US20030044936A1 - Peptide repeat immunogens - Google Patents
Peptide repeat immunogens Download PDFInfo
- Publication number
- US20030044936A1 US20030044936A1 US10/122,483 US12248302A US2003044936A1 US 20030044936 A1 US20030044936 A1 US 20030044936A1 US 12248302 A US12248302 A US 12248302A US 2003044936 A1 US2003044936 A1 US 2003044936A1
- Authority
- US
- United States
- Prior art keywords
- polypeptide
- copies
- peptide sequence
- epitope peptide
- peptide
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 113
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 52
- 229920001184 polypeptide Polymers 0.000 claims abstract description 49
- 108020003175 receptors Proteins 0.000 claims description 17
- 102000005962 receptors Human genes 0.000 claims description 17
- 102000005720 Glutathione transferase Human genes 0.000 claims description 8
- 108010070675 Glutathione transferase Proteins 0.000 claims description 8
- 230000005847 immunogenicity Effects 0.000 claims description 6
- 108700033844 Pseudomonas aeruginosa toxA Proteins 0.000 claims 1
- 239000000427 antigen Substances 0.000 description 26
- 108091007433 antigens Proteins 0.000 description 26
- 102000036639 antigens Human genes 0.000 description 26
- 239000000579 Gonadotropin-Releasing Hormone Substances 0.000 description 24
- 101000857870 Squalus acanthias Gonadoliberin Proteins 0.000 description 24
- XLXSAKCOAKORKW-AQJXLSMYSA-N gonadorelin Chemical compound C([C@@H](C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)NCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 XLXSAKCOAKORKW-AQJXLSMYSA-N 0.000 description 24
- 229940035638 gonadotropin-releasing hormone Drugs 0.000 description 24
- 241000283973 Oryctolagus cuniculus Species 0.000 description 19
- 229960005486 vaccine Drugs 0.000 description 16
- 108020001507 fusion proteins Proteins 0.000 description 14
- 102000037865 fusion proteins Human genes 0.000 description 14
- 241000699670 Mus sp. Species 0.000 description 11
- 239000002671 adjuvant Substances 0.000 description 10
- 230000028993 immune response Effects 0.000 description 10
- 230000003053 immunization Effects 0.000 description 10
- 238000002649 immunization Methods 0.000 description 10
- 230000002163 immunogen Effects 0.000 description 10
- 238000000034 method Methods 0.000 description 10
- 239000000203 mixture Substances 0.000 description 9
- 150000001413 amino acids Chemical class 0.000 description 8
- 239000012634 fragment Substances 0.000 description 8
- 238000004519 manufacturing process Methods 0.000 description 7
- 108020004707 nucleic acids Proteins 0.000 description 7
- 102000039446 nucleic acids Human genes 0.000 description 7
- 150000007523 nucleic acids Chemical class 0.000 description 7
- 241001465754 Metazoa Species 0.000 description 6
- 210000004027 cell Anatomy 0.000 description 6
- 108090000623 proteins and genes Proteins 0.000 description 6
- 206010028980 Neoplasm Diseases 0.000 description 5
- 108010046308 Type II DNA Topoisomerases Proteins 0.000 description 5
- 230000014509 gene expression Effects 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- 101710132601 Capsid protein Proteins 0.000 description 4
- 101710094648 Coat protein Proteins 0.000 description 4
- 102000052428 DNA topoisomerase II-beta Human genes 0.000 description 4
- 102100021181 Golgi phosphoprotein 3 Human genes 0.000 description 4
- 241000282412 Homo Species 0.000 description 4
- 101710125418 Major capsid protein Proteins 0.000 description 4
- 101710141454 Nucleoprotein Proteins 0.000 description 4
- 108700026244 Open Reading Frames Proteins 0.000 description 4
- 101710083689 Probable capsid protein Proteins 0.000 description 4
- 241000700618 Vaccinia virus Species 0.000 description 4
- 108020004705 Codon Proteins 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 3
- 201000011510 cancer Diseases 0.000 description 3
- 230000000295 complement effect Effects 0.000 description 3
- 238000004925 denaturation Methods 0.000 description 3
- 230000036425 denaturation Effects 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- 210000004408 hybridoma Anatomy 0.000 description 3
- 230000001965 increasing effect Effects 0.000 description 3
- 102000004169 proteins and genes Human genes 0.000 description 3
- 238000003259 recombinant expression Methods 0.000 description 3
- 238000002255 vaccination Methods 0.000 description 3
- 108091028732 Concatemer Proteins 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 101000762949 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) Exotoxin A Proteins 0.000 description 2
- 108091081062 Repeated sequence (DNA) Proteins 0.000 description 2
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 2
- 210000001744 T-lymphocyte Anatomy 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- 238000000137 annealing Methods 0.000 description 2
- 210000000612 antigen-presenting cell Anatomy 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 239000000284 extract Substances 0.000 description 2
- 230000006408 female gonad development Effects 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 239000012678 infectious agent Substances 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 210000001672 ovary Anatomy 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 231100000419 toxicity Toxicity 0.000 description 2
- 230000001988 toxicity Effects 0.000 description 2
- 239000003053 toxin Substances 0.000 description 2
- 231100000765 toxin Toxicity 0.000 description 2
- 108700012359 toxins Proteins 0.000 description 2
- 238000011282 treatment Methods 0.000 description 2
- ASWBNKHCZGQVJV-UHFFFAOYSA-N (3-hexadecanoyloxy-2-hydroxypropyl) 2-(trimethylazaniumyl)ethyl phosphate Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(O)COP([O-])(=O)OCC[N+](C)(C)C ASWBNKHCZGQVJV-UHFFFAOYSA-N 0.000 description 1
- UFBJCMHMOXMLKC-UHFFFAOYSA-N 2,4-dinitrophenol Chemical compound OC1=CC=C([N+]([O-])=O)C=C1[N+]([O-])=O UFBJCMHMOXMLKC-UHFFFAOYSA-N 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- USFZMSVCRYTOJT-UHFFFAOYSA-N Ammonium acetate Chemical compound N.CC(O)=O USFZMSVCRYTOJT-UHFFFAOYSA-N 0.000 description 1
- 239000005695 Ammonium acetate Substances 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-M Bicarbonate Chemical compound OC([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-M 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 102000009016 Cholera Toxin Human genes 0.000 description 1
- 108010049048 Cholera Toxin Proteins 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 101710146739 Enterotoxin Proteins 0.000 description 1
- 101710082714 Exotoxin A Proteins 0.000 description 1
- 102000012673 Follicle Stimulating Hormone Human genes 0.000 description 1
- 108010079345 Follicle Stimulating Hormone Proteins 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- 102000009151 Luteinizing Hormone Human genes 0.000 description 1
- 108010073521 Luteinizing Hormone Proteins 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 101100129095 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) lysX gene Proteins 0.000 description 1
- 101710138657 Neurotoxin Proteins 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 239000002033 PVDF binder Substances 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 230000005867 T cell response Effects 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 101710183280 Topoisomerase Proteins 0.000 description 1
- 201000005485 Toxoplasmosis Diseases 0.000 description 1
- 102000007537 Type II DNA Topoisomerases Human genes 0.000 description 1
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 238000007792 addition Methods 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 229940043376 ammonium acetate Drugs 0.000 description 1
- 235000019257 ammonium acetate Nutrition 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 230000000875 corresponding effect Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 210000004696 endometrium Anatomy 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 239000000147 enterotoxin Substances 0.000 description 1
- 231100000655 enterotoxin Toxicity 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 229940028334 follicle stimulating hormone Drugs 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 230000026109 gonad development Effects 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- 230000003054 hormonal effect Effects 0.000 description 1
- 230000004727 humoral immunity Effects 0.000 description 1
- 210000003016 hypothalamus Anatomy 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 210000003000 inclusion body Anatomy 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 1
- 231100000225 lethality Toxicity 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 229940040129 luteinizing hormone Drugs 0.000 description 1
- 101150110767 lysS gene Proteins 0.000 description 1
- 101150056234 lysS1 gene Proteins 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 239000002581 neurotoxin Substances 0.000 description 1
- 231100000618 neurotoxin Toxicity 0.000 description 1
- 231100000956 nontoxicity Toxicity 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 239000008024 pharmaceutical diluent Substances 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 229920000447 polyanionic polymer Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 201000001514 prostate carcinoma Diseases 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 229940023143 protein vaccine Drugs 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000001850 reproductive effect Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 238000012956 testing procedure Methods 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/21—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Pseudomonadaceae (F)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/23—Luteinising hormone-releasing hormone [LHRH]; Related peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/24011—Poxviridae
- C12N2710/24111—Orthopoxvirus, e.g. vaccinia virus, variola
- C12N2710/24122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
Definitions
- the invention is based on the discovery of a new means of generating an immune response to an epitope peptide by concatemerizing the epitope peptide and fusing the concatemer to a receptor binding domain (e.g., the receptor binding domain of a Pseudomonas exotoxin) or a carrier peptide with low immunogenicity (e.g., glutathione-S-transferase).
- a receptor binding domain e.g., the receptor binding domain of a Pseudomonas exotoxin
- a carrier peptide with low immunogenicity e.g., glutathione-S-transferase
- the invention features a fusion protein, more specifically, the fusion protein is a polypeptide including a carrier peptide sequence, and a plurality (e.g., 2, 5, 10, 20, or 30 copies) of epitope peptide sequences.
- One class of the carrier peptides each bears a receptor binding domain for better intake of the epitope peptide by antigen presenting cells and, thus, more effective activation of helper T-cells.
- the second class of the carrier peptides each has weak immunogenicity and helps to induce humoral immunity dominantly against the epitope peptide by increasing the size of the fusion protein.
- the epitope peptide sequence must be at least two amino acids in length (e.g., at least 3, 5, 7, 9, or 10 amino acids in length). In a preferred embodiment, the epitope peptide sequence can be less than 1000 amino acids in length (e.g., less than 500, 100, 50, or 20 amino acids in length).
- GnRH gonadotropin releasing hormone
- GnRH gonadotropin releasing hormone
- EHWSYGLRPG EHWSYGLRPG
- LIGICVAVTVAI LIGICVAVTVAI
- NEGDYNPGRKTS NEGDYNPGRKTS
- a receptor binding domain is an amino acid sequence within a polypeptide which specifically binds to an LDL or ⁇ 2 -macroglobulin cell receptor.
- An example of a receptor binding domain is amino acids 1-252 (domain Ia) of the P.
- PE aeruginosa exotoxin A
- PE MHLIPHWIPLVASLGLLAGGSSASAAEEAFDL (SEQ ID NO:3) WNECAKACVLDLKDGVRSSRMSVDPAIADTNGQGVLH YSMVLEGGNDALKLAIDNALSITSDGLTIRLEGGVEP NKPVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIH ELNAGNQLSHMSPIYTIEMGDELLAKLARDATFFVRA HESNEMQPTLAISHAGVSVVMAQTQPRREKRWSEWAS GKVLCLLDPLDGVYNYLAQQRCNLDDTWEGKIYRV.
- the position of the various elements within the polypeptide can vary, as long as the polypeptide is able to elicit an immune response in a mammal.
- all copies of the epitope peptide sequence are in a consecutive series, meaning that all copies occur as a single block of peptide repeats without intervening amino acids in between any two copies.
- a spacer e.g., 2-4 amino acids such as glycine, proline, or a combination of the two is placed between two copies of the epitope peptide sequence.
- the carrier peptide can occur anywhere in the polypeptide (e.g., at the N-terminus, at the C-terminus, internal, or between two copies of the epitope peptide sequence), as long as the intended function of the polypeptide as an antigen is not disrupted.
- the invention also features a nucleic acid (e.g., a recombinant expression vector) encoding one of the fusion proteins described above.
- the nucleic acid can be used for production of the fusion protein.
- polypeptides of the invention can be used to provide new antigens and vaccines for eliciting an immune response against specific epitope peptide sequences. These antigens can be formulated as safe and effective vaccines in mammals (including humans).
- FIG. 1 is a representation of a GnRH peptide sequence (SEQ ID NO:1) useful in the polypeptides of the invention and primer sequences (SEQ ID NO:4 for Oligo A; SEQ ID NO:5 for Oligo B) which encode it or portions thereof.
- FIG. 2 is a representation of how successive extension, denaturation, and annealing (i.e., PCR) of the primers shown in FIG. 1 produce a nucleic acid encoding concatamers of the peptide sequence also shown in FIG. 1.
- FIG. 3 is a representation of a final PCR amplification of the concatemeric nucleic acid shown in FIG. 2 to introduce at the ends of the concatemer a stop codon and suitable restriction sites for cloning.
- Adaptor primer A is designated SEQ ID NO:6.
- Adaptor primer B is designated SEQ ID NO:7.
- the 5′ overhang sequence containing the EcoRI site is designated SEQ ID NO:8.
- the 5′ overhang sequence containing the SacII site is designated SEQ ID NO:9.
- the invention relates to new polypeptides having multiple copies of an epitope peptide fused to a receptor binding domain (e.g., the receptor binding domain of a Pseudomonas exotoxin) or to a carrier peptide with low immunogenicity (e.g., glutathione-S-transferase). Multiple copies of a peptide antigen increase immunologic presentation of epitopes present in each monomeric peptide sequence.
- a receptor binding domain increases binding between the polypeptide and antigen presenting cells, thereby facilitating uptake and presentation of peptide sequences.
- a carrier peptide with low immunogenicity facilitates antigen recognition by increasing the size of the protein, thereby activating the antibody generating system.
- the invention also features a nucleic acid (e.g., a recombinant expression vector) encoding a fusion protein described above.
- the nucleic acid can be used for production of the fusion protein.
- the recombinant expression vectors can be designed for expression of polypeptides in prokaryotic (e.g., E. coli ) or eukaryotic cells (e.g., insect cells, yeast cells, or mammalian cells). Production of recombinant proteins in cells is well known in the art. See Goeddel (1990) Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif.
- the nucleic acids of the invention can be transcribed and translated in vitro, for example, using T7 promoter regulatory sequences and T7 polymerase.
- polypeptides of the invention can be used to generate antibodies that specifically bind a monomeric peptide sequence. Such antibodies can be used in diagnostic and/or therapeutic procedures that require the enhancement, inhibition, or detection of any molecule which contains the epitope presented by the peptide sequence.
- various host animals can be immunized by injection of a composition containing a polypeptide of the invention.
- Host animals can include rabbits, mice, guinea pigs, and rats.
- Various adjuvants can be used to increase the immunological response, depending on the host species, including but not limited to Freund's (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, dinitrophenol, and potentially useful human adjuvants such as BCG (bacille Calmette-Guerin) and Corynebacterium parvum.
- BCG Bacille Calmette-Guerin
- Antibodies include polyclonal antibodies, monoclonal antibodies, humanized or chimeric antibodies, single chain antibodies, Fab fragments, F(ab′) 2 fragments, and molecules produced using a Fab expression library.
- Monoclonal antibodies which are homogeneous populations of antibodies to a particular antigen, can be prepared using the polypeptides described above and standard hybridoma technology (see, e.g., Kohler et al., Nature 256:495, 1975; Kohler et al., Eur. J. Immunol. 6:511, 1976; Kohler et al., Eur. J. Immunol. 6:292, 1976; Hammerling et al., In: Monoclonal Antibodies and T Cell Hybridomas, Elsevier, N.Y., 1981; U.S. Pat. No.
- Such antibodies can be of any immunoglobulin class including IgG, IgM, IgE, IgA, IgD and any subclass thereof.
- the hybridoma producing the Mab may be cultivated in vitro or in vivo. The ability to produce high titers of mAbs in vivo makes this an excellent method of production.
- the antibodies can be used, for example, to detect the presence of an antigen in a biological sample as part of a diagnostic assay, and also to evaluate the effectiveness of medical treatments by other therapeutic approaches.
- chimeric antibodies In addition, techniques developed for the production of “chimeric antibodies” (Morrison et al., Proc. Natl. Acad. Sci. USA 81:6851, 1984; Neuberger et al., Nature 312:604, 1984; Takeda et al., Nature 314:452, 1984) by splicing the genes from a mouse antibody molecule of appropriate antigen specificity together with genes from a human antibody molecule of appropriate biological activity can be used.
- a chimeric antibody is a molecule in which different portions are derived from different animal species, such as those having a variable region derived from a murine Mab and a human immunoglobulin constant region.
- single chain antibodies are formed by linking the heavy and light chain fragments of the Fv region via an amino acid bridge, resulting in a single chain polypeptide.
- Antibody fragments that recognize and bind to specific epitopes can be generated by known techniques.
- fragments include, but are not limited to, F(ab′) 2 fragments that can be produced by pepsin digestion of the antibody molecule, and Fab fragments that can be generated by reducing the disulfide bridges of F(ab′) 2 fragments.
- the invention includes vaccine compositions (e.g., parenteral injectable vaccines) containing at least one polypeptide of the invention and, optionally, a pharmaceutically acceptable carrier, such as the diluents phosphate buffered saline or a bicarbonate solution (e.g., 0.24 M NaHCO 3 ).
- a pharmaceutically acceptable carrier such as the diluents phosphate buffered saline or a bicarbonate solution (e.g., 0.24 M NaHCO 3 ).
- the carriers used in the composition are selected on the basis of the mode and route of administration, and standard pharmaceutical practice. Suitable pharmaceutical carriers and diluents, as well as pharmaceutical necessities for their use, are described in Remington's Pharmaceutical Sciences.
- An adjuvant e.g., a cholera toxin, Escherichia coli heat-labile enterotoxin (LT), liposome, or immune-stimulating complex (ISCOM), can also be included in the new vaccine composition, if necessary.
- a cholera toxin Escherichia coli heat-labile enterotoxin (LT), liposome, or immune-stimulating complex (ISCOM)
- LT Escherichia coli heat-labile enterotoxin
- ISCOM immune-stimulating complex
- the amount of vaccine administered will depend, for example, on the particular peptide antigen in the polypeptide, whether an adjuvant is co-administered with the antigen, the type of adjuvant co-administered, the mode and frequency of administration, and the desired effect (e.g., protection or treatment), as can be determined by one skilled in the art.
- the new vaccine antigens are administered in amounts ranging between 1 ⁇ g and 100 mg polypeptide per adult human dose. If adjuvants are administered with the vaccines, amounts ranging between 1 ng and 1 mg per adult human dose can generally be used. Administration is repeated as necessary, as can be determined by one skilled in the art.
- a priming dose can be followed by three booster doses at weekly intervals.
- a booster shot can be given at 8 to 12 weeks after the first immunization, and a second booster can be given at 16 to 20 weeks, using the same formulation.
- Sera or T-cells can be taken from the individual for testing the immune response elicited by the vaccine against the neurotoxin. Methods of assaying antibodies or cytotoxic T cells against a specific antigen are well known in the art. Additional boosters can be given as needed.
- the immunization protocol can be optimized for eliciting a maximal immune response.
- mice e.g., Swiss-Webster mice
- mice can be vaccinated via an oral or parenteral route with a composition containing a polypeptide of the invention.
- the mice e.g., Swiss-Webster mice
- the mice are challenged with a LD 95 dose of the infectious agent. End points other than lethality can also be used.
- Efficacy is determined if mice receiving the vaccine die at a rate lower than the mock-vaccinated mice. Preferably, the difference in death rates should be statistically significant.
- Rabbits can be used in the above testing procedure instead of mice.
- the new vaccine compositions can be administered as ISCOMs.
- Protective immunity has been generated in a variety of experimental models of infection, including toxoplasmosis and Epstein-Barr virus-induced tumors, using ISCOMS as the delivery vehicle for antigens (Mowat et al., Immunology Today 12:383-385, 1991).
- Doses of antigen as low as 1 ⁇ g encapsulated in ISCOMs have been found to produce class I mediated cytotoxic T cell responses (Takahashi et al., Nature 344:873-875, 1990).
- GnRH Gonadotropin releasing hormone
- luteinizing hormone and follicle-stimulating hormone which in turn regulates gonad development in humans.
- increased expression of GnRH and its receptor has been correlated with a variety of tumors, including cancer of the breast, ovary, endometrium, and prostate. See, e.g., Imai et al., Cancer 74:2555-2561, 1994; Eidne et al., J. Clin. Endocrinol. Metab. 64:425-432, 1987; and Irmer et al., Cancer Res. 55:817-822, 1995. Therefore, antibodies against GnRH may provide a means to modulate reproductive hormone activity and/or cancer development and progression.
- TRPCR template repeat PCR
- Oligo A encoded target antigen GnRH.
- Oligo B was complementary to oligo A. Oligo A is dissected into 5′ half A1 and 3′ half A2, both halves being of equal lengths. Oligo B is dissected into 5′ half B 1 and 3′ half B2, again both halves being of equal lengths. A1 was complementary to B1, while A2 was complementary to B2.
- the thermal cycler was programmed for denaturation at 94° C. for 30 seconds, annealing at 37° C. for 30 seconds, and extension at 72° C. for 30 seconds. Using oligos A and B, PCR was performed for 30 cycles, followed by a final extension at 72° C. for 10 minutes. This PCR should produced DNA species containing repeated sequences encoding GnRH, as illustrated in FIG. 2.
- Adaptor A and Adaptor B Two adapter primers (Adaptor A and Adaptor B) were designed to add an appropriate stop codon at the end of the repeated open reading frame (ORF) and two suitable restriction sites flanking the ORF (FIG. 3).
- ORF repeated open reading frame
- FOG. 3 Two suitable restriction sites flanking the ORF.
- the template for the PCR was a 100-fold dilution of the TRPCR product produced as described above.
- the thermal cycler was programmed as described above, except that the denaturation was set for 1 minute instead of 30 seconds.
- the resulting PCR product contained a SacII site at the 5′ end, an EcoRI site at the 3′ end, and a stop codon at the end of the ORF.
- TRPCR and adaptor-PCR were then examined on a polyacrylamide gel.
- the majority of the TRPCR products were 500 bp to 700 bp in length.
- adaptor PCR products were distributed in a ladder, the lowest band containing the dimer of the GnRH DNA repeat and the slower migrating bands containing higher order multimers.
- the number of repeats present ranged from 3 to at least 12.
- One clone containing 12 repeats of GnRH coding sequence was chosen for further study.
- the DNA fragment encoding 12 repeats of GnRH was subcloned into plasmid pPEDI, which was produced by subcloning the sequence encoding domain Ia of PE in pJH14 (Hwang et al., J. Biol. Chem. 264:2379-2384, 1989) into pET (Novagen).
- This plasmid expresses a polypeptide containing domain Ia of PE, which includes the toxin receptor binding domain of the toxin, and contains a His 6 tag at its N-terminus.
- the GnRH repeats were inserted at the 3′ end of PE structure gene to produce pPEDIG12.
- the protein produced by this expression plasmid was designated PEIa-GnRH12.
- pPEDIG12 was transformed into BL21(DE3)lysS.
- the transformants were cultured at 37° C. in LB medium containing ampicillin (50 ⁇ g/ml), chloramphenicol (25 ⁇ g/ml) and tetracycline (10 ⁇ g/ml).
- a 600 of the culture reached 0.2
- IPTG was added to the culture to medium to achieve a final concentration of 0.1 mM.
- Cells were cultured for another 90 minutes and then harvested. Since PEIa-GnRH12 is overexpressed in the form of inclusion bodies, the cells were extracted with 6 M urea.
- the extracts were then purified using the Novagen pET His-Tag System.
- the fractions containing PEIa-GnRH12 were collected and dialysed against 50 mM ammonium acetate (pH 4.0).
- PEIa-GnRH12 was stable for at least 6 months when stored at 4° C.
- nickel-agarose affinity column chromatography PEIa-GnRH12 was isolated to about 95% purity, as determined by SDS-PAGE.
- GST-GnRH1 and GST-GnRH5 were specifically used as ELISA targets. Sera from thrice immunized rabbits, diluted 10,000-fold, recognized GST-GnRH1 and GST-GnRH5 to the same extent, thereby confirming that the immune response against the immunogen was directed to GnRH monomer-specific epitopes.
- mice and a pig were also immunized with PEIa-GnRH12.
- the mice immunization regimen was identical to the rabbit immunization described above, except that each mouse received a 100 ⁇ l bolus containing 10 ⁇ g PEIa-GnRH12 and 25 ⁇ g aluminum phosphate (pH 7.0) for each injection.
- a 24 day-old pig was injection once with a 1 ml bolus containing 10 mg PEIa-GnRH12 and 250 ⁇ g aluminum phosphate (pH 7.0).
- GnRH-specific antibodies were readily elicited in the mice and pig, as well as in rabbits, indicating that the antigens can elicit an immune response in a variety of animals. Further, a single immunization was sufficient to elicit an immune response.
- a DNA sequence containing a repeat of the vaccinia virus coat protein peptide LIGICVAVTVAI was constructed using PCR as described in Example 1 above.
- a PE fusion protein containing 16 repeats of the virus coat protein peptide was produced and purified according to the procedures in Example 1.
- a DNA sequence containing a repeat of a human DNA topoisomerase II ⁇ peptide NEGDYNPGRKTS was constructed using PCR as described in Example 1 above.
- a glutathione-S-transferase (GST) fusion protein containing 7 repeats of the human DNA topoisomerase II ⁇ peptide was produced and purified according to the procedures described in Example 1.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Virology (AREA)
- Endocrinology (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
A polypeptide containing a carrier peptide sequence and a plurality of epitope peptide sequences.
Description
- This application is a continuation-in-part of U.S. application Ser. No. 09/412,558, filed Oct. 5, 1999, incorporated herein in its entirety.
- The successful development of a protein-based vaccine often requires a delicate balance between enhancing immunogenicity of a particular antigen and minimizing any toxicity elicited by the enhancement. For example, an effective adjuvant used in animal studies (e.g., complete Freund's) may be too toxic to be used in vaccines prepared for humans.
- The invention is based on the discovery of a new means of generating an immune response to an epitope peptide by concatemerizing the epitope peptide and fusing the concatemer to a receptor binding domain (e.g., the receptor binding domain of a Pseudomonas exotoxin) or a carrier peptide with low immunogenicity (e.g., glutathione-S-transferase). Such a fusion protein elicits antigen-specific antibodies in mammals, with little or no toxicity observed.
- Accordingly, the invention features a fusion protein, more specifically, the fusion protein is a polypeptide including a carrier peptide sequence, and a plurality (e.g., 2, 5, 10, 20, or 30 copies) of epitope peptide sequences. One class of the carrier peptides each bears a receptor binding domain for better intake of the epitope peptide by antigen presenting cells and, thus, more effective activation of helper T-cells. The second class of the carrier peptides each has weak immunogenicity and helps to induce humoral immunity dominantly against the epitope peptide by increasing the size of the fusion protein.
- The epitope peptide sequence must be at least two amino acids in length (e.g., at least 3, 5, 7, 9, or 10 amino acids in length). In a preferred embodiment, the epitope peptide sequence can be less than 1000 amino acids in length (e.g., less than 500, 100, 50, or 20 amino acids in length). It can include any antigen in which an immune response against it is beneficial, such as gonadotropin releasing hormone or GnRH, e.g., EHWSYGLRPG (SEQ ID NO:1), a fragment of a vaccinia virus coat protein, e.g., LIGICVAVTVAI, (SEQ ID NO:2), or a fragment of the human topoisomerase IIβ, e.g., NEGDYNPGRKTS (SEQ ID NO:10).
- A receptor binding domain is an amino acid sequence within a polypeptide which specifically binds to an LDL or α2-macroglobulin cell receptor. An example of a receptor binding domain is amino acids 1-252 (domain Ia) of the P. aeruginosa exotoxin A (PE):
MHLIPHWIPLVASLGLLAGGSSASAAEEAFDL (SEQ ID NO:3) WNECAKACVLDLKDGVRSSRMSVDPAIADTNGQGVLH YSMVLEGGNDALKLAIDNALSITSDGLTIRLEGGVEP NKPVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIH ELNAGNQLSHMSPIYTIEMGDELLAKLARDATFFVRA HESNEMQPTLAISHAGVSVVMAQTQPRREKRWSEWAS GKVLCLLDPLDGVYNYLAQQRCNLDDTWEGKIYRV. - Variants of the sequence immediately above, including substitutions, deletions, or additions are permissible, provided that the receptor binding domain specifically binds to a LDL/α2-macroglobulin cell receptor.
- The position of the various elements within the polypeptide can vary, as long as the polypeptide is able to elicit an immune response in a mammal. In one example, all copies of the epitope peptide sequence are in a consecutive series, meaning that all copies occur as a single block of peptide repeats without intervening amino acids in between any two copies. In another example, a spacer (e.g., 2-4 amino acids such as glycine, proline, or a combination of the two) is placed between two copies of the epitope peptide sequence. In addition, the carrier peptide can occur anywhere in the polypeptide (e.g., at the N-terminus, at the C-terminus, internal, or between two copies of the epitope peptide sequence), as long as the intended function of the polypeptide as an antigen is not disrupted.
- The invention also features a nucleic acid (e.g., a recombinant expression vector) encoding one of the fusion proteins described above. The nucleic acid can be used for production of the fusion protein.
- The polypeptides of the invention can be used to provide new antigens and vaccines for eliciting an immune response against specific epitope peptide sequences. These antigens can be formulated as safe and effective vaccines in mammals (including humans).
- The details of one or more embodiments of the invention are set forth in the accompanying drawings and the description below. Other features, objects, and advantages of the invention will be apparent from the description and the drawings, and from the claims.
- FIG. 1 is a representation of a GnRH peptide sequence (SEQ ID NO:1) useful in the polypeptides of the invention and primer sequences (SEQ ID NO:4 for Oligo A; SEQ ID NO:5 for Oligo B) which encode it or portions thereof.
- FIG. 2 is a representation of how successive extension, denaturation, and annealing (i.e., PCR) of the primers shown in FIG. 1 produce a nucleic acid encoding concatamers of the peptide sequence also shown in FIG. 1.
- FIG. 3 is a representation of a final PCR amplification of the concatemeric nucleic acid shown in FIG. 2 to introduce at the ends of the concatemer a stop codon and suitable restriction sites for cloning. Adaptor primer A is designated SEQ ID NO:6. Adaptor primer B is designated SEQ ID NO:7. The 5′ overhang sequence containing the EcoRI site is designated SEQ ID NO:8. The 5′ overhang sequence containing the SacII site is designated SEQ ID NO:9.
- The invention relates to new polypeptides having multiple copies of an epitope peptide fused to a receptor binding domain (e.g., the receptor binding domain of a Pseudomonas exotoxin) or to a carrier peptide with low immunogenicity (e.g., glutathione-S-transferase). Multiple copies of a peptide antigen increase immunologic presentation of epitopes present in each monomeric peptide sequence. In addition, a receptor binding domain increases binding between the polypeptide and antigen presenting cells, thereby facilitating uptake and presentation of peptide sequences. A carrier peptide with low immunogenicity facilitates antigen recognition by increasing the size of the protein, thereby activating the antibody generating system.
- The invention also features a nucleic acid (e.g., a recombinant expression vector) encoding a fusion protein described above. The nucleic acid can be used for production of the fusion protein. The recombinant expression vectors can be designed for expression of polypeptides in prokaryotic (e.g.,E. coli) or eukaryotic cells (e.g., insect cells, yeast cells, or mammalian cells). Production of recombinant proteins in cells is well known in the art. See Goeddel (1990) Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. Alternatively, the nucleic acids of the invention can be transcribed and translated in vitro, for example, using T7 promoter regulatory sequences and T7 polymerase.
- I. Generation of Antibodies
- The polypeptides of the invention can be used to generate antibodies that specifically bind a monomeric peptide sequence. Such antibodies can be used in diagnostic and/or therapeutic procedures that require the enhancement, inhibition, or detection of any molecule which contains the epitope presented by the peptide sequence.
- In particular, various host animals can be immunized by injection of a composition containing a polypeptide of the invention. Host animals can include rabbits, mice, guinea pigs, and rats. Various adjuvants can be used to increase the immunological response, depending on the host species, including but not limited to Freund's (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, dinitrophenol, and potentially useful human adjuvants such as BCG (bacille Calmette-Guerin) andCorynebacterium parvum.
- Antibodies include polyclonal antibodies, monoclonal antibodies, humanized or chimeric antibodies, single chain antibodies, Fab fragments, F(ab′)2 fragments, and molecules produced using a Fab expression library.
- Monoclonal antibodies, which are homogeneous populations of antibodies to a particular antigen, can be prepared using the polypeptides described above and standard hybridoma technology (see, e.g., Kohler et al., Nature 256:495, 1975; Kohler et al., Eur. J. Immunol. 6:511, 1976; Kohler et al., Eur. J. Immunol. 6:292, 1976; Hammerling et al., In: Monoclonal Antibodies and T Cell Hybridomas, Elsevier, N.Y., 1981; U.S. Pat. No. 4,376,110; Kosbor et al., Immunology Today 4:72, 1983; Cole et al., Proc. Natl. Acad. Sci. USA 80:2026, 1983; and Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96, 1983). Such antibodies can be of any immunoglobulin class including IgG, IgM, IgE, IgA, IgD and any subclass thereof. The hybridoma producing the Mab may be cultivated in vitro or in vivo. The ability to produce high titers of mAbs in vivo makes this an excellent method of production.
- The antibodies can be used, for example, to detect the presence of an antigen in a biological sample as part of a diagnostic assay, and also to evaluate the effectiveness of medical treatments by other therapeutic approaches.
- In addition, techniques developed for the production of “chimeric antibodies” (Morrison et al., Proc. Natl. Acad. Sci. USA 81:6851, 1984; Neuberger et al., Nature 312:604, 1984; Takeda et al., Nature 314:452, 1984) by splicing the genes from a mouse antibody molecule of appropriate antigen specificity together with genes from a human antibody molecule of appropriate biological activity can be used. A chimeric antibody is a molecule in which different portions are derived from different animal species, such as those having a variable region derived from a murine Mab and a human immunoglobulin constant region.
- Alternatively, techniques described for the production of single chain antibodies (U.S. Pat. Nos. 4,946,778, 4,946,778, and 4,704,692) can be adapted to produce single chain antibodies against a particular peptide antigen. Single chain antibodies are formed by linking the heavy and light chain fragments of the Fv region via an amino acid bridge, resulting in a single chain polypeptide.
- Antibody fragments that recognize and bind to specific epitopes can be generated by known techniques. For example, such fragments include, but are not limited to, F(ab′)2 fragments that can be produced by pepsin digestion of the antibody molecule, and Fab fragments that can be generated by reducing the disulfide bridges of F(ab′)2 fragments.
- II. Production and Use of Vaccine Compositions
- The invention includes vaccine compositions (e.g., parenteral injectable vaccines) containing at least one polypeptide of the invention and, optionally, a pharmaceutically acceptable carrier, such as the diluents phosphate buffered saline or a bicarbonate solution (e.g., 0.24 M NaHCO3). The carriers used in the composition are selected on the basis of the mode and route of administration, and standard pharmaceutical practice. Suitable pharmaceutical carriers and diluents, as well as pharmaceutical necessities for their use, are described in Remington's Pharmaceutical Sciences. An adjuvant, e.g., a cholera toxin, Escherichia coli heat-labile enterotoxin (LT), liposome, or immune-stimulating complex (ISCOM), can also be included in the new vaccine composition, if necessary.
- The amount of vaccine administered will depend, for example, on the particular peptide antigen in the polypeptide, whether an adjuvant is co-administered with the antigen, the type of adjuvant co-administered, the mode and frequency of administration, and the desired effect (e.g., protection or treatment), as can be determined by one skilled in the art. In general, the new vaccine antigens are administered in amounts ranging between 1 μg and 100 mg polypeptide per adult human dose. If adjuvants are administered with the vaccines, amounts ranging between 1 ng and 1 mg per adult human dose can generally be used. Administration is repeated as necessary, as can be determined by one skilled in the art. For example, a priming dose can be followed by three booster doses at weekly intervals. A booster shot can be given at 8 to 12 weeks after the first immunization, and a second booster can be given at 16 to 20 weeks, using the same formulation. Sera or T-cells can be taken from the individual for testing the immune response elicited by the vaccine against the neurotoxin. Methods of assaying antibodies or cytotoxic T cells against a specific antigen are well known in the art. Additional boosters can be given as needed. By varying the amount of polypeptide, the copy number of peptide antigen in the polypeptide, and frequency of administration, the immunization protocol can be optimized for eliciting a maximal immune response.
- Before administering the above compositions in humans, toxicity and efficacy testing in animals are desirable. In an example of efficacy testing, mice (e.g., Swiss-Webster mice) can be vaccinated via an oral or parenteral route with a composition containing a polypeptide of the invention. For vaccines against an infectious agent, after the initial vaccination or after optional booster vaccinations, the mice (and corresponding control mice receiving mock vaccinations) are challenged with a LD95 dose of the infectious agent. End points other than lethality can also be used. Efficacy is determined if mice receiving the vaccine die at a rate lower than the mock-vaccinated mice. Preferably, the difference in death rates should be statistically significant. Rabbits can be used in the above testing procedure instead of mice.
- Alternatively, the new vaccine compositions can be administered as ISCOMs. Protective immunity has been generated in a variety of experimental models of infection, including toxoplasmosis and Epstein-Barr virus-induced tumors, using ISCOMS as the delivery vehicle for antigens (Mowat et al., Immunology Today 12:383-385, 1991). Doses of antigen as low as 1 μg encapsulated in ISCOMs have been found to produce class I mediated cytotoxic T cell responses (Takahashi et al., Nature 344:873-875, 1990).
- The specific examples below are to be construed as merely illustrative, and not limitative of the remainder of the disclosure in any way whatsoever. Without further elaboration, it is believed that one skilled in the art can, based on the description herein, utilize the present invention to its fullest extent. All publications recited herein are hereby incorporated by reference in their entirety.
- Gonadotropin releasing hormone (GnRH) is a decapeptide produced by the arcuate nuclei of the hypothalamus and regulates expression of luteinizing hormone and follicle-stimulating hormone, which in turn regulates gonad development in humans. In addition, increased expression of GnRH and its receptor has been correlated with a variety of tumors, including cancer of the breast, ovary, endometrium, and prostate. See, e.g., Imai et al., Cancer 74:2555-2561, 1994; Eidne et al., J. Clin. Endocrinol. Metab. 64:425-432, 1987; and Irmer et al., Cancer Res. 55:817-822, 1995. Therefore, antibodies against GnRH may provide a means to modulate reproductive hormone activity and/or cancer development and progression.
- To produce an antigen containing concatamers of GnRH fused to a receptor binding domain, the following approach, as outlined in FIGS.1-3, was used. This procedure was designated template repeat PCR (TRPCR).
- Two oligonucleotides were designed for TRPCR (FIG. 1). Oligo A encoded target antigen GnRH. Oligo B was complementary to oligo A. Oligo A is dissected into 5′ half A1 and 3′ half A2, both halves being of equal lengths. Oligo B is dissected into 5′
half B 1 and 3′ half B2, again both halves being of equal lengths. A1 was complementary to B1, while A2 was complementary to B2. - The thermal cycler was programmed for denaturation at 94° C. for 30 seconds, annealing at 37° C. for 30 seconds, and extension at 72° C. for 30 seconds. Using oligos A and B, PCR was performed for 30 cycles, followed by a final extension at 72° C. for 10 minutes. This PCR should produced DNA species containing repeated sequences encoding GnRH, as illustrated in FIG. 2.
- Two adapter primers (Adaptor A and Adaptor B) were designed to add an appropriate stop codon at the end of the repeated open reading frame (ORF) and two suitable restriction sites flanking the ORF (FIG. 3). For this step (which was designated adaptor PCR), the template for the PCR was a 100-fold dilution of the TRPCR product produced as described above. The thermal cycler was programmed as described above, except that the denaturation was set for 1 minute instead of 30 seconds. The resulting PCR product contained a SacII site at the 5′ end, an EcoRI site at the 3′ end, and a stop codon at the end of the ORF.
- The products of TRPCR and adaptor-PCR were then examined on a polyacrylamide gel. The majority of the TRPCR products were 500 bp to 700 bp in length. After adaptor PCR, products were distributed in a ladder, the lowest band containing the dimer of the GnRH DNA repeat and the slower migrating bands containing higher order multimers. The number of repeats present ranged from 3 to at least 12. One clone containing 12 repeats of GnRH coding sequence was chosen for further study.
- The DNA fragment encoding 12 repeats of GnRH was subcloned into plasmid pPEDI, which was produced by subcloning the sequence encoding domain Ia of PE in pJH14 (Hwang et al., J. Biol. Chem. 264:2379-2384, 1989) into pET (Novagen). This plasmid expresses a polypeptide containing domain Ia of PE, which includes the toxin receptor binding domain of the toxin, and contains a His6 tag at its N-terminus. The GnRH repeats were inserted at the 3′ end of PE structure gene to produce pPEDIG12. The protein produced by this expression plasmid was designated PEIa-GnRH12.
- pPEDIG12 was transformed into BL21(DE3)lysS. The transformants were cultured at 37° C. in LB medium containing ampicillin (50 μg/ml), chloramphenicol (25 μg/ml) and tetracycline (10 μg/ml). When the A600 of the culture reached 0.2, IPTG was added to the culture to medium to achieve a final concentration of 0.1 mM. Cells were cultured for another 90 minutes and then harvested. Since PEIa-GnRH12 is overexpressed in the form of inclusion bodies, the cells were extracted with 6 M urea.
- The extracts were then purified using the Novagen pET His-Tag System. The fractions containing PEIa-GnRH12 were collected and dialysed against 50 mM ammonium acetate (pH 4.0). PEIa-GnRH12 was stable for at least 6 months when stored at 4° C. After nickel-agarose affinity column chromatography, PEIa-GnRH12 was isolated to about 95% purity, as determined by SDS-PAGE.
- To test this new immunogen, six week old New Zealand female rabbits were immunized with PEIa-GnRH12. A 0.5 ml bolus containing 100 μg of PEIa-GnRH12 and 125 μg aluminum phosphate (pH 7.0) was injected into the rabbit at the first time point (six weeks after birth). One week after the first immunization, an identical 0.5 ml bolus was injected into the rabbits for a second immunization, followed by an identical injection two weeks after the first immunization. After the three immunizations, sera were collected for ELISA and immunoblotting analysis. To test whether antibodies against the multimeric antigen were directed to monomeric epitopes or to epitopes spanning the junction between monomers, several GST fusion proteins containing various multimers of GnRH were produced as targets for ELISA.
- Unexpectedly, the antibodies produced in the immunized rabbits failed to recognize GST alone, while the sera at 5,000-fold dilution recognized all GST-GnRH fusion proteins to the same extent, irrespectively of how many GnRH repeats the GST fusion proteins contained. These results suggested that most of the antibodies produced in response to the immunogen recognized monomeric GnRH epitopes rather than any hybrid epitopes created by concatemerization.
- GST-GnRH1 and GST-GnRH5 were specifically used as ELISA targets. Sera from thrice immunized rabbits, diluted 10,000-fold, recognized GST-GnRH1 and GST-GnRH5 to the same extent, thereby confirming that the immune response against the immunogen was directed to GnRH monomer-specific epitopes.
- To confirm that the antibodies elicited by the new immunogen were physiologically active, immunized rabbits were monitored for ovary development. As a control, rabbits were also immunized with PEIa-TopN8, a polypeptide containing domain Ia of PE fused to 8 repeats of a 10-amino acid topoisomerase N-terminal peptide. The PEIa-TopN8-immunized rabbits showed normal ovary development, while the ovaries of PEIa-GnRH12-immunized rabbits were significantly decreased in size. Thus, the GnRH immunogen produced can be used as an immunogen to induce autoantibodies useful for treating GnRH-associated diseases.
- To further confirm the utility of the new GnRH immunogen, mice and a pig were also immunized with PEIa-GnRH12. The mice immunization regimen was identical to the rabbit immunization described above, except that each mouse received a 100 μl bolus containing 10 μg PEIa-GnRH12 and 25 μg aluminum phosphate (pH 7.0) for each injection. In addition, a 24 day-old pig was injection once with a 1 ml bolus containing 10 mg PEIa-GnRH12 and 250 μg aluminum phosphate (pH 7.0). GnRH-specific antibodies were readily elicited in the mice and pig, as well as in rabbits, indicating that the antigens can elicit an immune response in a variety of animals. Further, a single immunization was sufficient to elicit an immune response.
- Instead of a GnRH peptide sequence, a DNA sequence containing a repeat of the vaccinia virus coat protein peptide LIGICVAVTVAI (SEQ ID NO:2) was constructed using PCR as described in Example 1 above. A PE fusion protein containing 16 repeats of the virus coat protein peptide was produced and purified according to the procedures in Example 1.
- Six-week old rabbits were injected with a 1 ml bolus containing 100 μg viral peptide repeat antigen and 100 μg complete Freund's adjuvant. Four weeks later, the rabbits received a second 1 ml injection containing 100 μg antigen and 100 μg incomplete Freund's adjuvant. At 8 weeks after the first immunization, the rabbits were injected with a 1 ml bolus containing 100 μg antigen (no adjuvant). Unexpectedly, rabbits thrice immunized with the virus coat protein immunogen produced vaccinia virus-specific antibodies.
- Thus, the general procedure of linking a peptide repeat to a PE receptor binding domain was shown to be successful for a second peptide.
- A DNA sequence containing a repeat of a human DNA topoisomerase IIβ peptide NEGDYNPGRKTS (SEQ ID NO:10) was constructed using PCR as described in Example 1 above. A glutathione-S-transferase (GST) fusion protein containing 7 repeats of the human DNA topoisomerase IIβ peptide (GST-TOP2β-7M) was produced and purified according to the procedures described in Example 1.
- Four New Zealand female rabbits were immunized with the purified GST-TOP2β-7M fusion protein. Sera were collected for Western blot analysis. Twenty micrograms of HeLa nuclear extract was separated by 5% SDS-PAGE. Proteins were transferred to a PVDF membrane which was subsequently blotted with a 5000X dilution of the anti-TOP2β antiserum. Unexpectedly, the results indicate that rabbits immunized with the GST-TOP2β-7M immunogen produced high titer antibodies specific for human DNA topoisomerase IIβ.
- All of the features disclosed in this specification may be combined in any combination. Each feature disclosed in this specification may be replaced by an alternative feature serving the same, equivalent, or similar purpose. Thus, unless expressly stated otherwise, each feature disclosed is only an example of a generic series of equivalent or similar features.
- From the above description, one skilled in the art can easily ascertain the essential characteristics of the present invention, and without departing from the spirit and scope thereof, can make various changes and modifications of the invention to adapt it to various usages and conditions. Thus, other embodiments are also within the scope of the following claims.
Claims (20)
1. A polypeptide comprising:
a carrier peptide sequence, and
a plurality of epitope peptide sequences.
2. The polypeptide of claim 1 , wherein the carrier peptide contains a receptor binding domain.
3. The polypeptide of claim 2 , wherein the polypeptide contains 2 to 30 copies of the epitope peptide sequence.
4. The polypeptide of claim 3 , wherein all copies of the epitope peptide sequence are in a consecutive series.
5. The polypeptide of claim 2 , wherein all copies of the epitope peptide sequence are in a consecutive series.
6. The polypeptide of claim 2 , wherein the receptor binding domain is that of Pseudomonas exotoxin A.
7. The polypeptide of claim 6 , wherein the polypeptide contains 2 to 30 copies of the epitope peptide sequence.
8. The polypeptide of claim 7 , wherein all copies of the epitope peptide sequence are in a consecutive series.
9. The polypeptide of claim 6 , wherein all copies of the epitope peptide sequence are in a consecutive series.
10. The polypeptide of claim 1 , wherein the carrier peptide is a peptide with low immunogenicity.
11. The polypeptide of claim 10 , wherein the polypeptide contains 2 to 30 copies of the epitope peptide sequence.
12. The polypeptide of claim 11 , wherein all copies of the epitope peptide sequence are in a consecutive series.
13. The polypeptide of claim 10 , wherein all copies of the epitope peptide sequence are in a consecutive series.
14. The polypeptide of claim 10 , wherein the carrier peptide is glutathione-S-transferase.
15. The polypeptide of claim 14 , wherein the polypeptide contains 2 to 30 copies of the epitope peptide sequence.
16. The polypeptide of claim 15 , wherein all copies of the epitope peptide sequence are in a consecutive series.
17. The polypeptide of claim 14 , wherein all copies of the epitope peptide sequence are in a consecutive series.
18. The polypeptide of claim 1 , wherein the polypeptide contains 2 to 30 copies of the epitope peptide sequence.
19. The polypeptide of claim 18 , wherein all copies of the epitope peptide sequence are in a consecutive series.
20. The polypeptide of claim 1 , wherein all copies of the epitope peptide sequence are in a consecutive series.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US10/122,483 US20030044936A1 (en) | 1999-10-05 | 2002-04-11 | Peptide repeat immunogens |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US09/412,558 US6838553B1 (en) | 1999-10-05 | 1999-10-05 | Peptide repeat immunogens |
US10/122,483 US20030044936A1 (en) | 1999-10-05 | 2002-04-11 | Peptide repeat immunogens |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US09/412,558 Continuation-In-Part US6838553B1 (en) | 1999-10-05 | 1999-10-05 | Peptide repeat immunogens |
Publications (1)
Publication Number | Publication Date |
---|---|
US20030044936A1 true US20030044936A1 (en) | 2003-03-06 |
Family
ID=23633489
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US09/412,558 Expired - Fee Related US6838553B1 (en) | 1999-10-05 | 1999-10-05 | Peptide repeat immunogens |
US10/122,483 Abandoned US20030044936A1 (en) | 1999-10-05 | 2002-04-11 | Peptide repeat immunogens |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US09/412,558 Expired - Fee Related US6838553B1 (en) | 1999-10-05 | 1999-10-05 | Peptide repeat immunogens |
Country Status (7)
Country | Link |
---|---|
US (2) | US6838553B1 (en) |
EP (1) | EP1090994B1 (en) |
AU (1) | AU772387B2 (en) |
CA (1) | CA2304377A1 (en) |
DE (1) | DE60037626D1 (en) |
NZ (1) | NZ507368A (en) |
TW (1) | TW528760B (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20110256172A1 (en) * | 2008-10-14 | 2011-10-20 | The Regents Of The University Of Michigan | Epitope-targeted anthrax vaccine |
Families Citing this family (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
ES2372359T3 (en) | 2007-04-20 | 2012-01-19 | F. Hoffmann-La Roche Ag | DETECTION OF PRIMARY INFECTIONS BY PATHOGENS. |
US8383767B2 (en) * | 2008-06-27 | 2013-02-26 | Academia Sinica | Immunogenic protein carrier containing an antigen presenting cell binding domain and a cysteine-rich domain |
WO2010127050A1 (en) * | 2009-04-28 | 2010-11-04 | Abbott Diabetes Care Inc. | Error detection in critical repeating data in a wireless sensor system |
US11246915B2 (en) | 2010-09-15 | 2022-02-15 | Applied Molecular Transport Inc. | Cholix toxin-derived fusion molecules for oral delivery of biologically active cargo |
SG11202009925PA (en) | 2018-03-08 | 2020-11-27 | Applied Molecular Transport Inc | Toxin-derived delivery constructs for oral delivery |
WO2020096695A1 (en) | 2018-11-07 | 2020-05-14 | Applied Molecular Transport Inc. | Cholix-derived carriers for oral delivery of heterologous payload |
BR112022002962A2 (en) | 2019-08-16 | 2022-07-05 | Applied Molecular Transport Inc | COMPOSITIONS, FORMULATIONS AND PRODUCTION AND PURIFICATION OF INTERLEUKIN |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20020004238A1 (en) * | 2000-04-03 | 2002-01-10 | Russell Michael W. | Chimeric antigen-enterotoxin mucosal immunogens |
Family Cites Families (18)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5668255A (en) | 1984-06-07 | 1997-09-16 | Seragen, Inc. | Hybrid molecules having translocation region and cell-binding region |
US4892827A (en) * | 1986-09-24 | 1990-01-09 | The United States Of America As Represented By The Department Of Health And Human Services | Recombinant pseudomonas exotoxins: construction of an active immunotoxin with low side effects |
US5830713A (en) | 1986-11-04 | 1998-11-03 | Protein Polymer Technologies, Inc. | Methods for preparing synthetic repetitive DNA |
SE459825B (en) * | 1988-07-18 | 1989-08-07 | Bent Erland Ilon | AUTOMATICALLY OPERATING EXCHANGE DEVICE |
NL8900726A (en) * | 1989-03-23 | 1990-10-16 | Stichting Centr Diergeneeskund | PEPTIDE, IMMUNOGENIC COMPOSITION AND VACCINE OR MEDICINAL PRODUCT; METHOD FOR IMMUNIZING A MAMMAL AGAINST LHRH, AND METHOD FOR IMPROVING THE MEAT QUALITY OF PIGS |
GB8915019D0 (en) * | 1989-06-30 | 1989-08-23 | Matthews Ruth C | Medicaments |
WO1991002799A1 (en) * | 1989-08-25 | 1991-03-07 | Biotechnology Australia Pty Ltd | Fusion proteins |
WO1992017590A1 (en) * | 1991-04-02 | 1992-10-15 | Schweiz. Serum- & Impfinstitut Bern | Therapeutic and preventive vaccines for hiv |
US5723129A (en) * | 1991-10-16 | 1998-03-03 | University Of Saskatchewan | GnRH-leukotoxin chimeras |
CA2131729C (en) * | 1992-03-02 | 2008-02-12 | Antonello Covacci | Helicobacter pylori proteins useful for vaccines and diagnostics |
US5648245A (en) | 1995-05-09 | 1997-07-15 | Carnegie Institution Of Washington | Method for constructing an oligonucleotide concatamer library by rolling circle replication |
AU7718696A (en) * | 1995-10-27 | 1997-05-15 | Merck & Co., Inc. | Pseudomonas exotoxin as immunogenic carrier in synthetic conjugate vaccines |
JP4150082B2 (en) * | 1996-08-27 | 2008-09-17 | カイロン コーポレイション | Monoclonal antibodies defining unique meningococcal B epitopes and their use in the preparation of vaccine compositions |
JP2001510683A (en) * | 1997-07-11 | 2001-08-07 | ザ ガバメント オブ ザ ユナイテッド ステイツ リプリゼンテッド バイ ザ セクレタリー, デパートメント オブ ヘルス アンド ヒューマン サービシーズ | Pseudomonas exotoxin A-like chimeric immunogen |
AU9310298A (en) * | 1997-09-09 | 1999-03-29 | Trustees Of Columbia University In The City Of New York, The | T-independent conjugate-vaccines |
US6140066A (en) * | 1998-03-24 | 2000-10-31 | Lorberboum-Galski; Haya | Methods of cancer diagnosis using a chimeric toxin |
US6387684B1 (en) * | 1999-09-13 | 2002-05-14 | Academia Sinica | Topoisomerase 1-mediated DNA delivery |
US20030219459A1 (en) * | 2002-01-18 | 2003-11-27 | Cytos Biotechnology Ag | Prion protein carrier-conjugates |
-
1999
- 1999-10-05 US US09/412,558 patent/US6838553B1/en not_active Expired - Fee Related
-
2000
- 2000-04-28 CA CA002304377A patent/CA2304377A1/en not_active Abandoned
- 2000-04-28 TW TW089108150A patent/TW528760B/en not_active IP Right Cessation
- 2000-05-19 DE DE60037626T patent/DE60037626D1/en not_active Expired - Lifetime
- 2000-05-19 EP EP00304253A patent/EP1090994B1/en not_active Expired - Lifetime
- 2000-10-05 NZ NZ507368A patent/NZ507368A/en not_active IP Right Cessation
- 2000-10-05 AU AU62500/00A patent/AU772387B2/en not_active Ceased
-
2002
- 2002-04-11 US US10/122,483 patent/US20030044936A1/en not_active Abandoned
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20020004238A1 (en) * | 2000-04-03 | 2002-01-10 | Russell Michael W. | Chimeric antigen-enterotoxin mucosal immunogens |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20110256172A1 (en) * | 2008-10-14 | 2011-10-20 | The Regents Of The University Of Michigan | Epitope-targeted anthrax vaccine |
Also Published As
Publication number | Publication date |
---|---|
EP1090994A3 (en) | 2001-07-18 |
CA2304377A1 (en) | 2001-04-05 |
TW528760B (en) | 2003-04-21 |
AU6250000A (en) | 2001-04-12 |
DE60037626D1 (en) | 2008-02-14 |
EP1090994B1 (en) | 2008-01-02 |
NZ507368A (en) | 2001-06-29 |
EP1090994A2 (en) | 2001-04-11 |
US6838553B1 (en) | 2005-01-04 |
AU772387B2 (en) | 2004-04-29 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN106561082B (en) | Vaccine composition against streptococcus suis infection | |
KR102482994B1 (en) | Vaccine composition for preventing or treating infection of SARS-CoV-2 | |
Drew et al. | Humoral immune responses to DNA vaccines expressing secreted, membrane bound and non-secreted forms of the: Taenia ovis 45W antigen | |
RU2270865C2 (en) | Immunogenic polypeptide inducing protective immune response against bacillus anthracis (variants), method for its preparing, nucleic acid encoding thereof, expression vector (variants), method and vaccine for prophylaxis of infection caused by bacillus anthracis | |
US11352416B2 (en) | Mosaic chimeric viral vaccine particle | |
JPH03502687A (en) | Respiratory syncytial viruses: vaccines and diagnostics | |
WO2022003119A1 (en) | Cross-reactive coronavirus vaccine | |
CN107847575A (en) | For pig reproduction and breathing syndrome and the vaccine combination of porcine circovirus associated diseases | |
US9701724B2 (en) | Vaccine for preventing porcine edema disease | |
US6838553B1 (en) | Peptide repeat immunogens | |
KR20120095167A (en) | Vaccine composition for immunocastration comprising stf2-gnrh fusion recombinant protein and method for animal immunocastration using the same | |
KR20210119230A (en) | Recombinant Protein for Removing Boar Taint and Vaccine Composition Comprising the Same | |
JP2000236887A (en) | Fusion protein containing carrier capable of inducing double immune reaction | |
KR102514122B1 (en) | Vaccine composition for preventing or treating infection of SARS-CoV-2 | |
CN116568324A (en) | Fusion proteins and vaccines | |
CN115322247A (en) | Novel charge mutant antigen of coronavirus receptor binding region and application | |
JP6902804B2 (en) | Vaccine composition containing hepatitis B virus-like particles as an adjuvant | |
KR20120095166A (en) | Stf2-gnrh fusion recombinant protein, gene coding the protein, recombinant vector comprising the gene, transformant transformed with the vector and method for preparing the fusion recombinant protein using the same | |
SURI et al. | Evaluation of recombinant protein r140, a polypeptide segment of tegumental glycoprotein Sm25, as a defined antigen vaccine against Schistosoma mansoni | |
KR101991577B1 (en) | Recombinant antigenic protein composed of multiple epitopes and preparation method thereof | |
JP2001321183A (en) | Peptide repeat immunogen | |
KR102039059B1 (en) | Protein comprising ectodomain of japanese encephalitis virus envelope proteins, homodimer thereof, and use thereof | |
US11801292B2 (en) | Polypeptide epitopes of S. aureus and respective monoclonal antibodies for the treatment of infections and immune-diagnosis | |
WO2003012117A1 (en) | Dna vaccine | |
KR20220062080A (en) | Immunotherapy for the treatment of prostate cancer |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: ACADEMIA SINICA, TAIWAN Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:HWANG, JAULANG;HSU, CHIA-TSE;TING, CHUN-JEN;REEL/FRAME:013846/0922 Effective date: 20030304 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |