US20050129679A1 - Method for opening tight junctions - Google Patents
Method for opening tight junctions Download PDFInfo
- Publication number
- US20050129679A1 US20050129679A1 US11/009,868 US986804A US2005129679A1 US 20050129679 A1 US20050129679 A1 US 20050129679A1 US 986804 A US986804 A US 986804A US 2005129679 A1 US2005129679 A1 US 2005129679A1
- Authority
- US
- United States
- Prior art keywords
- protein
- sina
- nucleic acid
- jam
- claudin
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0043—Nose
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
- C12N15/1138—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against receptors or cell surface proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/14—Type of nucleic acid interfering N.A.
Definitions
- a major disadvantage of drug administration by injection is that trained personnel are often required to administer the drug. For self-administered drugs, many patients are reluctant or unable to give themselves injections on a regular basis. Injection is also associated with increased risks of infection. Other disadvantages of drug injection include variability of delivery results between individuals, as well as unpredictable intensity and duration of drug action.
- Mucosal administration of therapeutic compounds may offer certain advantages over injection and other modes of administration, for example in terms of convenience and speed of delivery, as well as by reducing or elimination compliance problems and side effects that attend delivery by injection.
- mucosal delivery of biologically active agents is limited by mucosal barrier functions and other factors. For these reasons, mucosal drug administration typically requires larger amounts of drug than administration by injection.
- Other therapeutic compounds, including large molecule drugs, peptides and proteins, are often refractory to mucosal delivery.
- mucosal sites In addition to their poor intrinsic permeability, large macromolecular drugs, including proteins and peptides, are often subject to limited diffusion, as well as lumenal and cellular enzymatic degradation and rapid clearance at mucosal sites. These mucosal sites generally serve as a first line of host defense against pathogens and other adverse environmental agents that come into contact with the mucosal surface. Mucosal tissues provide a substantial barrier to the free diffusion of macromolecules, while enzymatic activities present in mucosal secretions can severely limit the bioavailability of therapeutic agents, particularly peptides and proteins. At certain mucosal sites, such as the nasal mucosa, the typical residence time of proteins and other macromolecular species delivered is limited, e.g., to about 15-30 minutes or less, due to rapid mucociliary clearance.
- FIG. 1 Screening siRNAs against TJ proteins identifies those that affect TER. Three siRNAs against each TJ protein expressed in respiratory cells were designed and chemically synthesized. The effects on TER were monitored before and after transfections. The figure is an example of the screening of siRNAs against CLDN 12 and JAM-1. The siRNA against CLDN 4 was used as a positive control. The best candidates showing maximum effect were used for determining the extent of mRNA reduction by the bDNA method.
- FIG. 2 Time Course of Specific siRNAs and Lipofectamine alone (blank) on TER.
- A The percent of TER, normalized against control siRNA at each time point. Effects of the transfection reagent (lipofectamine) on TER can be corrected.
- B Although the negative effects on TER by transfection procedure and reagents (blank) are observed, the TER value returns to normal after 3-4 days of transfection.
- FIG. 3 Transfection of Selected siRNAs against TJ Targets Decreases TER. 16HBE14 cells were grown on 12-well inserts for 3 days prior to transfection (80 pmol/insert). TER values measured at day 4 after transfection were near the optimal time point of TER recovery after transfection.
- FIG. 4 CLDN 4 Knockdown Decreases TER.
- A Epithelial cells were grown on 12-well inserts to the stage where tight junctions formed as indicated by values for transepithelial-electrical resistance (TER). siRNAs against claudins 4 and 12 and a negative control (80 pmol/each) were used individually to transfect cell monolayers.
- B Epithelial cells were grown in 6-well plates to 50% confluence followed by transfections with siRNA against claudin 4 and a negative control. TER values before day 9 are not shown since TER does not significantly develop until a mono-layer is established and tight junctions are formed.
- FIG. 5 Knockdown of Either CLDN 1 or 12 with CLDN 4 Decreases TER. Results indicate that 1 ⁇ 2 dose (40 pmol) did not show any significant effects on TER for any siRNA alone, while higher dose (80 pmol) of siRNA against CLDN 4 yields a knockdown effect. The effects of equal amounts of CLDN 4 and CLDN 1 (40 pmol each) is similar to 80-pmol of siRNA against CLDN 4 alone, while siRNA combinations with CLDN 12 (generally ineffective at any dose) have little effect.
- FIG. 6 Knockdown of Either CLDN 4 or 12 with JAM-1 Decreases TER. Results indicate that 1 ⁇ 2 dose (40 pmol) did not show any significant effects on TER for any siRNA alone, while higher dose (80 pmol) siRNA against CLDN 4 yields a knocking down effect. The effects of equal amount of CLDN 4 and JAM 1(40 pmol each) is similar with 80-pmol of siRNA against CLDN 4 alone, while pairing with siRNA against CLDN 12 (generally ineffective at any dose) has little effect.
- FIG. 7 Increased Dextran Permeability in siRNA Transfected Cells Correlates with Decreases in TER. Permeability assays were conducted on day 5 after transfection of 16HBE14o- Cell Inserts with siRNAs against indicated targets, using FITC-dextran, MW 4,400 in MEM/f12 media. The changes in permeability correlated well with changes in TER values ( FIG. 6 ).
- FIG. 8 Knockdown of Either CLDN 4 or 12 and Occludin Decreases TER. Results indicate that 1 ⁇ 2 dose (40 pmol) did not show any significant effects on TER for any siRNA alone (see FIGS. 5 and 6 ), while higher dose (80 pmol) siRNA against CLDN 4 yields a knockdown effect.
- the effects of equal amounts of CLDN 4 and occludin (40 pmol each) is similar to 80 pmol of siRNA against CLDN 4 alone, while combination with siRNA against CLDN 12 (generally ineffective at any dose) has little effect.
- compositions are antagonists to either the extracellular domain of the JAM-1protein or the extracellular domain of the claudin-4 protein or the extracellular domain of the occludin protein.
- examples of these are antibodies, antibody fragments and single chain antibodies that bind to either junctional adhesion molecule- I (JAM-1), occludin or claudin-4.
- the permeabilizing agent reversibly enhances mucosal epithelial paracellular transport, typically by modulating epithelial junctional structure and/or physiology at a mucosal epithelial surface in the subject.
- This effect typically involves inhibition by the permeabilizing agent of homotypic or heterotypic binding between epithelial membrane adhesive proteins of neighboring epithelial cells.
- small interfering nucleic acids can be used to downregulate the peptides through the mechanism of RNA interference as described below and thus open the tight junctions.
- Epithelial cells provide a crucial interface between the external environment and mucosal and submucosal tissues and extracellular compartments.
- One of the most important functions of mucosal epithelial cells is to determine and regulate mucosal permeability.
- epithelial cells create selective permeability barriers between different physiological compartments. Selective permeability is the result of regulated transport of molecules through the cytoplasm (the transcellular pathway) and the regulated permeability of the spaces between the cells (the paracellular pathway).
- TJ tight junction
- Tight junctions form continuous circumferential intercellular contacts between epithelial cells and create a regulated barrier to the paracellular movement of water, solutes, and immune cells. They also provide a second type of barrier that contributes to cell polarity by limiting exchange of membrane lipids between the apical and basolateral membrane domains.
- Tight junctions are thought to be directly involved in barrier and fence functions of epithelial cells by creating an intercellular seal to generate a primary barrier against the diffusion of solutes through the paracellular pathway, and by acting as a boundary between the apical and basolateral plasma membrane domains to create and maintain cell polarity, respectively. Tight junctions are also implicated in the transmigration of leukocytes to reach inflammatory sites. In response to chemo-attractants, leukocytes emigrate from the blood by crossing the endothelium and, in the case of mucosal infections, cross the inflamed epithelium. Transmigration occurs primarily along the paracellular rout and appears to be regulated via opening and closing of tight junctions in a highly coordinated and reversible manner.
- JAMs junctional adhesion molecules
- JAMs, occludin, and claudin extend into the paracellular space, and these proteins in particular have been contemplated as candidates for creating an epithelial barrier between adjacent epithelial cells and channels through epithelial cell layers.
- occludin, claudin, and JAM have been proposed to interact as homophilic binding partners to create a regulated barrier to paracellular movement of water, solutes, and immune cells between epithelial cells.
- JAM-1 murine junctional adhesion molecule-1
- the extracellular segment of the molecule comprises two Ig-like domains described as an amino terminal “VH-type” and a carboxy-terminal “C2-type” carboxy-terminal ⁇ -sandwich fold, Bazzoni et al., Microcirculation 8:143-152 (2001).
- Murine JAM-1 also contains two sites for N-glycosylation, and a cytoplasmic domain.
- the JAM-1 protein is a member of the immunoglobulin (Ig) superfamily and localizes to tight junctions of both epithelial and endothelial cells. Ultrastructural studies indicate that JAM-1 is limited to the membrane regions containing fibrils of occludin and claudin.
- JAM-1-encoding cDNA Transfection of a murine JAM-1-encoding cDNA into CHO cells leads to localization of the JAM-1 protein at cell-cell contacts, which only occurs in confluent monolayers when neighboring cells express JAM. In mixed cultures, where JAM transfectants are in contact with control transfectants, the protein remains diffuse—suggesting that JAM clustering is due to homophilic interaction, Martin-Padura, et al., J Cell Biol 142: 117-127 (1998).
- JAM-1 can mediate homotypic adhesion and influence monocyte transmigration via heterotypic adhesive and de-adhesive interactions.
- a monoclonal antibody against murine JAM-1 inhibits transmigration of leukocytes across endothelial cells and in an in vivo model of skin inflammatory reaction, Martin-Padura, et al., J Cell Biol 142: 117-127 (1998).
- Anti-murine JAM-1 antibodies also inhibit accumulation of leukocytes in the cerebrospinal fluid in cytokine-induced meningitis. It is unknown how these effects are mediated.
- the antibodies may inhibit a heterotypic interaction between JAM-1 and a leukocyte receptor, Del Maschio et al., J.
- the anti-JAM-1 antibodies may stabilize a homophilic JAM-mediated interaction between neighboring cells and thereby inhibit dissociation of the junctional complex, Balda et al., Cell Devel. Biol. 11: 281-289 (2000).
- JAM-1 activity proposes that an extracellular domain of JAM-1 is involved in intercellular adhesive interactions. Formation of JAM-1 dimers is thought to be due to stable and noncovalent interactions. Dissociation of JAM-1 dimers into monomeric subunits is reported at high ionic strength and acidic pH. In this general model, JAM-1 dimers are hypothesized to act as building blocks for JAM-1-dependent homophilic adhesion. In particular, JAM-1 may dimerize in cis-interactions yielding parallel homodimers positioned at one cell surface, and the cis-dimerization might expose an interface available for homophilic adhesive interactions between JAM-1 molecules on opposing cell surfaces.
- JAM-1 dimers expressed on transmigrating leukocytes are proposed to interact with JAM-1 dimers expressed on endothelial cells, thus accounting for the adhesion and de-adhesion events that occur during leukocyte transendothelial migration, Dejana, et al., Throb. Haemost. 86: 308-315 (2001).
- the putative extracellular domain of human JAM-1 was recently expressed as a fusion protein to generate anti-human JAM-1 antibodies that inhibited transepithelial resistance recovery (TER) in T84 cell monolayers after tight junction disruption mediated by transient calcium depletion, Liu et al., J. Cell. Sci. 113:2363-2374 (2000).
- the anti-JAM antibodies inhibit JAM-1 and occludin redistribution to TJs following calcium mediated disruption.
- these authors report that purified recombinant human JAM-1 containing the extracellular domain does not inhibit TER after tight junction disruption, contrary to published results for murine JAM-1.
- MGTKAQVERKLLCLFILAILLCSLALG SVTVH (SEQ ID NO: 1) SSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGD TTRLVCYNNKITASYEDRVTFLPTGITFKSVTREDT GTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIP SSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTN PKSTRAFSNSSYVLNPTTGELVFDPLSASDTGEYSC EARNGYGTPMTSNAVRMEAVERNVGVI VAAVLVTLI LLGILVFGIWFAYSRGHFDRTKKGTSSKKVIYSQPS ARSEGEFKQTSSFLV
- Human Claudin-4 209 amino acids MASMGLQVMGIALAVLGWLAVMLCCALPMW RVTAFI (SEQ ID NO: 2) GSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLA LPQDLQAAR ALVIISIIVAALGVLLSVVGGKCTNCL EDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNII QDFYNPLVASGQKRE MGASLYVGWAASGLLLLGGGL LCCNCPPRTDKPYSAKYSAARSAAASNYV
- the invention also provides diagnostic and therapeutic antibodies, including monoclonal antibodies, directed against a JAM, occludin or claudin peptide or protein, including antibodies against specific portions or domains (e.g., a homotypic binding interface) of a JAM, occludin or claudin protein.
- the antibodies specifically recognize functional portions of the JAM, occludin or claudin protein, and are therefore useful for blocking interactions between these proteins, or permeabilizing mucosal epithelial target cells when administered in vivo.
- immunotherapeutic reagents may include humanized antibodies, and can be combined for therapeutic use with additional active or inert ingredients as disclosed herein, e.g., in conventional pharmaceutically acceptable carriers or diluents, e.g., immunogenic adjuvants, and optionally with adjunctive or combinatorially active agents such as antiretroviral drugs.
- additional active or inert ingredients as disclosed herein, e.g., in conventional pharmaceutically acceptable carriers or diluents, e.g., immunogenic adjuvants, and optionally with adjunctive or combinatorially active agents such as antiretroviral drugs.
- Methods for generating functional antibodies, including humanized antibodies, antibody fragments, and other related agents are well known in the art (see, e.g., Harlow & Lane, Antibodies, A Laboratory Manual, (CSHP, NY, 1988); Queen et al., Proc. Natl. Acad. Sci. USA 86:10029-10033 (1989) and WO 90/07861.
- Human antibodies can be obtained using phage-display methods (see, e.g., Dower et al., WO 91/17271; McCafferty et al., WO 92/01047).
- methods for producing active antibody fragments are well known, including methods for generating separate heavy chains, light chains Fab, Fab′ F(ab′)2, Fv, and single chain antibodies.
- Fragments can be produced by enzymatic or chemical separation of intact immunoglobulins using standard methods. Fab fragments may be obtained from F(ab′)2 fragments by limited reduction, or from whole antibody by digestion with papain in the presence of reducing agents. Fragments can also be produced by recombinant DNA techniques.
- Segments of nucleic acids encoding selected fragments are produced by digestion of full-length coding sequences with restriction enzymes, or by de novo synthesis. Often fragments are expressed in the form of phage-coat fusion proteins. This manner of expression is advantageous for affinity-sharpening of antibodies.
- RNA interference refers to the process of sequence-specific post-transcriptional gene silencing in animals mediated by short interfering nucleic acids (siNAs), which are usually short interfering RNAs (siRNA).
- siNAs short interfering nucleic acids
- shiRNA short interfering RNAs
- dsRNAs double-stranded RNAs
- dsRNAs short interfering RNAs
- short interfering RNAs Short interfering RNAs derived from dicer activity are typically about 21 to about 23 nucleotides in length and comprise about 19 base pair duplexes [Hamilton et al., supra; Elbashir et al., Genes Dev., 15: 188 (2001)].
- RNA-induced silencing complex RNA-induced silencing complex
- RISC RNA-induced silencing complex
- RISC will then incorporate one strand into its complex, which strand will hybridize to a target mRNA and the RISC will hydrolyze or cleave the target mRNA at the site where the antisense strand is bound. Cleavage of the target RNA takes place in the middle of the region complementary to the antisense strand of the siRNA duplex [Elbashir et al., 2001, Genes Dev., 15, 188 (2001)].
- Nucleic acid molecules that act as mediators of the RNA interference gene silencing response are double-stranded nucleic acid molecules.
- the double-stranded nucleic acids are generally double-stranded RNA, however, the strands can contain one or more deoxyribonucleotides. The more precise term would be to call the RNAi mediators, small interfering nucleic acids or ‘siNA’.
- the siNA molecules are comprised of duplexes containing about 19 base pairs between oligonucleotides comprising about 19 to about 25 (e.g., about 19, 20, 21, 22, 23, 24 or 25) nucleotides.
- the siNA molecules may also be comprised of duplexes with overhanging ends of about 1 to about 3 (e.g., about 1, 2, or 3) nucleotides, for example, about 21-nucleotide duplexes with about 19 base pairs and 3′-terminal mononucleotide, dinucleotide, or trinucleotide overhangs.
- about 1 to about 3 e.g., about 1, 2, or 3
- nucleotides for example, about 21-nucleotide duplexes with about 19 base pairs and 3′-terminal mononucleotide, dinucleotide, or trinucleotide overhangs.
- Non-limiting examples of chemical modifications that can be made in an siNA include without limitation phosphorothioate internucleotide linkages, 2′-deoxyribonucleotides, 2′-O-methyl ribonucleotides, 2′-deoxy-2′-fluoro ribonucleotides, “universal base” nucleotides, “acyclic” nucleotides, 5-C-methyl nucleotides, and terminal glyceryl and/or inverted deoxy abasic residue incorporation.
- These chemical modifications, when used in various siNA constructs, are shown to preserve RNAi activity in cells while at the same time, dramatically increasing the serum stability of these compounds.
- a composition comprising a siNA molecule may be in a pharmaceutically acceptable carrier or diluent.
- the introduction of chemically-modified nucleotides into nucleic acid molecules provides a powerful tool in overcoming potential limitations of in vivo stability and bioavailability inherent to native RNA molecules that are delivered exogenously.
- the use of chemically-modified nucleic acid molecules can enable a lower dose of a particular nucleic acid molecule for a given therapeutic effect since chemically-modified nucleic acid molecules tend to have a longer half-life in serum.
- certain chemical modifications can improve the bioavailability of nucleic acid molecules by targeting particular cells or tissues and/or improving cellular uptake of the nucleic acid molecule.
- the overall activity of the modified nucleic acid molecule can be greater than that of the native molecule due to improved stability and/or delivery of the molecule.
- chemically-modified siNA can also minimize the possibility of activating interferon activity in humans.
- the antisense region of a siNA molecule of the invention can comprise a phosphorothioate internucleotide linkage at the 3′-end of said antisense region.
- the antisense region can comprise about one to about five phosphorothioate internucleotide linkages at the 5′-end of said antisense region.
- the 3′-terminal nucleotide overhangs of a siNA molecule of the invention can comprise ribonucleotides or deoxyribonucleotides that are chemically-modified at a nucleic acid sugar, base, or backbone.
- the 3′-terminal nucleotide overhangs can comprise one or more universal base ribonucleotides. In any of the embodiments of siNA molecules described herein, the 3′-terminal nucleotide overhangs can comprise one or more acyclic nucleotides.
- the invention features a chemically-modified short interfering nucleic acid (siNA) having about 1, 2, 3, 4, 5, 6, 7, 8 or more phosphorothioate internucleotide linkages in one siNA strand.
- the invention features a chemically-modified short interfering nucleic acid (siNA) individually having about 1, 2, 3, 4, 5, 6, 7, 8 or more phosphorothioate internucleotide linkages in both siNA strands.
- the phosphorothioate internucleotide linkages can be present in one or both oligonucleotide strands of the siNA duplex, for example in the sense strand, the antisense strand, or both strands.
- the siNA molecules of the invention can comprise one or more phosphorothioate internucleotide linkages at the 3′-end, the 5′-end, or both of the 3′- and 5′-ends of the sense strand, the antisense strand, or both strands.
- an exemplary siNA molecule of the invention can comprise about 1 to about 5 or more (e.g., about 1, 2, 3, 4, 5, or more) consecutive phosphorothioate internucleotide linkages at the 5′-end of the sense strand, the antisense strand, or both strands.
- an exemplary siNA molecule of the invention can comprise one or more (e.g., about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more) pyrimidine phosphorothioate internucleotide linkages in the sense strand, the antisense strand, or both strands.
- an exemplary siNA molecule of the invention can comprise one or more (e.g., about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more) purine phosphorothioate internucleotide linkages in the sense strand, the antisense strand, or both strands.
- An siNA molecule may be comprised of a circular nucleic acid molecule, wherein the siNA is about 38 to about 70 (e.g., about 38, 40, 45, 50, 55, 60, 65, or 70) nucleotides in length having about 18 to about 23 (e.g., about 18, 19, 20, 21, 22, or 23) base pairs wherein the circular oligonucleotide forms a dumbbell shaped structure having about 19 base pairs and 2 loops.
- the siNA is about 38 to about 70 (e.g., about 38, 40, 45, 50, 55, 60, 65, or 70) nucleotides in length having about 18 to about 23 (e.g., about 18, 19, 20, 21, 22, or 23) base pairs wherein the circular oligonucleotide forms a dumbbell shaped structure having about 19 base pairs and 2 loops.
- a circular siNA molecule contains two loop motifs, wherein one or both loop portions of the siNA molecule is biodegradable.
- a circular siNA molecule of the invention is designed such that degradation of the loop portions of the siNA molecule in vivo can generate a double-stranded siNA molecule with 3′-terminal overhangs, such as 3′-terminal nucleotide overhangs comprising about 2 nucleotides.
- Modified nucleotides present in siNA molecules preferably in the antisense strand of the siNA molecules, but also optionally in the sense and/or both antisense and sense strands, comprise modified nucleotides having properties or characteristics similar to naturally occurring ribonucleotides.
- the invention features siNA molecules including modified nucleotides having a Northern conformation (e.g., Northern pseudorotation cycle, see for example Saenger, Principles of Nucleic Acid Structure, Springer-Verlag ed., 1984).
- chemically modified nucleotides present in the siNA molecules of the invention preferably in the antisense strand of the siNA molecules of the invention, but also optionally in the sense and/or both antisense and sense strands, are resistant to nuclease degradation while at the same time maintaining the capacity to mediate RNAi.
- Non-limiting examples of nucleotides having a northern configuration include locked nucleic acid (LNA) nucleotides (e.g., 2′-O, 4′-C-methylene-(D-ribofuranosyl) nucleotides); 2′-methoxyethoxy (MOE) nucleotides; 2′-methyl-thio-ethyl, 2′-deoxy-2′-fluoro nucleotides. 2′-deoxy-2′-chloro nucleotides, 2′-azido nucleotides, and 2′-O-methyl nucleotides.
- LNA locked nucleic acid
- MOE 2′-methoxyethoxy
- the sense strand of a double stranded siNA molecule may have a terminal cap moiety such as an inverted deoxyabasic moiety, at the 3′-end, 5′-end, or both 3′ and 5′-ends of the sense strand.
- conjugates include conjugates and ligands described in Vargeese et al., U.S. patent application Ser. No. 10/427,160, filed Apr. 30, 2003, incorporated by reference herein in its entirety, including the drawings.
- the conjugate is covalently attached to the chemically-modified siNA molecule via a biodegradable linker.
- the conjugate molecule is attached at the 3′-end of either the sense strand, the antisense strand, or both strands of the chemically-modified siNA molecule.
- the conjugate molecule is attached at the 5′-end of either the sense strand, the antisense strand, or both strands of the chemically-modified siNA molecule. In yet another embodiment, the conjugate molecule is attached both the 3′-end and 5′-end of either the sense strand, the antisense strand, or both strands of the chemically-modified siNA molecule, or any combination thereof.
- a conjugate molecule of the invention comprises a molecule that facilitates delivery of a chemically-modified siNA molecule into a biological system, such as a cell.
- the conjugate molecule attached to the chemically-modified siNA molecule is a poly ethylene glycol, human serum albumin, or a ligand for a cellular receptor that can mediate cellular uptake.
- Examples of specific conjugate molecules contemplated by the instant invention that can be attached to chemically-modified siNA molecules are described in Vargeese et al., U.S. patent application Publication No. 20030130186, published Jul. 10, 2003, and U.S. patent application Publication No. 20040110296, published Jun. 10, 2004.
- the type of conjugates used and the extent of conjugation of siNA molecules of the invention can be evaluated for improved pharmacokinetic profiles, bioavailability, and/or stability of siNA constructs while at the same time maintaining the ability of the siNA to mediate RNAi activity.
- one skilled in the art can screen siNA constructs that are modified with various conjugates to determine whether the siNA conjugate complex possesses improved properties while maintaining the ability to mediate RNAi, for example in animal models as are generally known in the art.
- a siNA further may be further comprised of a nucleotide, non-nucleotide, or mixed nucleotide/non-nucleotide linker that joins the sense region of the siNA to the antisense region of the siNA.
- a nucleotide linker can be a linker of>2 nucleotides in length, for example about 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides in length.
- the nucleotide linker can be a nucleic acid aptamer.
- aptamer or “nucleic acid aptamer” as used herein is meant a nucleic acid molecule that binds specifically to a target molecule wherein the nucleic acid molecule has sequence that comprises a sequence recognized by the target molecule in its natural setting.
- an aptamer can be a nucleic acid molecule that binds to a target molecule where the target molecule does not naturally bind to a nucleic acid.
- the target molecule can be any molecule of interest.
- the aptamer can be used to bind to a ligand-binding domain of a protein, thereby preventing interaction of the naturally occurring ligand with the protein.
- a non-nucleotide linker may be comprised of an abasic nucleotide, polyether, polyamine, polyamide, peptide, carbohydrate, lipid, polyhydrocarbon, or other polymeric compounds (e.g. polyethylene glycols such as those having between 2 and 100 ethylene glycol units). Specific examples include those described by Seela and Kaiser, Nucleic Acids Res., 18:6353 (1990) and Nucleic Acids Res., 15:3113 (1987); Cload and Schepartz, J. Am. Chem. Soc., 113:6324 (1991); Richardson and Schepartz, J. Am. Chem.
- non-nucleotide further means any group or compound that can be incorporated into a nucleic acid chain in the place of one or more nucleotide units, including either sugar and/or phosphate substitutions, and allows the remaining bases to exhibit their enzymatic activity.
- the group or compound can be abasic in that it does not contain a commonly recognized nucleotide base, such as adenosine, guanine, cytosine, uracil or thymine, for example at the C1 position of the sugar.
- a commonly recognized nucleotide base such as adenosine, guanine, cytosine, uracil or thymine, for example at the C1 position of the sugar.
- the synthesis of a siNA molecule of the invention comprises: (a) synthesis of two complementary strands of the siNA molecule; (b) annealing the two complementary strands together under conditions suitable to obtain a double-stranded siNA molecule.
- synthesis of the two complementary strands of the siNA molecule is by solid phase oligonucleotide synthesis.
- synthesis of the two complementary strands of the siNA molecule is by solid phase tandem oligonucleotide synthesis.
- Oligonucleotides are synthesized using protocols known in the art, for example as described in Caruthers et al., 1992, Methods in Enzymology 211, 3-19, Thompson et al., International PCT Publication No. WO 99/54459, Wincott et al., 1995, Nucleic Acids Res. 23, 2677-2684, Wincott et al., 1997, Methods Mol. Bio., 74, 59, Brennan et al., 1998, Biotechnol Bioeng., 61, 33-45, and Brennan, U.S. Pat. No.
- RNA including certain siNA molecules of the invention follows the procedure as described in Usman et al., 1987, J. Am. Chem. Soc., 109, 7845; Scaringe et al., 1990, Nucleic Acids Res., 18, 5433; and Wincott et al., 1995, Nucleic Acids Res. 23, 2677-2684 Wincott et al., 1997, Methods Mol. Bio., 74, 59.
- nucleic acid molecules Methods for the delivery of nucleic acid molecules are described in Akhtar et al., Trends Cell Bio., 2, 139 (1992); Delivery Strategies for Antisense Oligonucleotide Therapeutics, ed. Akhtar, 1995, Maurer et al., Mol. Membr. Biol., 16: 129-140 (1999); Hofland and Huang, Handb. Exp. Pharmacol., 137: 165-192 (1999); and Lee et al., ACS Symp. Ser., 752: 184-192 (2000), Sullivan et al., PCT WO 94/02595, further describes the general methods for delivery of enzymatic nucleic acid molecules.
- Nucleic acid molecules can be administered to cells by a variety of methods known to those of skill in the art, including, but not restricted to, encapsulation in liposomes, by iontophoresis, or by incorporation into other vehicles, such as hydrogels, cyclodextrins, biodegradable nanocapsules, and bioadhesive microspheres, or by proteinaceous vectors (O'Hare and Normand, International PCT Publication No. WO 00/53722).
- the nucleic acid/vehicle combination is locally delivered by direct injection or by use of an infusion pump.
- nucleic acid molecules of the invention can take place using standard needle and syringe methodologies, or by needle-free technologies such as those described in Conry et al., Clin. Cancer Res., 5: 2330-2337 (1999) and Barry et al., International PCT Publication No. WO 99/31262.
- the molecules of the instant invention can be used as pharmaceutical agents. Pharmaceutical agents prevent, modulate the occurrence, or treat (alleviate a symptom to some extent, preferably all of the symptoms) of a disease state in a patient.
- the invention features a pharmaceutical composition
- a pharmaceutical composition comprising one or more nucleic acid(s) of the invention in an acceptable carrier, such as a stabilizer, buffer, and the like.
- the negatively charged polynucleotides of the invention can be administered (e.g., RNA, DNA or protein) and introduced into a patient by any standard means, with or without stabilizers, buffers, and the like, to form a pharmaceutical composition.
- standard protocols for formation of liposomes can be followed.
- the compositions of the present invention may also be formulated and used as tablets, capsules or elixirs for oral administration, suppositories for rectal administration, sterile solutions, suspensions for injectable administration, and the other compositions known in the art.
- the present invention also includes pharmaceutically acceptable formulations of the compounds described.
- formulations include salts of the above compounds, e.g., acid addition salts, for example, salts of hydrochloric, hydrobromic, acetic acid, and benzene sulfonic acid.
- a pharmacological composition or formulation refers to a composition or formulation in a form suitable for administration, e.g., systemic administration, into a cell or patient, including for example a human. Suitable forms, in part, depend upon the use or the route of entry, for example oral, transdermal, or by injection. Such forms should not prevent the composition or formulation from reaching a target cell (i.e., a cell to which the negatively charged nucleic acid is desirable for delivery). For example, pharmacological compositions injected into the blood stream should be soluble. Other factors are known in the art, and include considerations such as toxicity and forms that prevent the composition or formulation from exerting its effect.
- systemic administration in vivo systemic absorption or accumulation of drugs in the blood stream followed by distribution throughout the entire body.
- Administration routes which lead to systemic absorption include, without limitation: intravenous, subcutaneous, intraperitoneal, inhalation, oral, intrapulmonary and intramuscular.
- Each of these administration routes expose the desired negatively charged polymers, e.g., nucleic acids, to an accessible diseased tissue.
- the rate of entry of a drug into the circulation has been shown to be a function of molecular weight or size.
- the use of a liposome or other drug carrier comprising the compounds of the instant invention can potentially localize the drug, for example, in certain tissue types, such as the tissues of the reticular endothelial system (RES).
- RES reticular endothelial system
- a liposome formulation that can facilitate the association of drug with the surface of cells, such as, lymphocytes and macrophages is also useful. This approach may provide enhanced delivery of the drug to target cells by taking advantage of the specificity of macrophage and lymphocyte immune recognition of abnormal cells, such as cancer cells.
- compositions or formulation that allows for the effective distribution of the nucleic acid molecules of the instant invention in the physical location most suitable for their desired activity.
- agents suitable for formulation with the nucleic acid molecules of the instant invention include: P-glycoprotein inhibitors (such as Pluronic P85), which can enhance entry of drugs into the CNS [Jolliet-Riant and Tillement, Fundam. Clin.
- biodegradable polymers such as poly (DL-lactide-coglycolide) microspheres for sustained release delivery after intracerebral implantation (Emerich, D F et al., Cell Transplant, 8: 47-58 (1999)] (Alkermes, Inc. Cambridge, Mass.); and loaded nanoparticles, such as those made of polybutylcyanoacrylate, which can deliver drugs across the blood brain barrier and can alter neuronal uptake mechanisms ( Prog Neuropsychopharmacol Biol Psychiatry, 23: 941-949, (1999)].
- delivery strategies for the nucleic acid molecules of the instant invention include material described in Boado et al., J.
- compositions prepared for storage or administration which include a pharmaceutically effective amount of the desired compounds in a pharmaceutically acceptable carrier or diluent.
- Acceptable carriers or diluents for therapeutic use are well known in the pharmaceutical art, and are described, for example, in Remington's Pharmaceutical Sciences, Mack Publishing Co. (A. R. Gennaro edit. 1985).
- preservatives, stabilizers, dyes and flavoring agents may be provided. These include sodium benzoate, sorbic acid and esters of p-hydroxybenzoic acid.
- antioxidants and suspending agents may be used.
- a pharmaceutically effective dose is that dose required to prevent, inhibit the occurrence of, or treat (alleviate a symptom to some extent, preferably all of the symptoms) a disease state.
- the pharmaceutically effective dose depends on the type of disease, the composition used, the route of administration, the type of mammal being treated, the physical characteristics of the specific mammal under consideration, concurrent medication, and other factors that those skilled in the medical arts will recognize. Generally, an amount between 0.1 mg/kg and 100 mg/kg body weight/day of active ingredients is administered dependent upon potency of the negatively charged polymer.
- Aqueous suspensions contain the active materials in admixture with excipients suitable for the manufacture of aqueous suspensions.
- excipients are suspending agents, for example sodium carboxymethylcellulose, methylcellulose, hydropropyl-methylcellulose, sodium alginate, polyvinylpyrrolidone, gum tragacanth and gum acacia; dispersing or wetting agents can be a naturally-occurring phosphatide, for example, lecithin, or condensation products of an alkylene oxide with fatty acids, for example polyoxyethylene stearate, or condensation products of ethylene oxide with long chain aliphatic alcohols, for example heptadecaethyleneoxycetanol, or condensation products of ethylene oxide with partial esters derived from fatty acids and a hexitol such as polyoxyethylene sorbitol monooleate, or condensation products of ethylene oxide with partial esters derived from fatty acids and hexitol anhydrides, for example polyethylene sorbitan monoole
- the aqueous suspensions can also contain one or more preservatives, for example ethyl, or n-propyl p-hydroxybenzoate, one or more coloring agents, one or more flavoring agents, and one or more sweetening agents, such as sucrose or saccharin.
- preservatives for example ethyl, or n-propyl p-hydroxybenzoate
- coloring agents for example ethyl, or n-propyl p-hydroxybenzoate
- flavoring agents for example ethyl, or n-propyl p-hydroxybenzoate
- sweetening agents such as sucrose or saccharin.
- Oily suspensions can be formulated by suspending the active ingredients in a vegetable oil, for example arachis oil, olive oil, sesame oil or coconut oil, or in a mineral oil such as liquid paraffin.
- the oily suspensions can contain a thickening agent, for example beeswax, hard paraffin or cetyl alcohol.
- Sweetening agents and flavoring agents can be added to provide palatable oral preparations.
- These compositions can be preserved by the addition of an anti-oxidant such as ascorbic acid.
- Dispersible powders and granules suitable for preparation of an aqueous suspension by the addition of water provide the active ingredient in admixture with a dispersing or wetting agent, suspending agent and one or more preservatives.
- a dispersing or wetting agent e.g., glycerol, glycerol, glycerol, glycerol, glycerol, glycerol, glycerin, glycerin, glycerin, glycerin, glycerin, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, glycerol, glycerol, glycerol, glycerol, glycerol, glycerol, glycerol, glycerol, glycerol
- compositions of the invention can also be in the form of oil-in-water emulsions.
- the oily phase can be a vegetable oil or a mineral oil or mixtures of these.
- Suitable emulsifying agents can be naturally-occurring gums, for example gum acacia or gum tragacanth, naturally-occurring phosphatides, for example soy bean, lecithin, and esters or partial esters derived from fatty acids and hexitol, anhydrides, for example sorbitan monooleate, and condensation products of the said partial esters with ethylene oxide, for example polyoxyethylene sorbitan monooleate.
- the emulsions can also contain sweetening and flavoring agents.
- the pharmaceutical compositions can be in the form of a sterile injectable aqueous or oleaginous suspension.
- This suspension can be formulated according to the known art using those suitable dispersing or wetting agents and suspending agents that have been mentioned above.
- the sterile injectable preparation can also be a sterile injectable solution or suspension in a non-toxic parentally acceptable diluent or solvent, for example as a solution in 1,3-butanediol.
- the acceptable vehicles and solvents that can be employed are water, Ringer's solution and isotonic sodium chloride solution.
- sterile, fixed oils are conventionally employed as a solvent or suspending medium.
- any bland fixed oil can be employed including synthetic mono-or diglycerides.
- fatty acids such as oleic acid find use in the preparation of injectables.
- the siNAs can also be administered in the form of suppositories, e.g., for rectal administration of the drug.
- suppositories e.g., for rectal administration of the drug.
- These compositions can be prepared by mixing the drug with a suitable non-irritating excipient that is solid at ordinary temperatures but liquid at the rectal temperature and will therefore melt in the rectum to release the drug.
- suitable non-irritating excipient that is solid at ordinary temperatures but liquid at the rectal temperature and will therefore melt in the rectum to release the drug.
- Such materials include cocoa butter and polyethylene glycols.
- siNAs can be modified extensively to enhance stability by modification with nuclease resistant groups, for example, 2′-amino, 2′-C-allyl, 2′-fluoro, 2′-O-methyl, 2′-H.
- nuclease resistant groups for example, 2′-amino, 2′-C-allyl, 2′-fluoro, 2′-O-methyl, 2′-H.
- SiNA constructs can be purified by gel electrophoresis using general methods or can be purified by high pressure liquid chromatography and re-suspended in water.
- oligonucleotides are modified to enhance stability and/or enhance biological activity by modification with nuclease resistant groups, for example, 2′-amino, 2′-C-allyl, 2′-fluoro, 2′-O-methyl, 2′-O-allyl, 2′-H, nucleotide base modifications.
- nuclease resistant groups for example, 2′-amino, 2′-C-allyl, 2′-fluoro, 2′-O-methyl, 2′-O-allyl, 2′-H, nucleotide base modifications.
- the invention features modified siNA molecules, with phosphate backbone modifications comprising one or more phosphorothioate, phosphorodithioate, methylphosphonate, phosphotriester, morpholino, amidate carbamate, carboxymethyl, acetamidate, polyamide, sulfonate, sulfonamide, sulfamate, formacetal, thioformacetal, and/or alkylsilyl, substitutions.
- phosphate backbone modifications comprising one or more phosphorothioate, phosphorodithioate, methylphosphonate, phosphotriester, morpholino, amidate carbamate, carboxymethyl, acetamidate, polyamide, sulfonate, sulfonamide, sulfamate, formacetal, thioformacetal, and/or alkylsilyl, substitutions.
- Nucleic acid molecules can be administered to cells by a variety of methods known to those of skill in the art, including, but not restricted to, encapsulation in liposomes, by iontophoresis, or by incorporation into other vehicles, such as biodegradable polymers, hydrogels, cyclodextrins (see for example Gonzalez et al., Bioconjugate Chem., 10: 1068-1074 (1999); Wang et al., International PCT publication Nos.
- WO 03/47518 and WO 03/46185 poly(lactic-co-glycolic)acid (PLGA) and PLCA microspheres (see for example U.S. Pat. No. 6,447,796 and U.S. patent application Publication No. US 2002130430), biodegradable nanocapsules, and bioadhesive microspheres, or by proteinaceous vectors (O'Hare and Normand, International PCT Publication No. WO 00/53722).
- the nucleic acid/vehicle combination is locally delivered by direct injection or by use of an infusion pump.
- nucleic acid molecules of the invention can take place using standard needle and syringe methodologies, or by needle-free technologies such as those described in Conry et al., Clin. Cancer Res., 5: 2330-2337 (1999) and Barry et al., International PCT Publication No. WO 99/31262.
- the molecules of the instant invention can be used as pharmaceutical agents. Pharmaceutical agents prevent, modulate the occurrence, or treat (alleviate a symptom to some extent, preferably all of the symptoms) of a disease state in a subject.
- short interfering nucleic acid refers to any nucleic acid molecule capable of inhibiting or down regulating gene expression or viral replication, for example by mediating RNA interference “RNAi” or gene silencing in a sequence-specific manner
- siNA can be a double-stranded polynucleotide molecule comprising self-complementary sense and antisense regions, wherein the antisense region comprises nucleotide sequence that is complementary to nucleotide sequence in a target nucleic acid molecule or a portion thereof and the sense region having nucleotide sequence corresponding to the target nucleic acid sequence or a portion thereof.
- the siNA can be assembled from two separate oligonucleotides, where one strand is the sense strand and the other is the antisense strand, wherein the antisense and sense strands are self-complementary (i.e. each strand comprises nucleotide sequence that is complementary to nucleotide sequence in the other strand; such as where the antisense strand and sense strand form a duplex or double stranded structure, for example wherein the double stranded region is about 19 base pairs); the antisense strand comprises nucleotide sequence that is complementary to nucleotide sequence in a target nucleic acid molecule or a portion thereof and the sense strand comprises nucleotide sequence corresponding to the target nucleic acid sequence or a portion thereof.
- the siNA is assembled from a single oligonucleotide, where the self-complementary sense and antisense regions of the siNA are linked by means of a nucleic acid based or non-nucleic acid-based linker(s).
- the siNA can be a polynucleotide with a duplex, asymmetric duplex, hairpin or asymmetric hairpin secondary structure, having self-complementary sense and antisense regions, wherein the antisense region comprises nucleotide sequence that is complementary to nucleotide sequence in a separate target nucleic acid molecule or a portion thereof and the sense region having nucleotide sequence corresponding to the target nucleic acid sequence or a portion thereof.
- the siNA can be a circular single-stranded polynucleotide having two or more loop structures and a stem comprising self-complementary sense and antisense regions, wherein the antisense region comprises nucleotide sequence that is complementary to nucleotide sequence in a target nucleic acid molecule or a portion thereof and the sense region having nucleotide sequence corresponding to the target nucleic acid sequence or a portion thereof, and wherein the circular polynucleotide can be processed either in vivo or in vitro to generate an active siNA molecule capable of mediating RNAi.
- the siNA can also comprise a single stranded polynucleotide having nucleotide sequence complementary to nucleotide sequence in a target nucleic acid molecule or a portion thereof (for example, where such siNA molecule does not require the presence within the siNA molecule of nucleotide sequence corresponding to the target nucleic acid sequence or a portion thereof), wherein the single stranded polynucleotide can further comprise a terminal phosphate group, such as a 5′-phosphate (see for example Martinez et al., Cell., 110-563-574 (2002) and Schwarz et al., Molecular Cell, 10: 537-568(2002), or 5′,3′-diphosphate.
- a terminal phosphate group such as a 5′-phosphate
- the siNA molecule of the invention comprises separate sense and antisense sequences or regions, wherein the sense and antisense regions are covalently linked by nucleotide or non-nucleotide linkers molecules as is known in the art, or are alternately non-covalently linked by ionic interactions, hydrogen bonding, van der waals interactions, hydrophobic interactions, and/or stacking interactions.
- the siNA molecules of the invention comprise nucleotide sequence that is complementary to nucleotide sequence of a target gene.
- the siNA molecule of the invention interacts with nucleotide sequence of a target gene in a manner that causes inhibition of expression of the target gene.
- siNA molecules need not be limited to those molecules containing only RNA, but further encompasses chemically-modified nucleotides and non-nucleotides.
- the short interfering nucleic acid molecules of the invention lack 2′-hydroxy (2′-OH) containing nucleotides.
- short interfering nucleic acids do not require the presence of nucleotides having a 2′-hydroxy group for mediating RNAi and as such, short interfering nucleic acid molecules of the invention optionally do not include any ribonucleotides (e.g., nucleotides having a 2′-OH group).
- siNA molecules that do not require the presence of ribonucleotides within the siNA molecule to support RNAi can however have an attached linker or linkers or other attached or associated groups, moieties, or chains containing one or more nucleotides with 2′-OH groups.
- siNA molecules can comprise ribonucleotides at about 5, 10, 20, 30, 40, or 50% of the nucleotide positions.
- siNA is meant to be equivalent to other terms used to describe nucleic acid molecules that are capable of mediating sequence specific RNAi, for example short interfering RNA (siRNA), double-stranded RNA (dsRNA), micro-RNA (mRNA), short hairpin RNA (shRNA), short interfering oligonucleotide, short interfering nucleic acid, short interfering modified oligonucleotide, chemically-modified siRNA, post-transcriptional gene silencing RNA (ptgsRNA), and others.
- siRNA short interfering RNA
- dsRNA double-stranded RNA
- mRNA micro-RNA
- shRNA short hairpin RNA
- ptgsRNA post-transcriptional gene silencing RNA
- RNAi is meant to be equivalent to other terms used to describe sequence specific RNA interference, such as post transcriptional gene silencing, translational inhibition, or epigenetics.
- siNA molecules of the invention can be used to epigenetically silence genes at both the post-transcriptional level or the pre-transcriptional level.
- epigenetic regulation of gene expression by siNA molecules of the invention can result from siNA mediated modification of chromatin structure to alter gene expression.
- asymmetric hairpin as used herein is meant a linear siNA molecule comprising an antisense region, a loop portion that can comprise nucleotides or non-nucleotides, and a sense region that comprises fewer nucleotides than the antisense region to the extent that the sense region has enough complementary nucleotides to base pair with the antisense region and form a duplex with loop.
- an asymmetric hairpin siNA molecule of the invention can comprise an antisense region having length sufficient to mediate RNAi in a T-cell (e.g.
- the asymmetric hairpin siNA molecule can also comprise a 5′-terminal phosphate group that can be chemically modified.
- the loop portion of the asymmetric hairpin siNA molecule can comprise nucleotides, non-nucleotides, linker molecules, or conjugate molecules as described herein.
- asymmetric duplex as used herein is meant a siNA molecule having two separate strands comprising a sense region and an antisense region, wherein the sense region comprises fewer nucleotides than the antisense region to the extent that the sense region has enough complementary nucleotides to base pair with the antisense region and form a duplex.
- an asymmetric duplex siNA molecule of the invention can comprise an antisense region having length sufficient to mediate RNAi in a T-cell (e.g. about 19 to about 22 (e.g.
- nucleotides about 19, 20, 21, or 22 nucleotides
- sense region having about 3 to about 18 (e.g., about 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or 18) nucleotides that are complementary to the antisense region.
- modulate is meant that the expression of the gene, or level of RNA molecule or equivalent RNA molecules encoding one or more proteins or protein subunits, or activity of one or more proteins or protein subunits is up regulated or down regulated, such that expression, level, or activity is greater than or less than that observed in the absence of the modulator.
- modulate can mean “inhibit,” but the use of the word “modulate” is not limited to this definition.
- inhibitor By “inhibit”, “down-regulate”, or “reduce”, it is meant that the expression of the gene, or level of RNA molecules or equivalent RNA molecules encoding one or more proteins or protein subunits, or activity of one or more proteins or protein subunits, is reduced below that observed in the absence of the nucleic acid molecules (e.g., siNA) of the invention.
- inhibition, down-regulation or reduction with an siNA molecule is below that level observed in the presence of an inactive or attenuated molecule.
- inhibition, down-regulation, or reduction with siNA molecules is below that level observed in the presence of, for example, an siNA molecule with scrambled sequence or with mismatches.
- inhibition, down-regulation, or reduction of gene expression with a nucleic acid molecule of the instant invention is greater in the presence of the nucleic acid molecule than in its absence.
- highly conserved sequence region is meant, a nucleotide sequence of one or more regions in a target gene does not vary significantly from one generation to the other or from one biological system to the other.
- sense region is meant a nucleotide sequence of a siNA molecule having complementarity to an antisense region of the siNA molecule.
- the sense region of a siNA molecule can comprise a nucleic acid sequence having homology with a target nucleic acid sequence.
- antisense region is meant a nucleotide sequence of a siNA molecule having complementarity to a target nucleic acid sequence.
- the antisense region of a siNA molecule can optionally comprise a nucleic acid sequence having complementarity to a sense region of the siNA molecule.
- target nucleic acid is meant any nucleic acid sequence whose expression or activity is to be modulated.
- the target nucleic acid can be DNA or RNA.
- nucleic acid can form hydrogen bond(s) with another nucleic acid sequence by either traditional Watson-Crick or other non-traditional types.
- the binding free energy for a nucleic acid molecule with its complementary sequence is sufficient to allow the relevant function of the nucleic acid to proceed, e.g., RNAi activity. Determination of binding free energies for nucleic acid molecules is well known in the art [see, e.g., Turner et al., CSH Symp. Quant. Biol. LII pp.123-133 (1987); Frier et al., Proc. Nat. Acad. Sci.
- a percent complementarity indicates the percentage of contiguous residues in a nucleic acid molecule that can form hydrogen bonds (e.g., Watson-Crick base pairing) with a second nucleic acid sequence (e.g., 5, 6, 7, 8, 9, or 10 nucleotides out of a total of 10 nucleotides in the first oligonucleotide being based paired to a second nucleic acid sequence having 10 nucleotides represents 50%, 60%, 70%, 80%, 90%, and 100% complementary respectively).
- Perfectly complementary means that all the contiguous residues of a nucleic acid sequence will hydrogen bond with the same number of contiguous residues in a second nucleic acid sequence.
- cell is used in its usual biological sense, and does not refer to an entire-multicellular organism, e.g., specifically does not refer to a human.
- the cell can be present in an organism, e.g., birds, plants and mammals such as humans, cows, sheep, apes, monkeys, swine, dogs, and cats.
- the cell can be prokaryotic (e.g., bacterial cell) or eukaryotic (e.g., mammalian or plant cell).
- the cell can be of somatic or germ line origin, totipotent or pluripotent, dividing or non-dividing.
- the cell can also be derived from or can comprise a gamete or embryo, a stem cell, or a fully differentiated cell.
- vectors any nucleic acid- and/or viral-based technique used to deliver a desired nucleic acid.
- RNA is meant a molecule comprising at least one ribonucleotide residue.
- ribonucleotide is meant a nucleotide with a hydroxyl group at the 2′ position of a .beta.-D-ribo-furanose moiety.
- the terms include double-stranded RNA, single-stranded RNA, isolated RNA such as partially purified RNA, essentially pure RNA, synthetic RNA, recombinantly produced RNA, as well as altered RNA that differs from naturally occurring RNA by the addition, deletion, substitution and/or alteration of one or more nucleotides.
- Such alterations can include addition of non-nucleotide material, such as to the end(s) of the siNA or internally, for example at one or more nucleotides of the RNA.
- Nucleotides in the RNA molecules of the instant invention can also comprise non-standard nucleotides, such as non-naturally occurring nucleotides or chemically synthesized nucleotides or deoxynucleotides. These altered RNAs can be referred to as analogs or analogs of naturally-occurring RNA.
- subject is meant an organism, which is a donor or recipient of explanted cells or the cells themselves. “Subject” also refers to an organism to which the nucleic acid molecules of the invention can be administered.
- a subject can be a mammal or mammalian cells, including a human or human cells.
- universal base refers to nucleotide base analogs that form base pairs with each of the natural DNA/RNA bases with little discrimination between them.
- Non-limiting examples of universal bases include C-phenyl, C-naphthyl and other aromatic derivatives, inosine, azole carboxamides, and nitroazole derivatives such as 3-nitropyrrole, 4-nitroindole, 5-nitroindole, and 6-nitroindole as known in the art [see for example Loakes, Nucleic Acids Research, 29, 2437-2447 (2001)].
- acyclic nucleotide refers to any nucleotide having an acyclic ribose sugar, for example where any of the ribose carbons (C1, C2, C3, C4, or C5), are independently or in combination absent from the nucleotide.
- biodegradable refers to degradation in a biological system, for example enzymatic degradation or chemical degradation.
- biologically active molecule refers to compounds or molecules that are capable of eliciting or modifying a biological response in a system.
- biologically active siNA molecules either alone or in combination with other molecules contemplated by the instant invention include therapeutically active molecules such as antibodies, cholesterol, hormones, antivirals, peptides, proteins, chemotherapeutics, small molecules, vitamins, co-factors, nucleosides, nucleotides, oligonucleotides, enzymatic nucleic acids, antisense nucleic acids, triplex forming oligonucleotides, 2,5-A chimeras, siNA, dsRNA, allozymes, aptamers, decoys and analogs thereof.
- Biologically active molecules of the invention also include molecules capable of modulating the pharmacokinetics and/or pharmacodynamics of other biologically active molecules, for example, lipids and polymers such as polyamines, polyamides, polyethylene glycol and other polyethers.
- phospholipid refers to a hydrophobic molecule comprising at least one phosphorus group.
- a phospholipid can comprise a phosphorus-containing group and saturated or unsaturated alkyl group, optionally substituted with OH, COOH, oxo, amine, or substituted or unsubstituted aryl groups.
- cap structure is meant chemical modifications, which have been incorporated at either terminus of the oligonucleotide (see, for example, Adamic et al., U.S. Pat. No. 5,998,203). These terminal modifications protect the nucleic acid molecule from exonuclease degradation, and may help in delivery and/or localization within a cell.
- the cap may be present at the 5′-terminus (5′-cap) or at the 3′-terminal (3′-cap) or may be present on both termini.
- the 5′-cap includes, but is not limited to, glyceryl, inverted deoxy abasic residue (moiety); 4′,5′-methylene nucleotide; 1-(beta-D-erythrofuranosyl) nucleotide, 4′-thio nucleotide; carbocyclic nucleotide; 1,5-anhydrohexitol nucleotide; L-nucleotides; alpha-nucleotides; modified base nucleotide; phosphorodithioate linkage; threo-pentofuranosyl nucleotide; acyclic 3′,4′-seco nucleotide; acyclic 3,4-dihydroxybutyl nucleotide; acyclic 3,5-dihydroxypentyl nucleotide, 3′-3′-inverted nucleotide moiety; 3′-3′-inverted abasic moiety; 3′-2
- Non-limiting examples of the 3′-cap include, but are not limited to, glyceryl, inverted deoxy abasic residue (moiety), 4′,5′-methylene nucleotide; 1-(beta-D-erythrofuranosyl) nucleotide; 4′-thio nucleotide, carbocyclic nucleotide; 5′-amino-alkyl phosphate; 1,3-diamino-2-propyl phosphate; 3-aminopropyl phosphate; 6-aminohexyl phosphate; 1,2-aminododecyl phosphate; hydroxypropyl phosphate; 1,5-anhydrohexitol nucleotide; L-nucleotide; alpha-nucleotide; modified base nucleotide; phosphorodithioate; threo-pentofuranosyl nucleotide; acyclic 3′,4′-seco
- non-nucleotide any group or compound which can be incorporated into a nucleic acid chain in the place of one or more nucleotide units, including either sugar and/or phosphate substitutions, and allows the remaining bases to exhibit their enzymatic activity.
- the group or compound is abasic in that it does not contain a commonly recognized nucleotide base, such as adenosine, guanine, cytosine, uracil or thymine and therefore lacks a base at the 1′-position.
- nucleotide as used herein is as recognized in the art to include natural bases (standard), and modified bases well known in the art. Such bases are generally located at the 1′ position of a nucleotide sugar moiety. Nucleotides generally comprise a base, sugar and a phosphate group. The nucleotides can be unmodified or modified at the sugar, phosphate and/or base moiety, (also referred to interchangeably as nucleotide analogs, modified nucleotides, non-natural nucleotides, non-standard nucleotides and other; see, for example, Usman and McSwiggen, supra; Eckstein et al., International PCT Publication No.
- base modifications that can be introduced into nucleic acid molecules include, inosine, purine, pyridin-4-one, pyridin-2-one, phenyl, pseudouracil, 2,4,6-trimethoxy benzene, 3-methyl uracil, dihydrouridine, naphthyl, aminophenyl, 5-alkylcytidines (e.g., 5-methylcytidine), 5-alkyluridines (e.g., ribothymidine), 5-halouridine (e.g., 5-bromouridine) or 6-azapyrimidines or 6-alkylpyrimidines (e.g.
- modified bases in this aspect is meant nucleotide bases other than adenine, guanine, cytosine and uracil at 1′ position or their equivalents.
- target site is meant a sequence within a target RNA that is “targeted” for cleavage mediated by a siNA construct which contains sequences within its antisense region that are complementary to the target sequence.
- detecttable level of cleavage is meant cleavage of target RNA (and formation of cleaved product RNAs) to an extent sufficient to discern cleavage products above the background of RNAs produced by random degradation of the target RNA. Production of cleavage products from 1-5% of the target RNA is sufficient to detect above the background for most methods of detection.
- biological system is meant, material, in a purified or unpurified form, from biological sources, including but not limited to human, animal, plant, insect, bacterial, viral or other sources, wherein the system comprises the components required for RNAi activity.
- biological system includes, for example, a cell, tissue, or organism, or extract thereof.
- biological system also includes reconstituted RNAi systems that can be used in an in vitro setting.
- biodegradable linker refers to a nucleic acid or non-nucleic acid linker molecule that is designed as a biodegradable linker to connect one molecule to another molecule, for example, a biologically active molecule to a siNA molecule of the invention or the sense and antisense strands of a siNA molecule of the invention.
- the biodegradable linker is designed such that its stability can be modulated for a particular purpose, such as delivery to a particular tissue or cell type.
- the stability of a nucleic acid-based biodegradable linker molecule can be modulated by using various chemistries, for example combinations of ribonucleotides, deoxyribonucleotides, and chemically-modified nucleotides, such as 2′-O-methyl, 2′-fluoro, 2′-amino, 2′-O-amino, 2′-C-allyl, 2′-O-allyl, and other 2′-modified or base modified nucleotides.
- the biodegradable nucleic acid linker molecule can be a dimer, trimer, tetramer or longer nucleic acid molecule, for example, an oligonucleotide of about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 nucleotides in length, or can comprise a single nucleotide with a phosphorus-based linkage, for example, a phosphoramidate or phosphodiester linkage.
- the biodegradable nucleic acid linker molecule can also comprise nucleic acid backbone, nucleic acid sugar, or nucleic acid base modifications.
- abasic sugar moieties lacking a base or having other chemical groups in place of a base at the 1′ position, see for example Adamic et al., U.S. Pat. No. 5,998,203.
- unmodified nucleoside is meant one of the bases adenine, cytosine, guanine, thymine, or uracil joined to the 1′ carbon of .beta.-D-ribo-furanose.
- modified nucleoside is meant any nucleotide base which contains a modification in the chemical structure of an unmodified nucleotide base, sugar and/or phosphate.
- modified nucleotides are shown by Formulae I-VII and/or other modifications described herein.
- amino is meant 2′-NH 2 or 2′-O—NH 2 , which can be modified or unmodified.
- modified groups are described, for example, in Eckstein et al., U.S. Pat. No. 5,672,695 and Matulic-Adamic et al., U.S. Pat. No. 6,248,878.
- the siNA molecules can be complexed with cationic lipids, packaged within liposomes, or otherwise delivered to target cells or tissues.
- the nucleic acid or nucleic acid complexes can be locally administered to through injection, infusion pump or stent, with or without their incorporation in biopolymers.
- polyethylene glycol (PEG) can be covalently attached to siNA compounds of the present invention.
- the attached PEG can be any molecular weight, preferably from about 2,000 to about 50,000 Daltons (Da).
- the sense region can be connected to the antisense region via a linker molecule, such as a polynucleotide linker or a non-nucleotide linker.
- a linker molecule such as a polynucleotide linker or a non-nucleotide linker.
- TJ Tight junctions
- CLDNs Claudins
- JAMs Junctional Adhesion Molecules
- TJ TJ-like structures and functional properties of the TJ will not only provide insight on how the barrier is formed, but will identify those components that are most amenable to functional manipulation.
- the ability to transiently open tight junctions will facilitate the delivery of large molecule drugs, such as peptides, for nasal drug delivery.
- siRNA Transfection Four hour transfections of siRNAs were conducted 72 and 96 hours after seeding cells on inserts in serum free DMEM/F12, followed by addition of complete media. Each transfection mixture contained 80 pmol of siRNA and 4 ⁇ l of Lipofectamine 2000 (Invitrogen, Carlsbad, Calif.). Cells grown in dishes were transfected at approximately 50% confluence with 100 pmol siRNA /well in 6-well plates. Cells were then allowed to grow to confluence after transfection and either harvested for insert seeding or photographed. For insert seeding with siRNA-treated cells, transfected cells were detached, counted and re-suspended prior to seeding.
- TER Measurement Fresh, warm media is placed in a UV sterilized Endohm tissue resistance measurement chamber connected to an EVOM resistance meter from WPI (Sarasota, Fla.), and allowed to equilibrate to room temperature. Inserts to be measured were removed from the incubator and allowed to equilibrate to room temperature prior to measurement.
- Permeability Assay Inserts were left in the TER chamber until constant values were displayed. 50 ⁇ g of FITC dextran, MW 4,400, was applied on the apical side of each insert. Medium from basolateral chamber was transferred into 96-well plates and the amount of FITC determined by measuring fluorescence intensity following 1 hr incubation The permeability of each sample was calculated as percent of control (total fluorescence from lysed cell insert).
- Cells were either grown on collagen V coated coverslips or multi-well plates. After transfection or other treatments, cells were rinsed with PBS twice and fixed with 1% formaldehyde in PBS at room temperature for 10 min. Then 0.2% Triton X-100 was used to permeabilize cells for 10 min at room temperature. The cells were then blocked with 1% BSA for 30 min at room temperature and incubated with primary antibodies against Occludin or Claudin 4 (Zymed Inc. South San Francisco, Calif.) at room temperature for 60 min.
- FITC-conjugated goat anti-rabbit IgG (1:200) was used for Occludin and TRITC-conjugated goat anti-mouse (1:200) for Claudin 4 in double labeling at room temperature for 30 min. Between steps, the cells were washed 3 ⁇ -PBS. Vectashield mounting medium with DAPI (Vector Laboratories, Burlingame, Calif.) were used for coverslips. The images were captured using an inverted fluorescence microscope (Nikon eclipse TE2000).
- siRNAs used to target the mRNA of the tight junction proteins were the following.
- siRNA sequences Targets RNA sense sequence Antisense sequence Claudin-1 CCUCUUACCCAACACCAAG GAACCACAACCCAUUCUCC (SEQ ID NO: 12) (SEQ ID NO: 13) Claudin-1 GCAUGGUAUGGCAAUAGAA UUCUAUUGCCAUACCAUGC (SEQ ID NO: 14) (SEQ ID NO: 15) Claudin-3 CAUCAUCACGUCGCAGAAC GUUCUGCGACGUGAUGAUG (SEQ ID NO: 16) (SEQ ID NO: 17) Claudin-3 GCAAGGACUACCGUCUAUU AAUAGACGGUAGUCCUUGC (SEQ ID NO: 18) (SEQ ID NO: 19) Claudin-3 AUCACGUCGCAGAACAUUU AAAUGUUCUGCGACGUGAU (SEQ ID NO: 20) (SEQ ID NO: 21) Claudin-4 GACUUCUACAAUCCGCUGG CCAGC
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Biomedical Technology (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Health & Medical Sciences (AREA)
- Biotechnology (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Medicinal Chemistry (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Otolaryngology (AREA)
- Epidemiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Hematology (AREA)
- Diabetes (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US11/009,868 US20050129679A1 (en) | 2003-12-15 | 2004-12-10 | Method for opening tight junctions |
US11/624,630 US7696343B2 (en) | 2003-12-15 | 2007-01-18 | Method for opening tight junctions |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US52968203P | 2003-12-15 | 2003-12-15 | |
US11/009,868 US20050129679A1 (en) | 2003-12-15 | 2004-12-10 | Method for opening tight junctions |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/624,630 Continuation US7696343B2 (en) | 2003-12-15 | 2007-01-18 | Method for opening tight junctions |
Publications (1)
Publication Number | Publication Date |
---|---|
US20050129679A1 true US20050129679A1 (en) | 2005-06-16 |
Family
ID=34700019
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/009,868 Abandoned US20050129679A1 (en) | 2003-12-15 | 2004-12-10 | Method for opening tight junctions |
US11/624,630 Expired - Fee Related US7696343B2 (en) | 2003-12-15 | 2007-01-18 | Method for opening tight junctions |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/624,630 Expired - Fee Related US7696343B2 (en) | 2003-12-15 | 2007-01-18 | Method for opening tight junctions |
Country Status (2)
Country | Link |
---|---|
US (2) | US20050129679A1 (fr) |
WO (1) | WO2005058362A2 (fr) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20110064792A1 (en) * | 2007-10-12 | 2011-03-17 | Peter Humphries | Method for Opening Tight Junctions |
Families Citing this family (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8563515B2 (en) * | 2007-11-19 | 2013-10-22 | The Regents Of The University Of Colorado, A Body Corporate | Tight junction protein modulators and uses thereof |
WO2010027838A1 (fr) | 2008-08-27 | 2010-03-11 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Mir 204, mir 211, leurs anti-mir et leurs utilisations thérapeutiques |
CN107267518B (zh) * | 2017-08-01 | 2019-11-26 | 浙江大学 | 特异性抑制CLDN8基因表达的siRNA及其重组载体和应用 |
CN108191977B (zh) * | 2017-12-25 | 2018-12-18 | 首都医科大学宣武医院 | 用于检测缺血性脑卒中血脑屏障早期损伤的抗体及其应用 |
EP4358982A2 (fr) * | 2021-06-25 | 2024-05-01 | The J. David Gladstone Institutes, A Testamentary Trust Established under The Will of J. David Gladstone | Cellules germinales primordiales |
Citations (16)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4632440A (en) * | 1983-12-19 | 1986-12-30 | Societe Nationale Industrielle Et Aerospatiale | Device for locking a mobile panel with double security |
US5554388A (en) * | 1989-02-25 | 1996-09-10 | Danbiosyst Uk Limited | Systemic drug delivery compositions comprising a polycationi substance |
US5629011A (en) * | 1992-02-05 | 1997-05-13 | Danbiosyst Uk Limited | Composition for nasal administration |
US5744166A (en) * | 1989-02-25 | 1998-04-28 | Danbiosyst Uk Limited | Drug delivery compositions |
US5935604A (en) * | 1993-05-20 | 1999-08-10 | Danbiosyst Uk Limited | Nasal drug delivery composition containing nicotine |
US6048536A (en) * | 1994-10-04 | 2000-04-11 | Medeva Holdings Bv | Vaccine compositions |
US6110747A (en) * | 1997-12-31 | 2000-08-29 | Adherex Technologies Inc. | Compounds and methods for modulating tissue permeability |
US6136606A (en) * | 1995-11-01 | 2000-10-24 | Medeva Holdings Bv | Influenza vaccine compositions |
US6228396B1 (en) * | 1994-06-21 | 2001-05-08 | West Pharmaceutical Services Drug Delivery & Clinical Research Centre Limited | Colonic drug delivery composition |
US6342251B1 (en) * | 1997-12-02 | 2002-01-29 | West Pharmaceutical Services Drug Delivery & Clinical Research Centre Limited | Compositions for nasal administration |
US6383513B1 (en) * | 1997-12-19 | 2002-05-07 | West Pharmaceutical Services Drug Delivery & Clinical Research Centre Limited | Compositions comprising cannabinoids |
US6387917B1 (en) * | 1999-10-20 | 2002-05-14 | West Pharmaceutical Services Drug Delivery & Clinical Research Centre Limited | Salts of opioid analgesics, particularly morphine, and methods of using same |
US6391318B1 (en) * | 1995-12-07 | 2002-05-21 | West Pharmaceutical Services Drug Delivery & Clinical Research Centre Limited | Vaccine compositions including chitosan for intranasal administration and use thereof |
US20020082391A1 (en) * | 1996-03-15 | 2002-06-27 | Anderson James M. | Human occludin, its uses and enhancement of drug absorption using occludin inhibitors |
US20030027761A1 (en) * | 1999-06-02 | 2003-02-06 | Adherex Technologies, Inc. | Compounds and methods for modulating junctional adhesion molecule-mediated functions |
US6723700B1 (en) * | 1998-11-03 | 2004-04-20 | Adherex Technologies, Inc. | Compounds and methods for modulating claudin-mediated functions |
Family Cites Families (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB9707934D0 (en) | 1997-04-18 | 1997-06-04 | Danbiosyst Uk | Improved delivery of drugs to mucosal surfaces |
WO2000026360A1 (fr) * | 1998-11-03 | 2000-05-11 | Adherex Technologies Inc. | Composes et methodes permettant de moduler des fonctions induites par les claudines |
US20040028613A1 (en) * | 2001-06-25 | 2004-02-12 | Nastech Pharmaceutical Company Inc | Dopamine agonist formulations for enhanced central nervous system delivery |
FR2833840B1 (fr) * | 2001-12-21 | 2010-06-18 | Rytek | Methodes et compositions pour le traitement de pathologies respiratoires |
FR2833839A1 (fr) * | 2001-12-21 | 2003-06-27 | Rytek | Methodes et compositions pour le traitement de pathologies respiratoires |
US7666876B2 (en) | 2002-03-19 | 2010-02-23 | Vernalis (R&D) Limited | Buprenorphine formulations for intranasal delivery |
EP1539208A2 (fr) * | 2002-06-28 | 2005-06-15 | Nastech Pharmaceutical Company Inc. | Compositions et methodes permettant de moduler la physiologie de molecules d'adhesion jonctionnelle epitheliale en vue d'ameliorer l'administration de composes therapeutiques par voie muqueuse |
GB0300531D0 (en) | 2003-01-10 | 2003-02-12 | West Pharm Serv Drug Res Ltd | Pharmaceutical compositions |
US20040258663A1 (en) * | 2003-05-08 | 2004-12-23 | Nastech Pharmaceutical Company Inc. | Compositions and methods for enhanced mucosal delivery of interferon alpha |
CA2528465A1 (fr) * | 2003-06-09 | 2005-01-20 | Nastech Pharmaceutical Company Inc. | Compositions et procedes d'une meilleure administration d'hormone de croissance par voie muqueuse |
-
2004
- 2004-12-10 US US11/009,868 patent/US20050129679A1/en not_active Abandoned
- 2004-12-13 WO PCT/US2004/042602 patent/WO2005058362A2/fr active Application Filing
-
2007
- 2007-01-18 US US11/624,630 patent/US7696343B2/en not_active Expired - Fee Related
Patent Citations (17)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4632440A (en) * | 1983-12-19 | 1986-12-30 | Societe Nationale Industrielle Et Aerospatiale | Device for locking a mobile panel with double security |
US5554388A (en) * | 1989-02-25 | 1996-09-10 | Danbiosyst Uk Limited | Systemic drug delivery compositions comprising a polycationi substance |
US5744166A (en) * | 1989-02-25 | 1998-04-28 | Danbiosyst Uk Limited | Drug delivery compositions |
US5629011A (en) * | 1992-02-05 | 1997-05-13 | Danbiosyst Uk Limited | Composition for nasal administration |
US5935604A (en) * | 1993-05-20 | 1999-08-10 | Danbiosyst Uk Limited | Nasal drug delivery composition containing nicotine |
US6228396B1 (en) * | 1994-06-21 | 2001-05-08 | West Pharmaceutical Services Drug Delivery & Clinical Research Centre Limited | Colonic drug delivery composition |
US6048536A (en) * | 1994-10-04 | 2000-04-11 | Medeva Holdings Bv | Vaccine compositions |
US6136606A (en) * | 1995-11-01 | 2000-10-24 | Medeva Holdings Bv | Influenza vaccine compositions |
US6391318B1 (en) * | 1995-12-07 | 2002-05-21 | West Pharmaceutical Services Drug Delivery & Clinical Research Centre Limited | Vaccine compositions including chitosan for intranasal administration and use thereof |
US20020082391A1 (en) * | 1996-03-15 | 2002-06-27 | Anderson James M. | Human occludin, its uses and enhancement of drug absorption using occludin inhibitors |
US6342251B1 (en) * | 1997-12-02 | 2002-01-29 | West Pharmaceutical Services Drug Delivery & Clinical Research Centre Limited | Compositions for nasal administration |
US6383513B1 (en) * | 1997-12-19 | 2002-05-07 | West Pharmaceutical Services Drug Delivery & Clinical Research Centre Limited | Compositions comprising cannabinoids |
US6110747A (en) * | 1997-12-31 | 2000-08-29 | Adherex Technologies Inc. | Compounds and methods for modulating tissue permeability |
US6248864B1 (en) * | 1997-12-31 | 2001-06-19 | Adherex Technologies, Inc. | Compounds and methods and modulating tissue permeability |
US6723700B1 (en) * | 1998-11-03 | 2004-04-20 | Adherex Technologies, Inc. | Compounds and methods for modulating claudin-mediated functions |
US20030027761A1 (en) * | 1999-06-02 | 2003-02-06 | Adherex Technologies, Inc. | Compounds and methods for modulating junctional adhesion molecule-mediated functions |
US6387917B1 (en) * | 1999-10-20 | 2002-05-14 | West Pharmaceutical Services Drug Delivery & Clinical Research Centre Limited | Salts of opioid analgesics, particularly morphine, and methods of using same |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20110064792A1 (en) * | 2007-10-12 | 2011-03-17 | Peter Humphries | Method for Opening Tight Junctions |
US9540649B2 (en) * | 2007-10-12 | 2017-01-10 | The Provost, Fellows And Scholars Of The College Of The Holy And Undivided Trinity Of Queen Elizabeth Near Dublin | Method for opening tight junctions |
Also Published As
Publication number | Publication date |
---|---|
US20070253956A1 (en) | 2007-11-01 |
US7696343B2 (en) | 2010-04-13 |
WO2005058362A3 (fr) | 2006-01-12 |
WO2005058362A2 (fr) | 2005-06-30 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US8299236B2 (en) | Compositions and methods for enhancing delivery of nucleic acids into cells and for modifying expression of target genes in cells | |
US20060035815A1 (en) | Pharmaceutical compositions for delivery of ribonucleic acid to a cell | |
KR101900588B1 (ko) | hsp47 발현의 조절 | |
US20070281900A1 (en) | COMPOSITIONS AND METHODS FOR LIPID AND POLYPEPTIDE BASED siRNA INTRACELLULAR DELIVERY | |
US20070275923A1 (en) | CATIONIC PEPTIDES FOR siRNA INTRACELLULAR DELIVERY | |
US20070032441A1 (en) | Rna interference mediated inhibition of gene expression using chemically modified short interfering nucleic acid (sina) | |
US20100240730A1 (en) | RNA Interference Mediated Inhibition of Gene Expression Using Chemically Modified Short Interfering Nucleic Acid (siNA) | |
CA2628113A1 (fr) | Conjugues de peptide-arn substrat dicer utilises comme excipients d'administration pour arnsi | |
WO2005117991A2 (fr) | Compositions et procedes pour l'amelioration de l'administration d'acides nucleiques dans des cellules et pour la modification de l'expression de genes cibles dans des cellules | |
JP4948163B2 (ja) | 化学修飾した低分子干渉核酸(siNA)を使用する遺伝子発現のRNA干渉仲介抑制 | |
EP1934359A2 (fr) | Compositions pharmaceutiques pour acheminer de l'acide ribonucléique dans une cellule | |
US20120142754A1 (en) | Modulation of timp1 and timp2 expression | |
KR101937498B1 (ko) | 폐 질환 및 손상을 치료하기 위한 조성물 및 방법 | |
US7696343B2 (en) | Method for opening tight junctions | |
US9777278B2 (en) | Long interfering nucleic acid duplexes targeting multiple RNA targets | |
KR20080044909A (ko) | 세포 내로 리보핵산의 전달을 위한 약학 조성물 | |
MX2008003380A (en) | Pharmaceutical compositions for delivery of ribonucleic acid to a cell | |
MX2007003667A (en) | Method of treating an inflammatory disease by double stranded ribonucleic acid |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: NASTECH PHARMACEUTICAL COMPANY INC., WASHINGTON Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:CUI, KUNYUAN;DUTZAR, BENJAMIN H;REEL/FRAME:015625/0687;SIGNING DATES FROM 20041209 TO 20041210 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |