein the optimized recombinant polynucleotide encodes an antagonist of IL-10.
70. The method of claim 69 , wherein the antagonist of IL-10 is soluble or defective IL-10 receptor or IL-20/MDA-7.
71. The method of claim 47 , wherein the optimized recombinant or non-stochastically generated polynucleotide encodes a co-stimulator.
72. The method of claim 71 , wherein the co-stimulator is B7-1 (CD80) or B7-2 (CD86).
73. The method of claim 72 , wherein the screening step involves selecting variants with altered activity through CD28 or CTLA-4.
74. The method of claim 71 , wherein the co-stimulator is CD1, CD40, CD154 (ligand for CD40) or CD150 (SLAM).
75. The method of claim 71 , wherein the co-stimulator is a cytokine.
76. The method of claim 75 , wherein the cytokine is selected from the group consisting of IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, GM-CSF, G-CSF, TNF-alpha, IFN-alpha, IFN-gamma, and IL-20 (MDA-7).
77. The method of claim 76 , wherein the library of recombinant or non-stochastically generated polynucleotides is screened by testing the ability of cytokines encoded by the recombinant or non-stochastically generated polynucleotides to activate cells which contain a receptor for the cytokine.
78. The method of claim 77 , wherein the cells contain a heterologous nucleic acid that encodes the receptor for the cytokine.
79. The method of claim 76 , wherein the cytokine is interleukin-12 and screening is performed by growing mammalian cells which contain the genetic vaccine vector in a culture medium and detecting whether T cell proliferation or T cell differentiation is induced by contact with the culture medium.
80. The method of claim 76 , wherein the cytokine is interferon-gamma.
81. The method of claim 80 , wherein the library is screened by contacting replicable genetic packages, which express the encoded polypeptides of the optimized progeny polynucleotides as fusions with proteins displayed on the surface, with a plurality of B cells that display the receptor.
82. The method of claim 81 , further comprising identifying phage library members that are capable of inhibiting proliferation of the B cells.
83. The method of claim 76 , wherein the immune response of interest is differentiation of T cells to TH1 cells.
84. The method of claim 83 , wherein said immune response of interest is screened by contacting a population of T cells with the cytokines encoded by the members of the library of recombinant polynucleotides and identifying library members that encode a cytokine that induces the T cells to produce IL-2 and interferon-gamma.
85. The method of claim 75 , wherein the cytokine encoded by the optimized recombinant or non-stochastically generated polynucleotide exhibits reduced immunogenicity compared to a cytokine encoded by a non-optimized polynucleotide.
86. The method of claim 85 , wherein the reduced immunogenicity is detected by introducing a cytokine encoded by the recombinant or non-stochastically generated polynucleotide into a subject and determining whether an immune response is induced against the cytokine.
87. The method of claim 77 , wherein the cell is tested for ability to costimulate an immune response.
88. The method of claim 47 , wherein the optimized recombinant polynucleotide encodes a cytokine antagonist.
89. The method of claim 88 , wherein the cytokine antagonist is selected from the group consisting of a soluble cytokine receptor, a transmembrane cytokine receptor having a defective signal sequence, IL-10R and IL-4R.
90. The method of claim 47 , wherein the optimized recombinant or non-stochastically generated polynucleotide encodes a polypeptide capable of inducing a predominantly TH1 immune response.
91. The method of claim 47 , wherein the optimized recombinant or non-stochastically generated polynucleotide encodes a polypeptide capable of inducing a predominantly TH2 immune response.
92. The method of claim 47 , wherein said optimized modulatory effect on an immune response is a decrease in an unwanted modulatory effect on an immune response.
93. The method of claim 92 , wherein said method generates a molecule having a decreased ability to elicit an immune response from a host recipient of said molecule.
94. The method of claim 93 , wherein said recipient can be a human or an animal host.
95. The method of claim 94 , wherein said method generates a molecule having decreased antigenicity with respect to at least one host recipient of said molecule.
96. The method of claim 95 , wherein said recipient can be a human or an animal host.
97. The method of claim 47 , wherein said optimized modulatory effect on an immune response is both a decrease in a first unwanted modulatory effect on an immune response and an increase in a second desirable modulatory effect on an immune response.
98. The method of claim 97 , wherein the first and the second recipient hosts can be the same or different.
99. The method of claim 97 , wherein each of the first and the second recipient hosts can be human or animal.
100. The method of claim 97 , wherein said method generates a molecule having both a decreased ability to elicit a first immune response from a first host recipient of said molecule and an increased ability to elicit a second immune response from a second host recipient of said molecule.
101. The method of claim 100 , wherein the first and the second recipient hosts can be the same or different.
102. The method of claim 100 , wherein each of the first and the second recipient hosts can be a human or animal.
103. The method of claim 97 , wherein said method generates a molecule having both a first decreased antigenicity with respect to at least one host recipient of said molecule and a second decreased antigenicity with respect to at least one host recipient of said molecule.
104. The method of claim 92 , wherein said first and said second modulatory effect on an immune response are evolved for respectively a first and a second module on the same multimodule vaccine vector.
105. The method of claim 104 , wherein said module is selected from the group of modules consisting of an antigen coding sequence, a polyadenylation sequence, a sequence coding for a co-stimulatory molecule, a sequence coding for an inducible repressor or transactivator, a eukaryotic origin of replication, a prokaryotic origin of replication, a sequence coding for a prokaryotic marker, an enhancer, a promoter, an operator, an intron, or derivative fragments or analogs thereof, and any combination thereof.
106. The method of claim 47 , wherein the optimized modulatory effect on an immune response is comprised of an increase in the stability of the immunomodulatory (IM) polynucleotide or polypeptide encoded thereby.
107. The method of claim 106 , wherein said method generates a molecule having an increased stability ex vivo.
108. The method of claim 106 , wherein said method generates a molecule having increased stability in vivo, with respect to any means of biological elimination or degradation, upon administration to a host recipient.
109. The method of claim 47 , wherein the immunomodulatory (IM) polynucleotide or polypeptide encoded thereby has an optimized modulatory effect on an immune response in an animal or human host recipient.
110. The method of claim 109 , wherein said method generates an optimized genetic vaccine for any human and/or non-human recipients.
111. A method of providing an optimized recombinant or non-stochastically generated polynucleotide that has a modulatory effect on an immune response said method comprising recombinant or non-stochastically reassembling at least two parental template polynucleotides, each of which encodes a molecule that is involved in modulating an immune response, thereby providing a library of recombinant or non-stochastically generated polynucleotides.
112. The method of claim 111 , wherein the first and second parental templates differ from each other in two or more nucleotides.
113. The method of claim 111 , further comprising screening the library to identify at least one optimized recombinant or non-stochastically generated polynucleotide that exhibits through the encoded molecule an enhanced ability to modulate an immune response in comparison to a parental polynucleotide from which the library was created.
114. The method of claim 111 , wherein an optimized recombinant or non-stochastically generated polynucleotide is subjected to at least one further round of recombinant or non-stochastic reassembly with at least one additional polynucleotide to produce additional working libraries of recombinant polynucleotides.
115. The method of claim 114 , wherein said additional working libraries are screened to identify at least one further optimized recombinant or non-stochastically generated polynucleotide which encodes a polypeptide that has been optimized for its immunomodulatory effect when compared to the parental polynucleotide from which the library was created.
116. A method of providing an optimized polynucleotide that encodes an accessory molecule that improves the transport or presentation of antigens by a cell, said method comprising creating a library of recombinant or non-stochastically generated polynucleotides by subjecting to optimization by recombinant or non-stochastic directed evolution a parental polynucleotide set in which is encoded all or part of the accessory molecule.
117. The method of claim 116 , further comprising screening the library to identify an optimized recombinant or non-stochastically generated progeny polynucleotide that encodes a recombinant molecule that confers upon a cell an increased or decreased ability to transport or present an antigen on a surface of the cell as compared to an accessory molecule encoded by template polynucleotides not subjected to the recombinant or non-stochastic reassembly.
118. The method of claim 116 , wherein said method of directed evolution is selected from the group consisting of codon site-saturation mutagenesis, amino acid site-saturation mutagenesis, gene site saturation mutagenesis, introduction of mutations by recombinant or non-stochastic polynucleotide reassembly methods, synthetic ligation polynucleotide reassembly, gene reassembly, oligonucleotide-directed saturation mutagenesis, in vivo reassortment of polynucleotide sequences having partial homology, naturally occurring recombination processes which reduce sequence complexity, and any combination thereof.
119. The method of claim 116 , wherein said method generates an optimized molecule for any human and/or non-human recipients.
120. The method of claim 116 , further comprising forming a library of vectors by introducing the library of recombinant or non-stochastically generated polynucleotides into a genetic vaccine vector that encodes an antigen.
121. The method of claim 120 , wherein the library of vectors is introduced into mammalian cells.
122. The method of claim 121 , wherein said cells that exhibit increased or decreased immunogenicity to the antigen are identified.
123. The method of claim 116 , wherein the accessory molecule comprises a proteasome or a TAP polypeptide.
124. The method of claim 116 , wherein the accessory molecule comprises a cytotoxic T-cell inducing sequence.
125. The method of claim 124 , wherein the cytotoxic T-cell inducing sequence is obtained from a hepatitis B surface antigen.
126. The method of claim 116 , wherein the accessory molecule comprises an immunogenic agonist sequence.
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US10/877,846 US20050164222A1 (en) | 1998-02-11 | 2004-06-25 | Optimization of immunomodulatory properties of genetic vaccines |
US11/607,038 US20070087374A1 (en) | 1998-02-11 | 2006-12-01 | Optimization of immunomodulatory properties of genetic vaccines |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US7429498P | 1998-02-11 | 1998-02-11 | |
US24871699A | 1999-02-10 | 1999-02-10 | |
US09/724,869 US7390619B1 (en) | 1998-02-11 | 2000-11-28 | Optimization of immunomodulatory properties of genetic vaccines |
US10/877,846 US20050164222A1 (en) | 1998-02-11 | 2004-06-25 | Optimization of immunomodulatory properties of genetic vaccines |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US09/724,869 Continuation US7390619B1 (en) | 1998-02-11 | 2000-11-28 | Optimization of immunomodulatory properties of genetic vaccines |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/607,038 Continuation US20070087374A1 (en) | 1998-02-11 | 2006-12-01 | Optimization of immunomodulatory properties of genetic vaccines |
Publications (1)
Publication Number | Publication Date |
---|---|
US20050164222A1 true US20050164222A1 (en) | 2005-07-28 |
Family
ID=34317325
Family Applications (6)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US09/724,869 Expired - Fee Related US7390619B1 (en) | 1998-02-11 | 2000-11-28 | Optimization of immunomodulatory properties of genetic vaccines |
US10/877,846 Abandoned US20050164222A1 (en) | 1998-02-11 | 2004-06-25 | Optimization of immunomodulatory properties of genetic vaccines |
US10/877,035 Abandoned US20050064464A1 (en) | 1998-02-11 | 2004-06-25 | Optimization of immunomodulatory properties of genetic vaccines |
US10/981,535 Abandoned US20050222069A1 (en) | 1998-02-11 | 2004-11-05 | Optimization of immunomodulatory properties of genetic vaccines |
US11/607,035 Abandoned US20070087373A1 (en) | 1998-02-11 | 2006-12-01 | Optimization of immunomodulatory properties of genetic vaccines |
US11/607,038 Abandoned US20070087374A1 (en) | 1998-02-11 | 2006-12-01 | Optimization of immunomodulatory properties of genetic vaccines |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US09/724,869 Expired - Fee Related US7390619B1 (en) | 1998-02-11 | 2000-11-28 | Optimization of immunomodulatory properties of genetic vaccines |
Family Applications After (4)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10/877,035 Abandoned US20050064464A1 (en) | 1998-02-11 | 2004-06-25 | Optimization of immunomodulatory properties of genetic vaccines |
US10/981,535 Abandoned US20050222069A1 (en) | 1998-02-11 | 2004-11-05 | Optimization of immunomodulatory properties of genetic vaccines |
US11/607,035 Abandoned US20070087373A1 (en) | 1998-02-11 | 2006-12-01 | Optimization of immunomodulatory properties of genetic vaccines |
US11/607,038 Abandoned US20070087374A1 (en) | 1998-02-11 | 2006-12-01 | Optimization of immunomodulatory properties of genetic vaccines |
Country Status (1)
Country | Link |
---|---|
US (6) | US7390619B1 (en) |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10738095B2 (en) | 2015-06-03 | 2020-08-11 | The Medical College Of Wisconsin, Inc. | Engineered CCL20 locked dimer polypeptide |
US11571462B2 (en) | 2015-06-03 | 2023-02-07 | The Medical College Of Wisconsin, Inc. | Engineered CCL20 locked dimer polypeptide |
Families Citing this family (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2000011186A1 (en) * | 1998-08-21 | 2000-03-02 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Modified hcv peptide vaccines |
ATE439437T1 (en) | 1999-01-05 | 2009-08-15 | Univ Boston | IMPROVED CLONING PROCESS |
US20040005673A1 (en) | 2001-06-29 | 2004-01-08 | Kevin Jarrell | System for manipulating nucleic acids |
US7435562B2 (en) | 2000-07-21 | 2008-10-14 | Modular Genetics, Inc. | Modular vector systems |
TW200303759A (en) * | 2001-11-27 | 2003-09-16 | Schering Corp | Methods for treating cancer |
WO2006053131A1 (en) | 2004-11-11 | 2006-05-18 | Modular Genetics, Inc. | Ladder assembly and system for generating diversity |
CA2604242A1 (en) * | 2005-04-14 | 2006-10-19 | The University Of Queensland | Immunomodulating compositions and uses therefor |
CA3007787C (en) | 2010-06-03 | 2020-03-10 | Pharmacyclics Llc | The use of inhibitors of bruton's tyrosine kinase (btk) |
WO2014018567A1 (en) | 2012-07-24 | 2014-01-30 | Pharmacyclics, Inc. | Mutations associated with resistance to inhibitors of bruton's tyrosine kinase (btk) |
CA2890111A1 (en) | 2012-11-02 | 2014-05-08 | Pharmacyclics, Inc. | Tec family kinase inhibitor adjuvant therapy |
JP2017509336A (en) | 2014-03-20 | 2017-04-06 | ファーマサイクリックス エルエルシー | Mutations associated with phospholipase C gamma 2 and resistance |
KR20220080102A (en) * | 2019-09-11 | 2022-06-14 | 더 락커펠러 유니버시티 | Compositions and Methods Related to Human Neutralizing Antibodies to Hepatitis B |
Citations (75)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5252714A (en) * | 1990-11-28 | 1993-10-12 | The University Of Alabama In Huntsville | Preparation and use of polyethylene glycol propionaldehyde |
US5264563A (en) * | 1990-08-24 | 1993-11-23 | Ixsys Inc. | Process for synthesizing oligonucleotides with random codons |
US5338665A (en) * | 1991-10-16 | 1994-08-16 | Affymax Technologies N.V. | Peptide library and screening method |
US5348867A (en) * | 1991-11-15 | 1994-09-20 | George Georgiou | Expression of proteins on bacterial surface |
US5470725A (en) * | 1989-02-16 | 1995-11-28 | Carlsberg A/S | Thermostable (1,3-1,4)-β-glucanase |
US5512463A (en) * | 1991-04-26 | 1996-04-30 | Eli Lilly And Company | Enzymatic inverse polymerase chain reaction library mutagenesis |
US5514588A (en) * | 1994-12-13 | 1996-05-07 | Exxon Research And Engineering Company | Surfactant-nutrients for bioremediation of hydrocarbon contaminated soils and water |
US5571698A (en) * | 1988-09-02 | 1996-11-05 | Protein Engineering Corporation | Directed evolution of novel binding proteins |
US5589466A (en) * | 1989-03-21 | 1996-12-31 | Vical Incorporated | Induction of a protective immune response in a mammal by injecting a DNA sequence |
US5593972A (en) * | 1993-01-26 | 1997-01-14 | The Wistar Institute | Genetic immunization |
US5605793A (en) * | 1994-02-17 | 1997-02-25 | Affymax Technologies N.V. | Methods for in vitro recombination |
US5691170A (en) * | 1989-04-18 | 1997-11-25 | Therion Biologics | Generation of hybrid genes and proteins by virus-mediated recombination |
US5698426A (en) * | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
US5703057A (en) * | 1995-04-07 | 1997-12-30 | Board Of Regents The University Of Texas System | Expression library immunization |
US5718883A (en) * | 1993-04-14 | 1998-02-17 | The United States Of America As Represented By The Secretary Of The Navy | Transgenic animal model for autoimmune diseases |
US5723323A (en) * | 1985-03-30 | 1998-03-03 | Kauffman; Stuart Alan | Method of identifying a stochastically-generated peptide, polypeptide, or protein having ligand binding property and compositions thereof |
US5738852A (en) * | 1993-04-20 | 1998-04-14 | Solis Therapeutics, Inc. | Methods of enhancing antigen-specific T cell responses |
US5763192A (en) * | 1986-11-20 | 1998-06-09 | Ixsys, Incorporated | Process for obtaining DNA, RNA, peptides, polypeptides, or protein, by recombinant DNA technique |
US5763239A (en) * | 1996-06-18 | 1998-06-09 | Diversa Corporation | Production and use of normalized DNA libraries |
US5770434A (en) * | 1990-09-28 | 1998-06-23 | Ixsys Incorporated | Soluble peptides having constrained, secondary conformation in solution and method of making same |
US5783386A (en) * | 1994-02-24 | 1998-07-21 | Agresearch, New Zealand Pastoral Agriculture Research Institute Ltd. | Mycobacteria virulence factors and a novel method for their identification |
US5789228A (en) * | 1996-05-22 | 1998-08-04 | Diversa Corporation | Endoglucanases |
US5814473A (en) * | 1996-02-09 | 1998-09-29 | Diversa Corporation | Transaminases and aminotransferases |
US5824469A (en) * | 1986-07-17 | 1998-10-20 | University Of Washington | Method for producing novel DNA sequences with biological activity |
US5830696A (en) * | 1996-12-05 | 1998-11-03 | Diversa Corporation | Directed evolution of thermophilic enzymes |
US5834252A (en) * | 1995-04-18 | 1998-11-10 | Glaxo Group Limited | End-complementary polymerase reaction |
US5837458A (en) * | 1994-02-17 | 1998-11-17 | Maxygen, Inc. | Methods and compositions for cellular and metabolic engineering |
US5858776A (en) * | 1993-11-03 | 1999-01-12 | Repligen Corporation | Tumor cells with increased immunogenicity and uses therefor |
US5861310A (en) * | 1993-11-03 | 1999-01-19 | Dana-Farber Cancer Institute | Tumor cells modified to express B7-2 with increased immunogenicity and uses therefor |
US5862514A (en) * | 1996-12-06 | 1999-01-19 | Ixsys, Inc. | Method and means for synthesis-based simulation of chemicals having biological functions |
US5866363A (en) * | 1985-08-28 | 1999-02-02 | Pieczenik; George | Method and means for sorting and identifying biological information |
US5866344A (en) * | 1991-11-15 | 1999-02-02 | Board Of Regents, The University Of Texas System | Antibody selection methods using cell surface expressed libraries |
US5871974A (en) * | 1990-09-28 | 1999-02-16 | Ixsys Inc. | Surface expression libraries of heteromeric receptors |
US5876997A (en) * | 1997-08-13 | 1999-03-02 | Diversa Corporation | Phytase |
US5882883A (en) * | 1994-09-28 | 1999-03-16 | Novo Nordisk A/S | Process for the production of secondary metabolites |
US5925749A (en) * | 1995-08-23 | 1999-07-20 | Diversa Corporation | Carboxymethyl cellulase from Thermotoga maritima |
US5928905A (en) * | 1995-04-18 | 1999-07-27 | Glaxo Group Limited | End-complementary polymerase reaction |
US5939300A (en) * | 1996-07-03 | 1999-08-17 | Diversa Corporation | Catalases |
US5939250A (en) * | 1995-12-07 | 1999-08-17 | Diversa Corporation | Production of enzymes having desired activities by mutagenesis |
US5942430A (en) * | 1996-02-16 | 1999-08-24 | Diversa Corporation | Esterases |
US5948666A (en) * | 1997-08-06 | 1999-09-07 | Diversa Corporation | Isolation and identification of polymerases |
US5955358A (en) * | 1990-12-20 | 1999-09-21 | Ixsys, Incorporated | Optimization of binding proteins |
US5958751A (en) * | 1996-03-08 | 1999-09-28 | Diversa Corporation | α-galactosidase |
US5958672A (en) * | 1995-07-18 | 1999-09-28 | Diversa Corporation | Protein activity screening of clones having DNA from uncultivated microorganisms |
US5962283A (en) * | 1995-12-07 | 1999-10-05 | Diversa Corporation | Transminases and amnotransferases |
US5965408A (en) * | 1996-07-09 | 1999-10-12 | Diversa Corporation | Method of DNA reassembly by interrupting synthesis |
US5985646A (en) * | 1996-06-17 | 1999-11-16 | Diversa Corporation | Amidase |
US5985285A (en) * | 1995-03-13 | 1999-11-16 | The Secretary Of State For Defence In Her Britanic Majesty's Government Of The United Kingdom Of Great Britain And Northern Ireland | Vaccines for plague |
US6004788A (en) * | 1995-07-18 | 1999-12-21 | Diversa Corporation | Enzyme kits and libraries |
US6030779A (en) * | 1995-07-18 | 2000-02-29 | Diversa Corporation | Screening for novel bioactivities |
US6043030A (en) * | 1992-12-17 | 2000-03-28 | Cold Spring Harbor Laboratory | Cell-cycle regulatory proteins, and uses related thereto |
US6054312A (en) * | 1997-08-29 | 2000-04-25 | Selective Genetics, Inc. | Receptor-mediated gene delivery using bacteriophage vectors |
US6057103A (en) * | 1995-07-18 | 2000-05-02 | Diversa Corporation | Screening for novel bioactivities |
US6071716A (en) * | 1990-10-01 | 2000-06-06 | Dana-Farber Cancer Institute | DNA encoding, B7, a new member of the IG superfamily with unique expression on activated and neoplastic B cells |
US6084067A (en) * | 1993-07-26 | 2000-07-04 | Dana-Farber Cancer Institute | CTLA4/CD28 ligands and uses therefor |
US6087341A (en) * | 1998-02-12 | 2000-07-11 | The Board Of Trustees Of The Leland Standford Junior University | Introduction of nucleic acid into skin cells by topical application |
US6096548A (en) * | 1996-03-25 | 2000-08-01 | Maxygen, Inc. | Method for directing evolution of a virus |
US6117679A (en) * | 1994-02-17 | 2000-09-12 | Maxygen, Inc. | Methods for generating polynucleotides having desired characteristics by iterative selection and recombination |
US6153410A (en) * | 1997-03-25 | 2000-11-28 | California Institute Of Technology | Recombination of polynucleotide sequences using random or defined primers |
US6156511A (en) * | 1991-10-16 | 2000-12-05 | Affymax Technologies N.V. | Peptide library and screening method |
US6159687A (en) * | 1997-03-18 | 2000-12-12 | Novo Nordisk A/S | Methods for generating recombined polynucleotides |
US6159688A (en) * | 1997-03-18 | 2000-12-12 | Novo Nordisk A/S | Methods of producing polynucleotide variants |
US6165793A (en) * | 1996-03-25 | 2000-12-26 | Maxygen, Inc. | Methods for generating polynucleotides having desired characteristics by iterative selection and recombination |
US6165718A (en) * | 1996-01-10 | 2000-12-26 | Novo Nordisk A/S Novo Alle | Method for in vivo production of a mutant library in cells |
US6168919B1 (en) * | 1996-07-17 | 2001-01-02 | Diversa Corporation | Screening methods for enzymes and enzyme kits |
US6171820B1 (en) * | 1995-12-07 | 2001-01-09 | Diversa Corporation | Saturation mutagenesis in directed evolution |
US6174673B1 (en) * | 1997-06-16 | 2001-01-16 | Diversa Corporation | High throughput screening for novel enzymes |
US6194183B1 (en) * | 1995-09-07 | 2001-02-27 | Novo Nordisk A/S | Phage display for detergent enzyme activity |
US6238884B1 (en) * | 1995-12-07 | 2001-05-29 | Diversa Corporation | End selection in directed evolution |
US6251674B1 (en) * | 1997-01-17 | 2001-06-26 | Maxygen, Inc. | Evolution of whole cells and organisms by recursive sequence recombination |
US6261561B1 (en) * | 1996-04-19 | 2001-07-17 | Henry M. Jackson Foundation For The Advancement Of Military Medicine | Method of stimulating an immune response by administration of host organisms that express intimin alone or as a fusion protein with one or more other antigens |
US6368861B1 (en) * | 1999-01-19 | 2002-04-09 | Maxygen, Inc. | Oligonucleotide mediated nucleic acid recombination |
US6376246B1 (en) * | 1999-02-05 | 2002-04-23 | Maxygen, Inc. | Oligonucleotide mediated nucleic acid recombination |
US6406855B1 (en) * | 1994-02-17 | 2002-06-18 | Maxygen, Inc. | Methods and compositions for polypeptide engineering |
US6613514B2 (en) * | 1994-02-17 | 2003-09-02 | Maxygen, Inc. | Methods and compositions for polypeptide engineering |
Family Cites Families (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4882278A (en) | 1983-04-29 | 1989-11-21 | President And Fellows Of Harvard College | Non-toxinogenic vibrio cholerae mutants |
US5408265A (en) | 1992-02-07 | 1995-04-18 | Olympus Optical Co., Ltd. | Electronic endoscope system adaptable to different T.V. standards while utilizing a common light source |
ATE230418T1 (en) | 1994-08-08 | 2003-01-15 | Kyowa Hakko Kogyo Kk | MONOCLONAL ANTIBODIES AGAINST THE HUMAN MX PROTEIN MXA |
US20020182727A1 (en) * | 1995-05-19 | 2002-12-05 | Dana-Farber Cancer Institute | Methods for selectively modulating a Th2-type response within a population of activated CD4+ T cells |
US6429286B1 (en) * | 1997-04-16 | 2002-08-06 | Juridical Foundation The Chemo-Sero-Therapeutic Research Institute | Immunoregulatory molecules for costimulatory signal transduction |
-
2000
- 2000-11-28 US US09/724,869 patent/US7390619B1/en not_active Expired - Fee Related
-
2004
- 2004-06-25 US US10/877,846 patent/US20050164222A1/en not_active Abandoned
- 2004-06-25 US US10/877,035 patent/US20050064464A1/en not_active Abandoned
- 2004-11-05 US US10/981,535 patent/US20050222069A1/en not_active Abandoned
-
2006
- 2006-12-01 US US11/607,035 patent/US20070087373A1/en not_active Abandoned
- 2006-12-01 US US11/607,038 patent/US20070087374A1/en not_active Abandoned
Patent Citations (92)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5976862A (en) * | 1985-03-30 | 1999-11-02 | Ixsys Corporation | Process for obtaining DNA, RNA, peptides, polypeptides, or proteins, by recombinant DNA technique |
US5723323A (en) * | 1985-03-30 | 1998-03-03 | Kauffman; Stuart Alan | Method of identifying a stochastically-generated peptide, polypeptide, or protein having ligand binding property and compositions thereof |
US5824514A (en) * | 1985-03-30 | 1998-10-20 | Stuart A. Kauffman | Process for the production of expression vectors comprising at least one stochastic sequence of polynucleotides |
US5817483A (en) * | 1985-03-30 | 1998-10-06 | Stuart Kauffman | Process for the production of stochastically-generated peptides,polypeptides or proteins having a predetermined property |
US5814476A (en) * | 1985-03-30 | 1998-09-29 | Stuart Kauffman | Process for the production of stochastically-generated transcription or translation products |
US5866363A (en) * | 1985-08-28 | 1999-02-02 | Pieczenik; George | Method and means for sorting and identifying biological information |
US5824469A (en) * | 1986-07-17 | 1998-10-20 | University Of Washington | Method for producing novel DNA sequences with biological activity |
US5763192A (en) * | 1986-11-20 | 1998-06-09 | Ixsys, Incorporated | Process for obtaining DNA, RNA, peptides, polypeptides, or protein, by recombinant DNA technique |
US5571698A (en) * | 1988-09-02 | 1996-11-05 | Protein Engineering Corporation | Directed evolution of novel binding proteins |
US5470725A (en) * | 1989-02-16 | 1995-11-28 | Carlsberg A/S | Thermostable (1,3-1,4)-β-glucanase |
US5589466A (en) * | 1989-03-21 | 1996-12-31 | Vical Incorporated | Induction of a protective immune response in a mammal by injecting a DNA sequence |
US5691170A (en) * | 1989-04-18 | 1997-11-25 | Therion Biologics | Generation of hybrid genes and proteins by virus-mediated recombination |
US5523388A (en) * | 1990-08-24 | 1996-06-04 | Ixsys, Inc. | Methods of synthesizing oligonucleotides with random codons |
US5264563A (en) * | 1990-08-24 | 1993-11-23 | Ixsys Inc. | Process for synthesizing oligonucleotides with random codons |
US5808022A (en) * | 1990-08-24 | 1998-09-15 | Ixsys Incorporated | Oligonucleotides having random riplets |
US5871974A (en) * | 1990-09-28 | 1999-02-16 | Ixsys Inc. | Surface expression libraries of heteromeric receptors |
US5698426A (en) * | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
US5770434A (en) * | 1990-09-28 | 1998-06-23 | Ixsys Incorporated | Soluble peptides having constrained, secondary conformation in solution and method of making same |
US6071716A (en) * | 1990-10-01 | 2000-06-06 | Dana-Farber Cancer Institute | DNA encoding, B7, a new member of the IG superfamily with unique expression on activated and neoplastic B cells |
US5252714A (en) * | 1990-11-28 | 1993-10-12 | The University Of Alabama In Huntsville | Preparation and use of polyethylene glycol propionaldehyde |
US5955358A (en) * | 1990-12-20 | 1999-09-21 | Ixsys, Incorporated | Optimization of binding proteins |
US5512463A (en) * | 1991-04-26 | 1996-04-30 | Eli Lilly And Company | Enzymatic inverse polymerase chain reaction library mutagenesis |
US6156511A (en) * | 1991-10-16 | 2000-12-05 | Affymax Technologies N.V. | Peptide library and screening method |
US5338665A (en) * | 1991-10-16 | 1994-08-16 | Affymax Technologies N.V. | Peptide library and screening method |
US5348867A (en) * | 1991-11-15 | 1994-09-20 | George Georgiou | Expression of proteins on bacterial surface |
US5866344A (en) * | 1991-11-15 | 1999-02-02 | Board Of Regents, The University Of Texas System | Antibody selection methods using cell surface expressed libraries |
US6043030A (en) * | 1992-12-17 | 2000-03-28 | Cold Spring Harbor Laboratory | Cell-cycle regulatory proteins, and uses related thereto |
US5593972A (en) * | 1993-01-26 | 1997-01-14 | The Wistar Institute | Genetic immunization |
US5718883A (en) * | 1993-04-14 | 1998-02-17 | The United States Of America As Represented By The Secretary Of The Navy | Transgenic animal model for autoimmune diseases |
US5738852A (en) * | 1993-04-20 | 1998-04-14 | Solis Therapeutics, Inc. | Methods of enhancing antigen-specific T cell responses |
US6084067A (en) * | 1993-07-26 | 2000-07-04 | Dana-Farber Cancer Institute | CTLA4/CD28 ligands and uses therefor |
US5858776A (en) * | 1993-11-03 | 1999-01-12 | Repligen Corporation | Tumor cells with increased immunogenicity and uses therefor |
US6149905A (en) * | 1993-11-03 | 2000-11-21 | Genetics Institute, Inc. | Tumor cells with increased immunogenicity and uses therefor |
US5861310A (en) * | 1993-11-03 | 1999-01-19 | Dana-Farber Cancer Institute | Tumor cells modified to express B7-2 with increased immunogenicity and uses therefor |
US6132970A (en) * | 1994-02-17 | 2000-10-17 | Maxygen, Inc. | Methods of shuffling polynucleotides |
US6117679A (en) * | 1994-02-17 | 2000-09-12 | Maxygen, Inc. | Methods for generating polynucleotides having desired characteristics by iterative selection and recombination |
US6613514B2 (en) * | 1994-02-17 | 2003-09-02 | Maxygen, Inc. | Methods and compositions for polypeptide engineering |
US5811238A (en) * | 1994-02-17 | 1998-09-22 | Affymax Technologies N.V. | Methods for generating polynucleotides having desired characteristics by iterative selection and recombination |
US5830721A (en) * | 1994-02-17 | 1998-11-03 | Affymax Technologies N.V. | DNA mutagenesis by random fragmentation and reassembly |
US6406855B1 (en) * | 1994-02-17 | 2002-06-18 | Maxygen, Inc. | Methods and compositions for polypeptide engineering |
US6287861B1 (en) * | 1994-02-17 | 2001-09-11 | Maxygen, Inc. | Methods for generating polynucleotides having desired characteristics by iterative selection and recombination |
US5605793A (en) * | 1994-02-17 | 1997-02-25 | Affymax Technologies N.V. | Methods for in vitro recombination |
US5837458A (en) * | 1994-02-17 | 1998-11-17 | Maxygen, Inc. | Methods and compositions for cellular and metabolic engineering |
US6180406B1 (en) * | 1994-02-17 | 2001-01-30 | Maxygen, Inc. | Methods for generating polynucleotides having desired characteristics by iterative selection and recombination |
US5783386A (en) * | 1994-02-24 | 1998-07-21 | Agresearch, New Zealand Pastoral Agriculture Research Institute Ltd. | Mycobacteria virulence factors and a novel method for their identification |
US5882883A (en) * | 1994-09-28 | 1999-03-16 | Novo Nordisk A/S | Process for the production of secondary metabolites |
US5514588A (en) * | 1994-12-13 | 1996-05-07 | Exxon Research And Engineering Company | Surfactant-nutrients for bioremediation of hydrocarbon contaminated soils and water |
US5985285A (en) * | 1995-03-13 | 1999-11-16 | The Secretary Of State For Defence In Her Britanic Majesty's Government Of The United Kingdom Of Great Britain And Northern Ireland | Vaccines for plague |
US5703057A (en) * | 1995-04-07 | 1997-12-30 | Board Of Regents The University Of Texas System | Expression library immunization |
US5989553A (en) * | 1995-04-07 | 1999-11-23 | Board Of Regents, The University Of Texas System | Expression library immunization |
US5928905A (en) * | 1995-04-18 | 1999-07-27 | Glaxo Group Limited | End-complementary polymerase reaction |
US5834252A (en) * | 1995-04-18 | 1998-11-10 | Glaxo Group Limited | End-complementary polymerase reaction |
US6057103A (en) * | 1995-07-18 | 2000-05-02 | Diversa Corporation | Screening for novel bioactivities |
US6030779A (en) * | 1995-07-18 | 2000-02-29 | Diversa Corporation | Screening for novel bioactivities |
US5958672A (en) * | 1995-07-18 | 1999-09-28 | Diversa Corporation | Protein activity screening of clones having DNA from uncultivated microorganisms |
US6004788A (en) * | 1995-07-18 | 1999-12-21 | Diversa Corporation | Enzyme kits and libraries |
US5925749A (en) * | 1995-08-23 | 1999-07-20 | Diversa Corporation | Carboxymethyl cellulase from Thermotoga maritima |
US5962258A (en) * | 1995-08-23 | 1999-10-05 | Diversa Corporation | Carboxymethyl cellulase fromthermotoga maritima |
US6194183B1 (en) * | 1995-09-07 | 2001-02-27 | Novo Nordisk A/S | Phage display for detergent enzyme activity |
US5962283A (en) * | 1995-12-07 | 1999-10-05 | Diversa Corporation | Transminases and amnotransferases |
US6171820B1 (en) * | 1995-12-07 | 2001-01-09 | Diversa Corporation | Saturation mutagenesis in directed evolution |
US5939250A (en) * | 1995-12-07 | 1999-08-17 | Diversa Corporation | Production of enzymes having desired activities by mutagenesis |
US6054267A (en) * | 1995-12-07 | 2000-04-25 | Diversa Corporation | Method for screening for enzyme activity |
US6238884B1 (en) * | 1995-12-07 | 2001-05-29 | Diversa Corporation | End selection in directed evolution |
US6165718A (en) * | 1996-01-10 | 2000-12-26 | Novo Nordisk A/S Novo Alle | Method for in vivo production of a mutant library in cells |
US5814473A (en) * | 1996-02-09 | 1998-09-29 | Diversa Corporation | Transaminases and aminotransferases |
US5942430A (en) * | 1996-02-16 | 1999-08-24 | Diversa Corporation | Esterases |
US5958751A (en) * | 1996-03-08 | 1999-09-28 | Diversa Corporation | α-galactosidase |
US6096548A (en) * | 1996-03-25 | 2000-08-01 | Maxygen, Inc. | Method for directing evolution of a virus |
US6165793A (en) * | 1996-03-25 | 2000-12-26 | Maxygen, Inc. | Methods for generating polynucleotides having desired characteristics by iterative selection and recombination |
US6261561B1 (en) * | 1996-04-19 | 2001-07-17 | Henry M. Jackson Foundation For The Advancement Of Military Medicine | Method of stimulating an immune response by administration of host organisms that express intimin alone or as a fusion protein with one or more other antigens |
US5789228A (en) * | 1996-05-22 | 1998-08-04 | Diversa Corporation | Endoglucanases |
US5985646A (en) * | 1996-06-17 | 1999-11-16 | Diversa Corporation | Amidase |
US6001574A (en) * | 1996-06-18 | 1999-12-14 | Diversa Corporation | Production and use of normalized DNA libraries |
US5763239A (en) * | 1996-06-18 | 1998-06-09 | Diversa Corporation | Production and use of normalized DNA libraries |
US5939300A (en) * | 1996-07-03 | 1999-08-17 | Diversa Corporation | Catalases |
US5965408A (en) * | 1996-07-09 | 1999-10-12 | Diversa Corporation | Method of DNA reassembly by interrupting synthesis |
US6168919B1 (en) * | 1996-07-17 | 2001-01-02 | Diversa Corporation | Screening methods for enzymes and enzyme kits |
US5830696A (en) * | 1996-12-05 | 1998-11-03 | Diversa Corporation | Directed evolution of thermophilic enzymes |
US5862514A (en) * | 1996-12-06 | 1999-01-19 | Ixsys, Inc. | Method and means for synthesis-based simulation of chemicals having biological functions |
US6251674B1 (en) * | 1997-01-17 | 2001-06-26 | Maxygen, Inc. | Evolution of whole cells and organisms by recursive sequence recombination |
US6159688A (en) * | 1997-03-18 | 2000-12-12 | Novo Nordisk A/S | Methods of producing polynucleotide variants |
US6159687A (en) * | 1997-03-18 | 2000-12-12 | Novo Nordisk A/S | Methods for generating recombined polynucleotides |
US6177263B1 (en) * | 1997-03-25 | 2001-01-23 | California Institute Of Technology | Recombination of polynucleotide sequences using random or defined primers |
US6153410A (en) * | 1997-03-25 | 2000-11-28 | California Institute Of Technology | Recombination of polynucleotide sequences using random or defined primers |
US6174673B1 (en) * | 1997-06-16 | 2001-01-16 | Diversa Corporation | High throughput screening for novel enzymes |
US5948666A (en) * | 1997-08-06 | 1999-09-07 | Diversa Corporation | Isolation and identification of polymerases |
US5876997A (en) * | 1997-08-13 | 1999-03-02 | Diversa Corporation | Phytase |
US6054312A (en) * | 1997-08-29 | 2000-04-25 | Selective Genetics, Inc. | Receptor-mediated gene delivery using bacteriophage vectors |
US6087341A (en) * | 1998-02-12 | 2000-07-11 | The Board Of Trustees Of The Leland Standford Junior University | Introduction of nucleic acid into skin cells by topical application |
US6368861B1 (en) * | 1999-01-19 | 2002-04-09 | Maxygen, Inc. | Oligonucleotide mediated nucleic acid recombination |
US6376246B1 (en) * | 1999-02-05 | 2002-04-23 | Maxygen, Inc. | Oligonucleotide mediated nucleic acid recombination |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10738095B2 (en) | 2015-06-03 | 2020-08-11 | The Medical College Of Wisconsin, Inc. | Engineered CCL20 locked dimer polypeptide |
US11571462B2 (en) | 2015-06-03 | 2023-02-07 | The Medical College Of Wisconsin, Inc. | Engineered CCL20 locked dimer polypeptide |
Also Published As
Publication number | Publication date |
---|---|
US7390619B1 (en) | 2008-06-24 |
US20070087373A1 (en) | 2007-04-19 |
US20070087374A1 (en) | 2007-04-19 |
US20050222069A1 (en) | 2005-10-06 |
US20050064464A1 (en) | 2005-03-24 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO1999041368A2 (en) | Optimization of immunomodulatory properties of genetic vaccines | |
US20070087374A1 (en) | Optimization of immunomodulatory properties of genetic vaccines | |
US11008378B2 (en) | Compositions and methods for immunomodulation in an organism | |
CA2325351C (en) | Non-stochastic generation of genetic vaccines and enzymes | |
US20080019988A1 (en) | Targeting of genetic vaccine vectors | |
US20010006950A1 (en) | Genetic vaccine vector engineering | |
JP2004513878A (en) | Novel costimulatory molecules | |
WO2022067062A1 (en) | Rapid development of prophylactic broad spectrum vaccine for sars-cov-2 using phage mediated antigen delivery system | |
EP1518927A2 (en) | Optimization of immunomodulatory properties of genetic vaccines | |
AU2761302A (en) | Optimization of immunomodulatory properties of genetic vaccines | |
EP1181320B1 (en) | Somatic transgene immunization and related methods | |
WO2004004742A1 (en) | Improved gm-csf nucleic acid sequences | |
US20050277127A1 (en) | High-throughput method of DNA immunogen preparation and immunization | |
CA2492661C (en) | Non-stochastic generation of genetic vaccines and enzymes | |
AU2757902A (en) | Genetic vaccine vector engineering | |
AU2767702A (en) | Targeting of genetic vaccine vectors | |
Mažeikė | Generation of anticancer vaccine based on virus-like particles |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |