US12312416B2 - Fluorescein-specific cars exhibiting optimal t cell function against FL-PLE labelled tumors - Google Patents

Fluorescein-specific cars exhibiting optimal t cell function against FL-PLE labelled tumors Download PDF

Info

Publication number
US12312416B2
US12312416B2 US16/965,859 US201916965859A US12312416B2 US 12312416 B2 US12312416 B2 US 12312416B2 US 201916965859 A US201916965859 A US 201916965859A US 12312416 B2 US12312416 B2 US 12312416B2
Authority
US
United States
Prior art keywords
cells
car
ple
cell
alternatives
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active, expires
Application number
US16/965,859
Other versions
US20200354477A1 (en
Inventor
Michael C. Jensen
James F. Matthaei
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Seattle Childrens Hospital
Original Assignee
Seattle Childrens Hospital
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Seattle Childrens Hospital filed Critical Seattle Childrens Hospital
Priority to US16/965,859 priority Critical patent/US12312416B2/en
Publication of US20200354477A1 publication Critical patent/US20200354477A1/en
Application granted granted Critical
Publication of US12312416B2 publication Critical patent/US12312416B2/en
Active legal-status Critical Current
Adjusted expiration legal-status Critical

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/7051—T-cell receptor (TcR)-CD3 complex
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/44—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere, e.g. haptens, metals, DNA, RNA, amino acids
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/5758—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites
    • G01N33/5759—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites involving compounds localised on the membrane of tumour or cancer cells
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C07K2317/53—Hinge
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00—Detection or diagnosis of diseases
    • G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis

Definitions

  • compositions and methods of making and using these compositions relate to engineered chimeric antigen receptors (CARs) and compositions thereof having specificity and affinity for fluorescein containing ligands presented on the surface of tumor cells. Accordingly, provided herein are compositions and methods of making and using these compositions.
  • CARs engineered chimeric antigen receptors
  • Chimeric receptors are synthetic receptors that include an extracellular ligand binding domain, most commonly a single chain variable fragment of a monoclonal antibody (scFv) linked to intracellular signaling components, most commonly CD3 ⁇ alone or combined with one or more costimulatory domains.
  • scFv monoclonal antibody
  • Much of the research in the design of chimeric antigen receptors has focused on defining scFvs and other ligand binding elements that target malignant cells without causing serious toxicity to essential normal tissues, and on defining the optimal composition of intracellular signaling modules to activate T cell effector functions.
  • CAR T cell-mediated therapy that is selective for specific targets and which minimizes adverse side effects.
  • a complex comprising a chimeric antigen receptor (CAR) or a T cell receptor (TCR), wherein the CAR or TCR is joined to a lipid, wherein the lipid comprises a target moiety and the CAR is joined to said lipid through an interaction with said target moiety, and wherein the CAR or TCR comprises a spacer domain having a spacer length of 1-22 amino acids, 23-50 amino acids, 51-100 amino acids, 100 to 150 amino acids or 151-250 amino acids or a spacer length that is within a range defined by any two of the aforementioned lengths.
  • the CAR or TCR comprises a sequence as set forth in any one of SEQ ID NOs: 1-6.
  • the spacer domain is a IgG4 hinge connected to a CH2 domain to a CH3 domain. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 7. In some alternatives, the spacer domain is an IgG4 hinge connected to a CH3 domain. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 8. In some alternatives, the spacer domain is an IgG4 hinge only. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 9. Some embodiments include nucleic acids that encode any one of SEQ ID NO: 1-9, which may be present on a vector and/or introduced to a cell (e.g., a T cell).
  • the spacer comprises a length of 229 amino acids.
  • the lipid comprises a polar head group and a hydrophobic group.
  • the polar head comprises a choline, a phosphatidylcholine, sphingomyelin, phosphoethanolamine group, an oligosaccharide residue, a sugar residue, phosphatidyl serine or phosphatidyl inositol.
  • the polar-head group comprises phosphocholine, a piperidine moiety or a trimethylarseno-ethyl-phosphate moiety.
  • the hydrophobic group is fatty acid, such as an aliphatic chain.
  • the fatty acid is saturated or unsaturated.
  • the hydrophobic group comprises an alkyl, alkenyl or alkynyl group.
  • the hydrophobic group comprises a terpenoid lipid, such as a steroid or cholesterol.
  • the hydrophobic group comprises an ether linkage, wherein the ether linkage is between the polar head group and the aliphatic chain.
  • the sugar residue is a glycerol.
  • the hydrophobic group comprises a carbon alkyl chain, wherein the carbon alkyl chain comprises 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 carbons or any number that is within a range defined by any two aforementioned values.
  • the carbon alkyl chain comprises 18 carbons.
  • the lipid is a phospholipid ether.
  • the target moiety is biotin, digoxigenin, dinitrophenol or fluorescein.
  • the spacer comprises a PEG spacer, a Hapten (2 ⁇ ) spacer, or an alkane chain.
  • the PEG spacer comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16 PEG molecules, or any amount of PEG molecules that is within a range defined by any two aforementioned values.
  • the CAR or TCR is expressed by a cell or a T cell. In some alternatives, the CAR or TCR is on the surface of a cell or a T cell.
  • the cell is a precursor T cell. In some alternatives, the precursor T cell is a hematopoietic stem cell. In some alternatives, the cell is a CD8+T cytotoxic lymphocyte cell selected from the group consisting of na ⁇ ve CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells and bulk CD8+ T cells. In some alternatives, the cell is a CD4+T helper lymphocyte cell that is selected from the group consisting of na ⁇ ve CD4+ T cells, central memory CD4+ T cells, effector memory CD4+ T cells, and bulk CD4+ T cells. In some alternatives, the lipid is intercalated in a lipid bilayer of a target cell. In some alternatives, the target cell is a tumor cell. In some alternatives, the target cell is an immune cell. In some alternatives, the immune cell is a T cell or a B cell. In some alternatives, the target cell is present in a tumor microenvironment.
  • a cell comprising a complex of any one of the alternatives herein, the cell comprising a chimeric antigen receptor (CAR) or T cell receptor (TCR), wherein the CAR or TCR is bound to or is configured to bind to a lipid, wherein the lipid comprises a target moiety and the cell comprising the CAR is bound to the target moiety of the lipid, and wherein the CAR or TCR comprises a spacer domain.
  • CAR chimeric antigen receptor
  • TCR T cell receptor
  • the complex comprises a chimeric antigen receptor (CAR) or a T cell receptor (TCR), wherein the CAR or TCR is joined to or is configured to be joined to a lipid, wherein the lipid comprises a target moiety and the CAR is joined to or configured to be joined to said lipid through an interaction with said target moiety, and wherein the CAR or TCR comprises a spacer domain having a spacer length of 1-22 amino acids, 23-50 amino acids, 51-100 amino acids, 100 to 150 amino acids or 151-250 amino acids or a spacer length that is within a range defined by any two of the aforementioned lengths.
  • the CAR or TCR comprises a sequence as set forth in any one of SEQ ID NOs: 1-6.
  • the spacer domain is an IgG4 hinge connected to a CH2 domain to a CH3 domain. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 7. In some alternatives, the spacer domain is an IgG4 hinge connected to a CH3 domain. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 8. In some alternatives, the spacer domain is an IgG4 hinge only. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 9. In some alternatives, the cell comprises a nucleic acid encoding any one of SEQ ID. NO: 1-9). In some alternatives, the spacer comprises a length of 229 amino acids.
  • the lipid comprises a polar head group and a hydrophobic group.
  • the polar head comprises a choline, a phosphatidylcholine, sphingomyelin, phosphoethanolamine group, an oligosaccharide residue, a sugar residue, phosphatidyl serine or phosphatidyl inositol.
  • the polar-head group comprises phosphocholine, a piperidine moiety or a trimethylarseno-ethyl-phosphate moiety.
  • the hydrophobic group is fatty acid, such as an aliphatic chain. In some alternatives, the fatty acid is saturated or unsaturated.
  • the hydrophobic group comprises an alkyl, alkenyl or alkynyl group. In some alternatives, the hydrophobic group comprises a terpenoid lipid, such as a steroid or cholesterol. In some alternatives, the hydrophobic group comprises an ether linkage, wherein the ether linkage is between the polar head group and the aliphatic chain. In some alternatives, the sugar residue is a glycerol or sugar alcohol. In some alternatives, the hydrophobic group comprises a carbon alkyl chain, wherein the carbon alkyl chain comprises 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 carbons or any number that is within a range defined by any two aforementioned values. In some alternatives, the carbon alkyl chain comprises 18 carbons.
  • the lipid is a phospholipid ether.
  • the target moiety is biotin, digoxigenin, dinitrophenol or fluorescein.
  • the spacer comprises a PEG spacer, a Hapten (2 ⁇ ) spacer, or an alkane chain.
  • the PEG spacer comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16 PEG molecules, or any amount of PEG molecules that is within a range defined by any two aforementioned values.
  • the CAR or TCR is expressed by a cell or a T cell.
  • the CAR or TCR is on the surface of a cell or a T cell.
  • the cell is a precursor T cell.
  • the precursor T cell is a hematopoietic stem cell.
  • the cell is a CD8+T cytotoxic lymphocyte cell selected from the group consisting of na ⁇ ve CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells and bulk CD8+ T cells.
  • the cell is a CD4+T helper lymphocyte cell that is selected from the group consisting of na ⁇ ve CD4+ T cells, central memory CD4+ T cells, effector memory CD4+ T cells, and bulk CD4+ T cells.
  • the lipid is intercalated in a lipid bilayer of a target cell.
  • the target cell is a tumor cell.
  • the target cell is an immune cell.
  • the immune cell is a T cell or a B cell.
  • the target cell is present in a tumor microenvironment.
  • the cell is a precursor T cell.
  • the precursor T cell is a hematopoietic stem cell.
  • the cell is a CD8+T cytotoxic lymphocyte cell selected from the group consisting of na ⁇ ve CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells and bulk CD8+ T cells.
  • the cell is a CD4+T helper lymphocyte cell that is selected from the group consisting of na ⁇ ve CD4+ T cells, central memory CD4+ T cells, effector memory CD4+ T cells, and bulk CD4+ T cells.
  • the lipid is intercalated in a lipid bilayer of a target cell.
  • the target cell is a tumor cell.
  • the target cell is an immune cell.
  • the immune cell is a T cell or a B cell.
  • the target cell is present in a tumor microenvironment.
  • a method of treating, ameliorating, or inhibiting a cancer in a subject comprising a) introducing, providing, or administering to a subject a composition that comprises a lipid, which comprises a target moiety that is bound to a masking moiety, b) introducing, providing, or administering to said subject a cell comprising a chimeric antigen receptor (CAR) or T cell receptor (TCR), which is specific for the target moiety once the masking moiety is removed from the target moiety, and wherein the CAR or TCR comprises a spacer domain, c) removing the masking moiety from the target moiety thereby allowing the target moiety to bind to the CAR present on the cell, and, d) optionally, measuring or evaluating the binding of the cell comprising the CAR to the lipid, after steps a-c and/or e) optionally, measuring or evaluating the treatment, amelioration, or inhibition of said cancer after steps a-d, and/or
  • CAR chimeric antigen receptor
  • the complex or the cell is provided to the subject at the same time as the composition or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 15, 20, 24, 36 or 48 hours before or after administration of the composition, or any time within a range defined by any two aforementioned values.
  • the cell is provided to the subject 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 15, 20, 24, 36 or 48 hours before administration of the composition, or any time within a range defined by any two aforementioned values.
  • the cell is provided to the subject within seconds or minutes, such as less than an hour, of providing the composition to the subject.
  • a boost of the cell and/or the composition is provided to the subject.
  • an additional cancer therapy is provided, such as a small molecule, e.g., a chemical compound, an antibody therapy, e.g., a humanized monoclonal antibody with or without conjugation to a radionuclide, toxin, or drug, surgery, and/or radiation.
  • the cancer is a solid tumor, such as colon, breast, ovarian, lung, pancreatic, prostate, melanoma, renal, pancreatic, glioblastoma, neuroblastoma, medulloblastoma, sarcoma or liver cancer; or a non-solid tumor, such as a leukemia, or a multiple myeloma.
  • the spacer domain is an IgG4 hinge connected to a CH2 domain to a CH3 domain. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 7. In some alternatives, the spacer domain is an IgG4 hinge connected to a CH3 domain. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 8. In some alternatives, the spacer domain is a IgG4 hinge only. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 9. In some alternatives, the spacer comprises a sequence set forth in SEQ ID NO: 7. In some alternatives, binding of the target moiety to the CAR present on the cell induces production of at least one cytokine. In some alternatives, the at least one cytokine comprises IL-2, TNF- ⁇ and/or INF- ⁇ .
  • kits comprising a pharmaceutical grade FL-PLE.
  • the pharmaceutical grade FL-PLE comprises a hapten.
  • the pharmaceutical grade FL-PLE comprises fluorescein (e.g., FITC).
  • FIG. 1 A and FIG. 1 B schematically depict different spacers for CAR T cells.
  • FIG. 1 A shows an example of: (i) a second-generation CAR. The antigen recognition moiety (uppermost portion of molecule), which is presented at a desired distance by a short spacer domain, from the cell surface. This spacer is connected to a transmembrane domain, which is connected to two signaling domains; (ii) a medium spacer CAR, where another domain is added to the short spacer; and (iii) a long spacer CAR, where another domain is added to the medium spacer.
  • FIG. 1 B shows an example of different spacers exposed on CAR T cells.
  • long, medium, and short spacers can comprise a sequence as set forth in SEQ ID NO: 7, 8, and 9, respectively.
  • FIG. 2 schematically depicts an example of spacer length and orientation on a surface of a tumor cell.
  • a tumor cell whose surface is labeled with CART cell tumor targeting agent (CTCT).
  • CTCT CART cell tumor targeting agent
  • the tumor surface has proteins and other cellular debris protruding from the surface, which can impact a CTCT specific CAR's ability to recognize the CAR T cell tumor targeting agent (CTCT).
  • Panels A-C depict example embodiments of a PLE-CTCT imbedded into the lipid membrane
  • panels D-E depict example embodiments of a CAR T cell tumor targeting agent (CTCT) conjugated to a surface protein.
  • CTCT CAR T cell tumor targeting agent
  • a short CAR is unable to reach the CAR T cell tumor targeting agent (CTCT) and will not be able to activate.
  • C CAR T cell tumor targeting agent
  • CCT CAR T cell tumor targeting agent
  • D and E the long CAR from shown in panel C and the short CAR depicted in panel B are both able to recognize and activate through a CAR T cell tumor targeting agent (CTCT) that is conjugated to a surface protein.
  • FIG. 3 schematically depicts an example of a CTCT CART cell recognizing only unmasked PLE-CTCT and being activated.
  • a tumor loaded with a prodrug version of PLE-CTCT.
  • the prodrug provides steric hindrance to the CTCT specific CAR T cell making the Pro-PLE-CTCT unrecognizable to the CTCT specific CAR T cell.
  • FIG. 4 A depicts an example embodiment of a phospholipid conjugated with a hapten, fluorescein (PLE-CTCT). Structure of phospholipid ether (PLE) tethered to the hapten fluorescein (FL-PLE).
  • FL fluorescein
  • FL fluorescein
  • PEG Polyethylene glycol
  • PLE is the polar head group
  • iv is the hydrophobic tail for incorporation or tethering into the cell plasma membrane.
  • FIG. 4 B depicts an example prodrug version of FL-PLE in which a Pro moiety is conjugated to the hapten (fluorescein) via a cleavable bond indicated by the arrow.
  • the masked FL-PLE is substantially non-florescent.
  • the bond can be cleaved by the presence of reactive oxygen species (ROS), such as in a tumor microenvironment.
  • ROS reactive oxygen species
  • FIG. 5 depicts examples of different antiFL scFvs that were selected to create an antiFL CAR library (upper portion).
  • Lower portion depicts structures of example CARs with a long spacer (L), a medium spacer (M), or a short spacer (S).
  • the structures include a leader sequence, an scFv, a hinge/spacer, a CD28tm domain, a 41BB domain, a CD3 ⁇ , a T2A sequence, and an EGFTt domain.
  • L long spacer
  • M medium spacer
  • S short spacer
  • the structures include a leader sequence, an scFv, a hinge/spacer, a CD28tm domain, a 41BB domain, a CD3 ⁇ , a T2A sequence, and an EGFTt domain.
  • L long spacer
  • M medium spacer
  • S short spacer
  • the structures include a leader sequence, an scFv, a hinge/spacer, a CD28tm domain
  • FIG. 6 depicts FACS analysis of CD8+ T cells containing antiFL CARs.
  • Panel (a) and (b) depict T cells staining for the selection marker EGFRt containing either an antiFL(FITC-E2) CAR, which comprises SEQ ID NO: 5 [96% positive], or an antiFL(4M5.3) CAR, which comprises SEQ ID NO: 2 [80% positive], respectively.
  • Panels (c) and (d) depict T cells incubated with a mouse CD19-FITC antibody, then stained with an anti-mouse-Fc-Alexa647 antibody for the bound FITC antibody, for T cells containing either the antiFL(FITC-E2) CAR [97% positive], or the antiFL(4M5.3) CAR [79% positive], respectively.
  • FIG. 7 A depicts a FACS analysis of cells treated with FL-PLE.
  • FIG. 7 B depicts specific lysis of K562 cells in the presence or absence of FL-PLE, and in the presence or absence of CD8+ T cells containing an antiFL CAR.
  • FIG. 7 C depicts cytokine production from K562 cells in the presence or absence of FL-PLE, and in the presence or absence of CD8+ T cells containing an antiFL CAR.
  • FIG. 8 A depicts FACS of various cell lines treated with FL-PLE.
  • FIG. 8 B depicts specific lysis of cells treated with FL-PLE and contacted with CD8+ T cells containing an antiFL(FITC-E2) CAR containing a long spacer.
  • FIG. 9 depicts a FACS analysis of CD8+ T cells contain various antiFL CARs, and staining for a surface marker, EGFRt.
  • FIG. 10 depicts a FACS analysis of CD4+ T cells contain various antiFL CARs, and staining for a surface marker, EGFRt.
  • FIG. 11 depicts a FACS analysis of cells labeled with FL-PLE.
  • FIG. 12 depicts specific lysis of target cells incubated with FL-PLE and contacted with CD8+ T cells containing antiFL CARs.
  • FIG. 13 depicts cytokine production of cells incubated with FL-PLE and contacted with CD4+ T cells containing antiFL CARs.
  • FIG. 14 A depicts specific lysis of target cells incubated with FL-PLE and contacted with CD8+ T cells containing antiFL CARs.
  • FIG. 14 B depicts cytokine production of cells incubated with FL-PLE and contacted with CD4+ T cells containing antiFL CARs.
  • FIG. 15 A depicts a FACS analysis of cells containing various antiFL CARs.
  • FIG. 15 B depicts a FACS analysis of cells treated with FL-PLE.
  • FIG. 15 C depicts a series of graphs for specific lysis of various tumor cells in the presence or absence of FL-PLE, and contacted with various antiFL CARs.
  • FIG. 15 D depicts a series of graphs for cytokine production from T cells containing various antiFL CARs and contacted with various tumor cells in the presence or absence of FL-PLE.
  • FIG. 15 E depicts a series of graphs for cytokine production from T cells containing various antiFL CARs and contacted with various tumor cells in the presence or absence of FL-PLE.
  • FIG. 16 depicts an image of an orthotopic glioma xenograft in a subject which had been dosed intravenously with FL-PLE, and evaluated 48 hr later.
  • Left lower panel is an image of the control contralateral hemisphere of the subject. Both the orthotopic glioma xenograft and the control contralateral hemisphere of the subject were evaluated by staining with an anti-fluorescein antibody. Levels of retained FL-PLE were also quantified in both the orthotopic glioma xenograft and the control contralateral hemisphere, over time (right panel).
  • FIG. 17 depicts graphs demonstrating FL-PLE retention in different tumors in vivo.
  • FIG. 18 A depicts a FACS analysis of cells treated with FL-PLE, or ProFL-PLE.
  • FIG. 18 B depicts specific lysis of cells treated with FL-PLE or ProFL-PLE, and contacted with CD8+ T cells containing an antiFL CAR
  • FIG. 18 C depicts a series of graphs for cytokine product for cells in the presence or absence of masked or unmasked ProFL-PLE and FL-PLE, in the presence or absence of CD4+ T cells containing an antiFL(FITCE2) CAR with a long spacer.
  • FIG. 19 A depicts a FACS analysis of FL-PLE or ProFL-PLE binding to cells.
  • FIG. 19 B depicts a series of graphs for cytokine product for cells in the presence or absence of ProFL-PLE or FL-PLE, in the presence or absence of CD4+ T cells containing an antiFL(FITCE2) CAR with a long spacer.
  • FIG. 19 C depicts a FACS analysis of cells treated with FL-PLE or ProFL-PLE.
  • FIG. 20 depicts a graph of relative life span of mice having a neuroblastoma (Be2) tumor and treated with ProFL-PLE, FL-PLE or control, and administered either T cells containing an antiFL(FITCE2) long spacer CAR which comprised SEQ ID NO: 5, or a control.
  • FIG. 21 A depicts graphs for average tumor progression (top panel), and percent survival (bottom panel) in mice injected intra-tumorally with ProFL-PLE, and administered T cells containing an antiFL(FITCE2) CAR with a long spacer.
  • FIG. 21 B depicts graphs for average tumor progression (top panel), and percent survival (bottom panel) in mice injected intravenously with ProFL-PLE, and administered T cells containing an antiFL(FITCE2) CAR with a long spacer.
  • chimeric antigen receptors with specificity and a selected or designed affinity for the molecule fluorescein when presented on the surface of tumor cells loaded with exogenous FL-PLE, which results in redirected anti-tumor T cell reactivity.
  • FL-PLE is a synthetic molecular structure that is designed to integrate into the plasma membrane of tumors such that the molecule's fluorescein is present adjacent to the outer leaflet of the plasma membrane in the extracellular space.
  • the FL-PLE structure includes therapeutically important attributes.
  • a CAR that targets the fluorescein (FL) moiety of the FL-PLE is provided, and methods of making and using the same are also contemplated. These CARs can either be constitutively expressed or placed under regulated control.
  • CAR T cell therapies was hampered by the onerous task of identifying and vetting tens of hundreds of antigens, such as CAR targets, as was the development of associated CARs in order to address each type of cancer afflicting humans.
  • Previous work developed a FL-PLE that integrates into all tumors displaying one synthetic target molecule for CAR T cells to recognize. This eliminates the need for validation of tens of hundreds of CARs and instead allows for the use of a single FL specific CAR.
  • the present disclosure addresses the identification, creation, and engineering of suitable CAR T cells for binding to the FL moiety of FL-PLE.
  • the FL moiety may be masked and unmasked such that the FL moiety can be activated to receive the CAR T cell.
  • a FL specific CAR may recognize only unmasked CAR T cell tumor targeting agents (CTCTs) and not masked FLs.
  • Some embodiments of the methods and compositions provided herein can include aspects disclosed in WO 2018/148224 entitled “PHOSPHOLIPID ETHER (PLE) CAR T CELL TUMOR TARGETING (CTCT) AGENTS” which is hereby expressly incorporated by reference in its entirety.
  • the term “about” indicates that a value includes the inherent variation of error for the method being employed to determine a value, or the variation that exists among experiments.
  • Chimeric receptor refers to a synthetically designed receptor comprising a ligand binding domain of an antibody or other protein sequence that binds to a molecule associated with the disease or disorder and is linked via a spacer domain to one or more intracellular signaling domains of a T cell or other receptors, such as a costimulatory domain. Chimeric receptor can also be referred to as artificial T cell receptors, chimeric T cell receptors, chimeric immunoreceptors, and chimeric antigen receptors (CARs).
  • CARs chimeric antigen receptors
  • CARs are genetically engineered T-cell receptors designed to redirect T-cells to target cells that express specific cell-surface antigens.
  • T-cells can be removed from a subject and modified so that they can express receptors that can be specific for an antigen by a process called adoptive cell transfer. The T-cells are reintroduced into the patient where they can then recognize and target an antigen.
  • These CARs are engineered receptors that can graft a selected specificity onto an immune receptor cell.
  • CARs chimeric antigen receptors
  • the term chimeric antigen receptors or “CARs” are also considered by some investigators to include the antibody or antibody fragment, the spacer, signaling domain, and transmembrane region. Due to the surprising effects of modifying the different components or domains of the CAR described herein, such as the epitope binding region (for example, antibody fragment, scFv, or portion thereof), spacer, transmembrane domain, and/or signaling domain), the components of the CAR are frequently distinguished throughout this disclosure in terms of independent elements.
  • CAR T cell targeting agent is given its plain and ordinary meaning in view of the specification and can be described, for example as a composition that that can integrate into the membrane of a target cell.
  • the CTCT comprises a lipid, wherein the lipid comprises a target moiety and a masking moiety.
  • the masking moiety may be unmasked in the presence of low pH, ROS species and within a tumor microenvironment, for example.
  • the masking moiety inhibits specific binding of a CAR to the target moiety.
  • the target moiety may be recognized and bound by a chimeric antigen receptor that is specific for the target moiety.
  • the masking moiety is removed at a pH of 4, 5, 6, or 6.5 or any pH in between a range defined by any two aforementioned values.
  • T cell receptor or “TCR” is a molecule that is found on the surface of T lymphocytes or T cells that is responsible for the recognition of fragments of antigen bound to a major histocompatibility complex molecule.
  • Target moiety refers to a specific group or site on a molecule or chemical that is a binding target for another chemical or protein of interest.
  • a complex is provided, wherein the complex comprises a chimeric antigen receptor (CAR) or a T cell receptor (TCR) joined to a lipid, wherein the lipid comprises a target moiety and the CAR is joined to said lipid through an interaction with said target moiety.
  • the target moiety is biotin, digoxigenin, dinitrophenol or fluorescein.
  • a “single-chain variable fragment,” (scFv) is a fusion protein that can have variable regions of the heavy (VH) and light chains (VL) of immunoglobulins, connected with a short linker peptide of ten to 25 amino acids.
  • the short linker peptide can comprise 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 amino acids or any number of amino acids in between a range defined by any two aforementioned values.
  • the linker is usually rich in glycine for flexibility, as well as, serine or threonine for solubility, and can either connect the N-terminus of the VH with the C-terminus of the VL, or vice versa.
  • the scFv can be specific for an antigen.
  • Antigen or “Ag” as used herein, refers to a molecule that provokes an immune response. This immune response can involve either antibody production, or the activation of specific immunologically-competent cells, or both.
  • An antigen can be generated, synthesized, produced recombinantly or can be derived from a biological sample.
  • a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a biological fluid such, for example, blood, plasma or ascites fluid.
  • composition comprising cells manufactured by any one of the alternative methods herein.
  • the cells comprise a chimeric antigen receptor, wherein the chimeric antigen receptor comprises a scFv that is specific for an antigen.
  • Some embodiments provided herein relate to a ScFv described herein as antiFL(FITCE2 TyrH133Ala) (also referred to as antiFL(FITC-E2 Mut2), or as antiFL(Mut2)), which can be incorporated into a CAR in accordance with this disclosure (SEQ ID NO: 1), having an amino acid sequence of
  • Some embodiments provided herein relate to a scFv described herein as antiFL(4M5.3), which can be incorporated into a CAR in accordance with this disclosure (SEQ ID NO: 2), having an amino acid sequence of
  • Some embodiments provided herein relate to a ScFv described herein as antiFL(4420), which can be incorporated into a CAR in accordance with this disclosure (SEQ ID NO: 3), having an amino acid sequence of
  • Some embodiments provided herein relate to a ScFv described herein as antiFL(4D5Flu), which can be incorporated into a CAR in accordance with this disclosure (SEQ ID NO: 4), having an amino acid sequence of
  • Some embodiments provided herein relate to a ScFv described herein as antiFL(FITCE2), which can be incorporated into a CAR in accordance with this disclosure (SEQ ID NO: 5), having an amino acid sequence of
  • Some embodiments provided herein relate to a ScFv described herein as antiFL(FITCE2 HisH131Ala), which can be incorporated into a CAR in accordance with this disclosure (SEQ ID NO: 6), having an amino acid sequence of
  • Antigen specific binding domains can include protein or protein domains that can specifically bind to an epitope on a protein at a low or high binding affinity (fM to mM binding capacity).
  • the fusion protein comprises a protein or portion thereof that can modulate an immune response.
  • the protein comprises an antigen specific binding domain.
  • T-cells or “T lymphocytes” as used herein, can be from any mammalian species, preferably primate, including monkeys, dogs, and humans.
  • the T-cells are allogeneic (from the same species but different donor) as the recipient subject; in some alternatives the T-cells are autologous (the donor and the recipient are the same); in some alternatives the T-cells are syngeneic (the donor and the recipients are different but are identical twins).
  • Combination therapy refers to a therapy that uses more than one medication or modality for a treatment.
  • Combination therapy for example, can also refer to multiple therapies for a single disease, and often all the therapies are pharmaceutical product combinations.
  • Combination therapy can also involve prescribing and administering separate drugs in which the dosage can also have more than one active ingredient.
  • a combination therapy is provided, wherein the combination therapy comprises administering a genetically modified immune cell for modifying a tumor microenvironment.
  • the combination therapy comprises administering a genetically modified immune cell for modulating the suppression of the immune response in a tumor microenvironment.
  • the combination therapy comprises administering a genetically modified immune cell for minimizing the proliferation of tumor and suppressive cells in a subject in need thereof e.g. a human.
  • the combination therapy comprises administering a genetically modified immune cell for increasing the efficiency of an anti-cancer therapy, anti-infection therapy, antibacterial therapy, anti-viral therapy, or anti-tumoral therapy in a subject in need thereof e.g., a human.
  • the combination therapy further comprises administration of an inhibitor.
  • the inhibitor is not an enzymatic inhibitor.
  • the inhibitor is an enzymatic inhibitor.
  • the combination therapy comprises administering a therapeutic dose of an inhibitor or an antibody or a binding fragment thereof. These antibodies or binding fragments thereof can be humanized in some alternatives.
  • the combination therapy can further comprise administering a CAR bearing T-cell to a subject in need e.g., a human.
  • “Chemotherapeutic drugs” are a category of anti-cancer medicaments that can use, for example, chemical substances, such as anti-cancer drugs (chemotherapeutic agents), which can be administered as part of a standardized chemotherapy regimen. Chemotherapeutic drugs can be administered with a curative intent or to prolong life or to reduce symptoms (palliative chemotherapy). Additional chemotherapies can also include hormonal therapy and targeted therapy, as it is one of the major categories of medical oncology (pharmacotherapy for cancer). These modalities are often used in conjunction with other cancer therapies, such as radiation therapy, surgery, and/or hyperthermia therapy. In a few cases, cancer has been known to spread due to surgery. In some alternatives, a genetically modified immune cell is administered to the tumor site prior to or after a surgical procedure.
  • Chemotherapy in which chemotherapeutic drugs are administered, can use one drug at a time (single-agent chemotherapy) or several drugs at once (combination chemotherapy or polychemotherapy). The combination of chemotherapy and radiotherapy is chemoradiotherapy. Chemotherapy using drugs that convert to cytotoxic activity only upon light exposure is called photochemotherapy or photodynamic therapy.
  • the method can further comprise administering to a subject having cancer, photochemotherapy or photodynamic therapy after receiving the genetically modified immune cells or genetically engineered macrophages (GEMs).
  • GEMs genetically engineered macrophages
  • Chemotherapuetic drugs can include but are not limited to antibody-drug conjugates (for example, an antibody attached to a drug by a linker), nanoparticles (for example a nanoparticle can be 1-1000 nanometer sized particle for promoting tumor selectivity and aid in delivering low-solubility drugs), electochemotherapy, alkylating agents, antimetabolites (for example, 5-fluorouracil (5-FU), 6-mercaptopurine (6-MP), Capecitabine (Xeloda®), Cladribine, Clofarabine, Cytarabine (Ara-C®), Floxuridine, Fludarabine, Gemcitabine (Gemzar®), Hydroxyurea, Methotrexate, Pemetrexed (Alimta®), Pentostatin, or Thioguanine), anti-tumor antibiotics, topoisomerase inhibitors, mitotic inhibitors, corticosteroids, DNA intercalating agents, or checkpoint inhibitors (for example checkpoint kinases CHK1,
  • the genetically modified immune cells or compositions comprising genetically modified immune cells are administered in combination with one or more anti-cancer agents, such as any one or more of the foregoing compounds or therapies.
  • the one or more anti-cancer agent that is co-administered or administered in conjunction with the genetically modified immune cells comprises antibody-drug conjugates, nanoparticles, electrochemotherapy, alkylating agents, antimetabolites, anti-tumor antibiotics, topoisomerase inhibitors, mitotic inhibitors, corticosteroids, DNA intercalating agents, or checkpoint inhibitors.
  • the antimetabolites comprise 5-fluorouracil (5-FU), 6-mercaptopurine (6-MP), Capecitabine (Xeloda®), Cladribine, Clofarabine, Cytarabine (Ara-C®), Floxuridine, Fludarabine, Gemcitabine (Gemzar®), Hydroxyurea, Methotrexate, Pemetrexed (Alimta®), Pentostatin, or Thioguanine.
  • Subject refers to any organism upon which the alternatives described herein may be used or administered, e.g., for experimental, diagnostic, prophylactic, and/or therapeutic purposes.
  • Subjects or patients include, for example, animals.
  • the subject is mice, rats, rabbits, non-human primates, and humans.
  • the subject is a cow, sheep, pig, horse, dog, cat, primate or a human.
  • CCT CAR T cell tumor targeting
  • FL-PLE hapten fluorescein
  • fluorescein is a synthetic organic compound that is soluble in water and alcohol. It is widely used as a fluorescent tracer for many applications.
  • fluorescein is a target moiety on a lipid that is specifically recognized by a chimeric antigen receptor designed and/or selected for its ability to bind or interact with the fluorescein.
  • the lipid is a phospholipid ether.
  • lipid as described herein, is a class of organic compounds that comprise carbon chains, fatty acids or a fatty acid derivative that is typically insoluble in water but can integrate into or mix with hydrophobic or organic solvents.
  • lipids can include fats, waxes, fat soluble vitamins, monoglycerides, diglycerides, triglycerides, sphingolipids, cerebrosides, ceramides, or phospholipids. Described herein are amphiphilic lipids that can have a polar head group and a hydrophobic moiety or hydrophobic group.
  • “Hydrophobic group” or hydrophobic moiety is a molecule or a part of a molecule that is repelled from a mass of water and tends to be non-polar. This can include alkanes, oils or fats.
  • lipids can be glycerolipids, glycerophospholipids, sphingolipids, sterol lipids, prenol lipids, saccharolipids or polyketides.
  • a complex is provided, wherein the complex comprises a lipid.
  • the lipid comprises a polar head group and a hydrophobic moiety.
  • the hydrophobic moiety is a hydrophobic carbon tail.
  • the hydrophobic carbon tail is saturated or unsaturated. In some alternatives, the hydrophobic carbon tail comprises 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25 carbons or any number of carbons in between a range set forth in any aforementioned value. In some alternatives, the hydrophobic moiety is a steroid or a cholesterol. In some alternatives, the lipid comprises a glycerolipid, glycerophospholipid, sphingolipid, sterol lipid, prenol lipid, saccharolipid or polyketide. In some alternatives, the lipid is a phospholipid ether. In some alternatives, the lipid contains branched alkyl tails.
  • the lipid can be a sphingolipid.
  • the sphingolipid can contain a backbone of sphingoid bases, such as a set of aliphatic amino alcohols that includes sphingosine.
  • a sphingolipid with an R group consisting of a hydrogen atom only is a ceramide.
  • Other common R groups include phosphocholine, yielding a sphingomyelin, and various sugar monomers or dimers, yielding cerebrosides and globosides, respectively. Cerebrosides and globosides are collectively known as glycosphingolipids.
  • the lipid is a glycosphingolipid.
  • the lipid comprises a polar head group and a hydrophobic group.
  • the hydrophobic group comprises a fatty acid such as an aliphatic chain. The fatty acid can be saturated or unsaturated.
  • the hydrophobic group comprises an alkyl, alkenyl or alkynyl group.
  • the hydrophobic group comprises a terpenoid lipid, such as a steroid or cholesterol.
  • the hydrophobic group comprises an ether linkage, wherein the ether linkage is between the polar head group and the aliphatic chain.
  • the lipid is a phospholipid ether.
  • the polar head comprises a choline, a phosphatidylcholine, sphingomyelin, phosphoethanolamine group, an oligosaccharide residue, a sugar residue, phosphatidyl serine or phosphatidyl inositol.
  • the sugar is a glycerol or sugar alcohol.
  • the lipid is a single chain alkylphospholipid.
  • the lipid comprises a structure of synthetic alkylphospholipids, such as edelfosine, perifosine or erucylphosphocholine.
  • the lipid is a lysophosphatidylcholine, edlfosine, erucylphosphocholine, D-21805 or perfisone.
  • Such lipids are described for example, in van der Lui et al (“A new class of anticancer alkylphospholipids uses lipid rafts as membrane gateways to induce apoptosis in lymphoma cells” Mol Cancer Ther 2007; 6(8), 2007; hereby expressly incorporated by reference in its entirety).
  • a choline within the polar head group can be substituted with a piperidine moiety.
  • the lipid is an anticancer alkylphospholipid.
  • Anticancer phospholipids are described by vander Lui et al. (“A new class of anticancer alkylphospholipids uses lipid rafts as membrane gateways to induce apoptosis in lymphoma cells” Mol Cancer Ther 2007; 6(8), 2007; hereby expressly incorporated by reference in its entirety).
  • the lipids provided herein are synthetic and structurally related antitumor agents that interact with a cell membrane. These types of synthetic lipids are alkylphospholipids and are described by e.g., van Blitterswijk et al. (“Anticancer mechanisms and clinical application of alkylphopholipids” Biochimica et Biophysica Acta 1831 (2013) 663-674; hereby incorporated by reference in its entirety herein).
  • the synthetic alkylphospholipids can include edelfosine, miltefosine, perifosine, erucylphosphocholine or Erufosine.
  • the lipid is edelfosine, miltefosine, perifosine, erucylphosphocholine or Erufosine.
  • the lipid is a stable analog of lysophosphatidylcholine.
  • the lipid is a thio-ether variant of edelfosine, or 1-hexadecylthio-2-methoxymethyl-rac-glycero-3-phosphocholine.
  • the lipid is LysoPC, edelfosine, Ilmofosine, Miltefosine, Perifosine, Erucylphophocholine, or Erufosine.
  • “Polar-head group” as described herein is the hydrophilic group of a lipid, such as a phospholipid.
  • “Phospholipids” as described herein are a specific class of lipids that can form lipid bilayers due to their amphiphilic characteristic.
  • the phospholipid molecule comprises at least one hydrophobic fatty acid “tail” and a hydrophilic “head” or “polar-head group.”
  • the phospholipid or phospholipid ether comprises a polar-head group.
  • the polar-head group comprises phosphocholine, a piperidine moiety or a trimethylarseno-ethyl-phosphate moiety.
  • the lipid comprises a target moiety and the CAR is joined to or is configured to join to said lipid through an interaction with said target moiety.
  • the lipid comprises a polar-head group (e.g., comprising an aromatic ring) and a carbon alkyl chain.
  • a complex is provided, wherein the complex comprises one or more of said lipids.
  • the lipid comprises a polar head group.
  • the lipid is a phospholipid ether.
  • the phospholipid ether comprises a target moiety and the CAR is joined to or is configured to join to said phospholipid ether through an interaction and/or binding with said target moiety.
  • the phospholipid ether comprises a polar-head group and a carbon alkyl chain.
  • the polar head group comprises a choline, a phosphatidylcholine, sphingomyelin, phosphoethanolamine group, an oligosaccharide residue, a sugar residue, phosphatidyl serine or phosphatidyl inositol.
  • the polar head group comprises phosphocholine, a piperidine moiety or a trimethylarseno-ethyl-phosphate moiety.
  • the lipid is a phospholipid ether.
  • the sugar is a glycerol or sugar alcohol.
  • the polar head group comprises a sugar group.
  • the lipid comprises a mannose-containing head group.
  • the polar head group comprises sphingosine.
  • the polar head group comprises a glucose.
  • the polar head group comprises a di-, tri- or tetra-saccharide.
  • the lipid is a glucosylcerebroside.
  • the lipid is a lactosylceramide.
  • the lipid is a glycolipid.
  • the glycolipid comprises sugar units, such as n-glucose, n-galactose or N-actyl-n-glactosamine.
  • the lipid comprises a hydrocarbon ring such as a sterol.
  • the polar head group of the lipid comprises glycerol or a sugar alcohol. In some alternatives, the polar head group of the lipid comprises a phosphate group. In some alternatives, the polar head group of the lipid comprises choline. In some alternatives, the lipid is a phosphatidylethanolomine. In some alternatives, the lipid is a phosphatidylinositol. In some alternatives, the lipid comprises a sphingoid base backbone. In some alternatives, the lipid comprises a sterol lipid, such as cholesterol or its derivatives. In some alternatives, the lipid comprises saccharolipids. In some alternatives, the polar head group comprises choline, phosphate and/or glycerol.
  • the lipid is a glycolipid. In some alternatives, the lipid comprises a sugar. In some alternatives, the lipid is derived from sphingosine. In some alternatives, the lipid is a glycerol-glycolipid or a sphingo-glycolipid.
  • the lipid is an ether lipid with branched hydrophobic chains.
  • “Saturated” as described herein is a fatty acid molecule, in which there are no double bonds within the carbon molecules. Unsaturated as described herein indicates that there are one or more double bonds in a fatty acid chain.
  • a complex comprising a lipid is provided.
  • the lipid comprises a fatty acid chain, in which the fatty acid is saturated or unsaturated.
  • Alkyl as described herein, is an alkyl substituent that has a missing hydrogen.
  • alkenyl is an unsaturated hydrocarbon that contains at least one carbon-carbon double bond.
  • alkynyl is an unsaturated hydrocarbon containing at least one carbon-carbon triple bond.
  • Steroid as described herein, is a molecule that is derived from five carbon isoprene units. Steroids and sterols can be produced from terpenoid precursors. For example, steroids and cholesterol can be biosynthesized by terpenoid precursors.
  • Phospholipid ether as described herein is a lipid in which one or more of the carbon atoms on a polar head group are bonded to an alkyl chain via an ether linkage, as opposed to the more common ester linkage.
  • the polar head group is a glycerol.
  • the spacer for a chimeric antigen receptor refers to a polypeptide spacer, which spacer length is configured to or is selected for its ability to promote an increase in binding or interaction with a chimeric antigen receptor or to reduce or minimizes an adverse side effect associated with CAR T cell therapy.
  • a short spacer domain of a CAR has about 12 amino acids or less but greater than 1 amino acid and comprises all or a portion of a IgG4 hinge region sequence or variant thereof.
  • an intermediate spacer domain of a CAR has about 119 amino acids or less but greater than 1 amino acid and comprises all or a portion of a IgG4 hinge region sequence and a CH3 region or variant thereof.
  • a long spacer domain of a CAR has about 229 amino acids or less but greater than 1 amino acid and comprises all or a portion of a IgG4 hinge region sequence, a CH2 region, and a CH3 region or variant thereof.
  • the lipid can also comprise a spacer that separates the target moiety from the lipid and is bound to the polar-head group of the lipid.
  • the spacer of the lipid can comprise a PEG spacer, a Hapten spacer, a small peptide or an alkane chain.
  • the hapten spacer comprises two haptens (hapten (2 ⁇ ) spacer).
  • the lipid comprises a hydrophobic group, such as an alkane chain.
  • the alkane chain can comprise 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or 18 carbons, or any number of carbons between a range defined by any two aforementioned values.
  • the PEG spacer comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16 PEG molecules, or any amount of PEG molecules that is within a range defined by any two aforementioned values.
  • Hapten as described herein is a small molecule that elicit an immune response only when attached to a large carrier such as a protein; the carrier may be one that also does not elicit an immune response by itself. Once the body has generated antibodies to a hapten-carrier adduct, the small-molecule hapten may also be able to bind to the antibody, but it will usually not initiate an immune response; usually only the hapten-carrier adduct can do this.
  • a hapten is a small molecule binding moiety, which can be bound by or have specificity towards a scFv or antibody.
  • the cells provided are cytotoxic T lymphocytes.
  • “Cytotoxic T lymphocyte” (CTL) as used herein refers to a T lymphocyte that expresses CD8 on the surface thereof (e.g., a CD8 + T cell).
  • such cells are preferably “memory” T cells (TM cells) that are antigen-experienced.
  • the cell is a precursor T cell.
  • the precursor T cell is a hematopoietic stem cell.
  • the cell is a CD8+T cytotoxic lymphocyte cell selected from the group consisting of na ⁇ ve CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells and bulk CD8+ T cells.
  • the cell is a CD4+T helper lymphocyte cell that is selected from the group consisting of na ⁇ ve CD4+ T cells, central memory CD4+ T cells, effector memory CD4+ T cells, and bulk CD4+ T cells.
  • “Masking moiety” as used herein refers to a moiety on a lipid ether that is bound to the target moiety.
  • the masking moiety functions as a protective group to prevent recognition of the lipid's target moiety by blocking binding and recognition of a chimeric antigen receptor that is specific for the target moiety.
  • the masking moiety can be self-cleaved, thus allowing binding, interaction and/or recognition of the target moiety by the chimeric antigen receptor.
  • the lipid is a phospholipid ether.
  • the masking moiety comprises a phenolic hydroxyl group or PEG.
  • the phenolic hydroxyl group is bound to a hydroxyl on a xanthene moiety of fluorescein.
  • the masking moiety is bound to the target moiety by a cleavable moiety, which is optionally configured to be specifically cleavable in a tumor microenvironment.
  • the cleavable moiety which is configured to be cleavable in a tumor microenvironment, is cleaved by a reactive oxygen species reaction, an acidic pH, hypoxia, or nitrosylation.
  • the phospholipid ether comprises a target moiety and the CAR is joined to said phospholipid ether through an interaction with said target moiety.
  • the phospholipid ether comprises a polar-head group and a carbon alkyl chain.
  • Cancer is a group of diseases involving abnormal cell growth with the potential to invade or spread to other parts of the body.
  • Subjects that can be addressed using the methods described herein include subjects identified or selected as having cancer, including but not limited to colon, lung, liver, breast, renal, prostate, ovarian, skin (including melanoma), bone, leukemia, multiple myeloma, or brain cancer, etc. Such identification and/or selection can be made by clinical or diagnostic evaluation.
  • the tumor associated antigens or molecules are known, such as melanoma, breast cancer, brain cancer, squamous cell carcinoma, colon cancer, leukemia, myeloma, or prostate cancer.
  • Examples include but are not limited to B cell lymphoma, breast cancer, brain cancer, prostate cancer, and/or leukemia.
  • one or more oncogenic polypeptides are associated with kidney, uterine, colon, lung, liver, breast, renal, prostate, ovarian, skin (including melanoma), bone, brain cancer, adenocarcinoma, pancreatic cancer, chronic myelogenous leukemia or leukemia.
  • a method of treating, ameliorating, or inhibiting a cancer in a subject is provided.
  • the cancer is breast, ovarian, lung, pancreatic, prostate, melanoma, renal, pancreatic, glioblastoma, neuroblastoma, medulloblastoma, sarcoma, liver, colon, skin (including melanoma), bone or brain cancer.
  • the subject that receives one of the therapies described herein is also selected to receive an additional cancer therapy, which can include a cancer therapeutic, radiation, chemotherapy, or a cancer therapy drug.
  • the cancer therapy drug provided comprises Abiraterone, Alemtuzumab, Anastrozole, Aprepitant, Arsenic trioxide, Atezolizumab, Azacitidine, Bevacizumab, Bleomycin, Bortezomib, Cabazitaxel, Capecitabine, Carboplatin, Cetuximab, Chemotherapy drug combinations, Cisplatin, Crizotinib, Cyclophosphamide, Cytarabine, Denosumab, Docetaxel, Doxorubicin, Eribulin, Erlotinib, Etoposide, Everolimus, Exemestane, Filgrastim, Fluorouracil, Fulvestrant, Gemcitabine, Imatinib, Imiquimod, Ipilimumab, Ixabepilone, Lapatinib, Lenalidomide, Letrozole, Leuprolide, Mesna, Methotrexate, Nivolumab
  • Tumor microenvironment as described herein is a cellular environment, wherein a tumor exists.
  • the tumor microenvironment can include surrounding blood vessels, immune cells, fibroblasts, bone marrow-derived inflammatory cells, lymphocytes, signaling molecules or the extracellular matrix (ECM).
  • ECM extracellular matrix
  • the method includes human tumor therapy in which patients receive infusions of FL-PLE or derivatives thereof in combination with infusions of FL-specific CAR T cells.
  • this system represents a universal target antigen used in combination with a universal CAR and/or universal CAR expressing anti-tumor effector cells.
  • a PLE (18C alkyl chain) having a FL appended CAR recognition element, which is appended to the polar head group's choline via three repeat PEG spacers is provided.
  • An antiFL CAR library may be generated with different single chain variable fragments (scFvs), such as 6 or more different scFvs, with dissociation constants ranging from 200 fM to 10 nM, such as 200 fM, 210 fM, 220 fM, 230 fM, 240 fM, 250 fM, 260 fM, 270 fM, 280 fM, 290 fM, 300 fM, 400 fM, 500 fM, 600 fM, 700 fM, 800 fM, 900 fM, 1 pM, 100 pM, 200 pM, 300 pM, 400 pM, 500 pM, 600 pM, 700 pM, 800 pM, 900 pM, 1 nM, 2 nM, 3 nM, 4 nM, 5 nM, 6 nM, 7 nM, 8 nM, 9 nM, or 10 nm, or
  • Each scFv binds FL in a slightly different manner.
  • the binding of scFv to FL is partially due to the difference in binding affinities through mutations in the binding pocket and due to the fact that some scFvs were derived from phage display compared to yeast display.
  • three different spacers may be used, including, for example: long, IgG4 hinge connected to a CH2 domain to a CH3 domain; medium, IgG4 hinge connected to a CH3 domain; and short, IgG4 hinge only.
  • only FL-specific scFv CAR T cells with the correct orientation and spacer length exhibit redirected anti-tumor function in both in vitro and in vivo tumors loaded with FL PLE-CTCTs.
  • shape and size of the scFv's binding pocket can play a role in how well the CAR can activate.
  • a FL-specific CAR T cell comprising a targeting and recognition domain presented in a correct orientation with spacing and a binding affinity selected to create a desired T cell response.
  • the spacing is selected for generating a T cell response in the specific cells of interest.
  • the binding affinity is selected for generating a T cell response in the specific cells of interest.
  • different tumors or cells benefit from different orientation, different spacer lengths, and affinities of CAR T cells to allow for desired CAR T cell responses. Therefore, some embodiments provided herein relate to generating a desired or selected combination of orientation, spacer length, and binding affinity for a selected therapy.
  • an indication or measure of successful CAR T cells in vitro include cell lysis and the production of cytokines.
  • short spacer CARs typically do not produce cytokines; whereas the long spacer CARs produce a large quantity of cytokines.
  • an antiFL(4D5Flu) CAR which comprises SEQ ID NO: 4, and which is not able to produce cytokines with FL-PLE, is provided; whereas when cells are labeled with FL by another approach the antiFL(4D5Flu) CAR produces cytokines highlighting that the orientation of scFv to FL moiety of FL-PLE is an important and previously unrecognized variable in T cell activity.
  • lowering the dissociation constant such as improving the binding affinity, does not necessarily improve the activation of the CAR.
  • asymmetric T cell antitumor reactivity does not correlate with scFv KD.
  • asymmetric T cell antitumor reactivity may be spacer length dependent.
  • an antiFL(FITC-E2 Mut2) CAR which comprises SEQ ID NO: 1
  • is a robust CAR which could not have been predicted from any prior knowledge of CAR structure function or scFv studies. In contrast, the field teaches that the highest scFv affinity results in the best CAR.
  • FL-PLE administered to tumor-bearing mammals serves as a generic tumor-targeting agent that is retained on the tumor cell plasma membrane for recognition by FL-specific CAR T cells.
  • Identification of a FL-specific CAR with unexpected T cell signaling robustness upon engagement of tumor cells loaded with FL-PLE is provided herein.
  • This disclosure relates, in some embodiments, to the full development of a pharmaceutical-grade FL-PLE to be used in conjunction with a CAR T cell product, including in a kit. Other haptens could replace FL with CAR designed to react with these PLEs.
  • Some embodiments of the methods and compositions provided herein include methods of treating or ameliorating or inhibiting a cancer in a subject. Some such embodiments include administering an effective amount to the subject a composition comprising a lipid conjugated to a target moiety, wherein the target moiety comprises a masking moiety; and administering a cell, such as a population of the cells, to the subject, wherein the cell comprises a chimeric antigen receptor (CAR) or T cell receptor (TCR), which specifically binds to the target moiety in the absence of the masking moiety, wherein the CAR or TCR comprises: an amino acid sequence having at least 95% identity with a sequence selected from SEQ ID NO:01-06; and/or a spacer domain comprising, consisting essentially of, or consisting of: a IgG4 hinge connected to a CH2 domain to a CH3 domain, such as a long spacer having an amino acid sequence with at least 95% identity with SEQ ID NO:07, or having an amino acid sequence of SEQ ID
  • the CAR or TCR comprises an amino acid sequence selected from SEQ ID NO: 1-6.
  • the spacer comprises a length of 229 amino acids.
  • the CAR or TCR comprises an scFv domain having the amino acid sequence of SEQ ID NO:1 (FITC-E2 Mut2); and a spacer domain having the amino acid sequence of SEQ ID NO:07 (an exemplary long spacer).
  • the CAR or TCR comprises an scFv domain having the amino acid sequence of SEQ ID NO:2 (4M5.3); and a spacer domain having the amino acid sequence of SEQ ID NO:07 (an exemplary long spacer).
  • the CAR or TCR comprises: an scFv domain having the amino acid sequence of SEQ ID NO:5 (FITC-E2); and a spacer domain having the amino acid sequence of SEQ ID NO:07 (an exemplary long spacer).
  • Some embodiments of the methods and compositions provided herein include methods method of treating, ameliorating, or inhibiting a cancer in a subject comprising (a) introducing, providing, or administering to a subject a composition that comprises a lipid, which comprises a target moiety that is bound to a masking moiety; (b) introducing, providing, or administering to said subject a cell comprising a chimeric antigen receptor (CAR) or T cell receptor (TCR), which is specific for the target moiety once the masking moiety is removed from the target moiety, wherein the CAR or TCR comprises a spacer domain having a spacer length of 1-22 amino acids, 23-50 amino acids, 51-100 amino acids, 100 to 150 amino acids or 151-250 amino acids, wherein: the CAR or TCR comprises a sequence selected from SEQ ID NO:01-06; and/or the spacer domain comprises, consists essentially of, or consists of: an IgG4 hinge connected to a CH2 domain to a CH3 domain, such as a
  • the cell is provided to the subject at the same time or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 15, 20, 24, 36 or 48 hours before or after administration of the composition, or any time within a range defined by any two aforementioned values. In some embodiments, the cell is provided to the subject 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 15, 20, 24, 36 or 48 hours before administration of the composition, or any time within a range defined by any two aforementioned values. In some embodiments, the cell is provided to the subject within seconds or minutes, such as less than an hour, of providing the composition to the subject.
  • a boost of the cell and/or the composition is provided to the subject.
  • an additional cancer therapy is provided to said subject, such as a small molecule, e.g., a chemical compound, an antibody therapy, e.g., a humanized monoclonal antibody with or without conjugation to a radionuclide, toxin, or drug, surgery, and/or radiation.
  • a small molecule e.g., a chemical compound
  • an antibody therapy e.g., a humanized monoclonal antibody with or without conjugation to a radionuclide, toxin, or drug, surgery, and/or radiation.
  • the cancer is a solid tumor.
  • the cancer is a colon cancer, breast cancer, ovarian cancer, lung cancer, pancreatic cancer, prostate cancer, melanoma, renal cancer, pancreatic cancer, brain cancer, glioblastoma, neuroblastoma, medulloblastoma, sarcoma, bone cancer, bladder cancer, head and neck cancer, or liver cancer.
  • the cancer is a non-solid tumor, such as a leukemia or multiple myeloma. Examples of solid tumors include sarcomas, carcinomas, and lymphomas. More examples of cancers, such as solid and non-solid tumors are listed in Amin, M. B., et al., (Eds.). AJCC Cancer Staging Manual (8th edition). Springer International Publishing: American Joint Commission on Cancer; 2017 which is incorporated herein by reference in its entirety.
  • binding of the target moiety to the CAR present on the cell induces production of at least one cytokine.
  • the at least one cytokine comprises IL-2, TNF- ⁇ and/or INF- ⁇ .
  • the lipid comprises a polar head group and a hydrophobic group.
  • the polar head comprises a choline, a phosphatidylcholine, sphingomyelin, phosphoethanolamine group, an oligosaccharide residue, a sugar residue, phosphatidyl serine or phosphatidyl inositol.
  • the polar-head group comprises phosphocholine, a piperidine moiety or a trimethylarseno-ethyl-phosphate moiety.
  • the hydrophobic group is fatty acid, such as an aliphatic chain. In some embodiments, the fatty acid is saturated or unsaturated.
  • the hydrophobic group comprises an alkyl, alkenyl or alkynyl group. In some embodiments, the hydrophobic group comprises a terpenoid lipid, such as a steroid or cholesterol. In some embodiments, the hydrophobic group comprises an ether linkage, wherein the ether linkage is between the polar head group and the aliphatic chain. In some embodiments, the sugar residue is a glycerol or a sugar alcohol. In some embodiments, the hydrophobic group comprises a carbon alkyl chain, wherein the carbon alkyl chain comprises 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 carbons or any number that is within a range defined by any two aforementioned values. In some embodiments, the carbon alkyl chain comprises 18 carbons. In some embodiments, the lipid is a phospholipid ether.
  • the target moiety is biotin, digoxigenin, dinitrophenol, or fluorescein, or a derivative thereof. In some embodiments, the target moiety is fluorescein, or a derivative thereof.
  • the spacer comprises a polyethylene glycol (PEG) spacer, a Hapten (2 ⁇ ) spacer, or an alkane chain.
  • PEG spacer comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16 PEG molecules, or any amount of PEG molecules that is within a range defined by any two aforementioned values.
  • the cell is a precursor T cell. In some embodiments, the precursor T cell is a hematopoietic stem cell. In some embodiments, na ⁇ ve CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells and bulk CD8+ T cells. In some embodiments, the cell is a CD4+T helper lymphocyte cell that is selected from the group consisting of na ⁇ ve CD4+ T cells, central memory CD4+ T cells, effector memory CD4+ T cells, and bulk CD4+ T cells.
  • kits can include a pharmaceutical grade lipid conjugated with a targeting moiety.
  • the lipid comprises a polar head group and a hydrophobic group.
  • the polar head comprises a choline, a phosphatidylcholine, sphingomyelin, phosphoethanolamine group, an oligosaccharide residue, a sugar residue, phosphatidyl serine or phosphatidyl inositol.
  • the polar-head group comprises phosphocholine, a piperidine moiety or a trimethylarseno-ethyl-phosphate moiety.
  • the hydrophobic group is fatty acid, such as an aliphatic chain. In some embodiments, the fatty acid is saturated or unsaturated.
  • the hydrophobic group comprises an alkyl, alkenyl or alkynyl group. In some embodiments, the hydrophobic group comprises a terpenoid lipid, such as a steroid or cholesterol. In some embodiments, the hydrophobic group comprises an ether linkage, wherein the ether linkage is between the polar head group and the aliphatic chain. In some embodiments, the sugar residue is a glycerol or a sugar alcohol. In some embodiments, the hydrophobic group comprises a carbon alkyl chain, wherein the carbon alkyl chain comprises 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 carbons or any number that is within a range defined by any two aforementioned values. In some embodiments, the carbon alkyl chain comprises 18 carbons. In some embodiments, the lipid is a phospholipid ether.
  • the target moiety is biotin, digoxigenin, dinitrophenol, or fluorescein, or a derivative thereof. In some embodiments, the target moiety is fluorescein, or a derivative thereof.
  • the spacer comprises a polyethylene glycol (PEG) spacer, a Hapten (2 ⁇ ) spacer, or an alkane chain.
  • PEG spacer comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16 PEG molecules, or any amount of PEG molecules that is within a range defined by any two aforementioned values.
  • T cells were isolated from leukocyte reduction “cones” that are normally disposed of after plateletpheresis. Specifically, Ficoll density centrifugation was used to generate the T cell-containing peripheral blood mononuclear cell (PBMC) fraction and CD8+ and CD4+ T cells were sequentially purified using the appropriate magnetic enrichment kits. T cells were either immediately placed into CAR production the same day as isolation. T cells, ranging from 0.5-5 million cells, were stimulated with anti-human CD3/CD28 activator beads at a 1:1 ratio on Day 0. In some alternatives, the concentrations of the cells can range between 0.5, 1, 2, 3, 4 or 5 million cells that are produced for use with the anti-human CD3/CD28 activator beads.
  • PBMC peripheral blood mononuclear cell
  • T cells were transduced with CAR-containing lentivirus at a multiplicity of infection (MOI) ranging from 1 to 6 in the presence of protamine sulfate via spinoculation.
  • MOI multiplicity of infection
  • Half or full-media exchanges were conducted every 2-3 days to maintain the cell cultures at appropriate cell densities and expanded to larger culture vessels as needed. In general, cells were moved to larger culture vessels when cell concentrations reach 1.5-2 million cells/mL or when cultures appear visibly dense and media is yellow.
  • CD4+ T cells were reconstituted with fresh rhlL-7 and rhlL-15 at a final concentration of 50 ng/mL and 0.5 ng/mL, respectively, and CD8+ T cells were reconstituted with fresh rhlL-2 and rhlL-15 at a final concentration of 50 U/mL and 0.5 ng/mL, respectively.
  • Activator beads were magnetically removed on Days 9-11 of stimulation.
  • CAR T cells that did not contain DHFRdm for methotrexate-mediated selection of CAR expression such as those used in examples depicted in FIG. 8 B , FIG. 15 A , FIG. 15 C , FIG. 15 D , FIG. 15 D , FIG. 15 E , FIG. 18 C , FIG. 19 b , FIG. 19 C , FIG. 21 A and FIG. 21 B
  • cells were magnetically sorted based on reporter EGFRt expression using biotinylated antibody and anti-biotin microbeads during Days 10-21 of culture.
  • CAR T cells that did contain DHFRdm for methotrexate-mediated enrichment of CAR expression such as those used in examples depicted in FIG. 9 , FIG.
  • cells were first treated on Days 7-14 of culture with 50 nM methotrexate, then ramped up to 100 nM methotrexate on Days 14-19 of culture, and finally brought back down to 50 nM for Days 19-21 of culture.
  • methotrexate selection cells were separated on Ficol on Day 12 of culture to remove dead cells and improve culture viability.
  • T cells for each CAR were placed into a rapid expansion protocol (REP) with irradiated feeder PBMCs and TM-LCL cells. If fresh, unfrozen PBMCs were used, 25 million PBMCs and 5 million TM-LCL cells were used in each REP culture. If frozen PBMCs were used, these feeder cell numbers were doubled. PBMCs and TM-LCL cells were irradiated at 3500 and 8000 rads, respectively, using a Cesium source irradiator. In addition to the normal cytokines mentioned above, cells were also supplemented with OKT3 antibody at 30 ng/ ⁇ L for Days 0-5 of REP to provide acute TCR stimulation.
  • OKT3 antibody OKT3 antibody at 30 ng/ ⁇ L for Days 0-5 of REP to provide acute TCR stimulation.
  • Irradiated feeder cells disintegrated by Day 5 of REP, and CAR T cells were maintained similarly to as described herein.
  • CAR T cells that did contain DHFRdm for methotrexate-mediated enrichment of CAR expression such as those used in examples depicted in FIG. 9 , FIG. 10 , FIG. 12 , FIG. 13 , FIG. 14 A , and FIG. 14 B
  • 100 nM methotrexate was not introduced until Day 5 of REP and was maintained until Day 12 of REP to further enrich CAR-positive cells.
  • all CAR T cells described herein were introduced into functional chromium release cytotoxicity assays (CD8+ T cells only) as well as functional 3-plex cytokine release assays (CD4+ and CD8+ T cells).
  • Target cells were incubated with 51 Cr overnight.
  • the CTCT-PLE was also present in the media overnight with the 51 Cr.
  • CD8+ antiFL and mock T cell effectors (usually in day 8-16 of a rapid expansion protocol) were washed, seeded with the target cells in triplicate at various E:T ratios (30:1, 10:1, 3:1, 1:1), and allowed to co-incubate for 4 hours at 37° C.
  • E:T ratios (30:1, 10:1, 3:1, 1:1
  • the CTCT-PLE was incubated overnight in media. The next day all target cells were harvested, washed, and seeded in a 96 well plate at a concentration of 5 ⁇ 10 4 cells per well. CD8+ antiFL and mock T cell effectors (usually in day 8-16 of a rapid expansion protocol) were washed and seeded (1 ⁇ 10 5 cells/well) with the target cells allowed to co-incubate for 24 hours at 37° C. After 24 hr the supernatant was harvested and IFN-gamma, TNF-alpha, and IL-2 concentration in the supernatant were measured by using a BioPlex® 200 system (Bio-Rad).
  • FIG. 6 depicts cell positivity of CD8+ antiFL CARs T cell via staining for the selection marker EGFRt.
  • antiFL(FITC-E2) CAR which comprised SEQ ID NO: 5 [96% positive].
  • antiFL(4M5.3) CAR which comprised SEQ ID NO: 2 [80% positive].
  • a mouse CD19-FITC antibody was incubated with the T cells and washed out.
  • the binding domains of the CARs can comprise a sequence as set forth in SEQ ID NO: 1-6, and the spacer domains, which may also be part of the CARs, can comprise a sequence as set forth in SEQ ID NO: 7-9.
  • FIG. 7 A , FIG. 7 B , and FIG. 7 C show CAR T cell recognition and activation through FL-PLE in vitro.
  • K562 (leukemia) cells were incubated with FL-PLE overnight.
  • Cell integration of FL-PLE was analyzed by flow cytometry ( FIG. 7 A ).
  • the K562 OKT3+ cells (a cell line created to test the endogenous activation of T cells through the TCR) matched the K562 parental exactly. These cells were used in a chromium release assay ( FIG. 7 B ) and a cytokine release assay ( FIG. 7 C ) to test the activation of CD8+ antiFL(FITC-E2) CAR T cells compared with a CD8+ mock T cells from FIG. 6 . From these experiments, the antiFL (FITC-E2) CAR T cells recognized the FL moiety of the FL-PLE integrated into the plasma membrane and that the cells were activated. The amount of the activation was associated with the amount FL exposed on the surface of the cell.
  • FIG. 8 A and FIG. 8 B depict the universality of FL-PLE loading in tumor cells and recognition of the fluorescein moiety by antiFL CAR T cells.
  • K562 leukemia
  • U87 glioblastoma
  • 251T glioma
  • Be2 neuroblastoma
  • MDA-MB-231 adenocarcinoma
  • NIH OVCAR adenocarcinoma
  • 143B osteosarcoma
  • FIG. 9 shows CD8+ antiFL CAR T cells selected by methotrexate, a chemotherapeutic in which antiFL CARs include CARs with FITC-E2 scFv domain and either a long, medium or short spacer, and other CARs having an antiFL scFv domain as labeled and a long spacer.
  • CAR positivity of CD8+ antiFL CAR T cells staining for the surface marker EGFRt.
  • These antiFL CARs also harbored a gene for a double mutant dihydrofolate reductase (DHFRdm) that confered methotrexate resistance for methotrexate-mediated enrichment of CAR-positive cells. Every cell line except minimum EGFRt+ cells were diluted with mock T cells to make equivalent stocks to use in functional assays. Target: 18.1% EGFRt+. Actual: about 13-20% EGFRt+.
  • DHFRdm dihydrofolate reductase
  • FIG. 10 shows another example in which CD4+ antiFL CAR T cells selected by methotrexate, a chemotherapeutic. CAR positivity of CD4+ antiFL CAR T cells via staining for the surface marker EGFRt.
  • These antiFL CARs also harbor a gene for a double mutant dihydrofolate reductase (DHFRdm) that confers methotrexate resistance and, thus allows for methotrexate-mediated enrichment of CAR-positive cells. Every cell line except minimum EGFRt+ cells were diluted with mock T cells to make equivalent stocks to use in functional assays. Target: 18.1% EGFRt+. Actual: about 15-24% EGFRt+.
  • DHFRdm dihydrofolate reductase
  • Target cells were labelled with FL-PLE.
  • FIG. 11 shows loading of cells with FL-PLE.
  • Target cells for functional assays were made using K562 cells and MDA-MB-231 cells. Each cell group was labeled with FL-PLE.
  • Cell integration of FL-PLE to the plasma membrane was analyzed by flow cytometry.
  • FIG. 12 shows CD8+ antiFL CAR T cell cytotoxicity assays.
  • MDA-MB-231 cells were incubated with FL-PLE. Cell integration of FL-PLE was analyzed by flow cytometry. These cells and the CAR T cells were used in a chromium release assay.
  • the negative controls K562 Parental and MDA-MB-231) both showed no killing and the positive control (K562 OKT3+ cells) showed cell lysis as expected.
  • the long CAR barely outperformed the medium; whereas only slight killing was seen with the short CAR.
  • FIG. 14 A shows CD8+ antiFL CAR T cell assays with different antiFL scFv.
  • MDA-MB-231 cells were incubated with FL-PLE. Cell integration of FL-PLE was analyzed by flow cytometry. These cells and the CAR T cells were used in a chromium release assay.
  • the negative controls K562 Parental and MDA-MB-231) both showed no killing and the positive control (K562 OKT3+ cells) showed cell lysis as expected ( FIG. 14 A ).
  • This chromium assay tested four different antiFL scFv's in the context of a long CAR.
  • antiFL(4D5Flu) which comprised SEQ ID NO: 4 exhibited almost no killing.
  • AntiFL (4D5Flu) in other experiments has shown the ability to lysis cells labeled with FL. Accordingly, antiFL(4D5Flu) was not orientated in the correct relationship to recognize the FL moiety on the FL-PLE when integrated into a cell membrane.
  • FIG. 13 depicts CD4+ antiFL CAR T cell cytokine release assays.
  • K562 and MDA-MB-231 cells were incubated with FL-PLE. Cell integration of FL-PLE was analyzed by flow cytometry. These cells and the antiFL CAR T cells were used in a cytokine release assay.
  • the negative controls K562 Parental and MDA-MB-231) both showed no cytokine production and the positive control (K562 OKT3+ cells) showed production of all three cytokines for all cell lines.
  • This assay was designed to study the relationship of the spacer length of CAR and FL-PLE. This data shows that only the long spacer CAR in relationship with FL-PLE was able to produce all three cytokines.
  • FIG. 14 B depicts CD4+ antiFL CAR T cell cytokine release assays with different antiFL scFv.
  • K562 and MDA-MB-231 cells were incubated with FL-PLE. Cell integration of FL-PLE was analyzed by flow cytometry. These cells and the CAR T cells were used in a cytokine release assay.
  • the negative controls K562 Parental and MDA-MB-231) both showed no cytokine production and the positive control (K562 OKT3+ cells) showed production of all three cytokines for all cell lines.
  • This cytokine release assay tested five different antiFL scFv's in the context of a long CAR.
  • AntiFL(4M5.3) and antiFL(FITC-E2 Mut2) showed the best activation with FL-PLE and had vastly different disassociation constants, 270 fm and 3.1 nM respectively, showing that just lowering a CAR's disassociation constant did not necessarily make for the best CAR.
  • the CAR that did not work in conjunction with FL-PLE was antiFL(4D5Flu), which comprised SEQ ID NO: 4.
  • AntiFL(4D5Flu) exhibited no cytokine production in either cell line labeled with 5 ⁇ M FL-PLE.
  • AntiFL(4D5Flu) in other experiments has shown the ability to lysis cells labeled with FL. Accordingly, antiFL(4D5Flu) was not orientated in the correct relationship to recognize the FL moiety on FL-PLE when integrated into a cell membrane.
  • FIG. 15 A shows cell pure population of CD4+ and CD8+ antiFL CARs T cell via staining for the selection marker EGFRt.
  • K562 leukemia
  • MDA-MB-231 adenocarcinoma
  • FIG. 16 shows in vivo targeting and integration of FL-PLE with FL moiety available for binding.
  • FIG. 16 at top left shows 10 ⁇ fluorescent image, tumor was very bright compared to the normal healthy tissue, labeled as N. This showed the selective integration of FL-PLE into tumor membranes with FL moiety available for binding. Bottom left: bright signals were be seen when looking at the contralateral image of the brain. Right: To quantify this the MFI of the tumor and the contralateral side were individually calculated. This analysis was then repeated at multiple time points. These values were then plotted, generating a multiday retention time plot for FL-PLE upon this dose of FL-PLE.
  • Results depicted in FIG. 17 demonstrate the universality of in vivo targeting and integration of FL-PLE.
  • adenocarcinoma MDA-MB-231
  • osteosarcoma 143B
  • glioblastoma U87
  • the adenocarcinoma and osteosarcoma each received two flank tumors in their respective groups and the glioblastoma only received one flank tumor.
  • the fourth group had an adenocarcinoma tumor on one flank and an osteosarcoma on the opposite flank.
  • mice received an intravenous injection of FL-PLE. Mice were sacrificed and tumors were harvested at various time points post FL-PLE injection.
  • the tumors were removed and immediately fluorescently imaged for the presence of the fluorescein molecule on FL-PLE.
  • the graphs of FIG. 17 for the three different types of cancer all show a multiday day retention time with FL-PLE before the tumor's fluorescence reach base line levels (tumor that has never received FL-PLE).
  • the fourth group showed that FL-PLE simultaneously targeted two different types of cancers was retained for multiple days.
  • FIG. 18 A and FIG. 18 B show ProFL-PLE ability to block CAR T cell recognition until unmasked.
  • K562 (leukemia) cells were incubated with FL-PLE (high and low doses) or ProFL-PLE overnight.
  • Cell integration of FL-PLE and ProFL-PLE was analyzed by flow cytometry ( FIG. 18 A ). There was a clear shift from the control K562 parental with the K562 parental incubated with high dose FL-PLE whereas there was a smaller shift with K562 parental incubated with low dose FL-PLE.
  • FIG. 18 B shows cells used in a chromium release assay to test the activation of CD8+ antiFL CART cells compared with a CD8+ mock T cells.
  • antiFL CAR T cells recognized the FL moiety of the FL-PLE integrated into the plasma membrane.
  • the ProFL-PLE completely blocked the recognition of the antiFL CARs; whereas once the Pro protection was unmasked the FL moiety was available for recognition of antiFL CARs.
  • the lysis of the unmasked ProFL-PLE was about the same as the Low Dose FL-PLE, which correlated with the amount of FL exposed on the surface of the k562 cells.
  • FIGS. 18 A and 18 C shows cells used in a cytokine release assay to demonstrate the activation of CD4+ antiFL CAR T cells compared with a CD4+ mock T cells.
  • Cell integration of FL-PLE and ProFL-PLE was analyzed by flow cytometry ( FIG. 18 A ).
  • negative controls K562 Parental
  • K562 OKT3+ cells showed production of all three cytokines for all cell lines.
  • FL-PLE labeled cells were able to generate all three cytokines and was dependent on the amount of FL exposed on the surface.
  • ProFL-PLE cells labeled with the pro moiety still intact produced no cytokine meaning the antiFL CAR T cells were not activated.
  • ProFL-PLE labeled cells produced all 3 cytokines showing that upon removal of the Pro moiety the antiFL CAR T cell activated through ProFL-PLE integrated into the surface of a cancer cell.
  • labelling tumor cells with a masked hapten conjugated with a lipid, such as ProFL-PLE unmasking the hapten to obtain a unmasked hapten conjugated to a lipid integrated into a tumor cell membrane, and contacting the unmasked hapten with an anti-hapten CAR T cell activates the T cell in at least an in vitro environment.
  • FIG. 19 A , FIG. 19 B , and FIG. 19 C depict ProFL-PLE blocking CAR T cell recognition until unmasked, after unmasking the antiFL CAR T cell recognized the newly exposed fluorescein on the surface was then activated.
  • K562 (leukemia) cells were incubated with FL-PLE or ProFL-PLE overnight. Cell integration of FL-PLE and ProFL-PLE was analyzed by flow cytometry ( FIG. 19 A ). There was a clear shift from the control K562 parental with the K562 parental incubated with FL-PLE corresponding to the amount of FL exposed on the surface of the cell for CAR T cell recognition.
  • ProFL-PLE was not fluorescent due to the presence of the masking agent, a phenolic hydroxy group.
  • FIG. 19 B shows cells used in a cytokine release assay to continue to prove the activation of CD4+ and CD8+ antiFL CART cells compared with a CD4+ and CD8+ mock T cells.
  • the negative controls showed no cytokine production and the positive control (K562 OKT3+ cells) showed production of all three cytokines for all cell lines.
  • FL-PLE labeled cells were able to generate all three cytokines.
  • ProFL-PLE cells labeled with the pro moiety still intact produced no cytokine meaning the antiFL CAR T cells were not activating as designed.
  • After unmasking ProFL-PLE labeled cells produced all 3 cytokines showing that upon removal of the Pro moiety the antiFL CAR T cell activated through the unmasked ProFL-PLE integrated into the surface of the cancer cell. This shows the design of the ProFL-PLE works in an in vitro environment.
  • 19 C depicts results of staining cells from the co-culture of the cytokine release assay to investigate the up regulation of activation markers (LAG3, 41BB, and PD-1) on the CART cells after 24 hrs.
  • the live CD8+ antiFL(FITC-E2) long spacer CAR T cells are shown.
  • the negative control co-culture with k562 Parental showed no up regulation of activation markers and the positive control (K562 OKT3+ cells) showed up regulation of all three activation markers.
  • the K562 cells with ProFL-PLE showed only slightly elevated amounts of the activation markers meaning the intact Pro moiety was blocking antiFL CAR T cell recognition and activation.
  • K562 cells with FL-PLE or unmasked ProFL-PLE had similar levels of activation as the positive control showing that the antiFL CAR T cells were activating similarly through FL-PLE and unmasked ProFL-PLE.
  • FIG. 20 shows initial FL-PLE and ProFL-PLE in vivo therapy.
  • a neuroblastoma (Be2) tumor was established in 3 groups of mice by intracranial injection, the mice received an intracranial injection of T cells comprising an antiFL(FITCE2) long spacer CAR, which comprised SEQ ID NO: 5.
  • the control group only received the antiFL(FITCE2) long spacer CAR T cells and the tumor progressed as normal (black bar).
  • the second group receive a single intravenous injection of FL-PLE prior to T cell injection. This group lived ⁇ 20% longer than the control group.
  • the third group received 3 scheduled doses of ProFL-PLE via intravenous injection (one before T cell injection and two post T cell injection), which led to ⁇ 20% longer life span for the mice. These results additionally confirmed that ProFL-PLE was safe for re-dosing.
  • FIG. 21 A and FIG. 21 B show ProFL-PLE in vivo therapy for a flank tumor model.
  • adenocarcinoma MDA-MB-231 eGFP:ffLuc IL2+
  • tumors (2 tumors per mouse) were established in three groups of mice by subcutaneous injection, two groups of mice received injection of ProFL-PLE either intratumorally ( FIG. 21 A ) or intravenously (IV) ( FIG. 21 B ) and the control group received no injection of drug. Following the first injection of drug all three groups received IV injection of cells containing the antiFL(FITC-E2) long spacer CAR.
  • FIG. 21 A The ProFL-PLE intratumorally injected group received 12 doses of ProFL-PLE over 45 days and the tumor regressed to baseline levels by day 40 for all 3 mice. The mice lived tumor free till the end of the study on day 90.
  • FIG. 21 B The ProFL-PLE IV injected group received 10 doses of ProFL-PLE over 34 days and the tumor regressed to baseline levels by day ⁇ 40 for 2 mice. These mice lived tumor free till the end of the study on day 90. One mouse from this group died on day 16 with the control mice.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Cell Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Food Science & Technology (AREA)
  • Microbiology (AREA)
  • Analytical Chemistry (AREA)
  • Biotechnology (AREA)
  • Pathology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Physics & Mathematics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Physics & Mathematics (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

Aspects described herein pertain to engineered chimeric antigen receptors (CARs) and compositions thereof having specificity and affinity for fluorescein containing ligands presented on the surface of tumor cells. Also provided herein are compositions including CARs further comprising a spacer arm and methods of making and using these compositions.

Description

CROSS-REFERENCE TO RELATED APPLICATIONS
This application is a U.S. National Phase Application of PCT International Application Number PCT/US2019/014054, filed on Jan. 17, 2019, designating the United States of America and published in the English language, which is an International Application of and claims the benefit of priority to U.S. Provisional Application No. 62/627,147, filed on Feb. 6, 2018. The disclosures of the above-referenced applications are hereby expressly incorporated by reference in their entireties.
REFERENCE TO SEQUENCE LISTING
The present application is being filed along with a Sequence Listing in electronic format. The Sequence Listing is provided as a file entitled SeqList-SCRI-163NP.txt, created Jul. 29, 2020, which is approximately 42 Kb in size. The information in the electronic format of the Sequence Listing is hereby expressly incorporated by reference in its entirety
FIELD OF THE INVENTION
The alternatives described herein pertain to engineered chimeric antigen receptors (CARs) and compositions thereof having specificity and affinity for fluorescein containing ligands presented on the surface of tumor cells. Accordingly, provided herein are compositions and methods of making and using these compositions.
BACKGROUND
The adoptive transfer of human T lymphocytes that are engineered by gene transfer to express chimeric antigen receptors (CARs) specific for surface molecules expressed on tumor cells has the potential to effectively treat cancer. Chimeric receptors are synthetic receptors that include an extracellular ligand binding domain, most commonly a single chain variable fragment of a monoclonal antibody (scFv) linked to intracellular signaling components, most commonly CD3ζ alone or combined with one or more costimulatory domains. Much of the research in the design of chimeric antigen receptors has focused on defining scFvs and other ligand binding elements that target malignant cells without causing serious toxicity to essential normal tissues, and on defining the optimal composition of intracellular signaling modules to activate T cell effector functions. There remains a need for a CAR T cell-mediated therapy that is selective for specific targets and which minimizes adverse side effects.
SUMMARY
In a first aspect, a complex is provided, wherein the complex comprises a chimeric antigen receptor (CAR) or a T cell receptor (TCR), wherein the CAR or TCR is joined to a lipid, wherein the lipid comprises a target moiety and the CAR is joined to said lipid through an interaction with said target moiety, and wherein the CAR or TCR comprises a spacer domain having a spacer length of 1-22 amino acids, 23-50 amino acids, 51-100 amino acids, 100 to 150 amino acids or 151-250 amino acids or a spacer length that is within a range defined by any two of the aforementioned lengths. In some alternatives, the CAR or TCR comprises a sequence as set forth in any one of SEQ ID NOs: 1-6. In some alternatives, the spacer domain is a IgG4 hinge connected to a CH2 domain to a CH3 domain. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 7. In some alternatives, the spacer domain is an IgG4 hinge connected to a CH3 domain. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 8. In some alternatives, the spacer domain is an IgG4 hinge only. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 9. Some embodiments include nucleic acids that encode any one of SEQ ID NO: 1-9, which may be present on a vector and/or introduced to a cell (e.g., a T cell). In some alternatives, the spacer comprises a length of 229 amino acids. In some alternatives, the lipid comprises a polar head group and a hydrophobic group. In some alternatives, the polar head comprises a choline, a phosphatidylcholine, sphingomyelin, phosphoethanolamine group, an oligosaccharide residue, a sugar residue, phosphatidyl serine or phosphatidyl inositol. In some alternatives, the polar-head group comprises phosphocholine, a piperidine moiety or a trimethylarseno-ethyl-phosphate moiety. In some alternatives, the hydrophobic group is fatty acid, such as an aliphatic chain. In some alternatives, the fatty acid is saturated or unsaturated. In some alternatives, the hydrophobic group comprises an alkyl, alkenyl or alkynyl group. In some alternatives, the hydrophobic group comprises a terpenoid lipid, such as a steroid or cholesterol. In some alternatives, the hydrophobic group comprises an ether linkage, wherein the ether linkage is between the polar head group and the aliphatic chain. In some alternatives, the sugar residue is a glycerol. In some alternatives, the hydrophobic group comprises a carbon alkyl chain, wherein the carbon alkyl chain comprises 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 carbons or any number that is within a range defined by any two aforementioned values. In some alternatives, the carbon alkyl chain comprises 18 carbons. In some alternatives, the lipid is a phospholipid ether. In some alternatives, the target moiety is biotin, digoxigenin, dinitrophenol or fluorescein. In some alternatives, the spacer comprises a PEG spacer, a Hapten (2×) spacer, or an alkane chain. In some alternatives, the PEG spacer comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16 PEG molecules, or any amount of PEG molecules that is within a range defined by any two aforementioned values. In some alternatives, the CAR or TCR is expressed by a cell or a T cell. In some alternatives, the CAR or TCR is on the surface of a cell or a T cell. In some alternatives, the cell is a precursor T cell. In some alternatives, the precursor T cell is a hematopoietic stem cell. In some alternatives, the cell is a CD8+T cytotoxic lymphocyte cell selected from the group consisting of naïve CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells and bulk CD8+ T cells. In some alternatives, the cell is a CD4+T helper lymphocyte cell that is selected from the group consisting of naïve CD4+ T cells, central memory CD4+ T cells, effector memory CD4+ T cells, and bulk CD4+ T cells. In some alternatives, the lipid is intercalated in a lipid bilayer of a target cell. In some alternatives, the target cell is a tumor cell. In some alternatives, the target cell is an immune cell. In some alternatives, the immune cell is a T cell or a B cell. In some alternatives, the target cell is present in a tumor microenvironment.
In a second aspect, a cell comprising a complex of any one of the alternatives herein is provided, the cell comprising a chimeric antigen receptor (CAR) or T cell receptor (TCR), wherein the CAR or TCR is bound to or is configured to bind to a lipid, wherein the lipid comprises a target moiety and the cell comprising the CAR is bound to the target moiety of the lipid, and wherein the CAR or TCR comprises a spacer domain. In some alternatives, the complex comprises a chimeric antigen receptor (CAR) or a T cell receptor (TCR), wherein the CAR or TCR is joined to or is configured to be joined to a lipid, wherein the lipid comprises a target moiety and the CAR is joined to or configured to be joined to said lipid through an interaction with said target moiety, and wherein the CAR or TCR comprises a spacer domain having a spacer length of 1-22 amino acids, 23-50 amino acids, 51-100 amino acids, 100 to 150 amino acids or 151-250 amino acids or a spacer length that is within a range defined by any two of the aforementioned lengths. In some alternatives, the CAR or TCR comprises a sequence as set forth in any one of SEQ ID NOs: 1-6. In some alternatives, the spacer domain is an IgG4 hinge connected to a CH2 domain to a CH3 domain. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 7. In some alternatives, the spacer domain is an IgG4 hinge connected to a CH3 domain. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 8. In some alternatives, the spacer domain is an IgG4 hinge only. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 9. In some alternatives, the cell comprises a nucleic acid encoding any one of SEQ ID. NO: 1-9). In some alternatives, the spacer comprises a length of 229 amino acids. In some alternatives, the lipid comprises a polar head group and a hydrophobic group. In some alternatives, the polar head comprises a choline, a phosphatidylcholine, sphingomyelin, phosphoethanolamine group, an oligosaccharide residue, a sugar residue, phosphatidyl serine or phosphatidyl inositol. In some alternatives, the polar-head group comprises phosphocholine, a piperidine moiety or a trimethylarseno-ethyl-phosphate moiety. In some alternatives, the hydrophobic group is fatty acid, such as an aliphatic chain. In some alternatives, the fatty acid is saturated or unsaturated. In some alternatives, the hydrophobic group comprises an alkyl, alkenyl or alkynyl group. In some alternatives, the hydrophobic group comprises a terpenoid lipid, such as a steroid or cholesterol. In some alternatives, the hydrophobic group comprises an ether linkage, wherein the ether linkage is between the polar head group and the aliphatic chain. In some alternatives, the sugar residue is a glycerol or sugar alcohol. In some alternatives, the hydrophobic group comprises a carbon alkyl chain, wherein the carbon alkyl chain comprises 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 carbons or any number that is within a range defined by any two aforementioned values. In some alternatives, the carbon alkyl chain comprises 18 carbons. In some alternatives, the lipid is a phospholipid ether. In some alternatives, the target moiety is biotin, digoxigenin, dinitrophenol or fluorescein. In some alternatives, the spacer comprises a PEG spacer, a Hapten (2×) spacer, or an alkane chain. In some alternatives, the PEG spacer comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16 PEG molecules, or any amount of PEG molecules that is within a range defined by any two aforementioned values. In some alternatives, the CAR or TCR is expressed by a cell or a T cell. In some alternatives, the CAR or TCR is on the surface of a cell or a T cell. In some alternatives, the cell is a precursor T cell. In some alternatives, the precursor T cell is a hematopoietic stem cell. In some alternatives, the cell is a CD8+T cytotoxic lymphocyte cell selected from the group consisting of naïve CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells and bulk CD8+ T cells. In some alternatives, the cell is a CD4+T helper lymphocyte cell that is selected from the group consisting of naïve CD4+ T cells, central memory CD4+ T cells, effector memory CD4+ T cells, and bulk CD4+ T cells. In some alternatives, the lipid is intercalated in a lipid bilayer of a target cell. In some alternatives, the target cell is a tumor cell. In some alternatives, the target cell is an immune cell. In some alternatives, the immune cell is a T cell or a B cell. In some alternatives, the target cell is present in a tumor microenvironment. In some alternatives, the cell is a precursor T cell. In some alternatives, the precursor T cell is a hematopoietic stem cell. In some alternatives, the cell is a CD8+T cytotoxic lymphocyte cell selected from the group consisting of naïve CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells and bulk CD8+ T cells. In some alternatives, the cell is a CD4+T helper lymphocyte cell that is selected from the group consisting of naïve CD4+ T cells, central memory CD4+ T cells, effector memory CD4+ T cells, and bulk CD4+ T cells. In some alternatives, the lipid is intercalated in a lipid bilayer of a target cell. In some alternatives, the target cell is a tumor cell. In some alternatives, the target cell is an immune cell. In some alternatives, the immune cell is a T cell or a B cell. In some alternatives, the target cell is present in a tumor microenvironment.
In a third aspect, a method of treating, ameliorating, or inhibiting a cancer in a subject is provided, the method comprising a) introducing, providing, or administering to a subject a composition that comprises a lipid, which comprises a target moiety that is bound to a masking moiety, b) introducing, providing, or administering to said subject a cell comprising a chimeric antigen receptor (CAR) or T cell receptor (TCR), which is specific for the target moiety once the masking moiety is removed from the target moiety, and wherein the CAR or TCR comprises a spacer domain, c) removing the masking moiety from the target moiety thereby allowing the target moiety to bind to the CAR present on the cell, and, d) optionally, measuring or evaluating the binding of the cell comprising the CAR to the lipid, after steps a-c and/or e) optionally, measuring or evaluating the treatment, amelioration, or inhibition of said cancer after steps a-d, and/or f) and optionally, identifying a subject in need of a therapy for cancer prior to steps a-c. In some alternatives, the complex or the cell is provided to the subject at the same time as the composition or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 15, 20, 24, 36 or 48 hours before or after administration of the composition, or any time within a range defined by any two aforementioned values. In some alternatives, the cell is provided to the subject 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 15, 20, 24, 36 or 48 hours before administration of the composition, or any time within a range defined by any two aforementioned values. In some alternatives, the cell is provided to the subject within seconds or minutes, such as less than an hour, of providing the composition to the subject. In some alternatives, a boost of the cell and/or the composition is provided to the subject. In some alternatives, an additional cancer therapy is provided, such as a small molecule, e.g., a chemical compound, an antibody therapy, e.g., a humanized monoclonal antibody with or without conjugation to a radionuclide, toxin, or drug, surgery, and/or radiation. In some alternatives, the cancer is a solid tumor, such as colon, breast, ovarian, lung, pancreatic, prostate, melanoma, renal, pancreatic, glioblastoma, neuroblastoma, medulloblastoma, sarcoma or liver cancer; or a non-solid tumor, such as a leukemia, or a multiple myeloma. In some alternatives, the spacer domain is an IgG4 hinge connected to a CH2 domain to a CH3 domain. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 7. In some alternatives, the spacer domain is an IgG4 hinge connected to a CH3 domain. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 8. In some alternatives, the spacer domain is a IgG4 hinge only. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 9. In some alternatives, the spacer comprises a sequence set forth in SEQ ID NO: 7. In some alternatives, binding of the target moiety to the CAR present on the cell induces production of at least one cytokine. In some alternatives, the at least one cytokine comprises IL-2, TNF-α and/or INF-α.
In a fourth aspect, a kit comprising a pharmaceutical grade FL-PLE is provided. In some alternatives, the pharmaceutical grade FL-PLE comprises a hapten. In some alternatives, the pharmaceutical grade FL-PLE comprises fluorescein (e.g., FITC).
BRIEF DESCRIPTION OF THE DRAWINGS
FIG. 1A and FIG. 1B schematically depict different spacers for CAR T cells. FIG. 1A shows an example of: (i) a second-generation CAR. The antigen recognition moiety (uppermost portion of molecule), which is presented at a desired distance by a short spacer domain, from the cell surface. This spacer is connected to a transmembrane domain, which is connected to two signaling domains; (ii) a medium spacer CAR, where another domain is added to the short spacer; and (iii) a long spacer CAR, where another domain is added to the medium spacer. FIG. 1B shows an example of different spacers exposed on CAR T cells. In some embodiments, long, medium, and short spacers can comprise a sequence as set forth in SEQ ID NO: 7, 8, and 9, respectively.
FIG. 2 schematically depicts an example of spacer length and orientation on a surface of a tumor cell. A tumor cell whose surface is labeled with CART cell tumor targeting agent (CTCT). The tumor surface has proteins and other cellular debris protruding from the surface, which can impact a CTCT specific CAR's ability to recognize the CAR T cell tumor targeting agent (CTCT). Panels A-C depict example embodiments of a PLE-CTCT imbedded into the lipid membrane, whereas panels D-E depict example embodiments of a CAR T cell tumor targeting agent (CTCT) conjugated to a surface protein. In panel A, a long CAR is able to reach and activate via the PLE-CTCT. In panel B, a short CAR is unable to reach the CAR T cell tumor targeting agent (CTCT) and will not be able to activate. In panel C, a long CAR whose recognition domain is placed in a different orientation and is unable recognize the CAR T cell tumor targeting agent (CTCT). In panels D and E, the long CAR from shown in panel C and the short CAR depicted in panel B are both able to recognize and activate through a CAR T cell tumor targeting agent (CTCT) that is conjugated to a surface protein.
FIG. 3 schematically depicts an example of a CTCT CART cell recognizing only unmasked PLE-CTCT and being activated. A tumor loaded with a prodrug version of PLE-CTCT. In this example embodiment, the prodrug provides steric hindrance to the CTCT specific CAR T cell making the Pro-PLE-CTCT unrecognizable to the CTCT specific CAR T cell. Once the tumor microenvironment has cleaved the pro part of the Pro-PLE-CTCT, the CTCT specific CAR can recognize and activate through the unmasked PLE-CTCT.
FIG. 4A depicts an example embodiment of a phospholipid conjugated with a hapten, fluorescein (PLE-CTCT). Structure of phospholipid ether (PLE) tethered to the hapten fluorescein (FL-PLE). (i) FL (fluorescein), the target for CAR T cells. (ii) Polyethylene glycol (PEG), the spacer used to extend the target an ideal distance from the cell surface. (iii & iv) PLE, (iii) is the polar head group and (iv) is the hydrophobic tail for incorporation or tethering into the cell plasma membrane. FIG. 4B depicts an example prodrug version of FL-PLE in which a Pro moiety is conjugated to the hapten (fluorescein) via a cleavable bond indicated by the arrow. The masked FL-PLE is substantially non-florescent. The bond can be cleaved by the presence of reactive oxygen species (ROS), such as in a tumor microenvironment. Once unmasked the resulting structure is FL-PLE, which provides a florescent signal and can be bind an antiFL CAR.
FIG. 5 depicts examples of different antiFL scFvs that were selected to create an antiFL CAR library (upper portion). Lower portion depicts structures of example CARs with a long spacer (L), a medium spacer (M), or a short spacer (S). The structures include a leader sequence, an scFv, a hinge/spacer, a CD28tm domain, a 41BB domain, a CD3ζ, a T2A sequence, and an EGFTt domain. In total 18 different plasmids were used to create antiFL CAR T cells.
FIG. 6 depicts FACS analysis of CD8+ T cells containing antiFL CARs. Panel (a) and (b) depict T cells staining for the selection marker EGFRt containing either an antiFL(FITC-E2) CAR, which comprises SEQ ID NO: 5 [96% positive], or an antiFL(4M5.3) CAR, which comprises SEQ ID NO: 2 [80% positive], respectively. Panels (c) and (d) depict T cells incubated with a mouse CD19-FITC antibody, then stained with an anti-mouse-Fc-Alexa647 antibody for the bound FITC antibody, for T cells containing either the antiFL(FITC-E2) CAR [97% positive], or the antiFL(4M5.3) CAR [79% positive], respectively.
FIG. 7A depicts a FACS analysis of cells treated with FL-PLE.
FIG. 7B depicts specific lysis of K562 cells in the presence or absence of FL-PLE, and in the presence or absence of CD8+ T cells containing an antiFL CAR.
FIG. 7C depicts cytokine production from K562 cells in the presence or absence of FL-PLE, and in the presence or absence of CD8+ T cells containing an antiFL CAR.
FIG. 8A depicts FACS of various cell lines treated with FL-PLE.
FIG. 8B depicts specific lysis of cells treated with FL-PLE and contacted with CD8+ T cells containing an antiFL(FITC-E2) CAR containing a long spacer.
FIG. 9 depicts a FACS analysis of CD8+ T cells contain various antiFL CARs, and staining for a surface marker, EGFRt.
FIG. 10 depicts a FACS analysis of CD4+ T cells contain various antiFL CARs, and staining for a surface marker, EGFRt.
FIG. 11 depicts a FACS analysis of cells labeled with FL-PLE.
FIG. 12 depicts specific lysis of target cells incubated with FL-PLE and contacted with CD8+ T cells containing antiFL CARs.
FIG. 13 depicts cytokine production of cells incubated with FL-PLE and contacted with CD4+ T cells containing antiFL CARs.
FIG. 14A depicts specific lysis of target cells incubated with FL-PLE and contacted with CD8+ T cells containing antiFL CARs.
FIG. 14B depicts cytokine production of cells incubated with FL-PLE and contacted with CD4+ T cells containing antiFL CARs.
FIG. 15A depicts a FACS analysis of cells containing various antiFL CARs.
FIG. 15B depicts a FACS analysis of cells treated with FL-PLE.
FIG. 15C depicts a series of graphs for specific lysis of various tumor cells in the presence or absence of FL-PLE, and contacted with various antiFL CARs.
FIG. 15D depicts a series of graphs for cytokine production from T cells containing various antiFL CARs and contacted with various tumor cells in the presence or absence of FL-PLE.
FIG. 15E depicts a series of graphs for cytokine production from T cells containing various antiFL CARs and contacted with various tumor cells in the presence or absence of FL-PLE.
FIG. 16 (left upper panel) depicts an image of an orthotopic glioma xenograft in a subject which had been dosed intravenously with FL-PLE, and evaluated 48 hr later. Left lower panel is an image of the control contralateral hemisphere of the subject. Both the orthotopic glioma xenograft and the control contralateral hemisphere of the subject were evaluated by staining with an anti-fluorescein antibody. Levels of retained FL-PLE were also quantified in both the orthotopic glioma xenograft and the control contralateral hemisphere, over time (right panel).
FIG. 17 depicts graphs demonstrating FL-PLE retention in different tumors in vivo.
FIG. 18A depicts a FACS analysis of cells treated with FL-PLE, or ProFL-PLE.
FIG. 18B depicts specific lysis of cells treated with FL-PLE or ProFL-PLE, and contacted with CD8+ T cells containing an antiFL CAR
FIG. 18C depicts a series of graphs for cytokine product for cells in the presence or absence of masked or unmasked ProFL-PLE and FL-PLE, in the presence or absence of CD4+ T cells containing an antiFL(FITCE2) CAR with a long spacer.
FIG. 19A depicts a FACS analysis of FL-PLE or ProFL-PLE binding to cells.
FIG. 19B depicts a series of graphs for cytokine product for cells in the presence or absence of ProFL-PLE or FL-PLE, in the presence or absence of CD4+ T cells containing an antiFL(FITCE2) CAR with a long spacer.
FIG. 19C depicts a FACS analysis of cells treated with FL-PLE or ProFL-PLE.
FIG. 20 depicts a graph of relative life span of mice having a neuroblastoma (Be2) tumor and treated with ProFL-PLE, FL-PLE or control, and administered either T cells containing an antiFL(FITCE2) long spacer CAR which comprised SEQ ID NO: 5, or a control.
FIG. 21A depicts graphs for average tumor progression (top panel), and percent survival (bottom panel) in mice injected intra-tumorally with ProFL-PLE, and administered T cells containing an antiFL(FITCE2) CAR with a long spacer.
FIG. 21B depicts graphs for average tumor progression (top panel), and percent survival (bottom panel) in mice injected intravenously with ProFL-PLE, and administered T cells containing an antiFL(FITCE2) CAR with a long spacer.
DETAILED DESCRIPTION
Described herein are engineered chimeric antigen receptors (CARs) with specificity and a selected or designed affinity for the molecule fluorescein when presented on the surface of tumor cells loaded with exogenous FL-PLE, which results in redirected anti-tumor T cell reactivity. In some embodiments, FL-PLE is a synthetic molecular structure that is designed to integrate into the plasma membrane of tumors such that the molecule's fluorescein is present adjacent to the outer leaflet of the plasma membrane in the extracellular space. In some embodiments, the FL-PLE structure includes therapeutically important attributes. In some embodiments, a CAR that targets the fluorescein (FL) moiety of the FL-PLE is provided, and methods of making and using the same are also contemplated. These CARs can either be constitutively expressed or placed under regulated control.
While the adoptive transfer of transgene modified T cells has been successful in select settings, such as CD19 B cell lineage malignancies, these therapies have proved difficult to genericize to other cancer types because of the lack of a single target antigen that is present on all forms of cancer but not normal, healthy cells. Accordingly, the development of CAR T cell therapies was hampered by the onerous task of identifying and vetting tens of hundreds of antigens, such as CAR targets, as was the development of associated CARs in order to address each type of cancer afflicting humans. Previous work developed a FL-PLE that integrates into all tumors displaying one synthetic target molecule for CAR T cells to recognize. This eliminates the need for validation of tens of hundreds of CARs and instead allows for the use of a single FL specific CAR.
The present disclosure addresses the identification, creation, and engineering of suitable CAR T cells for binding to the FL moiety of FL-PLE. In some embodiments, the FL moiety may be masked and unmasked such that the FL moiety can be activated to receive the CAR T cell. In some embodiments, a FL specific CAR may recognize only unmasked CAR T cell tumor targeting agents (CTCTs) and not masked FLs.
Some embodiments of the methods and compositions provided herein can include aspects disclosed in WO 2018/148224 entitled “PHOSPHOLIPID ETHER (PLE) CAR T CELL TUMOR TARGETING (CTCT) AGENTS” which is hereby expressly incorporated by reference in its entirety.
Definitions
In the description that follows, the terms should be given their plain and ordinary meaning when read in light of the specification. One of skill in the art would understand the terms as used in view of the whole specification.
As used herein, “a” or “an” may mean one or more than one.
As used herein, the term “about” indicates that a value includes the inherent variation of error for the method being employed to determine a value, or the variation that exists among experiments.
“Chimeric receptor” as used herein refers to a synthetically designed receptor comprising a ligand binding domain of an antibody or other protein sequence that binds to a molecule associated with the disease or disorder and is linked via a spacer domain to one or more intracellular signaling domains of a T cell or other receptors, such as a costimulatory domain. Chimeric receptor can also be referred to as artificial T cell receptors, chimeric T cell receptors, chimeric immunoreceptors, and chimeric antigen receptors (CARs). These receptors can be used to graft the specificity of a monoclonal antibody or binding fragment thereof onto a T-cell, wherein transfer of their coding sequences is facilitated by viral vectors, such as a retroviral vector or a lentiviral vector. CARs are genetically engineered T-cell receptors designed to redirect T-cells to target cells that express specific cell-surface antigens. T-cells can be removed from a subject and modified so that they can express receptors that can be specific for an antigen by a process called adoptive cell transfer. The T-cells are reintroduced into the patient where they can then recognize and target an antigen. These CARs are engineered receptors that can graft a selected specificity onto an immune receptor cell. The term chimeric antigen receptors or “CARs” are also considered by some investigators to include the antibody or antibody fragment, the spacer, signaling domain, and transmembrane region. Due to the surprising effects of modifying the different components or domains of the CAR described herein, such as the epitope binding region (for example, antibody fragment, scFv, or portion thereof), spacer, transmembrane domain, and/or signaling domain), the components of the CAR are frequently distinguished throughout this disclosure in terms of independent elements.
“CAR T cell targeting agent,” (CTCT) is given its plain and ordinary meaning in view of the specification and can be described, for example as a composition that that can integrate into the membrane of a target cell. In the alternatives herein, the CTCT comprises a lipid, wherein the lipid comprises a target moiety and a masking moiety. The masking moiety may be unmasked in the presence of low pH, ROS species and within a tumor microenvironment, for example. In some embodiments, the masking moiety inhibits specific binding of a CAR to the target moiety. The target moiety may be recognized and bound by a chimeric antigen receptor that is specific for the target moiety. In some alternatives herein, the masking moiety is removed at a pH of 4, 5, 6, or 6.5 or any pH in between a range defined by any two aforementioned values.
A “T cell receptor” or “TCR” is a molecule that is found on the surface of T lymphocytes or T cells that is responsible for the recognition of fragments of antigen bound to a major histocompatibility complex molecule.
“Target moiety” as described herein, refers to a specific group or site on a molecule or chemical that is a binding target for another chemical or protein of interest. In some alternatives, a complex is provided, wherein the complex comprises a chimeric antigen receptor (CAR) or a T cell receptor (TCR) joined to a lipid, wherein the lipid comprises a target moiety and the CAR is joined to said lipid through an interaction with said target moiety. In some alternatives, the target moiety is biotin, digoxigenin, dinitrophenol or fluorescein.
A “single-chain variable fragment,” (scFv) is a fusion protein that can have variable regions of the heavy (VH) and light chains (VL) of immunoglobulins, connected with a short linker peptide of ten to 25 amino acids. The short linker peptide can comprise 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 amino acids or any number of amino acids in between a range defined by any two aforementioned values. The linker is usually rich in glycine for flexibility, as well as, serine or threonine for solubility, and can either connect the N-terminus of the VH with the C-terminus of the VL, or vice versa. This protein retains the specificity of the original immunoglobulin, despite removal of the constant regions and the introduction of the linker. The scFv can be specific for an antigen. “Antigen” or “Ag” as used herein, refers to a molecule that provokes an immune response. This immune response can involve either antibody production, or the activation of specific immunologically-competent cells, or both. An antigen can be generated, synthesized, produced recombinantly or can be derived from a biological sample. Such a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a biological fluid such, for example, blood, plasma or ascites fluid. In some alternatives herein, a composition is provided, wherein the composition comprises cells manufactured by any one of the alternative methods herein. In some alternatives, the cells comprise a chimeric antigen receptor, wherein the chimeric antigen receptor comprises a scFv that is specific for an antigen.
Some embodiments provided herein relate to a ScFv described herein as antiFL(FITCE2 TyrH133Ala) (also referred to as antiFL(FITC-E2 Mut2), or as antiFL(Mut2)), which can be incorporated into a CAR in accordance with this disclosure (SEQ ID NO: 1), having an amino acid sequence of
SVLTQPSSVSAAPGQKVTISCSGSTSNIGNNYVSWYQQHPGKAPKLMIYD
VSKRPSGVPDRFSGSKSGNSASLDISGLQSEDEADYYCAAWDDSLSEFLF
GTGTKLTVLGGGGGSGGGGSGGGGSQVQLVESGGNLVQPGGSLRLSCAAS
GFTFGSFSMSWVRQAPGGGLEWVAGLSARSSLTHYADSVKGRFTISRDNA
KNSVYLQMNSLRVEDTAVYYCARRSYDSSGYWGHFASYMDVWGQGTLVTV
S.
Some embodiments provided herein relate to a scFv described herein as antiFL(4M5.3), which can be incorporated into a CAR in accordance with this disclosure (SEQ ID NO: 2), having an amino acid sequence of
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLRWYLQKPGQSPK
VLIYKVSNRVSGVPDRFSGSGSGTDFTLKINRVEAEDLGVYFCSQSTHVP
WTFGGGTKLEIKSSADDAKKDAAKKDDAKKDDAKKDGGVKLDETGGGLVQ
PGGAMKLSCVTSGFTFGHYWMNWVRQSPEKGLEWVAQFRNKPYNYETYYS
DSVKGRFTISRDDSKSSVYLQMNNLRVEDTGIYYCTGASYGMEYLGQGTS
VTVS.
Some embodiments provided herein relate to a ScFv described herein as antiFL(4420), which can be incorporated into a CAR in accordance with this disclosure (SEQ ID NO: 3), having an amino acid sequence of
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSQGNTYLRWYLQKPGQSPK
VLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVP
WTFGGGTKLEIGGGGSGGGGSGGGGSEVKLDETGGGLVQPGRPMKLSCVA
SGFTFSDYWMNWVRQSPEKGLEWVAQIRNKPYNYETYYSDSVKGRFTISR
DDSKSSVYLQMNNLRVEDMGIYYCTGSYYGMDYWGQGTSVTVSS.
Some embodiments provided herein relate to a ScFv described herein as antiFL(4D5Flu), which can be incorporated into a CAR in accordance with this disclosure (SEQ ID NO: 4), having an amino acid sequence of
DYKDIQMTQSPSSLSASVGDRVTITCRASQSLVHSQGNTYLRWYQQKPGK
APKVLIYKVSNRFSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQST
HVPWTFGQGTKVELKRAGGGGSGGGGSGGGGSSGGGSGGGGSGGGGSEVQ
LVESGGGLVQPGGSLRLSCAASGFTFSMWMNWVRQAPGKGLEWVAQIRNK
PYNYETYYADSVKGRFTISRDTSKNTVYLQMNSLRAEDTAVYYCTGSYYG
MDYWGQGTLVTVSS.
Some embodiments provided herein relate to a ScFv described herein as antiFL(FITCE2), which can be incorporated into a CAR in accordance with this disclosure (SEQ ID NO: 5), having an amino acid sequence of
SVLTQPSSVSAAPGQKVTISCSGSTSNIGNNYVSWYQQHPGKAPKLMIYD
VSKRPSGVPDRFSGSKSGNSASLDISGLQSEDEADYYCAAWDDSLSEFLF
GTGTKLTVLGGGGGSGGGGSGGGGSQVQLVESGGNLVQPGGSLRLSCAAS
GFTFGSFSMSWVRQAPGGGLEWVAGLSARSSLTHYADSVKGRFTISRDNA
KNSVYLQMNSLRVEDTAVYYCARRSYDSSGYWGHFYSYMDVWGQGTLVTV
S.
Some embodiments provided herein relate to a ScFv described herein as antiFL(FITCE2 HisH131Ala), which can be incorporated into a CAR in accordance with this disclosure (SEQ ID NO: 6), having an amino acid sequence of
SVLTQPSSVSAAPGQKVTISCSGSTSNIGNNYVSWYQQHPGKAPKLMIYD
VSKRPSGVPDRFSGSKSGNSASLDISGLQSEDEADYYCAAWDDSLSEFLF
GTGTKLTVLGGGGGSGGGGSGGGGSQVQLVESGGNLVQPGGSLRLSCAAS
GFTFGSFSMSWVRQAPGGGLEWVAGLSARSSLTHYADSVKGRFTISRDNA
KNSVYLQMNSLRVEDTAVYYCARRSYDSSGYWGAFYSYMDVWGQGTLVTV
S.
“Antigen specific binding domains” can include protein or protein domains that can specifically bind to an epitope on a protein at a low or high binding affinity (fM to mM binding capacity). In some alternatives, the fusion protein comprises a protein or portion thereof that can modulate an immune response. In some alternatives, the protein comprises an antigen specific binding domain.
T-cells” or “T lymphocytes” as used herein, can be from any mammalian species, preferably primate, including monkeys, dogs, and humans. In some alternatives the T-cells are allogeneic (from the same species but different donor) as the recipient subject; in some alternatives the T-cells are autologous (the donor and the recipient are the same); in some alternatives the T-cells are syngeneic (the donor and the recipients are different but are identical twins).
“Combination therapy” as described herein, refers to a therapy that uses more than one medication or modality for a treatment. Combination therapy, for example, can also refer to multiple therapies for a single disease, and often all the therapies are pharmaceutical product combinations. Combination therapy can also involve prescribing and administering separate drugs in which the dosage can also have more than one active ingredient. In some alternatives, a combination therapy is provided, wherein the combination therapy comprises administering a genetically modified immune cell for modifying a tumor microenvironment. In some alternatives, the combination therapy comprises administering a genetically modified immune cell for modulating the suppression of the immune response in a tumor microenvironment. In some alternatives, the combination therapy comprises administering a genetically modified immune cell for minimizing the proliferation of tumor and suppressive cells in a subject in need thereof e.g. a human. In some alternatives, the combination therapy comprises administering a genetically modified immune cell for increasing the efficiency of an anti-cancer therapy, anti-infection therapy, antibacterial therapy, anti-viral therapy, or anti-tumoral therapy in a subject in need thereof e.g., a human. In some alternatives, the combination therapy further comprises administration of an inhibitor. In some alternatives, the inhibitor is not an enzymatic inhibitor. In some alternatives, the inhibitor is an enzymatic inhibitor. In some alternatives, the combination therapy comprises administering a therapeutic dose of an inhibitor or an antibody or a binding fragment thereof. These antibodies or binding fragments thereof can be humanized in some alternatives. In some alternatives, the combination therapy can further comprise administering a CAR bearing T-cell to a subject in need e.g., a human.
“Chemotherapeutic drugs” are a category of anti-cancer medicaments that can use, for example, chemical substances, such as anti-cancer drugs (chemotherapeutic agents), which can be administered as part of a standardized chemotherapy regimen. Chemotherapeutic drugs can be administered with a curative intent or to prolong life or to reduce symptoms (palliative chemotherapy). Additional chemotherapies can also include hormonal therapy and targeted therapy, as it is one of the major categories of medical oncology (pharmacotherapy for cancer). These modalities are often used in conjunction with other cancer therapies, such as radiation therapy, surgery, and/or hyperthermia therapy. In a few cases, cancer has been known to spread due to surgery. In some alternatives, a genetically modified immune cell is administered to the tumor site prior to or after a surgical procedure.
Chemotherapy, in which chemotherapeutic drugs are administered, can use one drug at a time (single-agent chemotherapy) or several drugs at once (combination chemotherapy or polychemotherapy). The combination of chemotherapy and radiotherapy is chemoradiotherapy. Chemotherapy using drugs that convert to cytotoxic activity only upon light exposure is called photochemotherapy or photodynamic therapy. In some alternatives of administering the genetically modified immune cell described herein, the method can further comprise administering to a subject having cancer, photochemotherapy or photodynamic therapy after receiving the genetically modified immune cells or genetically engineered macrophages (GEMs).
Chemotherapuetic drugs can include but are not limited to antibody-drug conjugates (for example, an antibody attached to a drug by a linker), nanoparticles (for example a nanoparticle can be 1-1000 nanometer sized particle for promoting tumor selectivity and aid in delivering low-solubility drugs), electochemotherapy, alkylating agents, antimetabolites (for example, 5-fluorouracil (5-FU), 6-mercaptopurine (6-MP), Capecitabine (Xeloda®), Cladribine, Clofarabine, Cytarabine (Ara-C®), Floxuridine, Fludarabine, Gemcitabine (Gemzar®), Hydroxyurea, Methotrexate, Pemetrexed (Alimta®), Pentostatin, or Thioguanine), anti-tumor antibiotics, topoisomerase inhibitors, mitotic inhibitors, corticosteroids, DNA intercalating agents, or checkpoint inhibitors (for example checkpoint kinases CHK1, or CHK2). In some alternatives of the methods described herein, the genetically modified immune cells or compositions comprising genetically modified immune cells are administered in combination with one or more anti-cancer agents, such as any one or more of the foregoing compounds or therapies. In some alternatives, the one or more anti-cancer agent that is co-administered or administered in conjunction with the genetically modified immune cells, comprises antibody-drug conjugates, nanoparticles, electrochemotherapy, alkylating agents, antimetabolites, anti-tumor antibiotics, topoisomerase inhibitors, mitotic inhibitors, corticosteroids, DNA intercalating agents, or checkpoint inhibitors. In some alternatives, the antimetabolites comprise 5-fluorouracil (5-FU), 6-mercaptopurine (6-MP), Capecitabine (Xeloda®), Cladribine, Clofarabine, Cytarabine (Ara-C®), Floxuridine, Fludarabine, Gemcitabine (Gemzar®), Hydroxyurea, Methotrexate, Pemetrexed (Alimta®), Pentostatin, or Thioguanine.
“Subject” or “patient,” as described herein, refers to any organism upon which the alternatives described herein may be used or administered, e.g., for experimental, diagnostic, prophylactic, and/or therapeutic purposes. Subjects or patients include, for example, animals. In some alternatives, the subject is mice, rats, rabbits, non-human primates, and humans. In some alternatives, the subject is a cow, sheep, pig, horse, dog, cat, primate or a human.
Some embodiments relate to a CAR T cell tumor targeting (CTCT) agent. Some embodiments provided herein relate to a phospholipid ether (PLE) tethered to the hapten fluorescein (FL-PLE). “Fluorescein” as described herein, is a synthetic organic compound that is soluble in water and alcohol. It is widely used as a fluorescent tracer for many applications. In the alternatives herein, fluorescein is a target moiety on a lipid that is specifically recognized by a chimeric antigen receptor designed and/or selected for its ability to bind or interact with the fluorescein. In some alternatives, the lipid is a phospholipid ether.
“Lipid” as described herein, is a class of organic compounds that comprise carbon chains, fatty acids or a fatty acid derivative that is typically insoluble in water but can integrate into or mix with hydrophobic or organic solvents. Without being limiting, lipids can include fats, waxes, fat soluble vitamins, monoglycerides, diglycerides, triglycerides, sphingolipids, cerebrosides, ceramides, or phospholipids. Described herein are amphiphilic lipids that can have a polar head group and a hydrophobic moiety or hydrophobic group. “Hydrophobic group” or hydrophobic moiety, as described herein, is a molecule or a part of a molecule that is repelled from a mass of water and tends to be non-polar. This can include alkanes, oils or fats. Without being limiting, lipids can be glycerolipids, glycerophospholipids, sphingolipids, sterol lipids, prenol lipids, saccharolipids or polyketides. In the alternatives herein a complex is provided, wherein the complex comprises a lipid. In some alternatives, the lipid comprises a polar head group and a hydrophobic moiety. In some alternatives, the hydrophobic moiety is a hydrophobic carbon tail. In some alternatives the hydrophobic carbon tail is saturated or unsaturated. In some alternatives, the hydrophobic carbon tail comprises 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25 carbons or any number of carbons in between a range set forth in any aforementioned value. In some alternatives, the hydrophobic moiety is a steroid or a cholesterol. In some alternatives, the lipid comprises a glycerolipid, glycerophospholipid, sphingolipid, sterol lipid, prenol lipid, saccharolipid or polyketide. In some alternatives, the lipid is a phospholipid ether. In some alternatives, the lipid contains branched alkyl tails.
In some alternatives, the lipid can be a sphingolipid. The sphingolipid can contain a backbone of sphingoid bases, such as a set of aliphatic amino alcohols that includes sphingosine. A sphingolipid with an R group consisting of a hydrogen atom only is a ceramide. Other common R groups include phosphocholine, yielding a sphingomyelin, and various sugar monomers or dimers, yielding cerebrosides and globosides, respectively. Cerebrosides and globosides are collectively known as glycosphingolipids. In some alternatives, the lipid is a glycosphingolipid.
As provided herein, the lipid comprises a polar head group and a hydrophobic group. In some alternatives, the hydrophobic group comprises a fatty acid such as an aliphatic chain. The fatty acid can be saturated or unsaturated. In some alternatives, the hydrophobic group comprises an alkyl, alkenyl or alkynyl group. In some alternatives, the hydrophobic group comprises a terpenoid lipid, such as a steroid or cholesterol. In some alternatives, the hydrophobic group comprises an ether linkage, wherein the ether linkage is between the polar head group and the aliphatic chain. In some alternatives, the lipid is a phospholipid ether. In some alternatives, the polar head comprises a choline, a phosphatidylcholine, sphingomyelin, phosphoethanolamine group, an oligosaccharide residue, a sugar residue, phosphatidyl serine or phosphatidyl inositol. In some alternatives, the sugar is a glycerol or sugar alcohol.
In some alternatives, the lipid is a single chain alkylphospholipid.
In some alternatives, the lipid comprises a structure of synthetic alkylphospholipids, such as edelfosine, perifosine or erucylphosphocholine. In some alternatives, the lipid is a lysophosphatidylcholine, edlfosine, erucylphosphocholine, D-21805 or perfisone. Such lipids are described for example, in van der Lui et al (“A new class of anticancer alkylphospholipids uses lipid rafts as membrane gateways to induce apoptosis in lymphoma cells” Mol Cancer Ther 2007; 6(8), 2007; hereby expressly incorporated by reference in its entirety). In some alternatives of the lipids described herein, a choline within the polar head group can be substituted with a piperidine moiety. In some alternatives, the lipid is an anticancer alkylphospholipid. Anticancer phospholipids are described by vander Lui et al. (“A new class of anticancer alkylphospholipids uses lipid rafts as membrane gateways to induce apoptosis in lymphoma cells” Mol Cancer Ther 2007; 6(8), 2007; hereby expressly incorporated by reference in its entirety).
In some alternatives, the lipids provided herein are synthetic and structurally related antitumor agents that interact with a cell membrane. These types of synthetic lipids are alkylphospholipids and are described by e.g., van Blitterswijk et al. (“Anticancer mechanisms and clinical application of alkylphopholipids” Biochimica et Biophysica Acta 1831 (2013) 663-674; hereby incorporated by reference in its entirety herein). Without being limiting, the synthetic alkylphospholipids can include edelfosine, miltefosine, perifosine, erucylphosphocholine or Erufosine. In some alternatives, the lipid is edelfosine, miltefosine, perifosine, erucylphosphocholine or Erufosine. In some alternatives, the lipid is a stable analog of lysophosphatidylcholine. In some alternatives, the lipid is a thio-ether variant of edelfosine, or 1-hexadecylthio-2-methoxymethyl-rac-glycero-3-phosphocholine. In some alterantives, the lipid is LysoPC, edelfosine, Ilmofosine, Miltefosine, Perifosine, Erucylphophocholine, or Erufosine.
“Polar-head group” as described herein, is the hydrophilic group of a lipid, such as a phospholipid. “Phospholipids” as described herein are a specific class of lipids that can form lipid bilayers due to their amphiphilic characteristic. The phospholipid molecule comprises at least one hydrophobic fatty acid “tail” and a hydrophilic “head” or “polar-head group.” In the alternative herein, the phospholipid or phospholipid ether comprises a polar-head group. In some alternatives, the polar-head group comprises phosphocholine, a piperidine moiety or a trimethylarseno-ethyl-phosphate moiety. In some alternatives, the lipid comprises a target moiety and the CAR is joined to or is configured to join to said lipid through an interaction with said target moiety. In some alternatives, the lipid comprises a polar-head group (e.g., comprising an aromatic ring) and a carbon alkyl chain. In some alternatives herein, a complex is provided, wherein the complex comprises one or more of said lipids. In some alternatives, the lipid comprises a polar head group. In some alternatives, the lipid is a phospholipid ether. In some alternatives, the phospholipid ether comprises a target moiety and the CAR is joined to or is configured to join to said phospholipid ether through an interaction and/or binding with said target moiety. In some alternatives, the phospholipid ether comprises a polar-head group and a carbon alkyl chain. In some alternatives, the polar head group comprises a choline, a phosphatidylcholine, sphingomyelin, phosphoethanolamine group, an oligosaccharide residue, a sugar residue, phosphatidyl serine or phosphatidyl inositol. In some alternatives, the polar head group comprises phosphocholine, a piperidine moiety or a trimethylarseno-ethyl-phosphate moiety. In some alternatives, the lipid is a phospholipid ether. In some alternatives, the sugar is a glycerol or sugar alcohol. In some alternatives, the polar head group comprises a sugar group. In some alternatives, the lipid comprises a mannose-containing head group. In some alternatives, the polar head group comprises sphingosine. In some alternatives, the polar head group comprises a glucose. In some alternatives, the polar head group comprises a di-, tri- or tetra-saccharide. In some alternatives, the lipid is a glucosylcerebroside. In some alternatives, the lipid is a lactosylceramide. In some alternatives, the lipid is a glycolipid. In some alternatives, the glycolipid comprises sugar units, such as n-glucose, n-galactose or N-actyl-n-glactosamine. In some alternatives, the lipid comprises a hydrocarbon ring such as a sterol.
In some alternatives, the polar head group of the lipid comprises glycerol or a sugar alcohol. In some alternatives, the polar head group of the lipid comprises a phosphate group. In some alternatives, the polar head group of the lipid comprises choline. In some alternatives, the lipid is a phosphatidylethanolomine. In some alternatives, the lipid is a phosphatidylinositol. In some alternatives, the lipid comprises a sphingoid base backbone. In some alternatives, the lipid comprises a sterol lipid, such as cholesterol or its derivatives. In some alternatives, the lipid comprises saccharolipids. In some alternatives, the polar head group comprises choline, phosphate and/or glycerol.
In some alternatives, the lipid is a glycolipid. In some alternatives, the lipid comprises a sugar. In some alternatives, the lipid is derived from sphingosine. In some alternatives, the lipid is a glycerol-glycolipid or a sphingo-glycolipid.
In some alternatives, the lipid is an ether lipid with branched hydrophobic chains.
“Saturated” as described herein is a fatty acid molecule, in which there are no double bonds within the carbon molecules. Unsaturated as described herein indicates that there are one or more double bonds in a fatty acid chain. In some alternatives herein a complex comprising a lipid is provided. In some alternatives, the lipid comprises a fatty acid chain, in which the fatty acid is saturated or unsaturated.
“Alkyl” as described herein, is an alkyl substituent that has a missing hydrogen.
An “alkenyl” group is an unsaturated hydrocarbon that contains at least one carbon-carbon double bond.
An “alkynyl” group is an unsaturated hydrocarbon containing at least one carbon-carbon triple bond.
“Terpenoid” as described herein, is a molecule that is derived from five carbon isoprene units. Steroids and sterols can be produced from terpenoid precursors. For example, steroids and cholesterol can be biosynthesized by terpenoid precursors.
“Phospholipid ether” as described herein is a lipid in which one or more of the carbon atoms on a polar head group are bonded to an alkyl chain via an ether linkage, as opposed to the more common ester linkage. In some alternatives, the polar head group is a glycerol.
Several types of “spacers” are described herein. The spacer for a chimeric antigen receptor refers to a polypeptide spacer, which spacer length is configured to or is selected for its ability to promote an increase in binding or interaction with a chimeric antigen receptor or to reduce or minimizes an adverse side effect associated with CAR T cell therapy. In some embodiments, a short spacer domain of a CAR has about 12 amino acids or less but greater than 1 amino acid and comprises all or a portion of a IgG4 hinge region sequence or variant thereof. In some embodiments, an intermediate spacer domain of a CAR has about 119 amino acids or less but greater than 1 amino acid and comprises all or a portion of a IgG4 hinge region sequence and a CH3 region or variant thereof. In some embodiments, a long spacer domain of a CAR has about 229 amino acids or less but greater than 1 amino acid and comprises all or a portion of a IgG4 hinge region sequence, a CH2 region, and a CH3 region or variant thereof. With regards to the lipid, the lipid can also comprise a spacer that separates the target moiety from the lipid and is bound to the polar-head group of the lipid. The spacer of the lipid can comprise a PEG spacer, a Hapten spacer, a small peptide or an alkane chain. In some alternatives, the hapten spacer comprises two haptens (hapten (2×) spacer). In some alternatives, the lipid comprises a hydrophobic group, such as an alkane chain. In some alternatives, the alkane chain can comprise 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or 18 carbons, or any number of carbons between a range defined by any two aforementioned values. In some alternatives, the PEG spacer comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16 PEG molecules, or any amount of PEG molecules that is within a range defined by any two aforementioned values.
“Hapten” as described herein is a small molecule that elicit an immune response only when attached to a large carrier such as a protein; the carrier may be one that also does not elicit an immune response by itself. Once the body has generated antibodies to a hapten-carrier adduct, the small-molecule hapten may also be able to bind to the antibody, but it will usually not initiate an immune response; usually only the hapten-carrier adduct can do this. In some embodiments, a hapten is a small molecule binding moiety, which can be bound by or have specificity towards a scFv or antibody.
In some alternatives herein, the cells provided are cytotoxic T lymphocytes. “Cytotoxic T lymphocyte” (CTL) as used herein refers to a T lymphocyte that expresses CD8 on the surface thereof (e.g., a CD8+ T cell). In some alternatives, such cells are preferably “memory” T cells (TM cells) that are antigen-experienced. In some alternatives, the cell is a precursor T cell. In some alternatives, the precursor T cell is a hematopoietic stem cell. In some alternatives, the cell is a CD8+T cytotoxic lymphocyte cell selected from the group consisting of naïve CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells and bulk CD8+ T cells. In some alternatives, the cell is a CD4+T helper lymphocyte cell that is selected from the group consisting of naïve CD4+ T cells, central memory CD4+ T cells, effector memory CD4+ T cells, and bulk CD4+ T cells.
“Masking moiety” as used herein, refers to a moiety on a lipid ether that is bound to the target moiety. The masking moiety functions as a protective group to prevent recognition of the lipid's target moiety by blocking binding and recognition of a chimeric antigen receptor that is specific for the target moiety. When the lipid is integrated into a cell, wherein the cell exists in a tumor environment or site of reactive oxygen species, the masking moiety can be self-cleaved, thus allowing binding, interaction and/or recognition of the target moiety by the chimeric antigen receptor. In some alternatives, the lipid is a phospholipid ether. In some alternatives, the masking moiety comprises a phenolic hydroxyl group or PEG. In some alternatives, the phenolic hydroxyl group is bound to a hydroxyl on a xanthene moiety of fluorescein. In some alternatives, the masking moiety is bound to the target moiety by a cleavable moiety, which is optionally configured to be specifically cleavable in a tumor microenvironment. In some alternatives, the cleavable moiety, which is configured to be cleavable in a tumor microenvironment, is cleaved by a reactive oxygen species reaction, an acidic pH, hypoxia, or nitrosylation. In some alternatives, the phospholipid ether comprises a target moiety and the CAR is joined to said phospholipid ether through an interaction with said target moiety. In some alternatives, the phospholipid ether comprises a polar-head group and a carbon alkyl chain.
“Cancer,” as described herein, is a group of diseases involving abnormal cell growth with the potential to invade or spread to other parts of the body. Subjects that can be addressed using the methods described herein include subjects identified or selected as having cancer, including but not limited to colon, lung, liver, breast, renal, prostate, ovarian, skin (including melanoma), bone, leukemia, multiple myeloma, or brain cancer, etc. Such identification and/or selection can be made by clinical or diagnostic evaluation. In some alternatives, the tumor associated antigens or molecules are known, such as melanoma, breast cancer, brain cancer, squamous cell carcinoma, colon cancer, leukemia, myeloma, or prostate cancer. Examples include but are not limited to B cell lymphoma, breast cancer, brain cancer, prostate cancer, and/or leukemia. In some alternatives, one or more oncogenic polypeptides are associated with kidney, uterine, colon, lung, liver, breast, renal, prostate, ovarian, skin (including melanoma), bone, brain cancer, adenocarcinoma, pancreatic cancer, chronic myelogenous leukemia or leukemia. In some alternatives, a method of treating, ameliorating, or inhibiting a cancer in a subject is provided. In some alternatives, the cancer is breast, ovarian, lung, pancreatic, prostate, melanoma, renal, pancreatic, glioblastoma, neuroblastoma, medulloblastoma, sarcoma, liver, colon, skin (including melanoma), bone or brain cancer. In some alternatives, the subject that receives one of the therapies described herein is also selected to receive an additional cancer therapy, which can include a cancer therapeutic, radiation, chemotherapy, or a cancer therapy drug. In some alternatives, the cancer therapy drug provided comprises Abiraterone, Alemtuzumab, Anastrozole, Aprepitant, Arsenic trioxide, Atezolizumab, Azacitidine, Bevacizumab, Bleomycin, Bortezomib, Cabazitaxel, Capecitabine, Carboplatin, Cetuximab, Chemotherapy drug combinations, Cisplatin, Crizotinib, Cyclophosphamide, Cytarabine, Denosumab, Docetaxel, Doxorubicin, Eribulin, Erlotinib, Etoposide, Everolimus, Exemestane, Filgrastim, Fluorouracil, Fulvestrant, Gemcitabine, Imatinib, Imiquimod, Ipilimumab, Ixabepilone, Lapatinib, Lenalidomide, Letrozole, Leuprolide, Mesna, Methotrexate, Nivolumab, Oxaliplatin, Paclitaxel, Palonosetron, Pembrolizumab, Pemetrexed, Prednisone, Radium-223, Rituximab, Sipuleucel-T, Sorafenib, Sunitinib, Talc Intrapleural, Tamoxifen, Temozolomide, Temsirolimus, Thalidomide, Trastuzumab, Vinorelbine or Zoledronic acid.
“Tumor microenvironment” as described herein is a cellular environment, wherein a tumor exists. Without being limiting, the tumor microenvironment can include surrounding blood vessels, immune cells, fibroblasts, bone marrow-derived inflammatory cells, lymphocytes, signaling molecules or the extracellular matrix (ECM).
In some embodiments, the method includes human tumor therapy in which patients receive infusions of FL-PLE or derivatives thereof in combination with infusions of FL-specific CAR T cells. In this scenario, this system represents a universal target antigen used in combination with a universal CAR and/or universal CAR expressing anti-tumor effector cells. In some embodiments, a PLE (18C alkyl chain) having a FL appended CAR recognition element, which is appended to the polar head group's choline via three repeat PEG spacers is provided. An antiFL CAR library may be generated with different single chain variable fragments (scFvs), such as 6 or more different scFvs, with dissociation constants ranging from 200 fM to 10 nM, such as 200 fM, 210 fM, 220 fM, 230 fM, 240 fM, 250 fM, 260 fM, 270 fM, 280 fM, 290 fM, 300 fM, 400 fM, 500 fM, 600 fM, 700 fM, 800 fM, 900 fM, 1 pM, 100 pM, 200 pM, 300 pM, 400 pM, 500 pM, 600 pM, 700 pM, 800 pM, 900 pM, 1 nM, 2 nM, 3 nM, 4 nM, 5 nM, 6 nM, 7 nM, 8 nM, 9 nM, or 10 nm, or an amount within a range defined by any two of the aforementioned values, which connect the scFv to the spacing element of the CAR. Each scFv binds FL in a slightly different manner. Without wishing to be bound by theory, the binding of scFv to FL is partially due to the difference in binding affinities through mutations in the binding pocket and due to the fact that some scFvs were derived from phage display compared to yeast display. In some embodiments, three different spacers (all derived from antibody components) may be used, including, for example: long, IgG4 hinge connected to a CH2 domain to a CH3 domain; medium, IgG4 hinge connected to a CH3 domain; and short, IgG4 hinge only. In some embodiments, only FL-specific scFv CAR T cells with the correct orientation and spacer length exhibit redirected anti-tumor function in both in vitro and in vivo tumors loaded with FL PLE-CTCTs. Moreover, the shape and size of the scFv's binding pocket can play a role in how well the CAR can activate.
Some embodiments provided herein relate to a FL-specific CAR T cell comprising a targeting and recognition domain presented in a correct orientation with spacing and a binding affinity selected to create a desired T cell response. In some embodiments, the spacing is selected for generating a T cell response in the specific cells of interest. In some embodiments, the binding affinity is selected for generating a T cell response in the specific cells of interest. In some embodiments, different tumors or cells benefit from different orientation, different spacer lengths, and affinities of CAR T cells to allow for desired CAR T cell responses. Therefore, some embodiments provided herein relate to generating a desired or selected combination of orientation, spacer length, and binding affinity for a selected therapy.
In some embodiments, an indication or measure of successful CAR T cells in vitro include cell lysis and the production of cytokines. As described herein in further detail, short spacer CARs typically do not produce cytokines; whereas the long spacer CARs produce a large quantity of cytokines.
In some embodiments, an antiFL(4D5Flu) CAR, which comprises SEQ ID NO: 4, and which is not able to produce cytokines with FL-PLE, is provided; whereas when cells are labeled with FL by another approach the antiFL(4D5Flu) CAR produces cytokines highlighting that the orientation of scFv to FL moiety of FL-PLE is an important and previously unrecognized variable in T cell activity. In some embodiments, lowering the dissociation constant, such as improving the binding affinity, does not necessarily improve the activation of the CAR. In some embodiments, asymmetric T cell antitumor reactivity does not correlate with scFv KD. In some embodiments, asymmetric T cell antitumor reactivity may be spacer length dependent. In some embodiments, an antiFL(FITC-E2 Mut2) CAR, which comprises SEQ ID NO: 1, is a robust CAR, which could not have been predicted from any prior knowledge of CAR structure function or scFv studies. In contrast, the field teaches that the highest scFv affinity results in the best CAR.
In some embodiments, FL-PLE administered to tumor-bearing mammals serves as a generic tumor-targeting agent that is retained on the tumor cell plasma membrane for recognition by FL-specific CAR T cells. Provided herein is the identification of a FL-specific CAR with unexpected T cell signaling robustness upon engagement of tumor cells loaded with FL-PLE. This disclosure relates, in some embodiments, to the full development of a pharmaceutical-grade FL-PLE to be used in conjunction with a CAR T cell product, including in a kit. Other haptens could replace FL with CAR designed to react with these PLEs.
TABLE 1 lists certain example sequences useful with embodiments provided herein.
TABLE 1
SEQ ID NO.
(description) SEQUENCE
SEQ ID NO: 01 SVLTQPSSVSAAPGQKVTISCSGSTSNIGNNYVSWYQQHPGKAPKLMIY
(scFv of antiFL DVSKRPSGVPDRFSGSKSGNSASLDISGLQSEDEADYYCAAWDDSLSEF
(FITCE2 Mut2 CAR) LFGTGTKLTVLGGGGGSGGGGSGGGGSQVQLVESGGNLVQPGGSLRLSC
AASGFTFGSFSMSWVRQAPGGGLEWVAGLSARSSLTHYADSVKGRFTIS
RDNAKNSVYLQMNSLRVEDTAVYYCARRSYDSSGYWGHFASYMDVWGQG
TLVTVS
SEQ ID NO: 02 DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLRWYLQKPGQSPKVLI
(antiFL(4M5.3) CAR) YKVSNRVSGVPDRFSGSGSGTDFTLKINRVEAEDLGVYFCSQSTHVPWTFGGG
TKLEIKSSADDAKKDAAKKDDAKKDDAKKDGGVKLDETGGGLVQPGGAMKL
SCVTSGFTFGHYWMNWVRQSPEKGLEWVAQFRNKPYNYETYYSDSVKGRFT
ISRDDSKSSVYLQMNNLRVEDTGIYYCTGASYGMEYLGQGTSVTVS
SEQ ID NO: 03 DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSQGNTYLRWYLQKPGQSPKVLI
(scFv of YKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPWTFGGG
antiFL(4420) CAR) TKLEIGGGGSGGGGSGGGGSEVKLDETGGGLVQPGRPMKLSCVASGFTFSDY
WMNWVRQSPEKGLEWVAQIRNKPYNYETYYSDSVKGRFTISRDDSKSSVYLQ
MNNLRVEDMGIYYCTGSYYGMDYWGQGTSVTVSS
SEQ ID NO: 04 DYKDIQMTQSPSSLSASVGDRVTITCRASQSLVHSQGNTYLRWYQQKPGK
(scFv of APKVLIYKVSNRFSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQST
antiFL(4D5Flu) CAR) HVPWTFGQGTKVELKRAGGGGSGGGGSGGGGSSGGGSGGGGSGGGGSEVQ
LVESGGGLVQPGGSLRLSCAASGFTFSDYWMNWVRQAPGKGLEWVAQIRN
KPYNYETYYADSVKGRFTISRDTSKNTVYLQMNSLRAEDTAVYYCTGSYY
GMDYWGQGTLVTVSS
SEQ ID NO: 05 SVLTQPSSVSAAPGQKVTISCSGSTSNIGNNYVSWYQQHPGKAPKLMIYDV
(scFv of SKRPSGVPDRFSGSKSGNSASLDISGLQSEDEADYYCAAWDDSLSEFLFGT
antiFL(FITCE2) CAR) GTKLTVLGGGGGSGGGGSGGGGSQVQLVESGGNLVQPGGSLRLSCAASGFT
FGSFSMSWVRQAPGGGLEWVAGLSARSSLTHYADSVKGRFTISRDNAKNSV
YLQMNSLRVEDTAVYYCARRSYDSSGYWGHFYSYMDVWGQGTLVTVS
SEQ ID NO: 06 SVLTQPSSVSAAPGQKVTISCSGSTSNIGNNYVSWYQQHPGKAPKLMIYDV
(scFv of SKRPSGVPDRFSGSKSGNSASLDISGLQSEDEADYYCAAWDDSLSEFLFGT
antiFL(FITCE2 GTKLTVLGGGGGSGGGGSGGGGSQVQLVESGGNLVQPGGSLRLSCAASGFT
HisH131Ala)) FGSFSMSWVRQAPGGGLEWVAGLSARSSLTHYADSVKGRFTISRDNAKNSV
YLQMNSLRVEDTAVYYCARRSYDSSGYWGAFYSYMDVWGQGTLVTVS
SEQ ID NO: 07 ESKYGPPCPPCPAPEFDGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQE
(IgG4 hinge DPEVQFNWYVDGVEVHNAKTKPREEQFQSTYRVVSVLTVLHQDWLNGKEYK
connected to a CH2 CKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKG
domain to a CH3 FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNV
domain spacer) FSCSVMHEALHNHYTQKSLSLSLGK
SEQ ID NO: 08 ESKYGPPCPPCPGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAV
(IgG4 hinge EWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHE
connected to a CH3 ALHNHYTQKSLSLSLGK
domain spacer)
SEQ ID NO: 09 ESKYGPPCPPCP
(IgG4 hinge only
spacer)
SEQ ID NO: 10 ATGCTTCTCCTGGTGACAAGCCTTCTGCTCTGTGAGTTACCACACCCAGCAT
(E2 anti-fluorescein TCCTCCTGATCCCAAGCGTGCTGACACAGCCTAGCTCCGTGTCTGCCGCCCC
antibody fragment TGGCCAGAAAGTGACCATCAGCTGTAGCGGCAGCACCAGCAACATCGGCA
CAR nucleic acid ACAACTACGTGTCCTGGTATCAGCAGCACCCCGGCAAGGCCCCCAAGCTGA
sequence) TGATCTACGACGTGTCCAAGCGGCCCAGCGGCGTGCCCGATAGATTTTCCG
GCAGCAAGAGCGGCAACAGCGCCAGCCTGGATATCAGCGGCCTGCAGTCT
GAGGACGAGGCCGACTACTATTGCGCCGCCTGGGACGATAGCCTGAGCGA
GTTCCTGTTTGGCACCGGCACCAAGCTGACAGTGCTGGGCGGAGGCGGAG
GATCTGGCGGCGGAGGAAGTGGCGGAGGGGGATCTCAGGTGCAGCTGGT
GGAAAGCGGCGGCAACCTGGTGCAGCCTGGCGGATCTCTGAGACTGAGCT
GTGCCGCCAGCGGCTTCACCTTCGGCAGCTTCAGCATGAGCTGGGTGCGC
CAGGCTCCTGGGGGAGGACTGGAATGGGTGGCAGGACTGAGCGCCAGAA
GCAGCCTGACCCACTACGCCGATAGCGTGAAGGGCCGGTTCACCATCAGC
CGGGACAACGCCAAGAACAGCGTGTACCTGCAGATGAACAGCCTGCGGGT
GGAAGATACCGCCGTGTACTACTGCGCCAGACGGTCCTACGACAGCAGCG
GCTACTGGGGCCACTTCTACAGCTACATGGACGTGTGGGGCCAGGGCACC
CTCGTGACAGTGTCTGAGAGCAAGTACGGACCGCCCTGCCCCCCTTGCCCT
GCCCCCGAGTTCGACGGCGGACCCAGCGTGTTCCTGTTCCCCCCCAAGCCC
AAGGACACCCTGATGATCAGCCGGACCCCCGAGGTGACCTGCGTGGTGGT
GGACGTGAGCCAGGAAGATCCCGAGGTCCAGTTCAATTGGTACGTGGACG
GCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGAGGAACAGTTCCA
GAGCACCTACCGGGTGGTGTCTGTGCTGACCGTGCTGCACCAGGACTGGC
TGAACGGCAAAGAATACAAGTGCAAGGTGTCCAACAAGGGCCTGCCCAGC
AGCATCGAAAAGACCATCAGCAAGGCCAAGGGCCAGCCTCGCGAGCCCCA
GGTGTACACCCTGCCTCCCTCCCAGGAAGAGATGACCAAGAACCAGGTGT
CCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGT
GGGAGAGCAACGGCCAGCCTGAGAACAACTACAAGACCACCCCTCCCGTG
CTGGACAGCGACGGCAGCTTCTTCCTGTACAGCCGGCTGACCGTGGACAA
GAGCCGGTGGCAGGAAGGCAACGTCTTTAGCTGCAGCGTGATGCACGAG
GCCCTGCACAACCACTACACCCAGAAGAGCCTGAGCCTGTCCCTGGGCAA
GATGTTCTGGGTGCTGGTGGTGGTGGGCGGGGTGCTGGCCTGCTACAGCC
TGCTGGTGACAGTGGCCTTCATCATCTTTTGGGTGAAACGGGGCAGAAAG
AAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTC
AAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGG
ATGTGAACTGCGGGTGAAGTTCAGCAGAAGCGCCGACGCCCCTGCCTACC
AGCAGGGCCAGAATCAGCTGTACAACGAGCTGAACCTGGGCAGAAGGGA
AGAGTACGACGTCCTGGATAAGCGGAGAGGCCGGGACCCTGAGATGGGC
GGCAAGCCTCGGCGGAAGAACCCCCAGGAAGGCCTGTATAACGAACTGCA
GAAAGACAAGATGGCCGAGGCCTACAGCGAGATCGGCATGAAGGGCGAG
CGGAGGCGGGGCAAGGGCCACGACGGCCTGTATCAGGGCCTGTCCACCG
CCACCAAGGATACCTACGACGCCCTGCACATGCAGGCCCTGCCCCCAAGGC
TCGAGGGCGGCGGAGAGGGCAGAGGAAGTCTTCTAACATGCGGTGACGT
GGAGGAGAATCCCGGCCCTAGGATGCTTCTCCTGGTGACAAGCCTTCTGCT
CTGTGAGTTACCACACCCAGCATTCCTCCTGATCCCACGCAAAGTGTGTAAC
GGAATAGGTATTGGTGAATTTAAAGACTCACTCTCCATAAATGCTACGAAT
ATTAAACACTTCAAAAACTGCACCTCCATCAGTGGCGATCTCCACATCCTGC
CGGTGGCATTTAGGGGTGACTCCTTCACACATACTCCTCCTCTGGATCCACA
GGAACTGGATATTCTGAAAACCGTAAAGGAAATCACAGGGTTTTTGCTGAT
TCAGGCTTGGCCTGAAAACAGGACGGACCTCCATGCCTTTGAGAACCTAGA
AATCATACGCGGCAGGACCAAGCAACATGGTCAGTTTTCTCTTGCAGTCGT
CAGCCTGAACATAACATCCTTGGGATTACGCTCCCTCAAGGAGATAAGTGA
TGGAGATGTGATAATTTCAGGAAACAAAAATTTGTGCTATGCAAATACAAT
AAACTGGAAAAAACTGTTTGGGACCTCCGGTCAGAAAACCAAAATTATAA
GCAACAGAGGTGAAAACAGCTGCAAGGCCACAGGCCAGGTCTGCCATGCC
TTGTGCTCCCCCGAGGGCTGCTGGGGCCCGGAGCCCAGGGACTGCGTCTC
TTGCCGGAATGTCAGCCGAGGCAGGGAATGCGTGGACAAGTGCAACCTTC
TGGAGGGTGAGCCAAGGGAGTTTGTGGAGAACTCTGAGTGCATACAGTG
CCACCCAGAGTGCCTGCCTCAGGCCATGAACATCACCTGCACAGGACGGG
GACCAGACAACTGTATCCAGTGTGCCCACTACATTGACGGCCCCCACTGCG
TCAAGACCTGCCCGGCAGGAGTCATGGGAGAAAACAACACCCTGGTCTGG
AAGTACGCAGACGCCGGCCATGTGTGCCACCTGTGCCATCCAAACTGCACC
TACGGATGCACTGGGCCAGGTCTTGAAGGCTGTCCAACGAATGGGCCTAA
GATCCCGTCCATCGCCACTGGGATGGTGGGGGCCCTCCTCTTGCTGCTGGT
GGTGGCCCTGGGGATCGGCCTCTTCATGTGA
SEQ ID NO: 11 MLLLVTSLLLCELPHPAFLLIPSVLTQPSSVSAAPGQKVTISCSGSTSNIGN
(E2 anti-fluorescein NYVSWYQQHPGKAPKLMIYDVSKRPSGVPDRFSGSKSGNSASLDISGLQSED
antibody fragment EADYYCAAWDDSLSEFLFGTGTKLTVLGGGGGSGGGGSGGGGSQVQLVESGG
CAR amino acid NLVQPGGSLRLSCAASGFTFGSFSMSWVRQAPGGGLEWVAGLSARSSLTHYA
sequence) DSVKGRFTISRDNAKNSVYLQMNSLRVEDTAVYYCARRSYDSSGYWGHFYSY
MDVWGQGTLVTVSESKYGPPCPPCPAPEFDGGPSVFLFPPKPKDTLMISRTP
EVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFQSTYRVVSVLTVL
HQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVD
KSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKMFWVLVVVGGVLACYSLL
VTVAFIIFWVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRK
NPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDAL
HMQALPPRLEGGGEGRGSLLTCGDVEENPGPRMLLLVTSLLLCELPHPAFLL
IPRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTH
TPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQ
FSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQK
TKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKC
NLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHC
VKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKI
PSIATGMVGALLLLLVVALGIGLFM
SEQ ID NO: 12 MLLLVTSLLLCELPHPAFLLIPDVVMTQTPLSLPVSLGDQASISCRSSQS
(4M5.3-CAR amino LVHSNGNTYLRWYLQKPGQSPKVLIYKVSNRVSGVPDRFSGSGSGTDFTL
acid sequence) KINRVEAEDLGVYFCSQSTHVPWTFGGGTKLEIKSSADDAKKDAAKKDDA
KKDDAKKDGGVKLDETGGGLVQPGGAMKLSCVTSGFTFGHYWMNWVRQSP
EKGLEWVAQFRNKPYNYETYYSDSVKGRFTISRDDSKSSVYLQMNNLRVE
DTGIYYCTGASYGMEYLGQGTSVTVSESKYGPPCPPCPAPEFDGGPSVFL
FPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPR
EEQFQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQ
PREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK
TTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLS
LSLGKMFWVLVVVGGVLACYSLLVTVAFIIFWVKRGRKKLLYIFKQPFMR
PVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELN
LGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIG
MKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRLEGGGEGRGSLLT
CGDVEENPGPRMLLLVTSLLLCELPHPAFLLIPRKVCNGIGIGEFKDSLS
INATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKE
ITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGL
RSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCK
ATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFV
ENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVM
GENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSIATGM
VGALLLLLVVALGIGLFM
SEQ ID NO: 13 ATGCTTCTCCTGGTGACAAGCCTTCTGCTCTGTGAGTTACCACACCCAGCAT
(4M 5.3-CAR TCCTCCTGATCCCAGACGTTGTAATGACCCAGACCCCTCTGTCTCTCCCCGT
nucleotide AAGCTTGGGCGACCAGGCGAGCATCTCTTGTCGGTCTTCCCAGTCCCTGGT
seq uence) CCATTCAAACGGCAATACTTACTTGCGGTGGTACTTGCAGAAGCCCGGTCA
ATCCCCAAAAGTGCTGATATACAAGGTTAGCAATCGGGTCAGTGGAGTGC
CCGACCGCTTCAGCGGAAGCGGATCCGGGACTGACTTCACTCTGAAGATC
AACCGGGTAGAAGCTGAAGACCTGGGGGTGTACTTCTGCTCTCAGTCAAC
ACACGTGCCATGGACCTTTGGAGGTGGCACCAAGCTGGAAATCAAATCAT
CAGCGGACGATGCCAAAAAAGACGCGGCCAAGAAGGACGATGCCAAGAA
GGATGATGCTAAAAAGGATGGCGGAGTCAAATTGGACGAGACAGGCGGG
GGACTGGTGCAGCCCGGCGGTGCCATGAAACTGTCTTGTGTGACCAGCGG
CTTTACCTTCGGGCATTATTGGATGAACTGGGTGCGACAGTCTCCAGAGAA
AGGGCTCGAGTGGGTGGCCCAGTTTCGAAATAAACCGTACAATTATGAGA
CCTACTATTCAGATTCTGTGAAAGGGCGCTTCACTATTTCACGCGACGACA
GCAAAAGTTCCGTCTACCTTCAGATGAACAACCTTAGAGTGGAGGATACCG
GAATATACTACTGCACGGGTGCCAGTTATGGCATGGAGTACTTGGGGCAG
GGGACATCTGTGACCGTTTCTGAGAGCAAGTACGGACCGCCCTGCCCCCCT
TGCCCTGCCCCCGAGTTCGACGGCGGACCCAGCGTGTTCCTGTTCCCCCCC
AAGCCCAAGGACACCCTGATGATCAGCCGGACCCCCGAGGTGACCTGCGT
GGTGGTGGACGTGAGCCAGGAAGATCCCGAGGTCCAGTTCAATTGGTACG
TGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGAGGAACA
GTTCCAGAGCACCTACCGGGTGGTGTCTGTGCTGACCGTGCTGCACCAGG
ACTGGCTGAACGGCAAAGAATACAAGTGCAAGGTGTCCAACAAGGGCCTG
CCCAGCAGCATCGAAAAGACCATCAGCAAGGCCAAGGGCCAGCCTCGCGA
GCCCCAGGTGTACACCCTGCCTCCCTCCCAGGAAGAGATGACCAAGAACCA
GGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGT
GGAGTGGGAGAGCAACGGCCAGCCTGAGAACAACTACAAGACCACCCCTC
CCGTGCTGGACAGCGACGGCAGCTTCTTCCTGTACAGCCGGCTGACCGTG
GACAAGAGCCGGTGGCAGGAAGGCAACGTCTTTAGCTGCAGCGTGATGCA
CGAGGCCCTGCACAACCACTACACCCAGAAGAGCCTGAGCCTGTCCCTGG
GCAAGATGTTCTGGGTGCTGGTGGTGGTGGGCGGGGTGCTGGCCTGCTAC
AGCCTGCTGGTGACAGTGGCCTTCATCATCTTTTGGGTGAAACGGGGCAG
AAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAAC
TACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAG
GAGGATGTGAACTGCGGGTGAAGTTCAGCAGAAGCGCCGACGCCCCTGCC
TACCAGCAGGGCCAGAATCAGCTGTACAACGAGCTGAACCTGGGCAGAAG
GGAAGAGTACGACGTCCTGGATAAGCGGAGAGGCCGGGACCCTGAGATG
GGCGGCAAGCCTCGGCGGAAGAACCCCCAGGAAGGCCTGTATAACGAACT
GCAGAAAGACAAGATGGCCGAGGCCTACAGCGAGATCGGCATGAAGGGC
GAGCGGAGGCGGGGCAAGGGCCACGACGGCCTGTATCAGGGCCTGTCCA
CCGCCACCAAGGATACCTACGACGCCCTGCACATGCAGGCCCTGCCCCCAA
GGCTCGAGGGCGGCGGAGAGGGCAGAGGAAGTCTTCTAACATGCGGTGA
CGTGGAGGAGAATCCCGGCCCTAGGATGCTTCTCCTGGTGACAAGCCTTCT
GCTCTGTGAGTTACCACACCCAGCATTCCTCCTGATCCCACGCAAAGTGTGT
AACGGAATAGGTATTGGTGAATTTAAAGACTCACTCTCCATAAATGCTACG
AATATTAAACACTTCAAAAACTGCACCTCCATCAGTGGCGATCTCCACATCC
TGCCGGTGGCATTTAGGGGTGACTCCTTCACACATACTCCTCCTCTGGATCC
ACAGGAACTGGATATTCTGAAAACCGTAAAGGAAATCACAGGGTTTTTGCT
GATTCAGGCTTGGCCTGAAAACAGGACGGACCTCCATGCCTTTGAGAACCT
AGAAATCATACGCGGCAGGACCAAGCAACATGGTCAGTTTTCTCTTGCAGT
CGTCAGCCTGAACATAACATCCTTGGGATTACGCTCCCTCAAGGAGATAAG
TGATGGAGATGTGATAATTTCAGGAAACAAAAATTTGTGCTATGCAAATAC
AATAAACTGGAAAAAACTGTTTGGGACCTCCGGTCAGAAAACCAAAATTAT
AAGCAACAGAGGTGAAAACAGCTGCAAGGCCACAGGCCAGGTCTGCCAT
GCCTTGTGCTCCCCCGAGGGCTGCTGGGGCCCGGAGCCCAGGGACTGCGT
CTCTTGCCGGAATGTCAGCCGAGGCAGGGAATGCGTGGACAAGTGCAACC
TTCTGGAGGGTGAGCCAAGGGAGTTTGTGGAGAACTCTGAGTGCATACAG
TGCCACCCAGAGTGCCTGCCTCAGGCCATGAACATCACCTGCACAGGACG
GGGACCAGACAACTGTATCCAGTGTGCCCACTACATTGACGGCCCCCACTG
CGTCAAGACCTGCCCGGCAGGAGTCATGGGAGAAAACAACACCCTGGTCT
GGAAGTACGCAGACGCCGGCCATGTGTGCCACCTGTGCCATCCAAACTGC
ACCTACGGATGCACTGGGCCAGGTCTTGAAGGCTGTCCAACGAATGGGCC
TAAGATCCCGTCCATCGCCACTGGGATGGTGGGGGCCCTCCTCTTGCTGCT
GGTGGTGGCCCTGGGGATCGGCCTCTTCATGTGA

Methods of Therapy
Some embodiments of the methods and compositions provided herein include methods of treating or ameliorating or inhibiting a cancer in a subject. Some such embodiments include administering an effective amount to the subject a composition comprising a lipid conjugated to a target moiety, wherein the target moiety comprises a masking moiety; and administering a cell, such as a population of the cells, to the subject, wherein the cell comprises a chimeric antigen receptor (CAR) or T cell receptor (TCR), which specifically binds to the target moiety in the absence of the masking moiety, wherein the CAR or TCR comprises: an amino acid sequence having at least 95% identity with a sequence selected from SEQ ID NO:01-06; and/or a spacer domain comprising, consisting essentially of, or consisting of: a IgG4 hinge connected to a CH2 domain to a CH3 domain, such as a long spacer having an amino acid sequence with at least 95% identity with SEQ ID NO:07, or having an amino acid sequence of SEQ ID NO:07; a IgG4 hinge connected to a CH3 domain, such as a medium spacer having an amino acid sequence with at least 95% identity with SEQ ID NO:08, or having an amino acid sequence of SEQ ID NO:08; or a IgG4 hinge, such as short spacer having an amino acid sequence with at least 95% identity with SEQ ID NO:09, or having an amino acid sequence of SEQ ID NO:09.
In some embodiments, the CAR or TCR comprises an amino acid sequence selected from SEQ ID NO: 1-6. In some embodiments, the spacer comprises a length of 229 amino acids. In some embodiments, the CAR or TCR comprises an scFv domain having the amino acid sequence of SEQ ID NO:1 (FITC-E2 Mut2); and a spacer domain having the amino acid sequence of SEQ ID NO:07 (an exemplary long spacer). In some embodiments, the CAR or TCR comprises an scFv domain having the amino acid sequence of SEQ ID NO:2 (4M5.3); and a spacer domain having the amino acid sequence of SEQ ID NO:07 (an exemplary long spacer). In some embodiments, the CAR or TCR comprises: an scFv domain having the amino acid sequence of SEQ ID NO:5 (FITC-E2); and a spacer domain having the amino acid sequence of SEQ ID NO:07 (an exemplary long spacer).
Some embodiments of the methods and compositions provided herein include methods method of treating, ameliorating, or inhibiting a cancer in a subject comprising (a) introducing, providing, or administering to a subject a composition that comprises a lipid, which comprises a target moiety that is bound to a masking moiety; (b) introducing, providing, or administering to said subject a cell comprising a chimeric antigen receptor (CAR) or T cell receptor (TCR), which is specific for the target moiety once the masking moiety is removed from the target moiety, wherein the CAR or TCR comprises a spacer domain having a spacer length of 1-22 amino acids, 23-50 amino acids, 51-100 amino acids, 100 to 150 amino acids or 151-250 amino acids, wherein: the CAR or TCR comprises a sequence selected from SEQ ID NO:01-06; and/or the spacer domain comprises, consists essentially of, or consists of: an IgG4 hinge connected to a CH2 domain to a CH3 domain, such as a long spacer having an amino acid sequence with at least 95% identity with SEQ ID NO:07, or having an amino acid sequence of SEQ ID NO:07; a IgG4 hinge connected to a CH3 domain, such as a medium spacer having an amino acid sequence with at least 95% identity with SEQ ID NO:08, or having an amino acid sequence of SEQ ID NO:08; or a IgG4 hinge, such as short spacer having an amino acid sequence with at least 95% identity with SEQ ID NO: 9, or having an amino acid sequence of SEQ ID NO:09; (c) removing the masking moiety from the target moiety thereby allowing the target moiety to bind to the CAR present on the cell; and (d) optionally, measuring or evaluating the binding of the cell comprising the CAR to the lipid, after steps a-c; and/or (e) optionally, measuring or evaluating the treatment, amelioration, or inhibition of said cancer after steps a-d; and/or (f) optionally, identifying a subject in need of a therapy for cancer prior to steps a-c.
In some embodiments, the cell is provided to the subject at the same time or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 15, 20, 24, 36 or 48 hours before or after administration of the composition, or any time within a range defined by any two aforementioned values. In some embodiments, the cell is provided to the subject 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 15, 20, 24, 36 or 48 hours before administration of the composition, or any time within a range defined by any two aforementioned values. In some embodiments, the cell is provided to the subject within seconds or minutes, such as less than an hour, of providing the composition to the subject.
In some embodiments, a boost of the cell and/or the composition is provided to the subject.
In some embodiments, an additional cancer therapy is provided to said subject, such as a small molecule, e.g., a chemical compound, an antibody therapy, e.g., a humanized monoclonal antibody with or without conjugation to a radionuclide, toxin, or drug, surgery, and/or radiation.
In some embodiments, the cancer is a solid tumor. In some embodiments the cancer is a colon cancer, breast cancer, ovarian cancer, lung cancer, pancreatic cancer, prostate cancer, melanoma, renal cancer, pancreatic cancer, brain cancer, glioblastoma, neuroblastoma, medulloblastoma, sarcoma, bone cancer, bladder cancer, head and neck cancer, or liver cancer. In some embodiments, the cancer is a non-solid tumor, such as a leukemia or multiple myeloma. Examples of solid tumors include sarcomas, carcinomas, and lymphomas. More examples of cancers, such as solid and non-solid tumors are listed in Amin, M. B., et al., (Eds.). AJCC Cancer Staging Manual (8th edition). Springer International Publishing: American Joint Commission on Cancer; 2017 which is incorporated herein by reference in its entirety.
In some embodiments, binding of the target moiety to the CAR present on the cell induces production of at least one cytokine. In some embodiments, wherein the at least one cytokine comprises IL-2, TNF-α and/or INF-α.
In some embodiments, the lipid comprises a polar head group and a hydrophobic group. In some embodiments, the polar head comprises a choline, a phosphatidylcholine, sphingomyelin, phosphoethanolamine group, an oligosaccharide residue, a sugar residue, phosphatidyl serine or phosphatidyl inositol. In some, the polar-head group comprises phosphocholine, a piperidine moiety or a trimethylarseno-ethyl-phosphate moiety. In some embodiments, the hydrophobic group is fatty acid, such as an aliphatic chain. In some embodiments, the fatty acid is saturated or unsaturated. In some embodiments, the hydrophobic group comprises an alkyl, alkenyl or alkynyl group. In some embodiments, the hydrophobic group comprises a terpenoid lipid, such as a steroid or cholesterol. In some embodiments, the hydrophobic group comprises an ether linkage, wherein the ether linkage is between the polar head group and the aliphatic chain. In some embodiments, the sugar residue is a glycerol or a sugar alcohol. In some embodiments, the hydrophobic group comprises a carbon alkyl chain, wherein the carbon alkyl chain comprises 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 carbons or any number that is within a range defined by any two aforementioned values. In some embodiments, the carbon alkyl chain comprises 18 carbons. In some embodiments, the lipid is a phospholipid ether.
In some embodiments, the target moiety is biotin, digoxigenin, dinitrophenol, or fluorescein, or a derivative thereof. In some embodiments, the target moiety is fluorescein, or a derivative thereof.
In some embodiments, the spacer comprises a polyethylene glycol (PEG) spacer, a Hapten (2×) spacer, or an alkane chain. In some embodiments, the PEG spacer comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16 PEG molecules, or any amount of PEG molecules that is within a range defined by any two aforementioned values.
In some embodiments, the cell is a precursor T cell. In some embodiments, the precursor T cell is a hematopoietic stem cell. In some embodiments, naïve CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells and bulk CD8+ T cells. In some embodiments, the cell is a CD4+T helper lymphocyte cell that is selected from the group consisting of naïve CD4+ T cells, central memory CD4+ T cells, effector memory CD4+ T cells, and bulk CD4+ T cells.
Kits
Some embodiments of the methods and compositions provided herein include kits. In some embodiments, a kit can include a pharmaceutical grade lipid conjugated with a targeting moiety.
In some embodiments, the lipid comprises a polar head group and a hydrophobic group. In some embodiments, the polar head comprises a choline, a phosphatidylcholine, sphingomyelin, phosphoethanolamine group, an oligosaccharide residue, a sugar residue, phosphatidyl serine or phosphatidyl inositol. In some embodiments, the polar-head group comprises phosphocholine, a piperidine moiety or a trimethylarseno-ethyl-phosphate moiety. In some embodiments, the hydrophobic group is fatty acid, such as an aliphatic chain. In some embodiments, the fatty acid is saturated or unsaturated. In some embodiments, the hydrophobic group comprises an alkyl, alkenyl or alkynyl group. In some embodiments, the hydrophobic group comprises a terpenoid lipid, such as a steroid or cholesterol. In some embodiments, the hydrophobic group comprises an ether linkage, wherein the ether linkage is between the polar head group and the aliphatic chain. In some embodiments, the sugar residue is a glycerol or a sugar alcohol. In some embodiments, the hydrophobic group comprises a carbon alkyl chain, wherein the carbon alkyl chain comprises 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 carbons or any number that is within a range defined by any two aforementioned values. In some embodiments, the carbon alkyl chain comprises 18 carbons. In some embodiments, the lipid is a phospholipid ether.
In some embodiments, the target moiety is biotin, digoxigenin, dinitrophenol, or fluorescein, or a derivative thereof. In some embodiments, the target moiety is fluorescein, or a derivative thereof.
In some embodiments, the spacer comprises a polyethylene glycol (PEG) spacer, a Hapten (2×) spacer, or an alkane chain. In some embodiments, the PEG spacer comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16 PEG molecules, or any amount of PEG molecules that is within a range defined by any two aforementioned values.
EXAMPLES Example 1—Preparation of CAR T Cells
T cells were isolated from leukocyte reduction “cones” that are normally disposed of after plateletpheresis. Specifically, Ficoll density centrifugation was used to generate the T cell-containing peripheral blood mononuclear cell (PBMC) fraction and CD8+ and CD4+ T cells were sequentially purified using the appropriate magnetic enrichment kits. T cells were either immediately placed into CAR production the same day as isolation. T cells, ranging from 0.5-5 million cells, were stimulated with anti-human CD3/CD28 activator beads at a 1:1 ratio on Day 0. In some alternatives, the concentrations of the cells can range between 0.5, 1, 2, 3, 4 or 5 million cells that are produced for use with the anti-human CD3/CD28 activator beads.
On Days 1-3 of stimulation, T cells were transduced with CAR-containing lentivirus at a multiplicity of infection (MOI) ranging from 1 to 6 in the presence of protamine sulfate via spinoculation. Half or full-media exchanges were conducted every 2-3 days to maintain the cell cultures at appropriate cell densities and expanded to larger culture vessels as needed. In general, cells were moved to larger culture vessels when cell concentrations reach 1.5-2 million cells/mL or when cultures appear visibly dense and media is yellow. Starting at Day 0 and for every cell feeding, CD4+ T cells were reconstituted with fresh rhlL-7 and rhlL-15 at a final concentration of 50 ng/mL and 0.5 ng/mL, respectively, and CD8+ T cells were reconstituted with fresh rhlL-2 and rhlL-15 at a final concentration of 50 U/mL and 0.5 ng/mL, respectively. Activator beads were magnetically removed on Days 9-11 of stimulation.
For CAR T cells that did not contain DHFRdm for methotrexate-mediated selection of CAR expression (such as those used in examples depicted in FIG. 8B, FIG. 15A, FIG. 15C, FIG. 15D, FIG. 15D, FIG. 15E, FIG. 18C, FIG. 19 b , FIG. 19C, FIG. 21A and FIG. 21B), cells were magnetically sorted based on reporter EGFRt expression using biotinylated antibody and anti-biotin microbeads during Days 10-21 of culture. For the CAR T cells that did contain DHFRdm for methotrexate-mediated enrichment of CAR expression (such as those used in examples depicted in FIG. 9 , FIG. 10 , FIG. 12 , FIG. 13 , FIG. 14A, and FIG. 14B), cells were first treated on Days 7-14 of culture with 50 nM methotrexate, then ramped up to 100 nM methotrexate on Days 14-19 of culture, and finally brought back down to 50 nM for Days 19-21 of culture. To prevent cultures from crashing due to poor cell viability from methotrexate selection, cells were separated on Ficol on Day 12 of culture to remove dead cells and improve culture viability.
On either Day 14 or 21 of culture, 0.5-2 million T cells for each CAR were placed into a rapid expansion protocol (REP) with irradiated feeder PBMCs and TM-LCL cells. If fresh, unfrozen PBMCs were used, 25 million PBMCs and 5 million TM-LCL cells were used in each REP culture. If frozen PBMCs were used, these feeder cell numbers were doubled. PBMCs and TM-LCL cells were irradiated at 3500 and 8000 rads, respectively, using a Cesium source irradiator. In addition to the normal cytokines mentioned above, cells were also supplemented with OKT3 antibody at 30 ng/μL for Days 0-5 of REP to provide acute TCR stimulation. Irradiated feeder cells disintegrated by Day 5 of REP, and CAR T cells were maintained similarly to as described herein. For CAR T cells that did contain DHFRdm for methotrexate-mediated enrichment of CAR expression (such as those used in examples depicted in FIG. 9 , FIG. 10 , FIG. 12 , FIG. 13 , FIG. 14A, and FIG. 14B), 100 nM methotrexate was not introduced until Day 5 of REP and was maintained until Day 12 of REP to further enrich CAR-positive cells. On Day 14 of REP, all CAR T cells described herein were introduced into functional chromium release cytotoxicity assays (CD8+ T cells only) as well as functional 3-plex cytokine release assays (CD4+ and CD8+ T cells).
Example 2—Cytotoxicity and Chromium Release Assays
Target cells were incubated with 51Cr overnight. For target cells that receive the CTCT-PLEs, the CTCT-PLE was also present in the media overnight with the 51Cr. The following day the target cells were washed and seeded in a 96 well plate at a concentration 5000 cell per well. CD8+ antiFL and mock T cell effectors (usually in day 8-16 of a rapid expansion protocol) were washed, seeded with the target cells in triplicate at various E:T ratios (30:1, 10:1, 3:1, 1:1), and allowed to co-incubate for 4 hours at 37° C. Also, to evaluate control 51Cr release, each target cell line was seeded with media only and for maximum 51Cr release each target cell line was seeded and lysed with 2% SDS. Control groups were done in sextuplicate. After co-incubation, the supernatant was harvested, dispensed on LUMA plates, and allowed to dry overnight. The next day samples were run on the Top Count instrument. Percent-specific lysis was calculated by the following formula:
( experimental ⁢ ⁢   51 ⁢ Cr ⁢ ⁢ release ) - ( control ⁢ ⁢   51 ⁢ Cr ⁢ ⁢ release ) ( maximum ⁢ ⁢   51 ⁢ Cr ⁢ ⁢ release ) - ( control ⁢ ⁢   51 ⁢ Cr ⁢ ⁢ release ) × 100
See e.g., Gonzalez, S., Naranjo, A., Serrano, L. M., Chang, W.-C., Wright, C. L., & Jensen, M. C. (2004). Genetic engineering of cytolytic T lymphocytes for adoptive T-cell therapy of neuroblastoma. The Journal of Gene Medicine, 6(6), 704-711, hereby expressly incorporated by reference in its entirety.
Example 3—Cytokine Release Assay
For target cells that received the CTCT-PLEs, the CTCT-PLE was incubated overnight in media. The next day all target cells were harvested, washed, and seeded in a 96 well plate at a concentration of 5×104 cells per well. CD8+ antiFL and mock T cell effectors (usually in day 8-16 of a rapid expansion protocol) were washed and seeded (1×105 cells/well) with the target cells allowed to co-incubate for 24 hours at 37° C. After 24 hr the supernatant was harvested and IFN-gamma, TNF-alpha, and IL-2 concentration in the supernatant were measured by using a BioPlex® 200 system (Bio-Rad).
Example 4—FACS Analysis for EGFRt and antiFL CAR Expression
CD8+ T cells containing antiFL CARs were stained for EGFRt or antiFL binding. FIG. 6 depicts cell positivity of CD8+ antiFL CARs T cell via staining for the selection marker EGFRt. (a) antiFL(FITC-E2) CAR which comprised SEQ ID NO: 5 [96% positive]. (b) antiFL(4M5.3) CAR which comprised SEQ ID NO: 2 [80% positive]. To test the antiFL CARs ability to bind to FL, a mouse CD19-FITC antibody was incubated with the T cells and washed out. Anti-mouse-Fc-Alexa647 antibody was stained for the bound FITC antibody (c) antiFL(FITC-E2) CAR [97% positive] and (d) antiFL(4M5.3) CAR [79% positive]. The two different stainings gave the same positivity confirming the one to one relationship of CAR to surface marker and that the antiFL CAR can bind to FL. The binding domains of the CARs can comprise a sequence as set forth in SEQ ID NO: 1-6, and the spacer domains, which may also be part of the CARs, can comprise a sequence as set forth in SEQ ID NO: 7-9.
Example 5—CAR T Cell Recognition and Activation Through FL-PLE In Vitro
T cells containing antiFL CARs were tested for binding to FL-PLE and activation. FIG. 7A, FIG. 7B, and FIG. 7C show CAR T cell recognition and activation through FL-PLE in vitro. K562 (leukemia) cells were incubated with FL-PLE overnight. Cell integration of FL-PLE was analyzed by flow cytometry (FIG. 7A). There was a clear shift from the control K562 parental with the K562 parental incubated with 5 μM FL-PLE, whereas there was a very slight shift with K562 parental incubated with 0.5 μM FL-PLE. This slight shift corresponded to a difference in the amount of FL exposed on the surface of the cell for CAR T cell recognition. Also, the K562 OKT3+ cells (a cell line created to test the endogenous activation of T cells through the TCR) matched the K562 parental exactly. These cells were used in a chromium release assay (FIG. 7B) and a cytokine release assay (FIG. 7C) to test the activation of CD8+ antiFL(FITC-E2) CAR T cells compared with a CD8+ mock T cells from FIG. 6 . From these experiments, the antiFL (FITC-E2) CAR T cells recognized the FL moiety of the FL-PLE integrated into the plasma membrane and that the cells were activated. The amount of the activation was associated with the amount FL exposed on the surface of the cell.
FIG. 8A and FIG. 8B depict the universality of FL-PLE loading in tumor cells and recognition of the fluorescein moiety by antiFL CAR T cells. K562 (leukemia), U87 (glioblastoma), 251T (glioma), Be2 (neuroblastoma), MDA-MB-231 (adenocarcinoma), NIH OVCAR (adenocarcinoma), and 143B (osteosarcoma) cells were incubated with FL-PLE overnight. Cell integration of FL-PLE was analyzed by flow cytometry (FIG. 8A). There was a clear shift from the control parental cell lines with the parental cell lines incubated with 5 FL-PLE corresponding to the amount of FL exposed on the surface of the cell for CAR T cell recognition. Also the K562 OKT3+ cells (a cell line created to test the endogenous activation of T cells through the TCR) matched the K562 parental exactly, as expected. These cells were used in a chromium release assay (FIG. 8B) to test the cytotoxic response of CD8+ antiFL(FITC-E2) CAR T cells compared with a CD8+ mock T cells. These experiments demonstrated that the antiFL(FITC-E2) CAR T cells recognized the FL moiety of the FL-PLE integrated into the plasma membrane of multiple different cancer types and that the CAR T cells are able to lyse the targets.
Example 6—Methotrexate Selection of CAR T Cells
CAR T cells were selected for with methotrexate. FIG. 9 shows CD8+ antiFL CAR T cells selected by methotrexate, a chemotherapeutic in which antiFL CARs include CARs with FITC-E2 scFv domain and either a long, medium or short spacer, and other CARs having an antiFL scFv domain as labeled and a long spacer. CAR positivity of CD8+ antiFL CAR T cells staining for the surface marker EGFRt. These antiFL CARs also harbored a gene for a double mutant dihydrofolate reductase (DHFRdm) that confered methotrexate resistance for methotrexate-mediated enrichment of CAR-positive cells. Every cell line except minimum EGFRt+ cells were diluted with mock T cells to make equivalent stocks to use in functional assays. Target: 18.1% EGFRt+. Actual: about 13-20% EGFRt+.
FIG. 10 shows another example in which CD4+ antiFL CAR T cells selected by methotrexate, a chemotherapeutic. CAR positivity of CD4+ antiFL CAR T cells via staining for the surface marker EGFRt. These antiFL CARs also harbor a gene for a double mutant dihydrofolate reductase (DHFRdm) that confers methotrexate resistance and, thus allows for methotrexate-mediated enrichment of CAR-positive cells. Every cell line except minimum EGFRt+ cells were diluted with mock T cells to make equivalent stocks to use in functional assays. Target: 18.1% EGFRt+. Actual: about 15-24% EGFRt+.
Example 7—Labelling Cells with FL-PLE
Target cells were labelled with FL-PLE. FIG. 11 shows loading of cells with FL-PLE. Target cells for functional assays were made using K562 cells and MDA-MB-231 cells. Each cell group was labeled with FL-PLE. Cell integration of FL-PLE to the plasma membranewas analyzed by flow cytometry.
Example 8—CAR T Cell Cytotoxicity Assays
Cytotoxicity of CAR T cells was tested. FIG. 12 shows CD8+ antiFL CAR T cell cytotoxicity assays. MDA-MB-231 cells were incubated with FL-PLE. Cell integration of FL-PLE was analyzed by flow cytometry. These cells and the CAR T cells were used in a chromium release assay. The negative controls (K562 Parental and MDA-MB-231) both showed no killing and the positive control (K562 OKT3+ cells) showed cell lysis as expected. For MDA-MB-231 cells labeled with FL-PLE, the long CAR barely outperformed the medium; whereas only slight killing was seen with the short CAR. These results demonstrated the importance of the spacer length for the CAR T cell lysis of target cells and the hapten labeling method for a cell was useful for deciding on a spacer length.
FIG. 14A shows CD8+ antiFL CAR T cell assays with different antiFL scFv. MDA-MB-231 cells were incubated with FL-PLE. Cell integration of FL-PLE was analyzed by flow cytometry. These cells and the CAR T cells were used in a chromium release assay. The negative controls (K562 Parental and MDA-MB-231) both showed no killing and the positive control (K562 OKT3+ cells) showed cell lysis as expected (FIG. 14A). This chromium assay tested four different antiFL scFv's in the context of a long CAR. For MDA-MB-231 cells labeled with FL-PLE, three of the antiFL CARs all showed equivalent lysis; whereas antiFL(4D5Flu) which comprised SEQ ID NO: 4 exhibited almost no killing. AntiFL (4D5Flu) in other experiments has shown the ability to lysis cells labeled with FL. Accordingly, antiFL(4D5Flu) was not orientated in the correct relationship to recognize the FL moiety on the FL-PLE when integrated into a cell membrane.
Example 9—CAR T Cell Cytokine Release Assays
Cytokine release from CAR T cells was assayed. FIG. 13 depicts CD4+ antiFL CAR T cell cytokine release assays. K562 and MDA-MB-231 cells were incubated with FL-PLE. Cell integration of FL-PLE was analyzed by flow cytometry. These cells and the antiFL CAR T cells were used in a cytokine release assay. The negative controls (K562 Parental and MDA-MB-231) both showed no cytokine production and the positive control (K562 OKT3+ cells) showed production of all three cytokines for all cell lines. This assay was designed to study the relationship of the spacer length of CAR and FL-PLE. This data shows that only the long spacer CAR in relationship with FL-PLE was able to produce all three cytokines.
FIG. 14B depicts CD4+ antiFL CAR T cell cytokine release assays with different antiFL scFv. K562 and MDA-MB-231 cells were incubated with FL-PLE. Cell integration of FL-PLE was analyzed by flow cytometry. These cells and the CAR T cells were used in a cytokine release assay. The negative controls (K562 Parental and MDA-MB-231) both showed no cytokine production and the positive control (K562 OKT3+ cells) showed production of all three cytokines for all cell lines. This cytokine release assay tested five different antiFL scFv's in the context of a long CAR. Of the K562 cells labeled with 5 μM FL-PLE, only four of the antiFL CARs showed activation. As the amount of FL-PLE was reduced to 500 nM in the K562 cells, antiFL(4M5.3) which comprised SEQ ID NO: 2 and antiFL(FITC-E2 Mut2) which comprised SEQ ID NO: 1 produced the most cytokine with only antiFL(FITC-E2 Mut2) was able to produce IL2. Also antiFL(4M5.3) and antiFL(FITC-E2 Mut2) produced the most cytokine with MDA-MB-231 cells labeled with 5 μM FL-PLE. AntiFL(4M5.3) and antiFL(FITC-E2 Mut2) showed the best activation with FL-PLE and had vastly different disassociation constants, 270 fm and 3.1 nM respectively, showing that just lowering a CAR's disassociation constant did not necessarily make for the best CAR. The CAR that did not work in conjunction with FL-PLE was antiFL(4D5Flu), which comprised SEQ ID NO: 4. AntiFL(4D5Flu) exhibited no cytokine production in either cell line labeled with 5 μM FL-PLE. AntiFL(4D5Flu) in other experiments has shown the ability to lysis cells labeled with FL. Accordingly, antiFL(4D5Flu) was not orientated in the correct relationship to recognize the FL moiety on FL-PLE when integrated into a cell membrane.
Three CARs antiFL CARs (4M5.3, FITC-E2, and FITC-E2 Mut2) with long spacer demonstrated enhanced functional output were tested further. CAR T cells were prepared with each antiFL CARs. FIG. 15A shows cell pure population of CD4+ and CD8+ antiFL CARs T cell via staining for the selection marker EGFRt. K562 (leukemia) and MDA-MB-231 (adenocarcinoma) cells were incubated with FL-PLE overnight, and cell integration of FL-PLE was analyzed by flow cytometry (FIG. 15B). There was a clear shift from the control parental cell lines with the parental cell lines incubated with 5 μM FL-PLE corresponding to the amount of FL exposed on the surface of the cell for CAR T cell recognition. The prepared CAR T cells were assayed in a chromium release assay (FIG. 15C) and in a cytokine release assay (FIG. 15D and FIG. 15E) to test the activation of the optimized antiFL CAR T cells compared to each other and mock T cells. From these experiments, in terms of recognition and activation antiFL(Mut2) CAR T cells had the greatest response followed by antiFL(FITC-E2) followed by antiFL(4M5.3) for both the leukemia and adenocarcinoma.
Example 10—In Vivo Targeting and Integration of FL-PLE
In vivo targeting and integration of FL-PLE was tested. FIG. 16 shows in vivo targeting and integration of FL-PLE with FL moiety available for binding. After a glioblastoma (U87 cells) tumor was established in a group of mice by intracranial injection, the mice received an intravenous injection of FL-PLE. Mice were sacrificed and brains were harvested at various time points post FL-PLE injection. Specifically, mice having an orthotopic glioma xenograft were dosed intravenously with FL-PLE, and the brains were evaluated over a period of 14 days. At 48 hr, the brain was prepared for histology. DAPI was also used to stain for the nucleus. An anti-Fluorescein antibody was used to stain for availability of fluorescein molecules of FL-PLE that were integrated into the membrane of cells. The glioma tumor exhibited retention of FL-PLE in excess compared to a tumor-free contra lateral hemisphere of a subject. FIG. 16 at top left shows 10× fluorescent image, tumor was very bright compared to the normal healthy tissue, labeled as N. This showed the selective integration of FL-PLE into tumor membranes with FL moiety available for binding. Bottom left: bright signals were be seen when looking at the contralateral image of the brain. Right: To quantify this the MFI of the tumor and the contralateral side were individually calculated. This analysis was then repeated at multiple time points. These values were then plotted, generating a multiday retention time plot for FL-PLE upon this dose of FL-PLE.
Results depicted in FIG. 17 demonstrate the universality of in vivo targeting and integration of FL-PLE. Here adenocarcinoma (MDA-MB-231), osteosarcoma (143B), and glioblastoma (U87) cell lines were used to show the universality. The adenocarcinoma and osteosarcoma each received two flank tumors in their respective groups and the glioblastoma only received one flank tumor. The fourth group had an adenocarcinoma tumor on one flank and an osteosarcoma on the opposite flank. After tumors were established in the groups of mice by subcutaneous injection, the mice received an intravenous injection of FL-PLE. Mice were sacrificed and tumors were harvested at various time points post FL-PLE injection. The tumors were removed and immediately fluorescently imaged for the presence of the fluorescein molecule on FL-PLE. The graphs of FIG. 17 for the three different types of cancer all show a multiday day retention time with FL-PLE before the tumor's fluorescence reach base line levels (tumor that has never received FL-PLE). The fourth group showed that FL-PLE simultaneously targeted two different types of cancers was retained for multiple days.
Example 11—Blocking CAR T Cell Binding with ProFL-PLE the Prodrug Version of FL-PLE (ProFL-PLE)
The activity of masked FL-PLE (ProFL-PLE) to inhibit CART cell binding to cells labelled with ProFL-PLE was tested. FIG. 18A and FIG. 18B show ProFL-PLE ability to block CAR T cell recognition until unmasked. K562 (leukemia) cells were incubated with FL-PLE (high and low doses) or ProFL-PLE overnight. Cell integration of FL-PLE and ProFL-PLE was analyzed by flow cytometry (FIG. 18A). There was a clear shift from the control K562 parental with the K562 parental incubated with high dose FL-PLE whereas there was a smaller shift with K562 parental incubated with low dose FL-PLE. This slight shift corresponded to a difference in the amount of FL exposed on the surface of the cell for CAR T cell recognition. ProFL-PLE was not fluorescent due to the presence of the masking agent, a phenolic hydroxy group. Therefore, ProFL-PLE and K562 Parentals had almost the same profile as observed by flow cytometry. When ProFL-PLE was unmasked the fluorescence of the fluorescein was revealed. The unmasked ProFL-PLE had a similar amount of FL exposed on the surface as the low dose FL-PLE. FIG. 18B shows cells used in a chromium release assay to test the activation of CD8+ antiFL CART cells compared with a CD8+ mock T cells. From these experiments, antiFL CAR T cells recognized the FL moiety of the FL-PLE integrated into the plasma membrane. The ProFL-PLE completely blocked the recognition of the antiFL CARs; whereas once the Pro protection was unmasked the FL moiety was available for recognition of antiFL CARs. The lysis of the unmasked ProFL-PLE was about the same as the Low Dose FL-PLE, which correlated with the amount of FL exposed on the surface of the k562 cells.
FIGS. 18A and 18C shows cells used in a cytokine release assay to demonstrate the activation of CD4+ antiFL CAR T cells compared with a CD4+ mock T cells. Cell integration of FL-PLE and ProFL-PLE was analyzed by flow cytometry (FIG. 18A). As shown in FIG. 18C, negative controls (K562 Parental) showed no cytokine production and the positive control (K562 OKT3+ cells) showed production of all three cytokines for all cell lines. FL-PLE labeled cells were able to generate all three cytokines and was dependent on the amount of FL exposed on the surface. ProFL-PLE cells labeled with the pro moiety still intact produced no cytokine meaning the antiFL CAR T cells were not activated. After unmasking, ProFL-PLE labeled cells produced all 3 cytokines showing that upon removal of the Pro moiety the antiFL CAR T cell activated through ProFL-PLE integrated into the surface of a cancer cell. This demonstrated that labelling tumor cells with a masked hapten conjugated with a lipid, such as ProFL-PLE, unmasking the hapten to obtain a unmasked hapten conjugated to a lipid integrated into a tumor cell membrane, and contacting the unmasked hapten with an anti-hapten CAR T cell activates the T cell in at least an in vitro environment.
FIG. 19A, FIG. 19B, and FIG. 19C depict ProFL-PLE blocking CAR T cell recognition until unmasked, after unmasking the antiFL CAR T cell recognized the newly exposed fluorescein on the surface was then activated. K562 (leukemia) cells were incubated with FL-PLE or ProFL-PLE overnight. Cell integration of FL-PLE and ProFL-PLE was analyzed by flow cytometry (FIG. 19A). There was a clear shift from the control K562 parental with the K562 parental incubated with FL-PLE corresponding to the amount of FL exposed on the surface of the cell for CAR T cell recognition. ProFL-PLE was not fluorescent due to the presence of the masking agent, a phenolic hydroxy group. Therefore, K562 incubated with ProFL-PLE in FBS and K562 Parentals had almost the same profile as observed by flow cytometry, i.e. the Pro moiety was still intact. When ProFL-PLE was unmasked (overnight incubation in media without FBS) the fluorescence of the fluorescein was revealed. The unmasked ProFL-PLE had a similar amount of FL exposed on the surface as the K562 cells incubated with FL-PLE. FIG. 19B shows cells used in a cytokine release assay to continue to prove the activation of CD4+ and CD8+ antiFL CART cells compared with a CD4+ and CD8+ mock T cells. The negative controls (K562 Parental) showed no cytokine production and the positive control (K562 OKT3+ cells) showed production of all three cytokines for all cell lines. As expected, FL-PLE labeled cells were able to generate all three cytokines. ProFL-PLE cells labeled with the pro moiety still intact produced no cytokine meaning the antiFL CAR T cells were not activating as designed. After unmasking, ProFL-PLE labeled cells produced all 3 cytokines showing that upon removal of the Pro moiety the antiFL CAR T cell activated through the unmasked ProFL-PLE integrated into the surface of the cancer cell. This shows the design of the ProFL-PLE works in an in vitro environment. FIG. 19C depicts results of staining cells from the co-culture of the cytokine release assay to investigate the up regulation of activation markers (LAG3, 41BB, and PD-1) on the CART cells after 24 hrs. The live CD8+ antiFL(FITC-E2) long spacer CAR T cells are shown. As expected the negative control co-culture with k562 Parental showed no up regulation of activation markers and the positive control (K562 OKT3+ cells) showed up regulation of all three activation markers. The K562 cells with ProFL-PLE showed only slightly elevated amounts of the activation markers meaning the intact Pro moiety was blocking antiFL CAR T cell recognition and activation. K562 cells with FL-PLE or unmasked ProFL-PLE had similar levels of activation as the positive control showing that the antiFL CAR T cells were activating similarly through FL-PLE and unmasked ProFL-PLE.
Example 12—In Vivo Activity of antiFL CART Cells
Mice having a brain tumor were administered either masked or unmasked FL-PLE, in combination with an antiFLCAR T cell. FIG. 20 shows initial FL-PLE and ProFL-PLE in vivo therapy. After a neuroblastoma (Be2) tumor was established in 3 groups of mice by intracranial injection, the mice received an intracranial injection of T cells comprising an antiFL(FITCE2) long spacer CAR, which comprised SEQ ID NO: 5. The control group only received the antiFL(FITCE2) long spacer CAR T cells and the tumor progressed as normal (black bar). The second group receive a single intravenous injection of FL-PLE prior to T cell injection. This group lived ˜20% longer than the control group. The third group received 3 scheduled doses of ProFL-PLE via intravenous injection (one before T cell injection and two post T cell injection), which led to ˜20% longer life span for the mice. These results additionally confirmed that ProFL-PLE was safe for re-dosing.
Example 13—In Vivo Activity of antiFL CAR T Cells with Masked FL-PLE
Administration of masked FL-PLE (ProFL-PLE) in combination with an antiFL CAR T cells was tested in mice with a breast cancer cell model. FIG. 21A and FIG. 21B show ProFL-PLE in vivo therapy for a flank tumor model. After adenocarcinoma (MDA-MB-231 eGFP:ffLuc IL2+) tumors (2 tumors per mouse) were established in three groups of mice by subcutaneous injection, two groups of mice received injection of ProFL-PLE either intratumorally (FIG. 21A) or intravenously (IV) (FIG. 21B) and the control group received no injection of drug. Following the first injection of drug all three groups received IV injection of cells containing the antiFL(FITC-E2) long spacer CAR. The grey vertical dotted lines on the graphs represent the days of injection. The control group died after 16 days from tumor burden. (FIG. 21A) The ProFL-PLE intratumorally injected group received 12 doses of ProFL-PLE over 45 days and the tumor regressed to baseline levels by day 40 for all 3 mice. The mice lived tumor free till the end of the study on day 90. (FIG. 21B) The ProFL-PLE IV injected group received 10 doses of ProFL-PLE over 34 days and the tumor regressed to baseline levels by day ˜40 for 2 mice. These mice lived tumor free till the end of the study on day 90. One mouse from this group died on day 16 with the control mice. These results demonstrate that ProFL-PLE injected intratumorally or IV in combination with antiFL CART cells was a viable therapy.
The following references are each expressly incorporated by reference in its entirety.
REFERENCES
  • 1. Ma, J. S. et al. (2016). Versatile strategy for controlling the specificity and activity of engineered T cells. Versatile strategy for controlling the specificity and activity of engineered T cells. Proceedings of the National Academy of Sciences of the United States of America, 113(4), E450-E458.
  • 2. Kim, M. S. et al. (2015). Redirection of Genetically Engineered CAR-T Cells Using Bifunctional Small Molecules. Journal of the American Chemical Society, 137(8), 2832-2835.
  • 3. Urbanska, K. et al. (2012). A universal strategy for adoptive immunotherapy of cancer through use of a novel T-cell antigen receptor. Cancer Research, 72(7), 1844-1852.
  • 4. Wu, C. Y. et al. (2015). Remote control of therapeutic T cells through a small molecule-gated chimeric receptor. Science, 350(6258), aab4077-aab4077.
  • 5. Kranz et al. (1981). Partial elucidation of an anti-hapten repertoire in BALB/c mice: comparative characterization of several monoclonal antiFLuorescyl antibodies. Mol Immunol, 18(10), 889-898.
  • 6. Jung et al. (1997). Improving in vivo folding and stability of a single-chain Fv antibody fragment by loop grafting. Protein Engineering Design & Selection, 10(8), 956-966.
  • 7. Schwesinger et al. (2000). Unbinding forces of single antibody-antigen complexes correlate with their thermal dissociation rates. PNAS, 97(18), 9972-9977.
  • 8. Boder et al. (2000). Directed evolution of antibody fragments with monovalent femtomolar antigen-binding affinity. PNAS, 97(20), 10701-10705.
  • 9. Honegger et al. (2005). A mutation designed to alter crystal packing permits structural analysis of a tight-binding fluorescein-scFv complex. Prot Sci, 14(10), 2537-2549.
It is understood that the examples and alternatives described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of any appended claims.
With respect to the use of substantially any plural and/or singular terms herein, those having skill in the art can translate from the plural to the singular and/or from the singular to the plural as is appropriate to the context and/or application. The various singular/plural permutations may be expressly set forth herein for sake of clarity.
It will be understood by those within the art that, in general, terms used herein, and especially in the appended claims (e.g., bodies of the appended claims) are generally intended as “open” terms (e.g., the term “including” should be interpreted as “including but not limited to,” the term “having” should be interpreted as “having at least,” the term “includes” should be interpreted as “includes but is not limited to,” etc.). It will be further understood by those within the art that if a specific number of an introduced claim recitation is intended, such an intent will be explicitly recited in the claim, and in the absence of such recitation no such intent is present. For example, as an aid to understanding, the following appended claims may contain usage of the introductory phrases “at least one” and “one or more” to introduce claim recitations. However, the use of such phrases should not be construed to imply that the introduction of a claim recitation by the indefinite articles “a” or “an” limits any particular claim containing such introduced claim recitation to alternatives containing only one such recitation, even when the same claim includes the introductory phrases “one or more” or “at least one” and indefinite articles such as “a” or “an” (e.g., “a” and/or “an” should be interpreted to mean “at least one” or “one or more”); the same holds true for the use of definite articles used to introduce claim recitations. In addition, even if a specific number of an introduced claim recitation is explicitly recited, those skilled in the art will recognize that such recitation should be interpreted to mean at least the recited number (e.g., the bare recitation of “two recitations,” without other modifiers, means at least two recitations, or two or more recitations). Furthermore, in those instances where a convention analogous to “at least one of A, B, and C, etc.” is used, in general such a construction is intended in the sense one having skill in the art would understand the convention (e.g., “a system having at least one of A, B, and C” would include but not be limited to systems that have A alone, B alone, C alone, A and B together, A and C together, B and C together, and/or A, B, and C together, etc.). In those instances where a convention analogous to “at least one of A, B, or C, etc.” is used, in general such a construction is intended in the sense one having skill in the art would understand the convention (e.g., “a system having at least one of A, B, or C” would include but not be limited to systems that have A alone, B alone, C alone, A and B together, A and C together, B and C together, and/or A, B, and C together, etc.). It will be further understood by those within the art that virtually any disjunctive word and/or phrase presenting two or more alternative terms, whether in the description, claims, or drawings, should be understood to contemplate the possibilities of including one of the terms, either of the terms, or both terms. For example, the phrase “A or B” will be understood to include the possibilities of “A” or “B” or “A and B.”

Claims (18)

What is claimed is:
1. A method of treating or inhibiting a solid tumor in a subject in need thereof, wherein the subject's bloodstream comprises engineered T cells comprising a chimeric antigen receptor (CAR), wherein the CAR specifically binds fluorescein, the method comprising:
administering to the subject a composition comprising fluorescein conjugated to a phospholipid ether (FL-PLE) in an amount effective to label tumor cells in the solid tumor,
wherein the T cells comprising the CAR that specifically bind the fluorescein and kill tumor cells in the solid tumor, thereby treating or inhibiting the solid tumor.
2. The method of claim 1, wherein the solid tumor is a breast cancer.
3. The method of claim 1, wherein the FL-PLE comprises a masking moiety.
4. The method of claim 3, wherein the masking moiety is cleaved by reactive oxygen species (ROS) present in a tumor microenvironment of the solid tumor.
5. The method of claim 4, wherein the masking moiety comprises a phenolic hydroxyl group bound to a hydroxyl on a xanthene moiety of the FL-PLE.
6. The method of claim 1, wherein the CAR comprises a ligand binding domain comprising an amino acid sequence having at least 95% sequence identity with any one of SEQ ID NOs: 1-6.
7. The method of claim 1, wherein the CAR comprises a spacer domain consisting of an IgG4 hinge connected to a CH2 domain and a CH3 domain.
8. The method of claim 1, wherein the CAR comprises a spacer domain consisting of an IgG4 hinge connected to a CH3 domain.
9. The method of claim 1, wherein the CAR comprises a spacer domain having a length of 51-100 amino acids.
10. The method of claim 1, wherein the CAR comprises a spacer domain having a length of 100-150 amino acids.
11. The method of claim 1, wherein the CAR comprises a spacer domain having a length of 150-250 amino acids.
12. The method of claim 6, wherein the ligand binding domain comprises the amino acid sequence having at least 95% sequence identity with SEQ ID NO: 1.
13. The method of claim 6, wherein the ligand binding domain comprises the amino acid sequence having at least 95% sequence identity with SEQ ID NO: 2.
14. The method of claim 6, wherein the ligand binding domain comprises the amino acid sequence having at least 95% sequence identity with SEQ ID NO: 5.
15. The method of claim 1, wherein the method increases survival of the subject compared to a subject not administered the FL-PLE.
16. The method of claim 1, wherein the FL-PLE comprises a masking moiety; and the CAR comprises a spacer domain comprising an IgG4 hinge, a CH2 domain and a CH3 domain.
17. The method of claim 16, wherein the spacer domain comprises an amino acid sequence having at least 95% sequence identity with SEQ ID NO: 07.
18. A method of treating or inhibiting a solid tumor in a subject in need thereof, comprising:
administering to the subject (i) a composition comprising fluorescein conjugated to a phospholipid ether (FL-PLE) in an amount effective to label tumor cells in the solid tumor, and (ii) a T cell comprising a chimeric antigen receptor (CAR), wherein the CAR specifically binds the fluorescein.
US16/965,859 2018-02-06 2019-01-17 Fluorescein-specific cars exhibiting optimal t cell function against FL-PLE labelled tumors Active 2042-04-19 US12312416B2 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US16/965,859 US12312416B2 (en) 2018-02-06 2019-01-17 Fluorescein-specific cars exhibiting optimal t cell function against FL-PLE labelled tumors

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US201862627147P 2018-02-06 2018-02-06
PCT/US2019/014054 WO2019156795A1 (en) 2018-02-06 2019-01-17 Fluorescein-specific cars exhibiting optimal t cell function against fl-ple labelled tumors
US16/965,859 US12312416B2 (en) 2018-02-06 2019-01-17 Fluorescein-specific cars exhibiting optimal t cell function against FL-PLE labelled tumors

Publications (2)

Publication Number Publication Date
US20200354477A1 US20200354477A1 (en) 2020-11-12
US12312416B2 true US12312416B2 (en) 2025-05-27

Family

ID=67549567

Family Applications (1)

Application Number Title Priority Date Filing Date
US16/965,859 Active 2042-04-19 US12312416B2 (en) 2018-02-06 2019-01-17 Fluorescein-specific cars exhibiting optimal t cell function against FL-PLE labelled tumors

Country Status (10)

Country Link
US (1) US12312416B2 (en)
EP (1) EP3749695A4 (en)
JP (3) JP7774961B2 (en)
CN (1) CN111936518A (en)
AU (1) AU2019218729B2 (en)
BR (1) BR112020015884A2 (en)
CA (1) CA3090089A1 (en)
IL (1) IL276473A (en)
SG (1) SG11202007426XA (en)
WO (1) WO2019156795A1 (en)

Families Citing this family (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP4282419A1 (en) 2012-12-20 2023-11-29 Purdue Research Foundation Chimeric antigen receptor-expressing t cells as anti-cancer therapeutics
AU2015243849B2 (en) 2014-04-10 2020-12-17 Seattle Children's Hospital (dba Seattle Children's Research Institute) Transgene genetic tags and methods of use
US12144850B2 (en) 2016-04-08 2024-11-19 Purdue Research Foundation Methods and compositions for car T cell therapy
AU2018219226B2 (en) * 2017-02-07 2024-12-19 Seattle Children's Hospital (dba Seattle Children's Research Institute) Phospholipid ether (PLE) CAR T cell tumor targeting (CTCT) agents
ES3010559T3 (en) 2017-02-28 2025-04-03 Endocyte Inc Compositions and methods for car t cell therapy
US11311576B2 (en) * 2018-01-22 2022-04-26 Seattle Children's Hospital Methods of use for CAR T cells
WO2019156795A1 (en) 2018-02-06 2019-08-15 Seattle Children's Hospital (dba Seattle Children's Research Institute) Fluorescein-specific cars exhibiting optimal t cell function against fl-ple labelled tumors
CA3091674A1 (en) 2018-02-23 2019-08-29 Endocyte, Inc. Sequencing method for car t cell therapy
CN112262214A (en) 2018-04-12 2021-01-22 优莫佳生物制药股份有限公司 Viral vectors and packaging cell lines
WO2020106992A1 (en) 2018-11-21 2020-05-28 Umoja Biopharma, Inc. Multicistronic vector for surface engineering lentiviral particles
CA3154281A1 (en) * 2019-10-16 2021-04-22 Andrew Scharenberg Retroviral vector for universal receptor therapy
CN115697388A (en) 2020-01-30 2023-02-03 优莫佳生物制药股份有限公司 Bispecific transduction enhancers
KR20220163940A (en) * 2020-02-04 2022-12-12 시애틀 칠드런즈 호스피탈 디/비/에이 시애틀 칠드런즈 리서치 인스티튜트 Anti-dinitrophenol Chimeric Antigen Receptor
CA3169804A1 (en) * 2020-02-04 2021-08-12 Seattle Children's Hospital (dba Seattle Children's Research Institute) Methods and compositions for stimulation of chimeric antigen receptor t cells with hapten labelled cells
KR20230021022A (en) * 2020-06-08 2023-02-13 시애틀 칠드런즈 호스피탈 디/비/에이 시애틀 칠드런즈 리서치 인스티튜트 Anti-CD171 Chimeric Antigen Receptor
EP4178626A4 (en) * 2020-07-13 2024-08-14 University of Southern California UNIVERSAL CAR-NK CELL TARGETING VARIOUS HIV-1 GP160 EPITOPES
CN116323656A (en) 2020-07-16 2023-06-23 优莫佳生物制药股份有限公司 Gating adapter targeting receptors

Citations (294)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1986004356A1 (en) 1985-01-28 1986-07-31 International Genetic Engineering, Inc. AraB PROMOTERS AND METHOD OF PRODUCING POLYPEPTIDES, INCLUDINN CECROPINS, BY MICROBIOLOGICAL TECHNIQUES
US5116964A (en) 1989-02-23 1992-05-26 Genentech, Inc. Hybrid immunoglobulins
WO1992010591A1 (en) 1990-12-14 1992-06-25 Cell Genesys, Inc. Chimeric chains for receptor-associated signal transduction pathways
WO1992015671A1 (en) 1991-03-08 1992-09-17 Cytomed, Inc. Soluble cd28 proteins and methods of treatment therewith
US5202238A (en) 1987-10-27 1993-04-13 Oncogen Production of chimeric antibodies by homologous recombination
US5216132A (en) 1990-01-12 1993-06-01 Protein Design Labs, Inc. Soluble t-cell antigen receptor chimeric antigens
US5514582A (en) 1989-02-23 1996-05-07 Genentech, Inc. Recombinant DNA encoding hybrid immunoglobulins
US5525503A (en) 1993-09-28 1996-06-11 Dana-Farber Cancer Institute, Inc. Signal transduction via CD28
US5538866A (en) 1992-11-05 1996-07-23 Sloan-Kettering Institute For Cancer Research Prostate-specific membrane antigen
US5670148A (en) 1991-10-21 1997-09-23 Cell Genesys, Inc. Combined cellular and immunosuppressive therapies
US5686281A (en) 1995-02-03 1997-11-11 Cell Genesys, Inc. Chimeric receptor molecules for delivery of co-stimulatory signals
US5741899A (en) 1995-02-02 1998-04-21 Cell Genesys, Inc. Chimeric receptors comprising janus kinase for regulating cellular pro liferation
US5747292A (en) 1993-04-06 1998-05-05 Fred Hutchinson Cancer Research Center Chimeric cytokine receptors in lymphocytes
US5830755A (en) 1995-03-27 1998-11-03 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services T-cell receptors and their use in therapeutic and diagnostic methods
US5834256A (en) 1993-06-11 1998-11-10 Cell Genesys, Inc. Method for production of high titer virus and high efficiency retroviral mediated transduction of mammalian cells
US5843728A (en) 1991-03-07 1998-12-01 The General Hospital Corporation Redirection of cellular immunity by receptor chimeras
US5851828A (en) 1991-03-07 1998-12-22 The General Hospital Corporation Targeted cytolysis of HIV-infected cells by chimeric CD4 receptor-bearing cells
US5906936A (en) 1988-05-04 1999-05-25 Yeda Research And Development Co. Ltd. Endowing lymphocytes with antibody specificity
US5912170A (en) 1991-03-07 1999-06-15 The General Hospital Corporation Redirection of cellular immunity by protein-tyrosine kinase chimeras
US5914109A (en) 1990-06-15 1999-06-22 New York University Heterohybridomas producing human monoclonal antibodies to HIV-1
US5935818A (en) 1995-02-24 1999-08-10 Sloan-Kettering Institute For Cancer Research Isolated nucleic acid molecule encoding alternatively spliced prostate-specific membrane antigen and uses thereof
US5969102A (en) 1997-03-03 1999-10-19 St. Jude Children's Research Hospital Lymphocyte surface receptor that binds CAML, nucleic acids encoding the same and methods of use thereof
US6004781A (en) 1988-01-22 1999-12-21 The General Hospital Corporation Nucleic acid encoding Ig-CD4 fusion proteins
US6005004A (en) 1994-08-05 1999-12-21 Molecular / Structural Biotechnologies, Inc. Lipophilic-polycationic delivery systems
US6004811A (en) 1991-03-07 1999-12-21 The Massachussetts General Hospital Redirection of cellular immunity by protein tyrosine kinase chimeras
US6083751A (en) 1994-11-01 2000-07-04 Targeted Genetics Corporation Chimeric receptors for the generation of selectively-activatable TH-independent cytotoxic T cells
US6103521A (en) 1995-02-06 2000-08-15 Cell Genesys, Inc. Multispecific chimeric receptors
US6132718A (en) 1994-07-06 2000-10-17 Immunomedics, Inc. Multi-stage cascade boosting vaccine
US6218187B1 (en) 1993-06-11 2001-04-17 Cell Genesys, Inc. Method for production of high titer virus and high efficiency retroviral mediated transduction of mammalian cells
US6261787B1 (en) 1996-06-03 2001-07-17 Case Western Reserve University Bifunctional molecules for delivery of therapeutics
US20010031252A1 (en) 2000-03-31 2001-10-18 Low Philip Stewart Method of treatment using ligand-immunogen conjugates
US6319494B1 (en) 1990-12-14 2001-11-20 Cell Genesys, Inc. Chimeric chains for receptor-associated signal transduction pathways
WO2001091625A2 (en) 2000-04-21 2001-12-06 Rutgers, The State University Of New Jersey Methods and compositions for the diagnosis of schizophrenia
US20020004052A1 (en) 1990-05-08 2002-01-10 David Berd Composition comprising a tumor cell extract and method of using the composition
US6395152B1 (en) 1998-07-09 2002-05-28 Acm Research, Inc. Methods and apparatus for electropolishing metal interconnections on semiconductor devices
US6406697B1 (en) 1989-02-23 2002-06-18 Genentech, Inc. Hybrid immunoglobulins
US6407221B1 (en) 1990-12-14 2002-06-18 Cell Genesys, Inc. Chimeric chains for receptor-associated signal transduction pathways
US6410319B1 (en) 1998-10-20 2002-06-25 City Of Hope CD20-specific redirected T cells and their use in cellular immunotherapy of CD20+ malignancies
US6432403B1 (en) 1997-06-11 2002-08-13 New York University Antibodies to polypeptides having prenylcysteine carboxyl methlytransferase activity or inhibiting activity
US20020111474A1 (en) 1990-12-14 2002-08-15 Capon Daniel J. Chimeric chains for receptor-associated signal transduction pathways
WO2002088334A1 (en) 2001-04-30 2002-11-07 City Of Hope Chimeric immunoreceptor useful in treating human cancers
US6521602B1 (en) 1999-03-01 2003-02-18 Gpc Biotech Inc. Anti-neoplastic compositions and uses thereof
US6524572B1 (en) 2000-06-26 2003-02-25 Rainbow Therapeutic Company Targeting recombinant virus with a bispecific fusion protein ligand in coupling with an antibody to cells for gene therapy
US20030175288A1 (en) 2000-07-31 2003-09-18 Kyogo Itoh Tumor antigen
US6699972B1 (en) 1999-06-25 2004-03-02 Academia Sinica Chimeric protein and method of controlling tumor growth using the protein
JP2004113062A (en) 2002-09-25 2004-04-15 Teruyuki Nagamune Animal cell having chimera receptor and its utilization
US6753162B1 (en) 1991-03-07 2004-06-22 The General Hospital Corporation Targeted cytolysis of HIV-infected cells by chimeric CD4 receptor-bearing cells
US6759243B2 (en) 1998-01-20 2004-07-06 Board Of Trustees Of The University Of Illinois High affinity TCR proteins and methods
US6770749B2 (en) 2000-02-22 2004-08-03 City Of Hope P53-specific T cell receptor for adoptive immunotherapy
US20040171096A1 (en) * 2002-12-10 2004-09-02 Echelon Biosciences Incorporated Compounds and methods of use thereof for assaying lysophospholipase D activity
US20050113564A1 (en) 2003-11-05 2005-05-26 St. Jude Children's Research Hospital Chimeric receptors with 4-1BB stimulatory signaling domain
WO2005084716A2 (en) 2004-03-02 2005-09-15 Cellectar, Llc Phospholipid analogs for diagnosis and treatment of cancer
US6953668B1 (en) 1992-11-05 2005-10-11 Sloan-Kettering Institute For Cancer Research Prostate-specific membrane antigen
WO2006029879A2 (en) 2004-09-17 2006-03-23 F.Hoffmann-La Roche Ag Anti-ox40l antibodies
US7037647B1 (en) 1995-02-24 2006-05-02 Sloan-Kettering Institute For Cancer Research Prostate-specific membrane antigen and uses thereof
US7049136B2 (en) 1991-03-07 2006-05-23 The General Hospital Corporation Redirection of cellular immunity by receptor chimeras
US7052906B1 (en) 1999-04-16 2006-05-30 Celltech R & D Limited Synthetic transmembrane components
US7070995B2 (en) 2001-04-11 2006-07-04 City Of Hope CE7-specific redirected immune cells
US20060155115A1 (en) 1998-05-19 2006-07-13 Avidex Limited Multivalent T cell receptor complexes
US7105159B1 (en) 1992-11-05 2006-09-12 Sloan-Kettering Institute For Cancer Research Antibodies to prostate-specific membrane antigen
US7217421B1 (en) 1998-11-03 2007-05-15 Cell Genesys, Inc. Cancer-associated antigens and methods of their identification and use
US20080051380A1 (en) 2006-08-25 2008-02-28 Auerbach Alan H Methods and compositions for treating cancer
US7348004B2 (en) 2003-05-06 2008-03-25 Syntonix Pharmaceuticals, Inc. Immunoglobulin chimeric monomer-dimer hybrids
US7354587B1 (en) 1994-07-06 2008-04-08 Immunomedics, Inc. Use of immunoconjugates to enhance the efficacy of multi-stage cascade boosting vaccines
WO2008057437A2 (en) 2006-11-03 2008-05-15 Purdue Research Foundation Ex vivo flow cytometry method and device
US7381408B2 (en) 2003-05-06 2008-06-03 Syntonix Pharmaceuticals, Inc. Methods for chemically synthesizing immunoglobulin chimeric proteins
US7435596B2 (en) 2004-11-04 2008-10-14 St. Jude Children's Research Hospital, Inc. Modified cell line and method for expansion of NK cell
US7446190B2 (en) 2002-05-28 2008-11-04 Sloan-Kettering Institute For Cancer Research Nucleic acids encoding chimeric T cell receptors
US7446179B2 (en) 2000-11-07 2008-11-04 City Of Hope CD19-specific chimeric T cell receptor
US20090011984A1 (en) 1998-02-23 2009-01-08 Seppo Yla-Herttuala Biotin-binding receptor molecules
US7482005B2 (en) 1991-03-29 2009-01-27 Genentech, Inc. Methods of treating diseases with anti-VEGF antibodies
US7514537B2 (en) 2001-04-30 2009-04-07 City Of Hope Chimeric immunoreceptor useful in treating human gliomas
WO2009091826A2 (en) 2008-01-14 2009-07-23 The Board Of Regents Of The University Of Texas System Compositions and methods related to a human cd19-specific chimeric antigen receptor (h-car)
US7569663B2 (en) 2000-01-03 2009-08-04 Mark L. Tykocinski Chimeric proteins and methods for using the same
US7572891B2 (en) 2000-02-14 2009-08-11 The Regents Of The University Of California Kidney-specific tumor vaccine directed against kidney tumor antigen G-250
US20090202501A1 (en) 2004-09-24 2009-08-13 Tong Zhang Chimeric NK receptor and methods for treating cancer
WO2009117117A1 (en) 2008-03-19 2009-09-24 Altor Bioscience Corporation T cell receptor fusions and conjugates and methods of use there of
US7618817B2 (en) 2004-07-10 2009-11-17 Fox Chase Cancer Center Genetically modified human natural killer cell lines
US7632497B2 (en) 2004-11-10 2009-12-15 Macrogenics, Inc. Engineering Fc Antibody regions to confer effector function
US7655461B2 (en) 2004-12-07 2010-02-02 University of Pittsbugh — Of the Commonwealth System of Higher Education Therapeutic and diagnostic cloned MHC-unrestricted receptor specific for the MUC1 tumor associated antigen
US7666424B2 (en) 2001-10-17 2010-02-23 Sloan-Kettering Institute For Cancer Research Methods of preparing and using single chain anti-tumor antibodies
WO2010025177A1 (en) 2008-08-26 2010-03-04 City Of Hope Method and compositions for enhanced anti-tumor effector functioning of t cells
EP2177230A1 (en) 2007-08-09 2010-04-21 Daiichi Sankyo Company, Limited Immunoliposome inducing apoptosis into cell expressing death domain-containing receptor
US7723111B2 (en) 2001-03-09 2010-05-25 The United States Of America As Represented By The Department Of Health And Human Services Activated dual specificity lymphocytes and their methods of use
US20100135974A1 (en) 2007-01-31 2010-06-03 Yeda Research And Development Co. Ltd. Redirected, genetically-engineered t regulatory cells and their use in suppression of autoimmune and inflammatory disease
US7741465B1 (en) 1992-03-18 2010-06-22 Zelig Eshhar Chimeric receptor genes and cells transformed therewith
US20100278830A1 (en) 2007-02-20 2010-11-04 Shoemaker Charles B Methods and systems for multi-antibody therapies
US7871817B2 (en) 2002-09-24 2011-01-18 Johannes Gutenberg-Universitat Mainz Method for rational mutagenesis of α/β t-cell receptors and correspondingly mutated mdm2-protein specific α/β t-cell receptors
US7906620B2 (en) 2002-08-16 2011-03-15 Yeda Research And Development Co. Ltd. Tumor associated antigen, peptides thereof, and use of same as anti-tumor vaccines
US7919079B2 (en) 2006-03-31 2011-04-05 Biosante Pharmaceuticals, Inc. Cancer immunotherapy compositions and methods of use
US7939059B2 (en) 2001-12-10 2011-05-10 California Institute Of Technology Method for the generation of antigen-specific lymphocytes
US20110172254A1 (en) 2008-09-17 2011-07-14 Endocyte, Inc. Folate receptor binding conjugates of antifolates
US20110178279A1 (en) 2009-08-03 2011-07-21 Williams John C Development of masked therapeutic antibodies to limit off-target effects: application to anti-egfr antibodies
US7998736B2 (en) 2004-10-08 2011-08-16 The United States Of America As Represented By The Department Of Health And Human Services Adoptive immunotherapy with enhanced T lymphocyte survival
US8105830B2 (en) 1998-10-21 2012-01-31 Altor Bioscience Corporation Polyspecific binding molecules and uses thereof
US20120093842A1 (en) 1992-03-18 2012-04-19 The United States of America, as represented by the Secretary, Dept. of Health & Human Service Chimeric receptor genes and cells transformed therewith
WO2012054825A1 (en) 2010-10-22 2012-04-26 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-mage-a3 t cell receptors and related materials and methods of use
WO2012082841A2 (en) 2010-12-14 2012-06-21 University Of Maryland, Baltimore Universal anti-tag chimeric antigen receptor-expressing t cells and methods of treating cancer
WO2012138475A1 (en) 2011-04-08 2012-10-11 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-epidermal growth factor receptor variant iii chimeric antigen receptors and use of same for the treatment of cancer
CN102775500A (en) 2012-08-03 2012-11-14 郑骏年 Chimeric antigen receptor iRGD-scFv (G250)-CD8-CD28-CD137-CD3zeta and application thereof
US20120302466A1 (en) 2009-10-29 2012-11-29 Sentman Charles L T cell receptor-deficient t cell compositions
US8324353B2 (en) 2001-04-30 2012-12-04 City Of Hope Chimeric immunoreceptor useful in treating human gliomas
US8389282B2 (en) 2007-03-30 2013-03-05 Memorial Sloan-Kettering Cancer Center Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes
WO2013039889A1 (en) 2011-09-15 2013-03-21 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services T cell receptors recognizing hla-a1- or hla-cw7-restricted mage
US8409577B2 (en) 2006-06-12 2013-04-02 Emergent Product Development Seattle, Llc Single chain multivalent binding proteins with effector function
US8450112B2 (en) 2008-04-09 2013-05-28 Maxcyte, Inc. Engineering and delivery of therapeutic compositions of freshly isolated cells
US20130143895A1 (en) 2010-02-17 2013-06-06 Andrès Mc Allister Bicyclic compounds and their uses as dual c-src / jak inhibitors
US8465743B2 (en) 2009-10-01 2013-06-18 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-vascular endothelial growth factor receptor-2 chimeric antigen receptors and use of same for the treatment of cancer
US20130156794A1 (en) 2010-05-04 2013-06-20 Yeda Research And Development Co. Ltd. Immunotherapy using redirected allogeneic cells
US8486911B2 (en) 2009-06-17 2013-07-16 University of Pittsburgh—of the Commonwealth System of Higher Education Th1-associated microRNAs and their use for tumor immunotherapy
EP2614077A1 (en) 2010-09-08 2013-07-17 Chemotherapeutisches Forschungsinstitut Georg-Speyer-Haus Chimeric antigen receptors with an optimized hinge region
US20130309258A1 (en) 2010-12-09 2013-11-21 The Trustees Of The University Of Pennsylvania Methods for Treatment of Cancer
WO2013177247A1 (en) 2012-05-22 2013-11-28 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Murine anti-ny-eso-1 t cell receptors
US20130323834A1 (en) 2010-05-21 2013-12-05 Bellicum Pharmaceuticals, Inc. Methods for inducing selective apoptosis
US20130344066A1 (en) 2008-11-07 2013-12-26 Sequenta, Inc. Methods of monitoring conditions by sequence analysis
US20140004132A1 (en) 2010-09-08 2014-01-02 Malcolm Brenner Immunotherapy of cancer using genetically engineered gd2-specific t cells
US20140004137A1 (en) 2010-12-09 2014-01-02 Stichting Sanquin Bloedvoorziening Immune restricted peptides with increased efficacy
WO2014011984A1 (en) 2012-07-13 2014-01-16 The Trustees Of The University Of Pennsylvania Toxicity management for anti-tumor activity of cars
US20140017170A1 (en) 2008-11-24 2014-01-16 Massachusetts Institute Of Technology Methods and compositions for localized agent delivery
WO2014031687A1 (en) 2012-08-20 2014-02-27 Jensen, Michael Method and compositions for cellular immunotherapy
WO2014043441A1 (en) 2012-09-14 2014-03-20 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services T cell receptors recognizing mhc class ii-restricted mage-a3
WO2014055771A1 (en) 2012-10-05 2014-04-10 The Trustees Of The University Of Pennsylvania Human alpha-folate receptor chimeric antigen receptor
US20140120136A1 (en) 2012-10-12 2014-05-01 The Babraham Institute Mir-155 enhancement of cd8+ t cell immunity
WO2014068388A1 (en) 2012-10-29 2014-05-08 Glaxo Group Limited 2 substituted cephem compounds
US20140134142A1 (en) 2012-05-25 2014-05-15 Cellectis Multi-Chain Chimeric Antigen Receptor and Uses Thereof
US20140134720A1 (en) 2011-05-17 2014-05-15 Ucl Business Plc Method
WO2014100615A1 (en) 2012-12-20 2014-06-26 Purdue Research Foundation Chimeric antigen receptor-expressing t cells as anti-cancer therapeutics
US8802374B2 (en) 2009-11-03 2014-08-12 City Of Hope Truncated epiderimal growth factor receptor (EGFRt) for transduced T cell selection
US20140227237A1 (en) 2011-09-16 2014-08-14 The Trustees Of The University Of Pennsylvania Rna engineered t cells for the treatment of cancer
US8809050B2 (en) 2009-12-08 2014-08-19 Wilson Wolf Manufacturing Methods of cell culture for adoptive cell therapy
WO2014127261A1 (en) 2013-02-15 2014-08-21 The Regents Of The University Of California Chimeric antigen receptor and methods of use thereof
US20140255363A1 (en) 2011-09-16 2014-09-11 Baylor College Of Medicine Targeting the tumor microenvironment using manipulated nkt cells
US20140271582A1 (en) 2013-03-15 2014-09-18 City Of Hope Cd123-specific chimeric antigen receptor redirected t cells and methods of their use
US20140271635A1 (en) 2013-03-16 2014-09-18 The Trustees Of The University Of Pennsylvania Treatment of cancer using humanized anti-cd19 chimeric antigen receptor
US20140274909A1 (en) 2011-10-20 2014-09-18 The Usa, As Represented By The Secretary, Department Of Health And Human Service Anti-cd22 chimeric antigen receptors
US20140286987A1 (en) 2013-03-14 2014-09-25 Bellicum Pharmaceuticals, Inc. Methods for controlling t cell proliferation
US20140286973A1 (en) 2013-03-15 2014-09-25 The Trustees Of The University Of Pennsylvania Chimeric antigen receptor specific for folate receptor beta
US8859229B2 (en) 2007-02-02 2014-10-14 Yale University Transient transfection with RNA
US20140308259A1 (en) 2011-11-03 2014-10-16 The Trustees Of The University Of Pennsylvania Isolated b7-h4 specific compositions and methods of use thereof
US20140322183A1 (en) 2013-03-15 2014-10-30 The Trustees Of The University Of Pennsylvania Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
US20140322212A1 (en) 2013-02-20 2014-10-30 Jennifer Brogdon Effective targeting of primary human leukemia using anti-cd123 chimeric antigen receptor engineered t cells
US20140322275A1 (en) 2013-02-20 2014-10-30 Jennifer Brogdon TREATMENT OF CANCER USING HUMANIZED ANTI-EGFRvIII CHIMERIC ANTIGEN RECEPTOR
US8877199B2 (en) 2009-05-15 2014-11-04 The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services B cell surface reactive antibodies
US8946385B2 (en) 2007-01-30 2015-02-03 Chugai Seiyaku Kabushiki Kaisha Chimeric Fcγ receptor and method for determination of ADCC activity by using the receptor
US8956860B2 (en) 2009-12-08 2015-02-17 Juan F. Vera Methods of cell culture for adoptive cell therapy
WO2015057852A1 (en) 2013-10-15 2015-04-23 The California Institute For Biomedical Research Chimeric antigen receptor t cell switches and uses thereof
US20150110760A1 (en) 2011-08-31 2015-04-23 Trustees Of Dartmouth College Nkp30 receptor targeted therapeutics
WO2015057834A1 (en) 2013-10-15 2015-04-23 The California Institute For Biomedical Research Peptidic chimeric antigen receptor t cell switches and uses thereof
US9023621B2 (en) 2010-02-12 2015-05-05 Oncomed Pharmaceuticals, Inc. Methods for identifying and isolating cells expressing a polypeptide
US20150139943A1 (en) 2013-10-17 2015-05-21 National University Of Singapore Chimeric receptors and uses thereof in immune therapy
US9040669B2 (en) 2011-02-11 2015-05-26 Memorial Sloan Kettering Cancer Center HLA-restricted, peptide-specific antigen binding proteins
US20150152181A1 (en) 2012-05-07 2015-06-04 The Trustees Of Dartmouth College Anti-b7-h6 antibody, fusion proteins, and methods of using the same
US9074000B2 (en) 2011-04-01 2015-07-07 Memorial Sloan Kettering Cancer Center T cell receptor-like antibodies specific for a WT1 peptide presented by HLA-A2
US9101609B2 (en) 2008-04-11 2015-08-11 Emergent Product Development Seattle, Llc CD37 immunotherapeutic and combination with bifunctional chemotherapeutic thereof
US9133436B2 (en) 2010-02-04 2015-09-15 The Trustees Of The University Of Pennsylvania ICOS critically regulates the expansion and function of inflammatory human Th17 cells
US20150283178A1 (en) 2014-04-07 2015-10-08 Carl H. June Treatment of cancer using anti-cd19 chimeric antigen receptor
US9156915B2 (en) 2012-04-26 2015-10-13 Thomas Jefferson University Anti-GCC antibody molecules
US9163258B2 (en) 2010-07-23 2015-10-20 Fred Hutchinson Cancer Research Center Method for the treatment of obesity
US20150307842A1 (en) 2009-10-29 2015-10-29 The Trustees Of Dartmouth College T cell receptor-deficient t cell compositions
WO2015164594A1 (en) 2014-04-23 2015-10-29 Board Of Regents, The University Of Texas System Chimeric antigen receptors (car) for use in therapy and methods for making the same
US9175308B2 (en) 2011-10-07 2015-11-03 Mie University Chimeric antigen receptor
US20150314014A1 (en) 2002-09-03 2015-11-05 Vit Lauermann Inhibitor which is deactivatable by a reagent produced by a target cell
US20150328292A1 (en) 2014-03-07 2015-11-19 Bellicum Pharmaceuticals, Inc. Caspase polypeptides having modified activity and uses thereof
US9211321B2 (en) 2009-10-27 2015-12-15 Immunicum Ab Method for proliferation of antigen-specific T cells
US9226936B2 (en) 2011-10-28 2016-01-05 The Wistar of Anatomy and Biology Methods and compositions for enhancing the therapeutic effect of anti-tumor T cells
US9242014B2 (en) 2010-06-15 2016-01-26 The Regents Of The University Of California Receptor tyrosine kinase-like orphan receptor 1 (ROR1) single chain Fv antibody fragment conjugates and methods of use thereof
US20160046700A1 (en) 2014-02-14 2016-02-18 Bellicum Pharmaceuticals, Inc. Methods for activating t cells using an inducible chimeric polypeptide
US20160046724A1 (en) 2014-07-21 2016-02-18 The Trustees Of The University Of Pennsylvania Treatment of cancer using humanized anti-bcma chimeric antigen receptor
WO2016025322A1 (en) 2014-08-09 2016-02-18 Purdue Research Foundation Design and development of neurokinin-1 receptor-binding agent delivery conjugates
US20160051651A1 (en) 2014-07-21 2016-02-25 The Trustees Of The University Of Pennsylvania Treatment of cancer using a cll-1 chimeric antigen receptor
US9272002B2 (en) 2011-10-28 2016-03-01 The Trustees Of The University Of Pennsylvania Fully human, anti-mesothelin specific chimeric immune receptor for redirected mesothelin-expressing cell targeting
US20160058857A1 (en) 2014-09-02 2016-03-03 Bellicum Pharmaceuticals, Inc. Costimulation of chimeric antigen receptors by myd88 and cd40 polypeptides
US20160068601A1 (en) 2014-08-19 2016-03-10 The Trustees Of The University Of Pennsylvania Treatment of cancer using a cd123 chimeric antigen receptor
WO2016054520A2 (en) 2014-10-03 2016-04-07 The California Institute For Biomedical Research Engineered cell surface proteins and uses thereof
US20160096892A1 (en) 2014-07-21 2016-04-07 The Trustees Of The University Of Pennsylvania Treatment of cancer using a cd33 chimeric antigen receptor
US9334330B2 (en) 2006-10-10 2016-05-10 Universite De Nantes Use of monoclonal antibodies specific to the O-acetylated form of GD2 ganglioside for the treatment of certain cancers
US20160136190A1 (en) 2014-11-17 2016-05-19 Cellectar Biosciences, Inc. Phospholipid Ether Analogs as Cancer-Targeting Drug Vehicles
US9345748B2 (en) 2010-09-21 2016-05-24 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-SSX-2 T cell receptors and related materials and methods of use
US9352036B2 (en) 2004-02-13 2016-05-31 Immunomedics, Inc. Delivery system for cytotoxic drugs by bispecific antibody pretargeting
US20160151465A1 (en) 2013-06-05 2016-06-02 Bellicum Pharmaceuticals, Inc. Methods for inducing partial apoptosis using caspase polypeptides
US9359447B2 (en) 2012-03-23 2016-06-07 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-mesothelin chimeric antigen receptors
US9365641B2 (en) 2012-10-01 2016-06-14 The Trustees Of The University Of Pennsylvania Compositions and methods for targeting stromal cells for the treatment of cancer
US20160166613A1 (en) 2014-12-15 2016-06-16 Bellicum Pharmaceuticals, Inc. Methods for controlled elimination of therapeutic cells
WO2016098078A2 (en) 2014-12-19 2016-06-23 Novartis Ag Dimerization switches and uses thereof
US20160175359A1 (en) 2014-12-15 2016-06-23 Bellicum Pharmaceuticals, Inc. Methods for controlled activation or elimination of therapeutic cells
WO2016102965A1 (en) 2014-12-24 2016-06-30 Ucl Business Plc Cell
US9394364B2 (en) 2011-04-19 2016-07-19 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Human monoclonal antibodies specific for glypican-3 and use thereof
US9393268B2 (en) 2013-03-15 2016-07-19 Thomas Jefferson University Cell-based anti-cancer compositions with reduced toxicity and methods of making and using the same
US9402888B2 (en) 2013-03-14 2016-08-02 The Wistar Institute Of Anatomy And Biology Methods and compositions for treating cancer
US9409992B2 (en) 2012-08-21 2016-08-09 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Mesothelin domain-specific monoclonal antibodies and use thereof
US9409994B2 (en) 2012-06-01 2016-08-09 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services High-affinity monoclonal antibodies to glypican-3 and use thereof
US9408904B2 (en) 2010-01-28 2016-08-09 The Children's Hospital Of Philadelphia Scalable manufacturing platform for viral vector purification and viral vectors so purified for use in gene therapy
US9416190B2 (en) 2012-09-27 2016-08-16 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Mesothelin antibodies and methods for eliciting potent antitumor activity
US9434935B2 (en) 2013-03-10 2016-09-06 Bellicum Pharmaceuticals, Inc. Modified caspase polypeptides and uses thereof
US9447194B2 (en) 2012-02-13 2016-09-20 Seattle Children's Hospital Bispecific chimeric antigen receptors and encoding polynucleotides thereof
WO2016149665A1 (en) 2015-03-18 2016-09-22 Baylor College Of Medicine Her2/erbb2 chimeric antigen receptor
WO2016168766A1 (en) 2015-04-15 2016-10-20 The California Institute For Biomedical Research Optimized chimeric receptor t cell switches and uses thereof
US9476028B2 (en) 2011-04-13 2016-10-25 Immunicum Ab Method for proliferation of antigen-specific T cells
US9487800B2 (en) 2010-09-08 2016-11-08 Chemotherapeutisches Forschunginstitut Georg-Speyer-Haus Interleukin 15 as selectable marker for gene transfer in lymphocytes
US9492529B2 (en) 2011-04-13 2016-11-15 Immunicum Ab Method for priming of T cells
US9492499B2 (en) 2014-10-14 2016-11-15 Riptide Bioscience, Inc. Peptides having anti-inflammatory properties
US9499855B2 (en) 2013-03-14 2016-11-22 Elwha Llc Compositions, methods, and computer systems related to making and administering modified T cells
US20160340649A1 (en) 2014-09-19 2016-11-24 City Of Hope Costimulatory Chimeric Antigen Receptor T Cells Targeting IL13Rx2
US9511092B2 (en) 2013-01-28 2016-12-06 St. Jude Children's Research Hospital, Inc. Chimeric receptor with NKG2D specificity for use in cell therapy against cancer and infectious disease
US20160361360A1 (en) 2015-06-12 2016-12-15 Immunomedics, Inc. Disease therapy with chimeric antigen receptor (car) constructs and t cells (car-t) or nk cells (car-nk) expressing car constructs
WO2016210447A1 (en) 2015-06-26 2016-12-29 University Of Southern California Masking chimeric antigen receptor t cells for tumor-specific activation
US9561291B2 (en) 2013-03-15 2017-02-07 Imre Kovesdi Methods of targeting T-cells to tumors
US9562087B2 (en) 2014-08-08 2017-02-07 The Board Of Trustees Of The Leland Stanford Junior University High affinity PD-1 agents and methods of use
US9567399B1 (en) 2016-06-20 2017-02-14 Kymab Limited Antibodies and immunocytokines
US9574014B2 (en) 2015-05-15 2017-02-21 City Of Hope Chimeric antigen receptor compositions
US9572836B2 (en) 2012-07-13 2017-02-21 The Trustees Of The University Of Pennsylvania Methods for assessing the suitability of transduced T cells for administration
US9572837B2 (en) 2015-03-02 2017-02-21 Innovative Cellular Therapeutics CO., LTD. Reducing immune tolerance induced by PD-L1
WO2017029512A1 (en) 2015-08-20 2017-02-23 Autolus Ltd Chimeric cytokine receptor
WO2017029511A1 (en) 2015-08-20 2017-02-23 Autolus Ltd Cell
US9587237B2 (en) 2013-03-14 2017-03-07 Elwha Llc Compositions, methods, and computer systems related to making and administering modified T cells
US9597357B2 (en) 2012-10-10 2017-03-21 Sangamo Biosciences, Inc. T cell modifying compounds and uses thereof
US9624292B2 (en) 2011-03-24 2017-04-18 Universitätsmedizin Der Johannes Gutenberg-Universität Mainz Single chain antigen recognizing constructs (scARCs) stabilized by the introduction of novel disulfide bonds
US9629877B2 (en) 2013-05-14 2017-04-25 Board Of Regents, The University Of Texas System Human application of engineered chimeric antigen receptor (CAR) T-cells
WO2017068360A1 (en) 2015-10-23 2017-04-27 Autolus Ltd Receptor
WO2017068361A1 (en) 2015-10-23 2017-04-27 Autolus Ltd Cell
US9636388B2 (en) 2015-05-19 2017-05-02 Morphogenesis, Inc. Multi-indication mRNA cancer immunotherapy
US9642906B2 (en) 2016-09-16 2017-05-09 Baylor College Of Medicine Generation of HPV-specific T-cells
US9650428B2 (en) 2014-12-02 2017-05-16 Roger Williams Hospital Methods and compositions for treating cancer
US9663756B1 (en) 2016-02-25 2017-05-30 Flodesign Sonics, Inc. Acoustic separation of cellular supporting materials from cultured cells
US9670281B2 (en) 2015-02-24 2017-06-06 The Regents Of The University Of California Binding-triggered transcriptional switches and methods of use thereof
US9676867B2 (en) 2005-12-02 2017-06-13 Dana-Farber Cancer Institute Inc. Chimeric T cell receptor comprising carbonic anhydrase IX (G250) antibody
US20170166877A1 (en) 2015-12-14 2017-06-15 Bellicum Pharmaceuticals, Inc. Dual controls for therapeutic cell activation or elimination
US9688760B2 (en) 2013-02-08 2017-06-27 Amgen Research (Munich) Gmbh Anti-leukocyte adhesion for the mitigation of potential adverse events caused by CD3-specific binding domains
US9688740B2 (en) 2011-10-26 2017-06-27 National Cancer Center Mutant CTLA4 gene transfected T cell and composition including same for anticancer immunotherapy
US9694033B2 (en) 2014-01-24 2017-07-04 The Cleveland Clinic Foundation IL-9 secreting CD8+ Tc9 cells and methods of treating cancer
US9701758B2 (en) 2013-05-24 2017-07-11 Board Of Regents, The University Of Texas System Anti-CD19 scFv (FMC63) polypeptide
US9708384B2 (en) 2011-09-22 2017-07-18 The Trustees Of The University Of Pennsylvania Universal immune receptor expressed by T cells for the targeting of diverse and multiple antigens
US9714278B2 (en) 2012-02-22 2017-07-25 The Trustees Of The University Of Pennsylvania Use of ICOS-based CARs to enhance antitumor activity and CAR persistence
US9717745B2 (en) 2015-03-19 2017-08-01 Zhejiang DTRM Biopharma Co. Ltd. Pharmaceutical compositions and their use for treatment of cancer and autoimmune diseases
US9725519B2 (en) 2012-06-08 2017-08-08 Kinki University Antibody against transporter and use thereof
WO2017137758A1 (en) 2016-02-12 2017-08-17 Autolus Limited Signalling system
WO2017137759A1 (en) 2016-02-12 2017-08-17 Autolus Limited Signalling system
US9738726B2 (en) 2013-06-11 2017-08-22 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services HER2-specific monoclonal antibodies and conjugates thereof
WO2017143094A1 (en) 2016-02-16 2017-08-24 Dana-Farber Cancer Institute, Inc. Immunotherapy compositions and methods
US9765142B2 (en) 2013-10-11 2017-09-19 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services TEM8 antibodies and their use in treatment and detection of tumors
US9765156B2 (en) 2012-07-13 2017-09-19 The Trustees Of The University Of Pennsylvania Enhancing activity of CAR T cells by co-introducing a bispecific antibody
US9765342B2 (en) 2012-04-11 2017-09-19 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Chimeric antigen receptors targeting B-cell maturation antigen
US9765330B1 (en) 2015-01-09 2017-09-19 Nant Holdings Ip, Llc Compositions and methods for reduction of allograft recognition and rejection
WO2017165245A2 (en) 2016-03-19 2017-09-28 F1 Oncology, Inc. Methods and compositions for transducing lymphocytes and regulated expansion thereof
WO2017165571A1 (en) 2016-03-22 2017-09-28 Seattle Children's Hospital (dba Seattle Children's Research Institute) Early intervention methods to prevent or ameliorate toxicity
US9777064B2 (en) 2015-03-17 2017-10-03 Chimera Bioengineering, Inc. Smart CAR devices, DE CAR polypeptides, side CARs and uses thereof
US9783591B2 (en) 2012-02-22 2017-10-10 The Trustees Of The University Of Pennsylvania Use of the CD2 signaling domain in second-generation chimeric antigen receptors
WO2017177149A2 (en) 2016-04-08 2017-10-12 Purdue Research Foundation Methods and compositions for car t cell therapy
US9790282B2 (en) 2013-03-25 2017-10-17 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-CD276 polypeptides, proteins, and chimeric antigen receptors
US9790267B2 (en) 2011-11-08 2017-10-17 The Trustees Of The University Of Pennsylvania Glypican-3-specific antibody and uses thereof
US9790467B2 (en) 2015-09-22 2017-10-17 Qt Holdings Corp Methods and compositions for activation or expansion of T lymphocytes
WO2017180587A2 (en) 2016-04-11 2017-10-19 Obsidian Therapeutics, Inc. Regulated biocircuit systems
US9796783B2 (en) 2014-03-05 2017-10-24 Cantargia Ab Anti human interleukin-1 receptor accessory protein (IL1 RAP) antibodies and uses thereof
US20170306303A1 (en) 2016-01-08 2017-10-26 The Regents Of The University Of California Conditionally active heterodimeric polypeptides and methods of use thereof
US9802997B2 (en) 2015-03-27 2017-10-31 Immatics Biotechnologies Gmbh Peptides and combination of peptides for use in immunotherapy against various tumors
US9809581B2 (en) 2015-11-19 2017-11-07 Chemocentryx, Inc. Inhibitors of CXCR2
US9808486B2 (en) 2013-08-30 2017-11-07 Board Of Regents, The University Of Texas System Administration of kynurenine depleting enzymes for tumor therapy
US9828399B2 (en) 2014-02-28 2017-11-28 The Royal Institution For The Advancement Of Learning/Mcgill University TC-PTP inhibitors as APC activators for immunotherapy
US9828435B2 (en) 2013-06-25 2017-11-28 Vaccinex, Inc. Use of antibodies or antigen-binding fragments thereof that specifically bind semaphorin-4D to increase tumor infiltrating leukocyte frequency
US9833480B2 (en) 2010-04-14 2017-12-05 Prospect Chartercare, Llc Methods and compositions for treating HIV
US9834545B2 (en) 2015-11-19 2017-12-05 Chemocentryx, Inc. Modulators of chemokine receptors
US20170356010A1 (en) 2016-03-19 2017-12-14 F1 Oncology, Inc. Methods and compositions for transducing lymphocytes and regulating the activity thereof
US9845362B2 (en) 2010-10-08 2017-12-19 The University Of North Carolina At Charlotte Compositions comprising chimeric antigen receptors, T cells comprising the same, and methods of using the same
WO2017216562A1 (en) 2016-06-16 2017-12-21 Autolus Limited Tunable chimeric antigen receptors
WO2017216561A1 (en) 2016-06-16 2017-12-21 Autolus Limited Chimeric antigen receptor
US9849092B2 (en) 2015-12-21 2017-12-26 Gholam A. Peyman Early cancer detection and enhanced immunotherapy
US9856497B2 (en) 2016-01-11 2018-01-02 The Board Of Trustee Of The Leland Stanford Junior University Chimeric proteins and methods of regulating gene expression
US9856322B2 (en) 2003-11-05 2018-01-02 St Jude Children's Research Hospital, Inc. Chimeric receptors with 4-1BB stimulatory signaling domain
US9855297B2 (en) 2013-05-29 2018-01-02 Cellectis Methods for engineering T cells for immunotherapy by using RNA-guided CAS nuclease system
US9855298B2 (en) 2015-05-28 2018-01-02 Kite Pharma, Inc. Methods of conditioning patients for T cell therapy
US9856501B2 (en) 2010-09-26 2018-01-02 Da Yu Enterprises, L.L.C. Method of recombinant macromolecular production
US9862775B2 (en) 2014-03-05 2018-01-09 Eutilex Co., Ltd. Monoclonal antibody which specifically recognizes B cell lymphoma and use thereof
WO2018013797A1 (en) 2016-07-13 2018-01-18 President And Fellows Of Harvard College Antigen-presenting cell-mimetic scaffolds and methods for making and using the same
US9873894B2 (en) 2013-05-15 2018-01-23 Sangamo Therapeutics, Inc. Methods and compositions for treatment of a genetic condition
US9879087B2 (en) 2014-11-12 2018-01-30 Siamab Therapeutics, Inc. Glycan-interacting compounds and methods of use
US9885021B2 (en) 2014-06-12 2018-02-06 Children's National Medical Center Generation of broadly-specific, virus-immune cells targeting multiple HIV antigens for preventive and therapeutic use
US9890393B2 (en) 2013-05-29 2018-02-13 Cellectis Methods for engineering T cells for immunotherapy by using RNA-guided CAS nuclease system
US9889160B2 (en) 2015-10-05 2018-02-13 Precision Biosciences, Inc. Genetically-modified cells comprising a modified human T cell receptor alpha constant region gene
WO2018111763A1 (en) 2016-12-12 2018-06-21 Seattle Children's Hospital (dba Seattle Children's Research Institute) Chimeric transcription factor variants with augmented sensitivity to drug ligand induction of transgene expression in mammalian cells
WO2018111834A1 (en) 2016-12-13 2018-06-21 Seattle Children's Hospital (dba Seattle Children's Research Institute) Methods of exogenous drug activation of chemical-induced signaling complexes expressed in engineered cells in vitro and in vivo
WO2018115146A1 (en) 2016-12-21 2018-06-28 Danmarks Tekniske Universitet Antigen presenting scaffolds for immune-cell manipulation
WO2018148224A1 (en) 2017-02-07 2018-08-16 Seattle Children's Hospital (dba Seattle Children's Research Institute) Phospholipid ether (ple) car t cell tumor targeting (ctct) agents
WO2018152451A1 (en) 2017-02-17 2018-08-23 Purdue Research Foundation Targeted ligand-payload based drug delivery for cell therapy
WO2018160622A1 (en) 2017-02-28 2018-09-07 Endocyte, Inc. Compositions and methods for car t cell therapy
WO2019060425A1 (en) 2017-09-19 2019-03-28 Massachusetts Institute Of Technology Compositions for chimeric antigen receptor t cell therapy and uses thereof
US10279047B2 (en) 2014-01-20 2019-05-07 University Of Utah Research Foundation Compositions and methods for modifying the surface of cells and methods of use
US20190209611A1 (en) 2016-10-20 2019-07-11 Miltenyi Biotec Gmbh Chimeric antigen receptor specific for tumor cells
US20190224237A1 (en) 2018-01-22 2019-07-25 Seattle Children's Hospital (dba Seattle Children's Research Institute) Methods of use for car t cells
WO2019156795A1 (en) 2018-02-06 2019-08-15 Seattle Children's Hospital (dba Seattle Children's Research Institute) Fluorescein-specific cars exhibiting optimal t cell function against fl-ple labelled tumors
US20190388468A1 (en) 2016-12-15 2019-12-26 Miltenyi Biotec Gmbh Immune cells expressing an antigen binding receptor and a chimeric costimulatory receptor
US20210317407A1 (en) * 2018-08-06 2021-10-14 Seattle Children's Hospital (dba Seattle Children's Research Institute) Methods and compositions for stimulation of chimeric antigen receptor t cells with hapten labelled cells
US20220125841A1 (en) * 2019-03-13 2022-04-28 Seattle Children's Hospital (dba Seattle Children'a Research Institute) Sodium fluorescein as a reversal agent for an anti-fluorescein car t cells and fluorescein-phospholipid-ethers or profluorescein-phospholipid-ethers
US20220280648A1 (en) * 2019-07-05 2022-09-08 Purdue Research Foundation Design and efficient synthesis of lipid-fluorescein conjugates for car-t cell therapy
US20230172981A1 (en) * 2020-02-04 2023-06-08 Seattle Children's Hospital (dba Seattle Children's Research Institute) Methods and compositions for stimulation of chimeric antigen receptor t cells with hapten labelled cells

Patent Citations (393)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1986004356A1 (en) 1985-01-28 1986-07-31 International Genetic Engineering, Inc. AraB PROMOTERS AND METHOD OF PRODUCING POLYPEPTIDES, INCLUDINN CECROPINS, BY MICROBIOLOGICAL TECHNIQUES
US5482856A (en) 1987-10-27 1996-01-09 Oncogen Inc. Production of chimeric antibodies by homologous recombination
US5202238A (en) 1987-10-27 1993-04-13 Oncogen Production of chimeric antibodies by homologous recombination
US6004781A (en) 1988-01-22 1999-12-21 The General Hospital Corporation Nucleic acid encoding Ig-CD4 fusion proteins
US6117656A (en) 1988-01-22 2000-09-12 General Hospital Corporation Cloned genes encoding IG-CD4 fusion proteins and the use thereof
US5912172A (en) 1988-05-04 1999-06-15 Yeda Research And Development Co. Ltd. Endowing lymphocytes with antibody specificity
US5906936A (en) 1988-05-04 1999-05-25 Yeda Research And Development Co. Ltd. Endowing lymphocytes with antibody specificity
US5514582A (en) 1989-02-23 1996-05-07 Genentech, Inc. Recombinant DNA encoding hybrid immunoglobulins
US6406697B1 (en) 1989-02-23 2002-06-18 Genentech, Inc. Hybrid immunoglobulins
US5714147A (en) 1989-02-23 1998-02-03 Genentech Inc. Hybrid immunoglobulins
US5116964A (en) 1989-02-23 1992-05-26 Genentech, Inc. Hybrid immunoglobulins
US5216132A (en) 1990-01-12 1993-06-01 Protein Design Labs, Inc. Soluble t-cell antigen receptor chimeric antigens
US20020004052A1 (en) 1990-05-08 2002-01-10 David Berd Composition comprising a tumor cell extract and method of using the composition
US5914109A (en) 1990-06-15 1999-06-22 New York University Heterohybridomas producing human monoclonal antibodies to HIV-1
US5359046A (en) 1990-12-14 1994-10-25 Cell Genesys, Inc. Chimeric chains for receptor-associated signal transduction pathways
US20020111474A1 (en) 1990-12-14 2002-08-15 Capon Daniel J. Chimeric chains for receptor-associated signal transduction pathways
US6407221B1 (en) 1990-12-14 2002-06-18 Cell Genesys, Inc. Chimeric chains for receptor-associated signal transduction pathways
US6319494B1 (en) 1990-12-14 2001-11-20 Cell Genesys, Inc. Chimeric chains for receptor-associated signal transduction pathways
WO1992010591A1 (en) 1990-12-14 1992-06-25 Cell Genesys, Inc. Chimeric chains for receptor-associated signal transduction pathways
US6392013B1 (en) 1991-03-07 2002-05-21 The General Hospital Corporation Redirection of cellular immunity by protein tyrosine kinase chimeras
US5843728A (en) 1991-03-07 1998-12-01 The General Hospital Corporation Redirection of cellular immunity by receptor chimeras
US5851828A (en) 1991-03-07 1998-12-22 The General Hospital Corporation Targeted cytolysis of HIV-infected cells by chimeric CD4 receptor-bearing cells
US6410014B1 (en) 1991-03-07 2002-06-25 The General Hospital Corporation Redirection of cellular immunity by protein-tyrosine kinase chimeras
US7049136B2 (en) 1991-03-07 2006-05-23 The General Hospital Corporation Redirection of cellular immunity by receptor chimeras
US7320787B2 (en) 1991-03-07 2008-01-22 The General Hospital Corporation Redirection of cellular immunity by protein tyrosine kinase chimeras
US5912170A (en) 1991-03-07 1999-06-15 The General Hospital Corporation Redirection of cellular immunity by protein-tyrosine kinase chimeras
US6753162B1 (en) 1991-03-07 2004-06-22 The General Hospital Corporation Targeted cytolysis of HIV-infected cells by chimeric CD4 receptor-bearing cells
US6004811A (en) 1991-03-07 1999-12-21 The Massachussetts General Hospital Redirection of cellular immunity by protein tyrosine kinase chimeras
WO1992015671A1 (en) 1991-03-08 1992-09-17 Cytomed, Inc. Soluble cd28 proteins and methods of treatment therewith
US7482005B2 (en) 1991-03-29 2009-01-27 Genentech, Inc. Methods of treating diseases with anti-VEGF antibodies
US5670148A (en) 1991-10-21 1997-09-23 Cell Genesys, Inc. Combined cellular and immunosuppressive therapies
US8211422B2 (en) 1992-03-18 2012-07-03 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Chimeric receptor genes and cells transformed therewith
US7741465B1 (en) 1992-03-18 2010-06-22 Zelig Eshhar Chimeric receptor genes and cells transformed therewith
US20120093842A1 (en) 1992-03-18 2012-04-19 The United States of America, as represented by the Secretary, Dept. of Health & Human Service Chimeric receptor genes and cells transformed therewith
US7105159B1 (en) 1992-11-05 2006-09-12 Sloan-Kettering Institute For Cancer Research Antibodies to prostate-specific membrane antigen
USRE43586E1 (en) 1992-11-05 2012-08-14 Sloan-Kettering Institute For Cancer Research Antibodies to prostate-specific membrane antigen
US6953668B1 (en) 1992-11-05 2005-10-11 Sloan-Kettering Institute For Cancer Research Prostate-specific membrane antigen
US5538866A (en) 1992-11-05 1996-07-23 Sloan-Kettering Institute For Cancer Research Prostate-specific membrane antigen
US5747292A (en) 1993-04-06 1998-05-05 Fred Hutchinson Cancer Research Center Chimeric cytokine receptors in lymphocytes
US5834256A (en) 1993-06-11 1998-11-10 Cell Genesys, Inc. Method for production of high titer virus and high efficiency retroviral mediated transduction of mammalian cells
US6218187B1 (en) 1993-06-11 2001-04-17 Cell Genesys, Inc. Method for production of high titer virus and high efficiency retroviral mediated transduction of mammalian cells
US5858740A (en) 1993-06-11 1999-01-12 Cell Genesys, Inc. Method for production of high titer virus and high efficiency retroviral mediated transduction of mammalian cells
US5525503A (en) 1993-09-28 1996-06-11 Dana-Farber Cancer Institute, Inc. Signal transduction via CD28
US7354587B1 (en) 1994-07-06 2008-04-08 Immunomedics, Inc. Use of immunoconjugates to enhance the efficacy of multi-stage cascade boosting vaccines
US6132718A (en) 1994-07-06 2000-10-17 Immunomedics, Inc. Multi-stage cascade boosting vaccine
US8163887B2 (en) 1994-07-06 2012-04-24 Immunomedics, Inc. Use of immunoconjugates to enhance the efficacy of multi-stage cascade boosting vaccines
US6005004A (en) 1994-08-05 1999-12-21 Molecular / Structural Biotechnologies, Inc. Lipophilic-polycationic delivery systems
US6083751A (en) 1994-11-01 2000-07-04 Targeted Genetics Corporation Chimeric receptors for the generation of selectively-activatable TH-independent cytotoxic T cells
US5741899A (en) 1995-02-02 1998-04-21 Cell Genesys, Inc. Chimeric receptors comprising janus kinase for regulating cellular pro liferation
US5837544A (en) 1995-02-02 1998-11-17 Cell Genesys, Inc. Method of inducing a cell to proliferate using a chimeric receptor comprising janus kinase
US6077947A (en) 1995-02-02 2000-06-20 Cell Genesys, Inc. DNA encoding an intracellular chimeric receptor comprising Janus kinase
US5712149A (en) 1995-02-03 1998-01-27 Cell Genesys, Inc. Chimeric receptor molecules for delivery of co-stimulatory signals
US5686281A (en) 1995-02-03 1997-11-11 Cell Genesys, Inc. Chimeric receptor molecules for delivery of co-stimulatory signals
US6103521A (en) 1995-02-06 2000-08-15 Cell Genesys, Inc. Multispecific chimeric receptors
US7037647B1 (en) 1995-02-24 2006-05-02 Sloan-Kettering Institute For Cancer Research Prostate-specific membrane antigen and uses thereof
US5935818A (en) 1995-02-24 1999-08-10 Sloan-Kettering Institute For Cancer Research Isolated nucleic acid molecule encoding alternatively spliced prostate-specific membrane antigen and uses thereof
US5830755A (en) 1995-03-27 1998-11-03 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services T-cell receptors and their use in therapeutic and diagnostic methods
US6261787B1 (en) 1996-06-03 2001-07-17 Case Western Reserve University Bifunctional molecules for delivery of therapeutics
US5969102A (en) 1997-03-03 1999-10-19 St. Jude Children's Research Hospital Lymphocyte surface receptor that binds CAML, nucleic acids encoding the same and methods of use thereof
US6432403B1 (en) 1997-06-11 2002-08-13 New York University Antibodies to polypeptides having prenylcysteine carboxyl methlytransferase activity or inhibiting activity
US6759243B2 (en) 1998-01-20 2004-07-06 Board Of Trustees Of The University Of Illinois High affinity TCR proteins and methods
US20090011984A1 (en) 1998-02-23 2009-01-08 Seppo Yla-Herttuala Biotin-binding receptor molecules
US20060155115A1 (en) 1998-05-19 2006-07-13 Avidex Limited Multivalent T cell receptor complexes
US6395152B1 (en) 1998-07-09 2002-05-28 Acm Research, Inc. Methods and apparatus for electropolishing metal interconnections on semiconductor devices
US6410319B1 (en) 1998-10-20 2002-06-25 City Of Hope CD20-specific redirected T cells and their use in cellular immunotherapy of CD20+ malignancies
US8105830B2 (en) 1998-10-21 2012-01-31 Altor Bioscience Corporation Polyspecific binding molecules and uses thereof
US7217421B1 (en) 1998-11-03 2007-05-15 Cell Genesys, Inc. Cancer-associated antigens and methods of their identification and use
US6521602B1 (en) 1999-03-01 2003-02-18 Gpc Biotech Inc. Anti-neoplastic compositions and uses thereof
US7052906B1 (en) 1999-04-16 2006-05-30 Celltech R & D Limited Synthetic transmembrane components
US6699972B1 (en) 1999-06-25 2004-03-02 Academia Sinica Chimeric protein and method of controlling tumor growth using the protein
US7569663B2 (en) 2000-01-03 2009-08-04 Mark L. Tykocinski Chimeric proteins and methods for using the same
US7572891B2 (en) 2000-02-14 2009-08-11 The Regents Of The University Of California Kidney-specific tumor vaccine directed against kidney tumor antigen G-250
US8741306B2 (en) 2000-02-14 2014-06-03 The Regents Of The University Of California Kidney specific tumor vaccine directed against kidney tumor antigen G-250
US6770749B2 (en) 2000-02-22 2004-08-03 City Of Hope P53-specific T cell receptor for adoptive immunotherapy
US20010031252A1 (en) 2000-03-31 2001-10-18 Low Philip Stewart Method of treatment using ligand-immunogen conjugates
WO2001091625A2 (en) 2000-04-21 2001-12-06 Rutgers, The State University Of New Jersey Methods and compositions for the diagnosis of schizophrenia
US6524572B1 (en) 2000-06-26 2003-02-25 Rainbow Therapeutic Company Targeting recombinant virus with a bispecific fusion protein ligand in coupling with an antibody to cells for gene therapy
US20030175288A1 (en) 2000-07-31 2003-09-18 Kyogo Itoh Tumor antigen
US7446179B2 (en) 2000-11-07 2008-11-04 City Of Hope CD19-specific chimeric T cell receptor
US7723111B2 (en) 2001-03-09 2010-05-25 The United States Of America As Represented By The Department Of Health And Human Services Activated dual specificity lymphocytes and their methods of use
US7354762B2 (en) 2001-04-11 2008-04-08 City Of Hope Method for producing CE7-specific redirected immune cells
US7070995B2 (en) 2001-04-11 2006-07-04 City Of Hope CE7-specific redirected immune cells
US7446191B2 (en) 2001-04-11 2008-11-04 City Of Hope DNA construct encoding CE7-specific chimeric T cell receptor
US7265209B2 (en) 2001-04-11 2007-09-04 City Of Hope CE7-specific chimeric T cell receptor
WO2002088334A1 (en) 2001-04-30 2002-11-07 City Of Hope Chimeric immunoreceptor useful in treating human cancers
US8324353B2 (en) 2001-04-30 2012-12-04 City Of Hope Chimeric immunoreceptor useful in treating human gliomas
US8497118B2 (en) 2001-04-30 2013-07-30 City Of Hope Chimeric immunoreceptor useful in treating human cancers
US7514537B2 (en) 2001-04-30 2009-04-07 City Of Hope Chimeric immunoreceptor useful in treating human gliomas
US8148154B2 (en) 2001-10-17 2012-04-03 Sloan-Kettering Institute For Cancer Research Method for preparation of single chain antibodies
US7666424B2 (en) 2001-10-17 2010-02-23 Sloan-Kettering Institute For Cancer Research Methods of preparing and using single chain anti-tumor antibodies
US7939059B2 (en) 2001-12-10 2011-05-10 California Institute Of Technology Method for the generation of antigen-specific lymphocytes
US7446190B2 (en) 2002-05-28 2008-11-04 Sloan-Kettering Institute For Cancer Research Nucleic acids encoding chimeric T cell receptors
US7906620B2 (en) 2002-08-16 2011-03-15 Yeda Research And Development Co. Ltd. Tumor associated antigen, peptides thereof, and use of same as anti-tumor vaccines
US20150314014A1 (en) 2002-09-03 2015-11-05 Vit Lauermann Inhibitor which is deactivatable by a reagent produced by a target cell
US7871817B2 (en) 2002-09-24 2011-01-18 Johannes Gutenberg-Universitat Mainz Method for rational mutagenesis of α/β t-cell receptors and correspondingly mutated mdm2-protein specific α/β t-cell receptors
US9062127B2 (en) 2002-09-24 2015-06-23 Johannes Gutenberg-Universitat Mainz Method for rational mutagenesis of α/βT-cell receptors and correspondingly mutated MDM2-protein specific α/βT-cell receptors
JP2004113062A (en) 2002-09-25 2004-04-15 Teruyuki Nagamune Animal cell having chimera receptor and its utilization
US20040171096A1 (en) * 2002-12-10 2004-09-02 Echelon Biosciences Incorporated Compounds and methods of use thereof for assaying lysophospholipase D activity
US7348004B2 (en) 2003-05-06 2008-03-25 Syntonix Pharmaceuticals, Inc. Immunoglobulin chimeric monomer-dimer hybrids
US7404956B2 (en) 2003-05-06 2008-07-29 Syntonix Pharmaceuticals, Inc. Immunoglobulin chimeric monomer-dimer hybrids
US9636416B2 (en) 2003-05-06 2017-05-02 Bioverativ Therapeutics Inc. Immunoglobulin chimeric monomer-dimer hybrids
US8932830B2 (en) 2003-05-06 2015-01-13 Biogen Idec Hemophilia, Inc. Immunoglobulin chimeric monomer-dimer hybrids
US7381408B2 (en) 2003-05-06 2008-06-03 Syntonix Pharmaceuticals, Inc. Methods for chemically synthesizing immunoglobulin chimeric proteins
US20050113564A1 (en) 2003-11-05 2005-05-26 St. Jude Children's Research Hospital Chimeric receptors with 4-1BB stimulatory signaling domain
US8399645B2 (en) 2003-11-05 2013-03-19 St. Jude Children's Research Hospital, Inc. Chimeric receptors with 4-1BB stimulatory signaling domain
US9856322B2 (en) 2003-11-05 2018-01-02 St Jude Children's Research Hospital, Inc. Chimeric receptors with 4-1BB stimulatory signaling domain
US9605049B2 (en) 2003-11-05 2017-03-28 St. Jude Children's Research Hospital, Inc. Chimeric receptors with 4-1BB stimulatory signaling domain
US9352036B2 (en) 2004-02-13 2016-05-31 Immunomedics, Inc. Delivery system for cytotoxic drugs by bispecific antibody pretargeting
WO2005084716A2 (en) 2004-03-02 2005-09-15 Cellectar, Llc Phospholipid analogs for diagnosis and treatment of cancer
US7618817B2 (en) 2004-07-10 2009-11-17 Fox Chase Cancer Center Genetically modified human natural killer cell lines
WO2006029879A2 (en) 2004-09-17 2006-03-23 F.Hoffmann-La Roche Ag Anti-ox40l antibodies
US20150225470A1 (en) 2004-09-24 2015-08-13 Trustees Of Dartmouth College Chimeric NK receptor and methods for treating cancer
US8252914B2 (en) 2004-09-24 2012-08-28 Trustees Of Dartmouth College Chimeric NK receptor and methods for treating cancer
US20090202501A1 (en) 2004-09-24 2009-08-13 Tong Zhang Chimeric NK receptor and methods for treating cancer
US7994298B2 (en) 2004-09-24 2011-08-09 Trustees Of Dartmouth College Chimeric NK receptor and methods for treating cancer
US7998736B2 (en) 2004-10-08 2011-08-16 The United States Of America As Represented By The Department Of Health And Human Services Adoptive immunotherapy with enhanced T lymphocyte survival
US9834590B2 (en) 2004-11-04 2017-12-05 St. Jude Children's Research Hospital, Inc. Chimeric receptors with 4-1BB stimulatory signaling domain
US7435596B2 (en) 2004-11-04 2008-10-14 St. Jude Children's Research Hospital, Inc. Modified cell line and method for expansion of NK cell
US7632497B2 (en) 2004-11-10 2009-12-15 Macrogenics, Inc. Engineering Fc Antibody regions to confer effector function
US9469684B2 (en) 2004-12-07 2016-10-18 University of Pittsburgh—of the Commonwealth System of Higher Education Therapeutic and diagnostic cloned MHC-unrestricted receptor specific for the MUC1 tumor associated antigen
US7655461B2 (en) 2004-12-07 2010-02-02 University of Pittsbugh — Of the Commonwealth System of Higher Education Therapeutic and diagnostic cloned MHC-unrestricted receptor specific for the MUC1 tumor associated antigen
US9676867B2 (en) 2005-12-02 2017-06-13 Dana-Farber Cancer Institute Inc. Chimeric T cell receptor comprising carbonic anhydrase IX (G250) antibody
US7919079B2 (en) 2006-03-31 2011-04-05 Biosante Pharmaceuticals, Inc. Cancer immunotherapy compositions and methods of use
US20130309267A1 (en) 2006-03-31 2013-11-21 The Regents Of The University Of California Cancer immunotherapy compositions and methods of use
US8409577B2 (en) 2006-06-12 2013-04-02 Emergent Product Development Seattle, Llc Single chain multivalent binding proteins with effector function
US20080051380A1 (en) 2006-08-25 2008-02-28 Auerbach Alan H Methods and compositions for treating cancer
US9334330B2 (en) 2006-10-10 2016-05-10 Universite De Nantes Use of monoclonal antibodies specific to the O-acetylated form of GD2 ganglioside for the treatment of certain cancers
WO2008057437A2 (en) 2006-11-03 2008-05-15 Purdue Research Foundation Ex vivo flow cytometry method and device
US9733245B2 (en) 2007-01-30 2017-08-15 Chugai Seiyaku Kabushiki Kaisha Chimeric Fc-gamma receptor and method for determination of ADCC activity by using the receptor
US8946385B2 (en) 2007-01-30 2015-02-03 Chugai Seiyaku Kabushiki Kaisha Chimeric Fcγ receptor and method for determination of ADCC activity by using the receptor
US20100135974A1 (en) 2007-01-31 2010-06-03 Yeda Research And Development Co. Ltd. Redirected, genetically-engineered t regulatory cells and their use in suppression of autoimmune and inflammatory disease
US8859229B2 (en) 2007-02-02 2014-10-14 Yale University Transient transfection with RNA
US20100278830A1 (en) 2007-02-20 2010-11-04 Shoemaker Charles B Methods and systems for multi-antibody therapies
US8389282B2 (en) 2007-03-30 2013-03-05 Memorial Sloan-Kettering Cancer Center Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes
US9220728B2 (en) 2007-03-30 2015-12-29 Memorial Sloan-Kettering Cancer Center Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes
EP2177230A1 (en) 2007-08-09 2010-04-21 Daiichi Sankyo Company, Limited Immunoliposome inducing apoptosis into cell expressing death domain-containing receptor
WO2009091826A2 (en) 2008-01-14 2009-07-23 The Board Of Regents Of The University Of Texas System Compositions and methods related to a human cd19-specific chimeric antigen receptor (h-car)
WO2009117117A1 (en) 2008-03-19 2009-09-24 Altor Bioscience Corporation T cell receptor fusions and conjugates and methods of use there of
US8450112B2 (en) 2008-04-09 2013-05-28 Maxcyte, Inc. Engineering and delivery of therapeutic compositions of freshly isolated cells
US9669058B2 (en) 2008-04-09 2017-06-06 Maxcyte, Inc. Engineering and delivery of therapeutic compositions of freshly isolated cells
US9101609B2 (en) 2008-04-11 2015-08-11 Emergent Product Development Seattle, Llc CD37 immunotherapeutic and combination with bifunctional chemotherapeutic thereof
US8822647B2 (en) 2008-08-26 2014-09-02 City Of Hope Method and compositions using a chimeric antigen receptor for enhanced anti-tumor effector functioning of T cells
WO2010025177A1 (en) 2008-08-26 2010-03-04 City Of Hope Method and compositions for enhanced anti-tumor effector functioning of t cells
US20110172254A1 (en) 2008-09-17 2011-07-14 Endocyte, Inc. Folate receptor binding conjugates of antifolates
US20130344066A1 (en) 2008-11-07 2013-12-26 Sequenta, Inc. Methods of monitoring conditions by sequence analysis
US20140017170A1 (en) 2008-11-24 2014-01-16 Massachusetts Institute Of Technology Methods and compositions for localized agent delivery
US8877199B2 (en) 2009-05-15 2014-11-04 The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services B cell surface reactive antibodies
US8486911B2 (en) 2009-06-17 2013-07-16 University of Pittsburgh—of the Commonwealth System of Higher Education Th1-associated microRNAs and their use for tumor immunotherapy
US20110178279A1 (en) 2009-08-03 2011-07-21 Williams John C Development of masked therapeutic antibodies to limit off-target effects: application to anti-egfr antibodies
US8465743B2 (en) 2009-10-01 2013-06-18 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-vascular endothelial growth factor receptor-2 chimeric antigen receptors and use of same for the treatment of cancer
US8822196B2 (en) 2009-10-01 2014-09-02 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-vascular endothelial growth factor receptor-2 chimeric antigen receptors and use of same for the treatment of cancer
US9522955B2 (en) 2009-10-01 2016-12-20 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-vascular endothelial growth factor receptor-2 chimeric antigen receptors and use of same for the treatment of cancer
US9211321B2 (en) 2009-10-27 2015-12-15 Immunicum Ab Method for proliferation of antigen-specific T cells
US20150307842A1 (en) 2009-10-29 2015-10-29 The Trustees Of Dartmouth College T cell receptor-deficient t cell compositions
US20120302466A1 (en) 2009-10-29 2012-11-29 Sentman Charles L T cell receptor-deficient t cell compositions
US20160120907A1 (en) 2009-10-29 2016-05-05 The Trustees Of Dartmouth College T cell receptor-deficient t cell compositions
US9273283B2 (en) 2009-10-29 2016-03-01 The Trustees Of Dartmouth College Method of producing T cell receptor-deficient T cells expressing a chimeric receptor
US9821011B1 (en) 2009-10-29 2017-11-21 The Trustees Of Dartmouth College T-cell receptor-deficient T cell compositions
US9663763B2 (en) 2009-10-29 2017-05-30 The Trustees Of Dartmouth College T-cell receptor-deficient T cell compositions
US9822340B1 (en) 2009-10-29 2017-11-21 The Trustees Of Dartmouth College T-cell receptor-deficient T cell compositions
US8802374B2 (en) 2009-11-03 2014-08-12 City Of Hope Truncated epiderimal growth factor receptor (EGFRt) for transduced T cell selection
US8956860B2 (en) 2009-12-08 2015-02-17 Juan F. Vera Methods of cell culture for adoptive cell therapy
US8809050B2 (en) 2009-12-08 2014-08-19 Wilson Wolf Manufacturing Methods of cell culture for adoptive cell therapy
US9408904B2 (en) 2010-01-28 2016-08-09 The Children's Hospital Of Philadelphia Scalable manufacturing platform for viral vector purification and viral vectors so purified for use in gene therapy
US9133436B2 (en) 2010-02-04 2015-09-15 The Trustees Of The University Of Pennsylvania ICOS critically regulates the expansion and function of inflammatory human Th17 cells
US9023621B2 (en) 2010-02-12 2015-05-05 Oncomed Pharmaceuticals, Inc. Methods for identifying and isolating cells expressing a polypeptide
US20130143895A1 (en) 2010-02-17 2013-06-06 Andrès Mc Allister Bicyclic compounds and their uses as dual c-src / jak inhibitors
US9833480B2 (en) 2010-04-14 2017-12-05 Prospect Chartercare, Llc Methods and compositions for treating HIV
US20130156794A1 (en) 2010-05-04 2013-06-20 Yeda Research And Development Co. Ltd. Immunotherapy using redirected allogeneic cells
US9393292B2 (en) 2010-05-21 2016-07-19 Baylor College Of Medicine Methods for inducing selective apoptosis
US20130323834A1 (en) 2010-05-21 2013-12-05 Bellicum Pharmaceuticals, Inc. Methods for inducing selective apoptosis
US9089520B2 (en) 2010-05-21 2015-07-28 Baylor College Of Medicine Methods for inducing selective apoptosis
US9242014B2 (en) 2010-06-15 2016-01-26 The Regents Of The University Of California Receptor tyrosine kinase-like orphan receptor 1 (ROR1) single chain Fv antibody fragment conjugates and methods of use thereof
US9163258B2 (en) 2010-07-23 2015-10-20 Fred Hutchinson Cancer Research Center Method for the treatment of obesity
US9493740B2 (en) 2010-09-08 2016-11-15 Baylor College Of Medicine Immunotherapy of cancer using genetically engineered GD2-specific T cells
EP2614077A1 (en) 2010-09-08 2013-07-17 Chemotherapeutisches Forschungsinstitut Georg-Speyer-Haus Chimeric antigen receptors with an optimized hinge region
US9487800B2 (en) 2010-09-08 2016-11-08 Chemotherapeutisches Forschunginstitut Georg-Speyer-Haus Interleukin 15 as selectable marker for gene transfer in lymphocytes
US9212229B2 (en) 2010-09-08 2015-12-15 Chemotherapeutisches Forschungsinstitut Georg-Speyer-Haus Chimeric antigen receptors with an optimized hinge region
US20140004132A1 (en) 2010-09-08 2014-01-02 Malcolm Brenner Immunotherapy of cancer using genetically engineered gd2-specific t cells
US9345748B2 (en) 2010-09-21 2016-05-24 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-SSX-2 T cell receptors and related materials and methods of use
US9856501B2 (en) 2010-09-26 2018-01-02 Da Yu Enterprises, L.L.C. Method of recombinant macromolecular production
US9845362B2 (en) 2010-10-08 2017-12-19 The University Of North Carolina At Charlotte Compositions comprising chimeric antigen receptors, T cells comprising the same, and methods of using the same
WO2012054825A1 (en) 2010-10-22 2012-04-26 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-mage-a3 t cell receptors and related materials and methods of use
US9540445B2 (en) 2010-12-09 2017-01-10 The Trustees Of The University Of Pennsylvania Compositions and methods for treatment of cancer
US9481728B2 (en) 2010-12-09 2016-11-01 The Trustees Of The University Of Pennsylvania Compositions and methods for treatment of cancer
US20130309258A1 (en) 2010-12-09 2013-11-21 The Trustees Of The University Of Pennsylvania Methods for Treatment of Cancer
US8906682B2 (en) 2010-12-09 2014-12-09 The Trustees Of The University Of Pennsylvania Methods for treatment of cancer
US9464140B2 (en) 2010-12-09 2016-10-11 The Trustees Of The University Of Pennsylvania Compositions and methods for treatment of cancer
US9518123B2 (en) 2010-12-09 2016-12-13 The Trustees Of The University Of Pennsylvania Compositions and methods for treatment of cancer
US9499629B2 (en) 2010-12-09 2016-11-22 The Trustees Of The University Of Pennsylvania Use of chimeric antigen receptor-modified T-cells to treat cancer
US20140004137A1 (en) 2010-12-09 2014-01-02 Stichting Sanquin Bloedvoorziening Immune restricted peptides with increased efficacy
WO2012082841A2 (en) 2010-12-14 2012-06-21 University Of Maryland, Baltimore Universal anti-tag chimeric antigen receptor-expressing t cells and methods of treating cancer
US20130287752A1 (en) * 2010-12-14 2013-10-31 University Of Maryland, Baltimore Universal anti-tag chimeric antigen receptor-expressing t cells and methods of treating cancer
US9040669B2 (en) 2011-02-11 2015-05-26 Memorial Sloan Kettering Cancer Center HLA-restricted, peptide-specific antigen binding proteins
US9453075B2 (en) 2011-02-11 2016-09-27 Memorial Sloan-Kettering Cancer Center HLA-restricted, peptide-specific antigen binding proteins
US9624292B2 (en) 2011-03-24 2017-04-18 Universitätsmedizin Der Johannes Gutenberg-Universität Mainz Single chain antigen recognizing constructs (scARCs) stabilized by the introduction of novel disulfide bonds
US9540448B2 (en) 2011-04-01 2017-01-10 Memorial Sloan Kettering Cancer Center T cell receptor-like antibodies specific for a WTI peptide presented by HLA-A2
US9074000B2 (en) 2011-04-01 2015-07-07 Memorial Sloan Kettering Cancer Center T cell receptor-like antibodies specific for a WT1 peptide presented by HLA-A2
US9266960B2 (en) 2011-04-08 2016-02-23 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-epidermal growth factor receptor variant III chimeric antigen receptors and use of same for the treatment of cancer
US9624306B2 (en) 2011-04-08 2017-04-18 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-epidermal growth factor receptor variant III chimeric antigen receptors and use of same for the treatment of cancer
WO2012138475A1 (en) 2011-04-08 2012-10-11 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-epidermal growth factor receptor variant iii chimeric antigen receptors and use of same for the treatment of cancer
US9492529B2 (en) 2011-04-13 2016-11-15 Immunicum Ab Method for priming of T cells
US9476028B2 (en) 2011-04-13 2016-10-25 Immunicum Ab Method for proliferation of antigen-specific T cells
US9789174B2 (en) 2011-04-13 2017-10-17 Immunicum Ab Method for proliferation of antigen-specific T cells
US9394364B2 (en) 2011-04-19 2016-07-19 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Human monoclonal antibodies specific for glypican-3 and use thereof
US20140134720A1 (en) 2011-05-17 2014-05-15 Ucl Business Plc Method
US9833476B2 (en) 2011-08-31 2017-12-05 The Trustees Of Dartmouth College NKP30 receptor targeted therapeutics
US20150110760A1 (en) 2011-08-31 2015-04-23 Trustees Of Dartmouth College Nkp30 receptor targeted therapeutics
US20140378389A1 (en) 2011-09-15 2014-12-25 The United States Of America, As Represented By The Secretary, Dept. Of Health And Human Services T cell receptors recognizing hla-a1- or hla-cw7-restricted mage
WO2013039889A1 (en) 2011-09-15 2013-03-21 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services T cell receptors recognizing hla-a1- or hla-cw7-restricted mage
US20140227237A1 (en) 2011-09-16 2014-08-14 The Trustees Of The University Of Pennsylvania Rna engineered t cells for the treatment of cancer
US20140255363A1 (en) 2011-09-16 2014-09-11 Baylor College Of Medicine Targeting the tumor microenvironment using manipulated nkt cells
US9708384B2 (en) 2011-09-22 2017-07-18 The Trustees Of The University Of Pennsylvania Universal immune receptor expressed by T cells for the targeting of diverse and multiple antigens
US9175308B2 (en) 2011-10-07 2015-11-03 Mie University Chimeric antigen receptor
US9868774B2 (en) 2011-10-20 2018-01-16 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-CD22 chimeric antigen receptors
US20140274909A1 (en) 2011-10-20 2014-09-18 The Usa, As Represented By The Secretary, Department Of Health And Human Service Anti-cd22 chimeric antigen receptors
US9688740B2 (en) 2011-10-26 2017-06-27 National Cancer Center Mutant CTLA4 gene transfected T cell and composition including same for anticancer immunotherapy
US9226936B2 (en) 2011-10-28 2016-01-05 The Wistar of Anatomy and Biology Methods and compositions for enhancing the therapeutic effect of anti-tumor T cells
US9272002B2 (en) 2011-10-28 2016-03-01 The Trustees Of The University Of Pennsylvania Fully human, anti-mesothelin specific chimeric immune receptor for redirected mesothelin-expressing cell targeting
US9868951B2 (en) 2011-10-28 2018-01-16 The Wistar Institute Of Anatomy And Biology Methods and compositions for enhancing the therapeutic effect of anti-tumor T cells
US20140308259A1 (en) 2011-11-03 2014-10-16 The Trustees Of The University Of Pennsylvania Isolated b7-h4 specific compositions and methods of use thereof
US9279008B2 (en) 2011-11-03 2016-03-08 The Trustees Of The University Of Pennsylvania Isolated B7-H4 specific compositions and methods of use thereof
US9422351B2 (en) 2011-11-03 2016-08-23 The Trustees Of The University Of Pennsylvania Isolated B7-H4 specific compositions and methods of use thereof
US9790267B2 (en) 2011-11-08 2017-10-17 The Trustees Of The University Of Pennsylvania Glypican-3-specific antibody and uses thereof
US9447194B2 (en) 2012-02-13 2016-09-20 Seattle Children's Hospital Bispecific chimeric antigen receptors and encoding polynucleotides thereof
US9714278B2 (en) 2012-02-22 2017-07-25 The Trustees Of The University Of Pennsylvania Use of ICOS-based CARs to enhance antitumor activity and CAR persistence
US9783591B2 (en) 2012-02-22 2017-10-10 The Trustees Of The University Of Pennsylvania Use of the CD2 signaling domain in second-generation chimeric antigen receptors
US9359447B2 (en) 2012-03-23 2016-06-07 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-mesothelin chimeric antigen receptors
US9765342B2 (en) 2012-04-11 2017-09-19 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Chimeric antigen receptors targeting B-cell maturation antigen
US9156915B2 (en) 2012-04-26 2015-10-13 Thomas Jefferson University Anti-GCC antibody molecules
US9662405B2 (en) 2012-04-26 2017-05-30 Thomas Jefferson University Method of treating cancer by administering chimeric antigen receptor comprising anti-GCC antibody
US9790278B2 (en) 2012-05-07 2017-10-17 The Trustees Of Dartmouth College Anti-B7-H6 antibody, fusion proteins, and methods of using the same
US20150152181A1 (en) 2012-05-07 2015-06-04 The Trustees Of Dartmouth College Anti-b7-h6 antibody, fusion proteins, and methods of using the same
WO2013177247A1 (en) 2012-05-22 2013-11-28 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Murine anti-ny-eso-1 t cell receptors
US20140134142A1 (en) 2012-05-25 2014-05-15 Cellectis Multi-Chain Chimeric Antigen Receptor and Uses Thereof
US9409994B2 (en) 2012-06-01 2016-08-09 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services High-affinity monoclonal antibodies to glypican-3 and use thereof
US9725519B2 (en) 2012-06-08 2017-08-08 Kinki University Antibody against transporter and use thereof
WO2014011984A1 (en) 2012-07-13 2014-01-16 The Trustees Of The University Of Pennsylvania Toxicity management for anti-tumor activity of cars
US9572836B2 (en) 2012-07-13 2017-02-21 The Trustees Of The University Of Pennsylvania Methods for assessing the suitability of transduced T cells for administration
US9765156B2 (en) 2012-07-13 2017-09-19 The Trustees Of The University Of Pennsylvania Enhancing activity of CAR T cells by co-introducing a bispecific antibody
CN102775500A (en) 2012-08-03 2012-11-14 郑骏年 Chimeric antigen receptor iRGD-scFv (G250)-CD8-CD28-CD137-CD3zeta and application thereof
US20150306141A1 (en) * 2012-08-20 2015-10-29 Fred Hutchinson Cancer Resesarch Center Method and compositions for cellular immunotherapy
WO2014031687A1 (en) 2012-08-20 2014-02-27 Jensen, Michael Method and compositions for cellular immunotherapy
US9803022B2 (en) 2012-08-21 2017-10-31 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Mesothelin domain-specific monoclonal antibodies and use thereof
US9409992B2 (en) 2012-08-21 2016-08-09 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Mesothelin domain-specific monoclonal antibodies and use thereof
WO2014043441A1 (en) 2012-09-14 2014-03-20 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services T cell receptors recognizing mhc class ii-restricted mage-a3
US9416190B2 (en) 2012-09-27 2016-08-16 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Mesothelin antibodies and methods for eliciting potent antitumor activity
US9365641B2 (en) 2012-10-01 2016-06-14 The Trustees Of The University Of Pennsylvania Compositions and methods for targeting stromal cells for the treatment of cancer
WO2014055771A1 (en) 2012-10-05 2014-04-10 The Trustees Of The University Of Pennsylvania Human alpha-folate receptor chimeric antigen receptor
US9597357B2 (en) 2012-10-10 2017-03-21 Sangamo Biosciences, Inc. T cell modifying compounds and uses thereof
US20140120136A1 (en) 2012-10-12 2014-05-01 The Babraham Institute Mir-155 enhancement of cd8+ t cell immunity
WO2014068388A1 (en) 2012-10-29 2014-05-08 Glaxo Group Limited 2 substituted cephem compounds
US20170290900A1 (en) 2012-12-20 2017-10-12 Purdue Research Foundation Chimeric antigen receptor-expressing t cells as anti-cancer therapeutics
US20150320799A1 (en) 2012-12-20 2015-11-12 Purdue Research Foundation Chimeric antigen receptor-expressing t cells as anti-cancer therapeutics
WO2014100615A1 (en) 2012-12-20 2014-06-26 Purdue Research Foundation Chimeric antigen receptor-expressing t cells as anti-cancer therapeutics
US9511092B2 (en) 2013-01-28 2016-12-06 St. Jude Children's Research Hospital, Inc. Chimeric receptor with NKG2D specificity for use in cell therapy against cancer and infectious disease
US9688760B2 (en) 2013-02-08 2017-06-27 Amgen Research (Munich) Gmbh Anti-leukocyte adhesion for the mitigation of potential adverse events caused by CD3-specific binding domains
US20170340672A1 (en) 2013-02-15 2017-11-30 The Regents Of The University Of California Chimeric antigen receptor and methods of use thereof
US20150368342A1 (en) 2013-02-15 2015-12-24 The Regents Of The University Of California Chimeric antigen receptor and methods of use thereof
US9587020B2 (en) 2013-02-15 2017-03-07 The Regents Of The University Of California Chimeric antigen receptor and methods of use thereof
WO2014127261A1 (en) 2013-02-15 2014-08-21 The Regents Of The University Of California Chimeric antigen receptor and methods of use thereof
US9821012B2 (en) 2013-02-15 2017-11-21 The Regents Of The University Of California Chimeric antigen receptor and methods of use thereof
US9573988B2 (en) 2013-02-20 2017-02-21 Novartis Ag Effective targeting of primary human leukemia using anti-CD123 chimeric antigen receptor engineered T cells
US20140322212A1 (en) 2013-02-20 2014-10-30 Jennifer Brogdon Effective targeting of primary human leukemia using anti-cd123 chimeric antigen receptor engineered t cells
US9394368B2 (en) 2013-02-20 2016-07-19 Novartis Ag Treatment of cancer using humanized anti-EGFRvIII chimeric antigen receptor
US20140322275A1 (en) 2013-02-20 2014-10-30 Jennifer Brogdon TREATMENT OF CANCER USING HUMANIZED ANTI-EGFRvIII CHIMERIC ANTIGEN RECEPTOR
US9434935B2 (en) 2013-03-10 2016-09-06 Bellicum Pharmaceuticals, Inc. Modified caspase polypeptides and uses thereof
US9587237B2 (en) 2013-03-14 2017-03-07 Elwha Llc Compositions, methods, and computer systems related to making and administering modified T cells
US20140286987A1 (en) 2013-03-14 2014-09-25 Bellicum Pharmaceuticals, Inc. Methods for controlling t cell proliferation
US9402888B2 (en) 2013-03-14 2016-08-02 The Wistar Institute Of Anatomy And Biology Methods and compositions for treating cancer
US9499855B2 (en) 2013-03-14 2016-11-22 Elwha Llc Compositions, methods, and computer systems related to making and administering modified T cells
US9657105B2 (en) 2013-03-15 2017-05-23 City Of Hope CD123-specific chimeric antigen receptor redirected T cells and methods of their use
US9561291B2 (en) 2013-03-15 2017-02-07 Imre Kovesdi Methods of targeting T-cells to tumors
US9745368B2 (en) 2013-03-15 2017-08-29 The Trustees Of The University Of Pennsylvania Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
US20140286973A1 (en) 2013-03-15 2014-09-25 The Trustees Of The University Of Pennsylvania Chimeric antigen receptor specific for folate receptor beta
US9446105B2 (en) 2013-03-15 2016-09-20 The Trustees Of The University Of Pennsylvania Chimeric antigen receptor specific for folate receptor β
US20140322183A1 (en) 2013-03-15 2014-10-30 The Trustees Of The University Of Pennsylvania Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
US9393268B2 (en) 2013-03-15 2016-07-19 Thomas Jefferson University Cell-based anti-cancer compositions with reduced toxicity and methods of making and using the same
US20140271582A1 (en) 2013-03-15 2014-09-18 City Of Hope Cd123-specific chimeric antigen receptor redirected t cells and methods of their use
US20140271635A1 (en) 2013-03-16 2014-09-18 The Trustees Of The University Of Pennsylvania Treatment of cancer using humanized anti-cd19 chimeric antigen receptor
US9790282B2 (en) 2013-03-25 2017-10-17 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-CD276 polypeptides, proteins, and chimeric antigen receptors
US9629877B2 (en) 2013-05-14 2017-04-25 Board Of Regents, The University Of Texas System Human application of engineered chimeric antigen receptor (CAR) T-cells
US9873894B2 (en) 2013-05-15 2018-01-23 Sangamo Therapeutics, Inc. Methods and compositions for treatment of a genetic condition
US9701758B2 (en) 2013-05-24 2017-07-11 Board Of Regents, The University Of Texas System Anti-CD19 scFv (FMC63) polypeptide
US9855297B2 (en) 2013-05-29 2018-01-02 Cellectis Methods for engineering T cells for immunotherapy by using RNA-guided CAS nuclease system
US9890393B2 (en) 2013-05-29 2018-02-13 Cellectis Methods for engineering T cells for immunotherapy by using RNA-guided CAS nuclease system
US20160151465A1 (en) 2013-06-05 2016-06-02 Bellicum Pharmaceuticals, Inc. Methods for inducing partial apoptosis using caspase polypeptides
US9738726B2 (en) 2013-06-11 2017-08-22 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services HER2-specific monoclonal antibodies and conjugates thereof
US9828435B2 (en) 2013-06-25 2017-11-28 Vaccinex, Inc. Use of antibodies or antigen-binding fragments thereof that specifically bind semaphorin-4D to increase tumor infiltrating leukocyte frequency
US9808486B2 (en) 2013-08-30 2017-11-07 Board Of Regents, The University Of Texas System Administration of kynurenine depleting enzymes for tumor therapy
US9765142B2 (en) 2013-10-11 2017-09-19 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services TEM8 antibodies and their use in treatment and detection of tumors
WO2015057852A1 (en) 2013-10-15 2015-04-23 The California Institute For Biomedical Research Chimeric antigen receptor t cell switches and uses thereof
WO2015057834A1 (en) 2013-10-15 2015-04-23 The California Institute For Biomedical Research Peptidic chimeric antigen receptor t cell switches and uses thereof
US20150238631A1 (en) 2013-10-15 2015-08-27 The California Institute For Biomedical Research Chimeric antigen receptor t cell switches and uses thereof
US20150307564A1 (en) 2013-10-15 2015-10-29 The California Institute For Biomedical Research Peptidic chimeric antigen receptor t cell switches and uses thereof
US20150139943A1 (en) 2013-10-17 2015-05-21 National University Of Singapore Chimeric receptors and uses thereof in immune therapy
US10279047B2 (en) 2014-01-20 2019-05-07 University Of Utah Research Foundation Compositions and methods for modifying the surface of cells and methods of use
US9694033B2 (en) 2014-01-24 2017-07-04 The Cleveland Clinic Foundation IL-9 secreting CD8+ Tc9 cells and methods of treating cancer
US20160046700A1 (en) 2014-02-14 2016-02-18 Bellicum Pharmaceuticals, Inc. Methods for activating t cells using an inducible chimeric polypeptide
US9828399B2 (en) 2014-02-28 2017-11-28 The Royal Institution For The Advancement Of Learning/Mcgill University TC-PTP inhibitors as APC activators for immunotherapy
US9862775B2 (en) 2014-03-05 2018-01-09 Eutilex Co., Ltd. Monoclonal antibody which specifically recognizes B cell lymphoma and use thereof
US9796783B2 (en) 2014-03-05 2017-10-24 Cantargia Ab Anti human interleukin-1 receptor accessory protein (IL1 RAP) antibodies and uses thereof
US20150328292A1 (en) 2014-03-07 2015-11-19 Bellicum Pharmaceuticals, Inc. Caspase polypeptides having modified activity and uses thereof
US20150283178A1 (en) 2014-04-07 2015-10-08 Carl H. June Treatment of cancer using anti-cd19 chimeric antigen receptor
WO2015164594A1 (en) 2014-04-23 2015-10-29 Board Of Regents, The University Of Texas System Chimeric antigen receptors (car) for use in therapy and methods for making the same
US9885021B2 (en) 2014-06-12 2018-02-06 Children's National Medical Center Generation of broadly-specific, virus-immune cells targeting multiple HIV antigens for preventive and therapeutic use
US20160051651A1 (en) 2014-07-21 2016-02-25 The Trustees Of The University Of Pennsylvania Treatment of cancer using a cll-1 chimeric antigen receptor
US20160096892A1 (en) 2014-07-21 2016-04-07 The Trustees Of The University Of Pennsylvania Treatment of cancer using a cd33 chimeric antigen receptor
US20160046724A1 (en) 2014-07-21 2016-02-18 The Trustees Of The University Of Pennsylvania Treatment of cancer using humanized anti-bcma chimeric antigen receptor
US9777061B2 (en) 2014-07-21 2017-10-03 Novartis Ag Treatment of cancer using a CD33 chimeric antigen receptor
US9562087B2 (en) 2014-08-08 2017-02-07 The Board Of Trustees Of The Leland Stanford Junior University High affinity PD-1 agents and methods of use
WO2016025322A1 (en) 2014-08-09 2016-02-18 Purdue Research Foundation Design and development of neurokinin-1 receptor-binding agent delivery conjugates
US9815901B2 (en) 2014-08-19 2017-11-14 Novartis Ag Treatment of cancer using a CD123 chimeric antigen receptor
US20160068601A1 (en) 2014-08-19 2016-03-10 The Trustees Of The University Of Pennsylvania Treatment of cancer using a cd123 chimeric antigen receptor
US20160058857A1 (en) 2014-09-02 2016-03-03 Bellicum Pharmaceuticals, Inc. Costimulation of chimeric antigen receptors by myd88 and cd40 polypeptides
US20160340649A1 (en) 2014-09-19 2016-11-24 City Of Hope Costimulatory Chimeric Antigen Receptor T Cells Targeting IL13Rx2
WO2016054520A2 (en) 2014-10-03 2016-04-07 The California Institute For Biomedical Research Engineered cell surface proteins and uses thereof
US9492499B2 (en) 2014-10-14 2016-11-15 Riptide Bioscience, Inc. Peptides having anti-inflammatory properties
US9879087B2 (en) 2014-11-12 2018-01-30 Siamab Therapeutics, Inc. Glycan-interacting compounds and methods of use
US20160136190A1 (en) 2014-11-17 2016-05-19 Cellectar Biosciences, Inc. Phospholipid Ether Analogs as Cancer-Targeting Drug Vehicles
US9650428B2 (en) 2014-12-02 2017-05-16 Roger Williams Hospital Methods and compositions for treating cancer
US20160175359A1 (en) 2014-12-15 2016-06-23 Bellicum Pharmaceuticals, Inc. Methods for controlled activation or elimination of therapeutic cells
US20160166613A1 (en) 2014-12-15 2016-06-16 Bellicum Pharmaceuticals, Inc. Methods for controlled elimination of therapeutic cells
WO2016098078A2 (en) 2014-12-19 2016-06-23 Novartis Ag Dimerization switches and uses thereof
WO2016102965A1 (en) 2014-12-24 2016-06-30 Ucl Business Plc Cell
US20190161531A1 (en) 2014-12-24 2019-05-30 Ucl Business Plc Cell
US9765330B1 (en) 2015-01-09 2017-09-19 Nant Holdings Ip, Llc Compositions and methods for reduction of allograft recognition and rejection
US9670281B2 (en) 2015-02-24 2017-06-06 The Regents Of The University Of California Binding-triggered transcriptional switches and methods of use thereof
US9572837B2 (en) 2015-03-02 2017-02-21 Innovative Cellular Therapeutics CO., LTD. Reducing immune tolerance induced by PD-L1
US9777064B2 (en) 2015-03-17 2017-10-03 Chimera Bioengineering, Inc. Smart CAR devices, DE CAR polypeptides, side CARs and uses thereof
WO2016149665A1 (en) 2015-03-18 2016-09-22 Baylor College Of Medicine Her2/erbb2 chimeric antigen receptor
US9717745B2 (en) 2015-03-19 2017-08-01 Zhejiang DTRM Biopharma Co. Ltd. Pharmaceutical compositions and their use for treatment of cancer and autoimmune diseases
US9802997B2 (en) 2015-03-27 2017-10-31 Immatics Biotechnologies Gmbh Peptides and combination of peptides for use in immunotherapy against various tumors
US9862756B2 (en) 2015-03-27 2018-01-09 Immatics Biotechnologies Gmbh Peptides and combination of peptides for use in immunotherapy against various tumors
US9840548B2 (en) 2015-03-27 2017-12-12 Immatics Biotechnologies Gmbh Peptides and combination of peptides for use in immunotherapy against various tumors
WO2016168766A1 (en) 2015-04-15 2016-10-20 The California Institute For Biomedical Research Optimized chimeric receptor t cell switches and uses thereof
WO2016168769A1 (en) 2015-04-15 2016-10-20 The California Institute For Biomedical Research Chimeric receptor t cell switches for her2
US9574014B2 (en) 2015-05-15 2017-02-21 City Of Hope Chimeric antigen receptor compositions
US9636388B2 (en) 2015-05-19 2017-05-02 Morphogenesis, Inc. Multi-indication mRNA cancer immunotherapy
US9855298B2 (en) 2015-05-28 2018-01-02 Kite Pharma, Inc. Methods of conditioning patients for T cell therapy
WO2016201300A1 (en) 2015-06-12 2016-12-15 Immunomedics, Inc. Disease therapy with chimeric antigen receptor (car) constructs and t cells (car-t) or nk cells (car-nk) expressing car constructs
US20160361360A1 (en) 2015-06-12 2016-12-15 Immunomedics, Inc. Disease therapy with chimeric antigen receptor (car) constructs and t cells (car-t) or nk cells (car-nk) expressing car constructs
WO2016210447A1 (en) 2015-06-26 2016-12-29 University Of Southern California Masking chimeric antigen receptor t cells for tumor-specific activation
WO2017029512A1 (en) 2015-08-20 2017-02-23 Autolus Ltd Chimeric cytokine receptor
WO2017029511A1 (en) 2015-08-20 2017-02-23 Autolus Ltd Cell
US9790467B2 (en) 2015-09-22 2017-10-17 Qt Holdings Corp Methods and compositions for activation or expansion of T lymphocytes
US9889161B2 (en) 2015-10-05 2018-02-13 Precision Biosciences, Inc. Genetically-modified cells comprising a modified human T cell receptor alpha constant region gene
US9889160B2 (en) 2015-10-05 2018-02-13 Precision Biosciences, Inc. Genetically-modified cells comprising a modified human T cell receptor alpha constant region gene
WO2017068360A1 (en) 2015-10-23 2017-04-27 Autolus Ltd Receptor
WO2017068361A1 (en) 2015-10-23 2017-04-27 Autolus Ltd Cell
US9834545B2 (en) 2015-11-19 2017-12-05 Chemocentryx, Inc. Modulators of chemokine receptors
US9809581B2 (en) 2015-11-19 2017-11-07 Chemocentryx, Inc. Inhibitors of CXCR2
US20170166877A1 (en) 2015-12-14 2017-06-15 Bellicum Pharmaceuticals, Inc. Dual controls for therapeutic cell activation or elimination
US9849092B2 (en) 2015-12-21 2017-12-26 Gholam A. Peyman Early cancer detection and enhanced immunotherapy
US20170306303A1 (en) 2016-01-08 2017-10-26 The Regents Of The University Of California Conditionally active heterodimeric polypeptides and methods of use thereof
US9856497B2 (en) 2016-01-11 2018-01-02 The Board Of Trustee Of The Leland Stanford Junior University Chimeric proteins and methods of regulating gene expression
WO2017137759A1 (en) 2016-02-12 2017-08-17 Autolus Limited Signalling system
WO2017137758A1 (en) 2016-02-12 2017-08-17 Autolus Limited Signalling system
WO2017143094A1 (en) 2016-02-16 2017-08-24 Dana-Farber Cancer Institute, Inc. Immunotherapy compositions and methods
US9663756B1 (en) 2016-02-25 2017-05-30 Flodesign Sonics, Inc. Acoustic separation of cellular supporting materials from cultured cells
WO2017165245A2 (en) 2016-03-19 2017-09-28 F1 Oncology, Inc. Methods and compositions for transducing lymphocytes and regulated expansion thereof
US20170356010A1 (en) 2016-03-19 2017-12-14 F1 Oncology, Inc. Methods and compositions for transducing lymphocytes and regulating the activity thereof
WO2017165571A1 (en) 2016-03-22 2017-09-28 Seattle Children's Hospital (dba Seattle Children's Research Institute) Early intervention methods to prevent or ameliorate toxicity
WO2017177149A2 (en) 2016-04-08 2017-10-12 Purdue Research Foundation Methods and compositions for car t cell therapy
WO2017180587A2 (en) 2016-04-11 2017-10-19 Obsidian Therapeutics, Inc. Regulated biocircuit systems
WO2017216561A1 (en) 2016-06-16 2017-12-21 Autolus Limited Chimeric antigen receptor
WO2017216562A1 (en) 2016-06-16 2017-12-21 Autolus Limited Tunable chimeric antigen receptors
US9567399B1 (en) 2016-06-20 2017-02-14 Kymab Limited Antibodies and immunocytokines
US20190292517A1 (en) 2016-07-13 2019-09-26 President And Fellows Of Harvard College Antigen-presenting cell-mimetic scaffolds and methods for making and using the same
WO2018013797A1 (en) 2016-07-13 2018-01-18 President And Fellows Of Harvard College Antigen-presenting cell-mimetic scaffolds and methods for making and using the same
US9642906B2 (en) 2016-09-16 2017-05-09 Baylor College Of Medicine Generation of HPV-specific T-cells
US20190209611A1 (en) 2016-10-20 2019-07-11 Miltenyi Biotec Gmbh Chimeric antigen receptor specific for tumor cells
WO2018111763A1 (en) 2016-12-12 2018-06-21 Seattle Children's Hospital (dba Seattle Children's Research Institute) Chimeric transcription factor variants with augmented sensitivity to drug ligand induction of transgene expression in mammalian cells
WO2018111834A1 (en) 2016-12-13 2018-06-21 Seattle Children's Hospital (dba Seattle Children's Research Institute) Methods of exogenous drug activation of chemical-induced signaling complexes expressed in engineered cells in vitro and in vivo
US20190388468A1 (en) 2016-12-15 2019-12-26 Miltenyi Biotec Gmbh Immune cells expressing an antigen binding receptor and a chimeric costimulatory receptor
WO2018115146A1 (en) 2016-12-21 2018-06-28 Danmarks Tekniske Universitet Antigen presenting scaffolds for immune-cell manipulation
WO2018148224A1 (en) 2017-02-07 2018-08-16 Seattle Children's Hospital (dba Seattle Children's Research Institute) Phospholipid ether (ple) car t cell tumor targeting (ctct) agents
US20230322925A1 (en) * 2017-02-07 2023-10-12 Seattle Children’S Hospital (Dba Seattle Children’S Research Institute) Phospholipid ether (ple) car t cell tumor targeting (ctct) agents
US11649288B2 (en) * 2017-02-07 2023-05-16 Seattle Children's Hospital Phospholipid ether (PLE) CAR T cell tumor targeting (CTCT) agents
US20200087399A1 (en) 2017-02-07 2020-03-19 Seattle Children's Hospital (dba Seattle Children's Research Institute) Phospholipid ether (ple) car t cell tumor targeting (ctct) agents
WO2018152451A1 (en) 2017-02-17 2018-08-23 Purdue Research Foundation Targeted ligand-payload based drug delivery for cell therapy
WO2018160622A1 (en) 2017-02-28 2018-09-07 Endocyte, Inc. Compositions and methods for car t cell therapy
WO2019060425A1 (en) 2017-09-19 2019-03-28 Massachusetts Institute Of Technology Compositions for chimeric antigen receptor t cell therapy and uses thereof
US20190224237A1 (en) 2018-01-22 2019-07-25 Seattle Children's Hospital (dba Seattle Children's Research Institute) Methods of use for car t cells
US11311576B2 (en) * 2018-01-22 2022-04-26 Seattle Children's Hospital Methods of use for CAR T cells
US20220257652A1 (en) * 2018-01-22 2022-08-18 Seattle Children's Hospital (dba Seattle Children's Research Institute) Methods of use for car t cells
US20190255109A1 (en) * 2018-01-22 2019-08-22 Endocyte, Inc. Methods of use for car t cells
US11779602B2 (en) * 2018-01-22 2023-10-10 Endocyte, Inc. Methods of use for CAR T cells
WO2019156795A1 (en) 2018-02-06 2019-08-15 Seattle Children's Hospital (dba Seattle Children's Research Institute) Fluorescein-specific cars exhibiting optimal t cell function against fl-ple labelled tumors
US20210317407A1 (en) * 2018-08-06 2021-10-14 Seattle Children's Hospital (dba Seattle Children's Research Institute) Methods and compositions for stimulation of chimeric antigen receptor t cells with hapten labelled cells
US20220125841A1 (en) * 2019-03-13 2022-04-28 Seattle Children's Hospital (dba Seattle Children'a Research Institute) Sodium fluorescein as a reversal agent for an anti-fluorescein car t cells and fluorescein-phospholipid-ethers or profluorescein-phospholipid-ethers
US20220280648A1 (en) * 2019-07-05 2022-09-08 Purdue Research Foundation Design and efficient synthesis of lipid-fluorescein conjugates for car-t cell therapy
US20230172981A1 (en) * 2020-02-04 2023-06-08 Seattle Children's Hospital (dba Seattle Children's Research Institute) Methods and compositions for stimulation of chimeric antigen receptor t cells with hapten labelled cells

Non-Patent Citations (358)

* Cited by examiner, † Cited by third party
Title
Abken, H. et al. Chimeric T-Cell Receptors: Highly Specific Tools to Target Cytotoxic T-Lymphocytes to Tumour Cells, Cancer Treatment Reviews (1997); 23:97-112.
Abken, H., et al., Tuning tumor-specific T-cell activation: a matter of costimulation? Trends in Immunology vol. 23 No. 5 May 2002: 240-45.
Abstracts for the 26th Annual Scientific Meeting of the Society for Immunotherapy of Cancer (SITC), J Immunother., vol. 34, No. 9, Nov.-Dec. 2011 (62 pp.).
Airenne et al., Recombinant avidin and avidin-fusion proteins , Biomolecular Engineering16 (1999) 87-92.
Alcover et al., A soluble form of the human CD8 alpha chain expressed in the baculovirus system: Biochemical characterization and binding to MHC Class I , Molecular Immunology, vol. 30, No. 1, pp. 55-67, 1993.
Alexander et al., Indoleamine 2,3-Dioxygenase Expression in Transplanted NOD Islets Prolongs Graft Survival After Adoptive Transfer of Diabetogenic Splenocytes, Diabetes2002, vol. 51 pp. 356-365.
Alonso-Camino et al. CARbodies: Human Antibodies Against Cell Surface Tumor Antigens Selected From Repertoires Displayed on T Cell Chimeric Antigen Receptors. (2013) Mol Ther Nucl Acids 2, e93 (11 pages).
Altenschmidt, U. et al. Adoptive transfer of in vitro-targeted, activated T lymphocytes results in total tumor regression, J. Immunol. (1997); 159:5509-15.
Altenschmidt, U., et al., Specific cytotoxic T lymphocytes in gene therapy, J. Mol. Med. (1997); 75, 259-266.
Altschul et al., "Local Alignment Statistics, [27] Multiple Alignment and Phylogenetic Trees," Methods in Enzymology (1996) 266:460-480.
Altschul, S. et al., Basic local alignment search tool, J. Mol. Bio., 1990, 215, 403-410.
Altvater, B., et al., 284 (CD244) Signaling by Recombinant Antigen-specific Chimeric Receptors Costimulates Natural Killer Cell Activation to Leukemia and Neuroblastoma Cells , Clin Cancer Res 2009;15(15) Aug. 1, 2009: 4857-66.
Alvarez-Vallina, L. et al., Antigen-specific targeting of CD28-mediated T cell co-stimulation using chimeric single-chain antibody variable fragment-CD28 receptors, Eur. J. Immunol, 1996, 26, 2304-2309.
Amin et al., The Eighth Edition AJCC Cancer Staging Manual: Continuing to Build a Bridge From a Population-Based to a More Personalized Approach to Cancer Staging, CA Cancer J Clin (2017) vol. 67, No. 2, pp. 93-99.
An et al., IgG2m4, an engineered antibody isotype with reduced Fc function, mAbs 2009, Landes Bioscience, 1:6, 572-579.
Ang et al., Generating a Chimeric Antigen Receptor to Redirect T-Cell Specificity after Infusion , Molecular Therapy vol. 19, Supplement 1, May 2011, S137-S138.
Arch, R, et al., 4-1BB and Ox40 Are Members of a Tumor Necrosis Factor (TNF)-Nerve Growth Factor Receptor Subfamily That Bind TNF Receptor-Associated Factors and Activate Nuclear Factor kB, Molecular and Cellular Biology (1998); 558-565.
Aruffo, A, et al., Molecular cloning of a CD28 cDNA by a high-efficiency COS cell expression system, Proc. Nati. Acad. Sci. USA (1987); 84: 8573-8577.
Baba et al., N-Linked Carbohydrate on Human Leukocyte Antigen-C and Recognition by Natural Killer Cell Inhibitory Receptors , Human Immunology 61, 1202-1218 (2000).
Baiu et al. (Published online Jul. 26, 2017) Targeted Molecular Radiotherapy of Pediatric Solid Tumors Using a Radioiodinated Alkyl-Phospholipid Ether Analog. J Nucl Med 2018; 59: 244-250. *
Baniyash et al., The T Cell Antigen Receptor Zeta Chain is Tyrosine Phosphorylated open Activation the Journal of Biological Chemistry, vol. 263, No. 34, Issue of Dec. 5, pp. 18225-18230.
Barber, et al., Chimeric NKG2D Receptor-Expressing T Cells as an Immunotherapy for Multiple Myeloma, Exp Hematol. (Oct. 2008); 36(10):1318-28.
Barocas et al., A population-based study of renal cell carcinoma and prostate cancer in the same patients, BJU International, (2006) 97(1): 33-36.
Barrett et al., Chimeric Antigen Receptor Therapy for Cancer Annual Review of Medicine vol. 65: 333-347 (2014).
Bauer et al., Activation of NK Cells and T Cells by NKG2D, a Receptor for Stress-Inducible MICA, Science 1999, vol. 285 pp. 727-729.
Bauer, A, et al., Differential signal transduction via T-cell receptor CD3′2, CD3C-,v,and CD3′q2 isoforms, Proc. Nati. Acad. Sci. USA (1991); 88: 3842-3846.
Baum et al. Retrovirus vectors: toward the plentivirus? (2006) Molecular Therapy: The Journal of the American Society of Gene Therapy. 13:1050-1063.
Becker, M. L. B., et al., Expression of a hybrid immunoglobulin-T cell receptor protein in transgenic mice, Cell (1989); 58:911-921.
Bedzyk, WD et al., Active site structure and antigen binding properties of idiotypically cross-reactive anti-fluorescein monoclonal antibodies, J Biol Chem., 1990, 265, 133-138.
Bejcek, B, et al., Development and Characterization of Three Recombinant Single Chain Antibody Fragments (scFvs) Directed against the CD19 Antigen1, Cancer Research55, (1995); 2346-2351.
Berg et al., Section 3.2 Primary Structure: Amino Acids Are Linked by Peptide Bonds to Form Polypeptide Chains Biochemistry. 5th Ed. New York. W.H. Freeman; 2002, pp. 1-16.
Berger et al., Feb. 2015, Safety of targeting ROR1 in primates with chimeric antigen receptor modified T cells, Cancer Immunology Research, 3(2):206-216.
Berger, C., et al., Analysis of trans gene-specific immune responses that limit the in vivopersistence of adoptively transferred HSV-TK-modified donor T cells after allogeneic hematopoietic cell transplantation. Blood, 2006, 107(6): p. 2294-302.
Bio-Rad 2016, The T Cell Marker, CD3 Antigen and Antibodies, retrieved on May 4, 2024 from the Internet: <URL: https://www.bio-rad-antibodies.com/static/2016/innate/the-t-cell-marker-cd3-antigen-and-antibodies.pdf>, 5 pp.
Bluemel, C., et al., Epitope distance to the target cell membrane and antigen size determine the potency of T cell-mediated lysis by BiTE antibodies specific for a large melanoma surface antigen. Cancer Immunol Immunother (2010); 59(8): 1197-209.
Boder et al., Directed evolution of antibody fragments with monovalent femtomolar antigen-binding affinity, PNAS (Sep. 26, 2000) vol. 97, No. 20, pp. 10701-10705.
Bolhuis, R. L. et al. Preparation for a phase I/II study using autologous gene modified T lymphocytes for treatment of metastatic renal cancer patients., Adv. Exp. Med. Biol. (1998); 451:547-55.
Boomer et al., Cutting Edge: A Double-Mutant Knockin of the CD28 YMNM and PYAP Motifs Reveals a Critical Role for the YMNM Motif in Regulation of T Cell Proliferation andBcl-x L Expression The Journal of Immunology. 2014; 192, pp. 3465-3469.
Boomer, J, et al.,, An Enigmatic Tail of CD28 Signaling, Washington University School of Medicine (2010); 1-20.
Boursier et al., Evidence for an Extended Structure of the T-cell Co-receptor CD8α as Deduced from the Hydrodynamic Properties of Soluble Forms of the Extracellular Region*, The Journal of Biological Chemistry 1993, vol. 268, No. 3, Issue of Jan. 25, pp. 2013-2020.
Brennan et al., Carbohydrate Recognition by a Natural Killer Cell Receptor, Ly-49C*, The Journal of Biological Chemistry 1995, vol. 270, No. 17, Issue of Apr. 28, pp. 9691-9694.
Brentjens et al., CD19-targeted T cells rapidly induce molecular remissions in adults with chemotherapy-refractory acute lymphoblastic leukemia. Sci Transl Med. 2013 5(177)ra38 (11 pages).
Brentjens, et al., Eradication of systemic B-cell tumors by genetically targeted human T lymphocytes co-stimulated by CD80 and interleukin-15, Nat. Med. (2003); 9: 279-286.
Bruhns et al., Differential Roles of N- and C-Terminal Immunoreceptor Tyrosine-Based Inhibition Motifs During Inhibition of Cell Activation by Killer Cell Inhibitory Receptors, The Journal of Immunology 1999; 162:3168-3175.
Bukczynski et al., Costimulatory ligand 4-1 BBL (CD137L) as an efficient adjuvant of human antiviral cytotoxic T cell responses, Proc. Natl. Acad. Sci. USA, 2004, 101:1291-1296.
Cambier, et al., Antigen and Fc receptor signaling. The awesome power of the immunoreceptor tyrosine-based activation motif (ITAM), J Immunol. (Oct. 1, 1995); 155(7):3281-5.
Camerini, D, et al.,. The T cell activation antigen CD27 is a member of the nerve growth factor/tumor necrosis factor receptor gene family, The Journal of Immunology (1991);3165-3169.
Cameron, B.J., et al., Identification of a Titin-Derived HLA-A1-Presented Peptide as a Cross-Reactive Target for Engineered MAGE A3-Directed T Cells, Sci Transl Med (Aug. 7, 2013); 5(197): 197ra103 (11 pages).
Canfield et al., The Binding Affinity of Human IgG for its High Affinity Fc Receptor is Determined by Multiple Amino Acids in the CH2 Domain and Is Modulated by the Hinge Region, J. Exp. Med. 1991, vol. 173 pp. 1483-1491.
Cannons et al., 4-1BB ligand induces cell division, sustains survival, and enhances effector function of CD4 and CD8 T cells with similar efficacy, J Immunol. Aug. 2001, 167(3): 1313-1324.
Carlens et al. Ex vivo T lymphocyte expansion for retroviral transduction: influence of serum-free media on variations in cell expansion rates and lymphocyte subset distribution. (2000) Exp Hernatol 28(10): 1137-46.
Cartellieri, M. et al., Chimeric antigen receptor-engineered T cells for immunotherapy of cancer, J. Biomedicine and Biotechnology, 2010, Article ID 956304, 13 pages.
Caruana et al., 2013, Boosting in vivo CAR-redirected virus-specific CTLs with universal-artificial antigen presenting cells, Blood, 122(21):4204.
Cavalieri et al. Human T lymphocytes transduced by lentiviral vectors in the absence of TCR activation maintain an intact immune competence. (2003) Blood. 102(2): 497-505.
Chalupny et al., T-cell activation molecule 4-1BB binds to extracellular matrix proteins, Proc. Natl. Acad. Sci., USA, 89: 103360-10364 (Nov. 1992).
Chang et al., A Chimeric Receptor with NKG2D Specificity Enhances Natural Killer Cell Activation and Killing of Tumor Cells , Cancer Res 2013;73:1777-1786. Published online Jan. 9, 2013.
Cheadle et al., Chimeric antigen receptors for T-cell based therapy Methods Mol Biol. 2012; 907:645-66.
Chen et al. Fusion protein linkers: property, design and functionality, Adv Drug Deliv Rev.(2013); 65: 1357-1369 (Epub Sep. 29, 2012).
Cheng et al., Mar. 26, 2004, Hapten-directed targeting to single-chain antibody receptors, Cancer Gene Therapy, 11(5):380-388.
Cho C. Rapid identification of cytokine release syndrome after haploidentical PBSC transplantation and successful therapy with tocilizumab. Bone Marrow Transplant. Dec. 2016;51(12):1620-1621, Epub Sep. 26, 2016.
Cho et al., Macromolecular versus small-molecule therapeutics: drug discovery, development and clinical considerations TIBTECH, vol. 14, May 1996, pp. 153-158.
Chothia et al., December 1989, Conformations of immunoglobulin hypervariable regions, Nature, 342:877-883.
Cohen et al. Recognition of fresh human tumor by human peripheral blood lymphocytes transduced with a bicistronic retroviral vector encoding a murine anti-p53 TCR (2005) J Immunol. 175:5799-5808.
Colcher, D. et al. In vivo tumor targeting of a recombinant single-chain antigen-binding protein., J. Nat. Cancer Inst. (1990); 82:1191-1197.
Cole et al., The molecular determinants of CD8 co-receptor function , 2012, Immunology, 137, 139-148.
Common Terminology Criteria for Adverse Events (CTCAE), National Cancer Institute Common Toxicity Criteria version 4.03 (NCI-CTCAE v4.03 (2010) (196 pages).
Cooper et al. T-cell clones can be rendered specific for CD19: toward the selective augmentation of the graft-versus-B-lineage leukemia effect (2003) Blood. 101(4): 1637-1644.
Cooper et al., Enhanced antilymphoma efficacy of CD19-redirected influenza MP1—specific CTLs by cotransfer of T cells modified to present influenza MP1, Blood 2005, vol. 105 No. 4 pp. 1622-1631.
Cordaro, T. A et al. Tumor size at the time of adoptive transfer determines whether tumor rejection occurs, Eur. J. Immunol. (2000); 30: 1297-1307.
Croft, M., The role of TNF superfamily members in T-cell function and diseases Nature Reviews, Immunology, vol. 9, Apr. 2009, pp. 271-285.
Dall, Peter et al., In vivo cervical cancer growth inhibition by genetically engineered cytotoxic T cells. Cancer Immunol. Immunother. (Jan. 2005); 54(1):51-60.
Darcy, P. K. et al., Expression in cytotoxic T lymphocytes of a single-chain anti-carcinoembryonic antigen antibody, Redirected Fas ligand-mediated lysis of colon carcinoma, Eur. J. Immunol. (1998); 28:1663-72.
Davila M. L. et al: Efficacy and toxicity management of 19-28z CAR T cell therapy in B cell acute lymphoblastic leukemia Sci Transl Med. Feb. 19, 2014;6(224):224-25.
Davila Marco L. et al: CD19-Targeted T Cells for Hematologic Malignancies Clinical Experience to Date , Cancer Journal, vol. 21, No. 6, Jan. 1, 2015 (Jan. 1, 2015),pp. 470-474.
Debelouchina et al., A molecular engineering toolbox for the structural biologist Quarterly Reviews of Biophysics, 2017, 50, e7, pp. 1-41.
Deming et al., Oct. 6, 2014, Phospholipid ether analogs for the detection of colorectal tumors. PLOS One, 9(10):e109668.
Deng et al., 2019, Antitumor activity of NKG2D CAR-T cells against human colorectal cancer cells in vitro and in vivo, Am J. Cancer Res, 9(5):945-958.
Diefenbach et al., The innate immune response to tumors and its role in the induction of T-cell immunity, Immunological Reviews 2002, vol. 188: 9-21.
Dissanayake et al., Mar. 19, 2014, Peptide-pulsed dendritic cells have superior ability to induce immune-mediated tissue destruction compared to peptide with adjuvant. PLOS One, 9(3):e92380, 10 pp.
Dotti, et al. Design and development of therapies using chimeric antigen receptor-expressing T cells. Immun Rev (Jan. 2014); 257(1): 107-126.
Dubrovska, A., et al., A chemically induced vaccine strategy for prostate cancer, ACS Chem Biol (2011); 6(11): 1223-31.
Duncan et al., Localization of the binding site for the human high-affinity Fc receptor onlg G, Nature 1998, vol. 332 pp. 563-564.
Elsaid et al. Enhanced Radiosensitivity in Solid Tumors using a Tumor-selective Alkyl Phospholipid Ether Analog. Mol Cancer Ther. Nov. 2018; 17(11): 2320-2328. *
Ertl, H. C. et al., Considerations for the clinical application of chimeric antigen receptor T cells: observations from a recombinant DNA advisory committee symposium held Jun. 15, 2010, Cancer Res., 2011, 71, 3175-3181.
Eshhar, et al., Design of Cytotoxic T Lymphocytes with Antibody-Type Specificity against Tumor Cells Using Chimeric TcR, Journal of Cellular Biochemistry, Supplement 14B, UCLA Symposia on Molecular & Cellular Biology, Abstracts, 19th Annual Meeting, Jan. 27-Feb. 8, 1990, p. 70.
Eshhar, Z., et al., Functional expression of chimeric receptor genes in human T cells, J. Immunol. Meth. (2001); 248: 67-76.
Fang et al., Jul. 17, 2013, Lipid-insertion enables targeting functionalization of erythrocyte membrane- cloaked nanoparticles, Nanoscale, 5(19): 8884-8888.
Fedorov VD, et al., PD-1- and CTLA-4-based inhibitory chimeric antigen receptors (ICARs) divert off—target immunotherapy responses, Sci Transl Med. (Dec. 11, 2013);5(215):215ra172 (12 pages).
Feng et al., Convergence on a Distinctive Assembly Mechanism by Unrelated Families of Activating Immune Receptors , Immunity, vol. 22, 427-438, Apr. 2005.
Feng et al., The Assembly of Diverse Immune Receptors is Focused on a Polar Membrane-Embedded Interaction Site , 2006. PLoS Biol 4(5):e142.
Ferrone, S., et al., How much longer will tumor cells fool the immune system, Immunol. Today (2000); 21: 70-72.
Figini, M, et al., Conversion of murine antibodies to human antibodies and their optimization for ovarian cancer therapy targeted to the folate receptor, Cancer ImmunolImmunother (Apr. 2009); 58(4):531-46 (Epub Aug. 15, 2008).
Foell et al., CD137-mediated T cell co-stimulation terminates existing autoimmune disease in SLE-prone NZB/NZW F1 mice., Ann N Y Acad Sci. Apr. 2003; 987:230-5.
Frecha et al. Advances in the field of lentivector-based transduction of T and B lymphocytes for gene therapy (2010) Molecular Therapy: The Journal of the American Society of Gene Therapy. 18:1748-1757.
Frost et al., In Vitro Evaluation of Avidin Antibody Pretargeting Using 211At-Labeled andBiotinylated Poly-L-Lysine as Effector Molecule*, Cancer 2010, Cancer Therapy With Antibodies and Immunoconjugates, Supplement to Cancer, pp. 1101-1110.
Fujita, K. et al., Prolonged disease-free period in patients with advanced epithelial ovarian cancer after adoptive transfer of tumor-infiltrating lymphocytes. Clin. Cancer Res., 1995, 1, 501-507.
Gargalionis et al., The molecular rationale of Src inhibition in colorectal carcinomas, Int. J.Cancer, 134:2019-2029 (2013).
Gargett, T., et al., GD2-specific CART Cells Undergo Potent Activation and Deletion Following Antigen Encounter but can be Protected From Activation-induced Cell Death by PD-1 Blockade. Mol Ther, 2016. 24(6): p. 1135-49.
Gilboa, E., How tumors escape immune destruction and what we can do about it, Cancer Immunol. Immunother. (1999); 48: 382-385.
Gilham et al., CAR-T cells and solid tumors: tuning T cells to challenge an inveterate foe, Trends in Molecular Medicine (2012); 18(7): 377-384 (Epub May 19, 2012).
Gilham et al., Primary polyclonal human T lymphocytes targeted to carcino-embryonicantigens and neural cell adhesion molecule tumor antigens by CD3zeta-based chimeric immune receptors, J. Immunother, (Mar.-Apr. 2000); 25 (2): 139-151.
Gillies, S.D. et al., Targeting Human Cytotoxic T Lymphocytes to Kill Heterologous Epidermal Growth Factor Receptor-Bearing Tumor Cells, The Journal of Immunology (1991); 146(3): 1067-1071.
Gong, M. C., et al., Prostate-specific membrane antigen (PSMA)-specific monoclonal antibodies in the treatment of prostate and other cancers, Cancer Metastasis Rev. (1999); 18: 483-490.
Gonzalez et al., Genetic engineering of cytolytic T lymphocytes for adoptive T-cell therapy of neuroblastoma, The Journal of Gene Medicine (Jun. 2004) vol. 6, Issue 6, 704-711.
Goverman, J. et al., Chimeric immunoglobulin-T cell receptor proteins form functional receptors: implications for T cell receptor complex formation and activation, Cell (1990); 60:929-939.
Greenfield, E. A, Nguyen, K. A & Kuchroo, V. K. CD28/B7 co-stimulation: a review. Crit. Rev. Immunol. 18, 389-41 8 (1998).
Griffiths et al., The Nature of DNA Modern Genetic Analysis. New York: W.H. Freeman; 1999, pp. 1-11.
Grosenbach et al., A recombinant vector expressing transgenes for four T-cell costimulatory molecules (OX40L, B7-1, ICAM-1, LFA-3) induces sustained CD4+ and CD8+ T-cell activation, protection from apoptosis, and enhanced cytokine production, Cellular Immunology 222 (2003) 45-57.
Gross et al., Development and study of chimeric immunoglobulin/T cell receptor molecules as functional receptors that endow T cells with antibody-type specificity, Ph.D. Thesis presented to the Feinberg Graduate School, The Wiezmann Institute of Science, Rehovot, Israel (1990); 1-70.
Gross, G. et al., Endowing T cells with antibody specific using chimeric T cell receptors, Department of Chemical Immunology, FASEB J. (Dec. 1992); 6(15):3370-8.
Gross, G. et al., Expression of immunoglobuling-T-cell receptor chimeric molecules as functional receptors with antibody-type specificity, Proc. Natl. Acad. Sci., 1989, 86, 10024-10028.
Gross, G. et al., Generation of effector T cells expressing chimeric T cell receptor with antibody type-specificity, Transplant. Proc. (1989); 21 (1 Pt 1):127-130.
Grupp et al., Chimeric Antigen Receptor-Modified T Cells for Acute Lymphoid Leukemia, N. Engl. J. Med. (Apr. 18, 2013) 368(16):1509-1518.
Grupp Stephan A .: Advances in T-cell therapy for All, Best Practice & Research Clinical Haematology, vol. 27, No. 3-4, Sep. 1, 2014(Sep. 1, 2014), pp. 222-228.
Gruss et al., Tumor Necrosis Factor Ligand Superfamily: Involvement in the Pathology of Malignant Lymphomas Blood, vol. 85, No. 12, Jun. 15, 1995, pp. 3378-3404.
Guinn et al., 4-1BBL Cooperates with B7-1 and B7-2 in Converting a B Cell Lymphoma Cell Line into a Long-Lasting Antitumor Vaccine, The Journal of Immunology162:5003-5010 (1999).
Habib-Agahi,H., Phan, T.T. and Searle,P.F. Co-stimulation with 4-1BB ligand allows extended T-cell proliferation, synergizes with CD80/CD86 and can reactivate anergic T cells Int. Immunol. 19 (12), 1383-1394 (2007).
Hackett et al. A transposon and transposase system for human application (2010) Molecular Therapy: The Journal of the American Society of Gene Therapy. 18:674-683.
Hanson, H. L. et al. Eradication of established tumors by CD8+ T cell adoptive immunotherapy. Immunity 13, 265-276 (2000).
Harper et al., CTLA-4 and CD28 Activated Lymphocyte Molecules are Closely Related in Both Mouse and Human as to Sequence, Message, Expression, Gene Structure, and Chromosomal Location , The Journal of Immunology, vol. 147, 1037-1044, No. 3, Aug. 1, 1991.
Hatakeyama et al., Transmembrane Signaling of Interleukin 2 Receptor, J. Exp. Med. 1987, vol. 166 pp. 362-375.
Haynes et al., Redirecting Mouse CTL Against Colon Carcinoma: Superior Signaling Efficacy of Single-Chain Variable Domain Chimeras Containing TOR-zeta vs Fcepsilon RI-gamma J Immunol 2001; 166:182-187 (Haynes 2001).
Hege et al., Safety, tumor trafficking and immunogenicity of chimeric antigen receptor (CAR)-T cells specific for TAG-72 in colorectal cancer, Journal for Immunotherapy of Cancer 2017, 5:22.
Hege et al., Systemic T Cell-independent Tumor Immunity after Transplantation of Universal Receptor—modified Bone Marrow into SCID Mice , J. Exp. Med. vol. 184 Dec. 1996 pp. 2261-2269.
Herron, J.N., et al., High resolution structures of the Apr. 4, 20 Fab-fluorescein complex in two solvent systems: effects of solvent on structure and antigen-binding affinity . Biophys J, 1994. 67(6): p. 2167-83.
Heuser, et al., T-cell activation by recombinant immunoreceptors: impact of the intracellular signalling domain on the stability of receptor expression and antigen-specific activation of grafted T-cells, Gene Therapy (2003); 10: 1408-1419.
Hombach et al., T cell activation by recombinant FcεRl γ-chain immune receptors: an extracellular spacer domain impairs antigen-dependent T cell activation but not antigen recognition, Gene Therapy (2000) 7, 1067-1075.
Hombach, et al., Adoptive Immunotherapy with Genetically Engineered T Cells: Modification of the IgG1 Fc ‘Spacer’ Domain in the Extracellular Molety of Chimeric Antigen Receptors Avoids ‘Off-Target’ Activation and Unintended Initiation of an Innate Immune Response, Gene Ther. (Oct. 2010); 17(10):1206-13.
Honegger et al., A mutation designed to alter crystal packing permits structural analysis of a tight-binding fluorescein-scFv complex, Protein Science (2005) 14(10), 2537-2549.
Huang, J., et al., Modulation by IL-2 of CD70 and CD27 expression on CD8+ T cells: importance for the therapeutic effectiveness of cell transfer immunotherapy J. Immunol. 176 (12), 7726-7735 (2006).
Hudecek et al. Jun. 15, 2013, Receptor affinity and extracellular domain modifications affect tumor recognition by ROR1-specific chimeric antigen receptor T-cells. Clin Cancer Res. 19(12):3153-3164.
Hughes M. S. et al., Transfer of a TCR gene derived from a patient with a marked antitumor response conveys highly active T-cell effector functions. Hum Gene Ther Apr. 2005; 16(4):457-72).
Hunter et al., Inhibition of Fcγ Receptor-Mediated Phagocytosis by a Nonphagocytic FcγReceptor, Blood, vol. 91, No. 5 Mar. 1, 1998: pp. 1762-1768.
Hutchins, B. et al., Site-specific coupling and sterically controlled formation of multimeric antibody fab fragments with unnatural amino acids, J. Mol. Biol., 2011, 406, 595-603.
Hutloff, A. et al., ICOS is an inducible T-cell costimulator structurally and functionally related to CD28. Nature, 1999, 397, 263-266.
Hwu, et al., The Genetic Modification of T Cells for Cancer Therapy: An Overview of Laboratory and Clinical Trials, Cancer Detection and Prevention (1994); 18(1):43-50.
Hyman et al. Probing oxidative stress: Small molecule fluorescent sensors of metal ions, reactive oxygen species, and thiols. Coordination Chemistry Reviews (2012) 256: 2333-2356. *
Imai, C. et al., Chimeric receptors with 4-1BB signaling capacity provoke potent cytotoxicity against acute lymphoblastic leukemia, Leukemia, 2004, 18, 676-684.
Imai, K., et al., Comparing Antibody and Small-Molecule Therapies for Cancer ; https://www.medscape.com/viewarticle/550008 (26 pages).
International Search Report for PCT/US2019/014054 dated May 31, 2019.
Irving, B. A., et al., The cytoplasmic domain of the T cell receptor zeta chain is sufficient to couple to receptor-associated signal transduction pathways' Cell (1991); 64:891-901.
Isakov et al., PKC-theta-mediated signal delivery from the TCR/CD28 surface receptors , Frontiers in Immunology, T Cell Biology, Aug. 2012, vol. 3, Article 273, pp. 1-12.
Janeway et al., Appendix I. Immunologists' Toolbox Immunobiology: The Immune System in Health and Disease. 5th ed. New York: Garland Science; 2001 (101 pages).
Janeway et al., The structure of a typical antibody molecule Immunobiology: The Immune System in Health and Disease. 5th Ed. New York: Garland Science; 2001, pp. 1-11.
Jang, I, et al., Human 4-1BB (CD137) Signals Are Mediated by TRAF2 and Activate Nuclear Factor-kB, Biochemical and Biophysical Research Communications (1998);613-620.
Jena et al., Redirecting T-cell specificity by introducing a tumor-specific chimeric antigen Receptor, Blood 2010, vol. 116, No. 7, pp. 1035-1044.
Jensen, M. C., et al., Abstract #98: Targeting Pre-B Acute Lymphoblastic Leukemia With T Cell Clones Engineered To Express A CD19-Specific Chimeric Immunoreceptor, Blood (Nov. 16, 2000); 96(11):26A.
Jensen, M. et al. CD20 is a Molecular Target For scFvFc[zeta] Receptor Redirected T Cells: Implications for Cellular Immunotherapy of CD20+ Malignancy, Biology of Blood and Marrow Transplantation (1998); 4:75-83.
Jensen, M.C., et al., Antitransgene rejection responses contribute to attenuated persistence of adoptively transferred CD20/CD19-specific chimeric antigen receptor redirected T cells in humans. Biol Blood Marrow Transplant, 2010. 16(9): p. 1245-56.
Johnson et al., 2000, Kabat database and its applications: 30 years after the first variability plot, Nucleic Acids Res., 28(1): 214-218.
Jonnalagadda et al., Chimeric Antigen Receptors With Mutated IgG4 Fc Spacer Avoid Fc Receptor Binding and Improve T Cell Persistence and Antitumor Efficacy, Molecular Therapy 2015, vol. 23, No. 4, pp. 757-768.
Jung et al., Improving in vivo folding and stability of a single-chain Fv antibody fragment by loop grafting, Protein Engineering (1997) vol. 10, No. 8, pp. 956-966.
Jung, S. et al., Selection for improved protein stability by phage display, J. Mol. Biol., 1999, 294, 163-180.
Kabat et al., 1991, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (TOC).
Kagoya, Y., et al., Transient stimulation expands superior antitumor T cells for adoptive therapy. JCI Insight, 2017. 2(2): p. e89580 (13 pages).
Kalos et al., T Cells with Chimeric Antigen Receptors Have Potent Antitumor Effects and Can Establish Memory in Patients with Advanced Leukemia, Sci. Transl. Med. (Aug. 10, 2011) 3(95):1-21.
Kandalaft, L. et al., A phase I clinical trial of adoptive transfer of folate receptor-alpha redirected autologous T cells for recurrent ovarian cancer, Journal of Translational Medicine, 2012, 10:157, 10 pages.
Kang, S. et al: Therapeutic uses of anti-interleukin-6 receptor antibody, International Immunology, vol. 27, No. 1, Aug. 20, 2014 (Aug. 20, 2014), pp. 21-29.
Karachaliou et al., Common Co-activation of AXL and CDCP1 in EGFR-mutation-positive Non-small cell Lung Cancer Associated with Poor Prognosis, EBioMedicine (2017) https://doi.org/10/1016/j.ebiom.2018.02.001.
Kariv et al., Analysis of the Site of Interaction of CD28 with Its Counterreceptors CD80 and CD86 and Correlation with Function, 157 J. Immunol.29-38 (1996).
Katz et al., Recognition of HLA-Cw4 but Not HLA-Cw6 by the NK Cell Receptor Killer Celllg-Like Receptor Two-Domain Short Tail No. 4 , J Immunol 2001; 166:7260-7267.
Kennedy, M. et al., Optical imaging of metastatic tumors using a folate-targeted fluorescent probe, J. Biomed. Opt., 2003, 8, 636-641.
Kim el al. Redirection of Genetically Engineered CAR⋅T Cells Using Bifunctional Small Molecules, Journal of the American Chemical Society (Feb. 18, 2015) vol. 137, No. 8, pp. 2832-2835, with 8 page supporting document.
Kim et al., NMR Structural Studies of Interactions of a Small, Nonpeptidyl Tpo Mimic with the Thrombopoietin Receptor Extracellular Juxtamembrane and Transmembrane Domains, J Biol Chem (2007) 282(19):14253-14261.
Kim et al., Protein conjugation with genetically encoded unnatural amino acids, Curr OpinChem Biol (2013); 17:412-419 (Epub May 9, 2013).
Kim et al., Therapeutic Potential of 4-1BB (CD137) As a Regulator for Effector CD8+ T Cells, Journal of Hematotherapy & Stem Cell Research (2001) 10:441-449.
Kintzing et al., Emerging Strategies for Developing Next-Generation Protein Therapeutics for Cancer Treatment Trends in Pharmacological Sciences, vol. 37, No. 12, Dec. 2016, pp. 993-1008.
Klotz et al., Macromolecule-Small Molecule Interactions. Strong Binding by Intramolecularly Cross-Linked Polylysine Biochemistry. vol. 10, No. 6, Mar. 16, 1971, pp. 923-926.
Kochenderfer et al., Construction and pre-clinical evaluation of an anti-CD19 chimeric antigen receptor, Journal of Immunotherapy (2009); 32(7): 689-702.
Kochenderfer et al., Treating B-cell cancer with T cells expressing anti-CD19chimeric antigen receptors 2013, Nature Reviews Clinical Oncology, 10, 267-276 (2013).
Kochenderfer, J. et al., B-cell depletion and remissions of malignancy along with cytokine-associated toxicity in a clinical trial of anti-CD19 chimeric-antigen-receptor-transduced T cells, Blood, 2012, 119, 2709-2720.
Kochenderfer, J. et al., Eradication of B-lineage cells and regression of lymphoma in a patient treated with autologous T cells genetically engineered to recognize CD19, Blood, 2010, 116, 4099-4102.
Kolmar, H. et al., Alternative binding proteins: biological activity and therapeutic potential of cystine-knot miniproteins, The FEBS Journal, 2008, 275, 26684-26690.
Kozer et al., 2011, Evidence for extended YFP-EGFR dimers in the absence of ligand on the surface of living cells, Physical Biology, 8:066002, 12 pp.
Kranz et al., Partial elucidation of an anti-hapten repertoire in BALB/c mice: comparative characterization of several monoclonal antiFLuorescyl antibodies, Mol Immunol (1981) 18(10), 889-898.
Krause, A., et al., Genetic approaches to sustain the function of tumor-specific T-lymphocytes, Mol. Ther. (2000); 1 (S260): 713.
Kularatne, S.A. et al., Prostate-specific membrane antigen targeted imaging and therapy of prostate cancer using a PSMA Inhibitor as a homing ligand, Mol. Pharm., 2009, 6,780-789.
Kunik et al., Jun. 6, 2012, Paratome: an online tool for systematic identification of antigen-binding regions in antibodies based on sequence or structure, Nucl Acids Res. 40:W521-W524.
Kuwana, Y. et al., Expression of chimeric receptor composed of immunoglobulin-derived V regions and T-cell receptor-derived C regions, Biochem. Biophys. Res. Comm. (1987); 149:960-968.
Kwon, B, et al., cDNA sequences of two inducible T-cell genes, cDNA sequences of two inducible T-cell genes (1989); 86: 1963-1967.
Kwon, B, et al., Expression Characteristics of Two Potential T Cell Mediator Genes, Cellular Immunology (1989): 414-422.
Lafage-Pochitaloff M, Costello R, Couez D, Simonetti J, Mannoni P, Mawas C, Olive D. Human CD28 and CTLA-4 lg superfamily genes are located on chromosome 2 at bands q33-q34 Immunogenetics 1190;31(3):198-201.
Lamers et al., Immune responses to transgene and retroviral vector in patients treated withex vivo-engineered T cells, Blood (2011) 117(1): 72-82.
Lamers, C. et al., Treatment of Metastatic Renal Cell Carcinoma With Autologous T-Lymphocytes Genetically Retargeted Against Carbonic Anhydrase IX: First Clinical Experience, J. Clin. Oncol., 2006, 24, e20-22.
Laroche et al., Characterization of a Recombinant Single-chain Molecule Comprising the Variable Domains of a Monoclonal Antibody Specific for Human Fibrin Fragment D-dimer*, The Journal of Biological Chemistry 1991, vol. 266, No. 25, Issue of Sep. 5, pp. 16343-16349.
Latza, U. et al., The human OX40 homolog: cDNA structure, expression and chromosomal assignment of the ACT35 antigen, Eur. J. Immunol., 1994, 24, 677-683.
Lee et al., Current concepts in the diagnosis and management of cytokine release syndrome Blood. Jul. 10, 2014;124(2):188-95. doi: 10.1182/blood-2014-05-552729. Epub May 29, 2014, with errata.
Lee et al., Jan. 15, 2019, Use of a single CAR T cell and several bispecific adapters facilitates eradication of multiple antigenically different solid tumors, Cancer Research, 79(2):387-396.
Lee, D, et al., 4-1BB Signaling Activates the T Cell Factor 1 Effector/b-Catenin Pathway with Delayed Kinetics via ERK Signaling and Delayed PI3K/AKT Activation to Promote the Proliferation of CD8+ T Cells, PLOS One (2013); 8: 1-11.
Lefranc et al., 2003, IMGT unique numbering for immunoglobulin and T cell receptor variable domains and Ig superfamily V-like domains, Dev Comp Immunol. 27:55-77.
Li et al., Jan. 2020, CAIZ-specific CAR-T cells and sunitinib show synergistic effects against metastatic renal cancer models, J Immunother, 43(1): 16-28.
Liebowitz, D. N., Lee, K. P. & June, C. H. Co-stimulatory approaches to adoptive immunotherapy. Curr. Opin. Oncol. 10, 533-541 (1998).
Lin et al., Transglutaminase-catalyzed site-specific conjugation of small-molecule probes to proteins in vitro and on the surface of living cells, J. Am. Chem. Soc. (2006); 128:4542-4543.
Linenberger, CD33-directed therapy with gemtuzumab ozogamicin in acute myeloid leukemia: progress in understanding cytotoxicity and potential mechanisms of drug resistance , Leukemia (2005) 19, 176-182.
Liou et al., A chimeric mouse-human antibody that retains specificity for HIV gp 120 and mediates the lysis of HIV-infected cells, J Immunol 1989; 143: 3967-3975.
Liu et al. Phospholipid-Graphene Nanoassembly as a Fluorescence Biosensor for Sensitive Detection of Phospholipase D Activity. Anal. Chem. 2012, 84, 14, 5944-5950. *
Lodish et al., Hierarchical Structure of Proteins Molecular Cell Biology. 4th Ed. New York: W.H. Freeman; 2000. pp. 1-25.
Lohmueller et al., 2018, mSA2 affinity-enhanced biotin-binding CAR T cells for universal tumor targeting, Oncoimmunology, 7(1):e1368604.
Long, A.H., et al., 4-IBB costimulation ameliorates T cell exhaustion induced by tonic signaling of chimeric antigen receptors. Nat Med, 2015. 21(6): p. 581-90.
Love et al., ITAM-mediated Signaling by the T-Cell Antigen Receptor , Cold Spring HarbPerspect Biol 2010;2:a002485.
Lowin-Kropf et al., Cytoskeletal Polarization of T Cells is Regulated by an Immunoreceptor Tyrosine-based Activation Motif—dependent Mechanism, The Journal of Cell Biology 1998, vol. 140, No. 4, pp. 861-871.
Lu et al., Mar. 2019, Preclinical Evaluation of Bispecific Adaptor Molecule Controlled Folate Receptor CAR-T Cell Therapy with Special Focus on Pediatric Malignancies. Frontiers in Oncology, 9(51): 1-20.
Lu, Y. et al., Folate-targeted dinitrophenyl hapten immunotherapy: effect of linkerchemistry on antitumor activity and allergic potential, Mol. Pharm., 2007, 695-706.
Lu, Y. et al., Preclinical pharmacokinetics, tissue distribution, and antitumor activity of afolate-hapten conjugate-targeted immunotheraphy in hapten-immunized mice, Molecular Cancer Therapeutics, 2006, 5, 3258-3267.
Lueders et al., The Long Terminal Repeat of an Endogenous Intracisternal A—ParticleGene Functions as a Promoter When Introduced into Eucaryotic Cells by Transfection Molecular and Cellular Biology, vol. 4, No. 10, Oct. 1984, pp. 2128-2135.
Lustgarten, J., et al., Specific Elimination of IgE Production Using T Cell Lines Expressing Chimeric T Cell Receptor Genes, European Journal of Immunology (1995); 25(10):2985-2991.
Ma et al., Jul. 12, 2019, Enhanced CAR-T cell activity against solid tumors by vaccine boosting through the chimeric receptor, Science, 365(6449): 162-168.
Ma et al., Versatile strategy for controlling the specificity and activity of engineered T cells, Proc. Nat. Acad. Sci. U.S.A (Jan. 12, 2016) vol. 113, No. 4, pp. 450-458.
Ma, Q. et al., Carcinoembryonic antigen-immunoglobulin Fc fusion protein (CEA-Fc) for identification and activation of anti-CEA immunoglobulin-T-cell receptor-modified T cells, representative of a new class of lg fusion proteins, Cancer Gene Therapy (2004); 11: 297-306.
Ma, Q., et al., Genetically engineered T cells as adoptive immunotherapy of cancer, Cancer Chemother Biol Response Modif (2002); 20: 315-41.
Maeda et al., Tumor vascular permeability and the EPR effect in macromolecular therapeutics: a review, Journal of Controlled Release 65 (2000), pp. 271-284 (14 pages).
Maher, et al., Human T-lymphocyte cytotoxicity and proliferation directed by a single chimeric TCRzeta/CD28 receptor, Nature Biotechnology (2002); 20: 70-75.
Makabe et al., Jan. 11, 2008, Thermodynamic consequences of mutations in Vernier zone residues of a humanized anti-human epidermal growth factor receptor murine antibody, 528, Journal of Biological Chemistry, 283(2): 1156-1166.
Marincola, F. M., et al., Escape of human solid tumors from T cell recognition: molecular mechanisms and functional significance, Adv. Immunol. (2000); 74: 181-273.
Martin et al., Dec. 1989, Modeling antibody hypervariable loops: a combined algorithm, Proc Natl Acad Sci (USA), 86:9268-9272.
Maude Shannon L. et al. Chimeric Antigen Receptor T Cells for Sustained Remissions in Leukemia N Engl J Med. Oct. 16, 2014;371(16):1507-17.
Maude Shannon L. et al. Managing Cytokine Release Syndrome Associated With Novel T Cell-Engaging Therapies Cancer J. Mar.-Apr. 2014;20(2):119-22.
Maus et al., Ex vivo expansion of polyclonal and antigen-specific cytotoxic T lymphocytes by artificial APCs expressing ligands for the T-cell receptor, CD28 and 4-1BB, Nature Biotechnology, Nature Publishing Group, New York, NY, US, vol. 20, No. 2, Feb. 1, 2002, pp. 143-148.
Maus, M.V., et al., T cells expressing chimeric antigen receptors can cause anaphylaxis in humans. Cancer Immunol Res, 2013. 1(1): p. 26-31.
McEnaney et al., Jul. 20, 2012, Antibody-recruiting molecules: an emerging paradigm for engaging immune function in treating human disease. ACS Chem Biol. 7(7): 1139-1151.
Mcguinness RP, et al., Anti-tumor activity of human T cells expressing the CC49-zeta chimeric immune receptor, Hum Gene Ther. (Jan. 20, 1999); 10(2):165-73.
Medstrand et al., Long Terminal Repeats Are Used as Alternative Promoters for the Endothelin B Receptor and Apolipoprotein C-I Genes in Humans , The Journal of Biological Chemistry, vol. 276, No. 3, Issue of Jan. 19, pp. 1896-1903, 2001.
Melero, I, et al., Amplification of tumor immunity by gene transfer of the co-stimulatory 4-1BB ligand: synergy with the CD28 co-stimulatory pathway, Bristol-Myers Squibb Pharmaceutical Research Institute (1998); 1116-1121.
Melief, C. J. et al., Strategies for immunotherapy of cancer, Adv. Immunol. (2000); 75:235-282.
Mooney et al., Concise Review: Neural Stem Cell-Mediated Targeted Cancer Therapies Stem Cells Translational Medicine, 2018, pp. 740-747.
Moore et al., Characterisation of salmon and trout CD8α and CD8β, Molecular Immunology 42 (2005) 1225-1234.
Moretta et al., Activating Receptors and Coreceptors Involved in Human Natural Killer Cell-Mediated Cytolysis, Annu. Rev. Immunol. 2001. 19:197-223.
Morgan RA, et al., Cancer regression in patients after transfer of genetically engineered lymphocytes, Science (Oct. 6, 2006); 314(5796): 126-9.
Morrison, C, CAR-T Field Booms as Next-Generation Platforms Attract Big Players, Nature Biotechnology (Jun. 2015); 33: 571-72.
Muller T, et al., Expression of a CD20-specific chimeric antigen receptor enhances cytotoxic activity of NK cells and overcomes NK-resistance of lymphoma and leukemia cells, Cancer Immunol. Immunother. (2008); 57: 411-423.
Mungra et al., Targeted human cytolytic fusion proteins at the cutting edge: harnessing the apoptosis-inducing properties of human enzymes for the selective elimination of tumor cells Oncotarget, vol. 10, No. 8, 2019, pp. 897-915.
Munn et al., Role of Low-Affinity Fc Receptors in Antibody-dependent Tumor Cell Phagocytosis by Human Monocyte-derived Macrophages, Cancer Research 51, 1117-1123, Feb. 15, 1991.
Nam, K, et al., Cross-Linking of 4-1BB Activates TCR-Signaling Pathways in CD8 T Lymphocytes1, The Journal of Immunology; 1898-1905.
National Cancer Institute. CAR T-Cell Therapy: Engineering Patients' Immune Cells to Treat Their Cancers, Cancer Research Updates, Updated: Oct. 16, 2014; 5 pages; retrieved Nov. 17, 2014 fromhttp://www.cancer.gov/cancertopics/research-updates/2013/CAR-T-Cells.
Nelson, Aaron L., Antibody fragments, mAbs 2010, Landes Bioscience, vol. 2, Issue 1, pp. 77-83.
Nieba, L. et al., Disrupting the hydrophobic patches at the antibody variable/constant domain interface: improved in vivo folding and physical characterization of an engineered scFv fragment, Protein Eng., 1997, 10, 435-444.
Oelke et al., Ex vivo induction and expansion of antigen-specific cytotoxic T cells by HLA-Ig-coated artificial antigen-presenting cells, Nature Medicine (2003); 9(5):619-624.
Oelsner, S., et al., Continuously expanding CAR NK-92 cells display selective cytotoxicity against B-cell leukemia and lymphoma , Cytotherapy, 2017; 19: 235-249.
Ohgaki et al. Ratiometric fluorescence imaging of cell surface pH by poly(ethylene glycol)-phospholipid conjugated with fluorescein isothiocyanate. Scientific Reports 2017; 7: 17484, p. 1-9. *
Okazaki et al., PD-1 immunoreceptor inhibits B cell receptor mediated signaling by recruiting src homology2-domain-containing tyrosine phosphatase 2 to phosphotyrosine , PNAS Nov. 20, 2001, vol. 98, No. 24, 13866-13871.
Orr, B. et al., Rapid method for measuring ScFv thermal stability by yeast surface display, Biotechnol Prog., 2003. 19, 631-638.
Pages et al., Two Distinct Intracytoplasmic Regions of the T-cell Adhesion Molecule CD28 Participate in Phosphatidylinositol 3-Kinase Association The Journal of Biological Chemistry, vol. 271, No. 16, Apr. 19, 1996, pp. 9403-9409.
Paillard, F. Immunotherapy with T cells bearing chimeric antitumor receptors, Hum. Gene Ther. (1999); 10: 151-153.
Paillasse, M, et al., Insights into the Cholecystokinin 2 Receptor Binding Site and Processes of Activation, The American Society for Pharmacology and Experimental Therapeutics (2006); 70:1935-1945.
Pameijer, C.R., et al., Conversion of a tumor-binding peptide identified by phage display to a functional chimeric T cell antigen receptor, Cancer Gene Ther., 2007, 14, 91-07.
Park et al., Treating cancer with genetically engineered T cells Trends Biotechnol. Nov. 29, 2011(11): 550-557.
Parkhurst et al. Characterization of genetically modified T-cell receptors that recognize the CEA:691-699 peptide in the context of HLA-A2.1 on human colorectal cancer cells (2009) Clin Cancer Res. Jan. 1, 2009;15(1):169-80.
Patel Jaina M et al: Cancer CARtography: charting out a new approach to cancer immunotherapy, Immunotherapy. 2014;6(6):675-8.
Pollock et al., Inducible T cell antigen 4-1BB. Analysis of expression and function, J Immunol 1993; 150:771-781.
Porter DL, et al. Chimeric antigen receptor T cells persist and induce sustained remissions in relapsed refractory chronic lymphocytic leukemia . Science translational medicine. 2015;7(303):303-39. doi: 10. I 126/scitransimed.aac5415. PubMed PMID:26333935.
Porter, D.L. et al., Chimeric antigen receptor-modified T cells in chronic lymphoid leukemia, N. Engl. J. Med., 2011, 365, 725-733.
Prasad et al., T-cell antigen CD28 interacts with the lipid kinase phosphatidylinositol3-kinase by a cytoplasmic Tyr(P)-Met-Xaa-Met motif, Proc. Natl. Acad. Sci. USA, vol. 91, pp. 2834-2838, Mar. 1994.
Product brochure for the Engineered Autologous Cell Therapy (eACT™) Platform, available from Kite Pharma, retrieved Oct. 25, 2015 from http://www.kitepharma.com/c/products/eact.php.
Pule et al., Artificial T-cell receptors, Cytotherapy (2003) 5(3):211-226.
Pule et al., Virus-specific T cells engineered to coexpress tumor-specific receptors: persistence and antitumor activity in individuals with neuroblastoma, Nat. Med. (2008); 14: 1264-1270.
Qin et al., Incorporation of a hinge domain improves the expansion of chimeric antigen receptor T cells, Journal of Hematology & Oncology (2017) 10:68.
Rai et al., Expression systems for production of heterologous proteins, Current Science2001, vol. 80, No. 9, pp. 1121-1128.
Recent patent applications in chimeric antigen receptors, Nature Biotechnology 32(3): 239 (2014).
Reddy et al., Elimination of Fc Receptor-Dependent Effector Functions of a Modified IgG4Monoclonal Antibody to Human CD4, J Immunol 2000; 164: 1925-1933.
Redmond et al., The role of OX40-mediated co-stimulation in T cell activation and survival, Crit. Rev. Immunol. 2009, 29(3): 187-201.
Reichert, J. Day 1, Emerging Disruptive Technologies and Cutting-Edge Analytical Techniques, MAbs, 2009, 1, 190-209.
Restifo et al., Adoptive immunotherapy for cancer: harnessing the T cell response, Nat. Rev. Immunol. (Mar. 22, 2012) 12(4):269-281.
Reubi, Jean Claude, Peptide Receptors as Molecular Targets for Cancer Diagnosis and Therapy, Endocrine Reviews 24(4): 389-427.
Riha et al., CD28 co-signaling in the adaptive immune response Self/Nonself 1:3,231-240; Jul./Aug./Sep. 2010.
Riley et al., The CD28 family: a T-cell rheostat for therapeutic control of T-cell activation, Blood, Jan. 1, 2005, vol. 105, No. 1, pp. 13-21.
Riviere, I., Gallardo, H. F., Hagani, A B. & Sadelain, M. Retroviral-mediated gene transfer in primary murine and human T-lymphocytes. Mol. Biotechnol. 15, 133-142 (2000).
Roberts et al., Chemistry for peptide and protein PEGylation, Advanced Drug Delivery Reviews (2002); 54:459-476.
Rodgers, D. et al., Switch-mediated activation and retargeting of CAR-T cells for B-cell malignancies, Proc. Natl. Acad. Sci., 2016, 113, E459-468.
Romeo, C. at al., Sequence requirements for induction of cytolysis by the T cell antigen/Fc receptor zeta chain, Cell (1992); 68:889-897.
Romeo, C., et al., Cellular immunity to HIV activated by CD4 fused to T cell or Fc receptor polypeptides, Cell (1991); 64:1037-1046.
Rosenberg Cell transfer immunotherapy for metastatic solid cancer—what clinicians need to know (2011) Nat Rev Clin Oncol. 8(10):577-85).
Rosenberg et al. Adoptive cell transfer: a clinical path to effective cancer immunotherapy. Nat Rev Cancer. Apr. 2008; 8(4):299-308.
Rosenberg, S. A. et al., Adoptive cell therapy for the treatment of patients with metastatic melanoma, Current Opinion in Immunology, 2009, 21, 233-240.
Rotz Seth J. et al. Severe cytokine release syndrome in a patient receivingPD-1-directed therapy Pediatr Blood Cancer. Dec. 2017;64(12). Epub May 24, 2017 (4 pages).
Rueckert S, et al., A monoclonal antibody as an effective therapeutic agent in breast cancer: trastuzumab Expert Opin Biol Ther. Jun. 2005;5(6):853-66.
Ruella et al., 2016, Dual CD19 and CD123 targeting prevents antigen-loss relapses after cd19-directed immunotherapies, J Clin Invest. 126(10): 3814-3826.
Sadelain et al., Targeting Tumours with Genetically Enhanced T Lymphocytes, Nat Rev Cancer (Jan. 2003): 3(1): 35-45.
Sadelain, et al., The promise and potential pitfalls of chimeric antigen receptors, Current Opinion in Immunology (2009): 21: 215-223.
Sadelain, M. et al., The basic principles of chimeric antigen receptor design, Cancer Discov., 2013, 3, 388-398.
Samudrala et al., 1999, Ab Initio Protein Structure Prediction Using a Combined Hierarchical Approach, Proteins, Structure, Function and Genetics Suppl., 3:194-198.
Saoulli, C, et al., CD28-Independent, TRAF2-dependent Costimulation of Resting T Cells by 4-1BB Ligand, Master of Science Thesis, Department of Immunology University of Toronto (1998), 77 pp.
Saraswat et al., DNA as Therapeutics; an Update, Indian J Pharm Sci. Sep.-Oct. 2009;71(5): 488-498.
Scholler, J., et al., Decade-long safety and function of retroviral-modified chimeric antigen receptor T cells, Sci Transl Med (May 2, 2012); 4(132): 132ra53 (7 pages).
Schonfeld, K, et al., Selective Inhibition of Tumor Growth by Clonal NK Cells Expressing an Erb82/HER2-Specific Chimeric Antigen Receptor , Mol. Ther., vol. 23 No. 2, 330-338 Feb. 2015.
Schreiber, S.L., Organic synthesis toward small-molecule probes and drugs PNAS, vol. 108, No. 17, Apr. 26, 2011, pp. 6699-6702.
Schwesinger et al., Unbinding forces of single antibody-antigen complexes correlate with their thermal dissociation rates, PNAS (2000) 97(18), 9972-9977.
Scott, D., et al., Immunogenicity of biotinylated hapten-avidin complexes, Mol Immunol(1984); 21(11): 1055-60.
Sega, E. et al., Tumor detection using folate receptor-targeted imaging agents, Cancer Metastasis Rev., 2008, 27, 655-664.
Sentman Challenges of creating effective chimeric antigen receptors for cancer therapy Immunotherapy. Aug. 2013;5(8):783-5.
Serghides et al., Evaluation of OX40 Ligand as a Costimulator of Human Antiviral Memory CD8 T Cell Responses: Comparison with B7.1 and 4-1BBL, The Journal of Immunology 175:6368-6377 (2005).
Shields et al., High Resolution Mapping of the Binding Site on Human IgG1 for FcyRI, FcyRII, FcyRIII, and FcRn and Design of IgG1 Variants with Improved Binding to the FcyR*, The Journal of Biological Chemistry 2001, vol. 276, No. 9, Issue of Mar. 2, pp. 6591-6604.
Shirasu, N. et al., Construction and Molecular Characterization of Human Chimeric T-Cell Antigen Receptors Specific for Carcinoembryonic Antigen, Anticancer Research (2010); 30:2731-2738.
Sobota et al., Binding of IgG-Opsonized Particles to FcyR Is an Active Stage of Phagocytosis That Involves Receptor Clustering and Phosphorylation, The Journal of Immunology 2005; 175:4450-4457.
Stancovski et al., Targeting of T Lymphocytes to Neu/HER2-Expressing Cells Using Chimeric Single Chain Fv Receptors, J. Immunol. (1993); 151(11):6577-6582.
Stein, P, et al., The Cytoplasmic Domain of CD28 Is both Necessary and Sufficient for Costimulation of Interleukin-2 Secretion and Association with Phosphatidylinositol3′-Kinase, American Society for Microbiology (1994); 14: 3392-3402.
Stephan et al., T cell-encoded CD80 and 4-1BBL induce auto- and transcostimulation, resulting in potent tumor rejection, Nature Medicine (Dec. 2007); 13(12): 1440-1449.
Stevens et al., Generation of Tumor-Specific CTLs from Melanoma Patients by Using Peripheral Blood Stimulated with Allogeneic Melanoma Tumor Cell Lines, J. Immunol(1995); 154:762-771.
Suhoski, M.M., et al., Engineering artificial antigen-presenting cells to express a diverse array of co-stimulatory molecules. Mol Ther, 2007. 15(5): p. 981-8.
Sun et al., Jan. 2018, Immunotherapy with CAR-Modified T cells: toxicities and overcoming strategies, Journal of Immunology Research, 2018:1-10.
Sutherland et al. Modular Chimeric Antigen Receptor Systems for Universal Car T Cell Retargeting. Int. J. Mol. Sci. 2020, 21(19), 7222, p. 1-14. *
Swanson et al. Fluorescent Cancer-Selective Alkylphosphocholine Analogs for Intraoperative Glioma Detection. Neurosurgery 2015; 76: 115-124. *
Swanson et al., The coordination of signaling during Fc receptor-mediated phagocytosis, Journal of Leukocyte Biology, vol. 76, Dec. 2004, pp. 1093-1103.
Tam et al., Functional, Biophysical, and Structural Characterization of Human IgG1 andIgG4 Fc Variants with Ablated Immune Functionality, Antibodies 2017, 6, 12.
Tamada et al. Redirecting Gene-Modified T Cells toward Various Cancer Types Using Tagged Antibodies, Clinical Cancer Research (Oct. 2, 2012) vol. 18, Iss. 23, pp. 6436-6445, with correction.
Tanaka, Toshio et al. Immunotherapeutic implications of IL-6 blockade for cytokine storm. Immunotherapy. Jul. 2016;8(8):959-70.
Tapeinos et al. Physical, Chemical, and Biological Structures based on ROS-Sensitive Moieties that are Able to Respond to Oxidative Microenvironments. Adv. Mater. 2016, 28: 5553-5585. *
Tatsumi et al., 2012, he non-invasive cell surface modification of hepatocytes with PEG-lipid derivatives, Biomaterials, 33:821-828.
Teachey D. T. et al. Cytokine release syndrome after blinatumomab treatment related to abnormal macrophage activation and ameliorated with cytokine-directed therapy Blood. Jun. 27, 2013;121(26):5154-7. doi: 10.1182/blood-2013-02-485623. Epub May 15, 2013.
Themeli, M., et al., Generation of tumor-targeted human T lymphocytes from induced pluripotent stem cells for cancer therapy, Nat Biotechnol (2013); 31(10):928-33 (Epub Aug. 11, 2013).
Tsukahara et al. CD19 target-engineered T-cells accumulate at tumor lesions in human B-cell lymphoma xenograft mouse models (2013) Biochem Biophys Res Commun 438(1): 84-9. Epub Jul. 17, 2013.
Tumor necrosis factor receptor superfamily, HUGO Gene Nomenclature Committee, 2 pp.
Turatti, F., et al., Redirected activity of human antitumor chimeric immune receptors is governed by antigen and receptor expression levels and affinity of interaction, J Immunother (2007); 30(7): 684-93.
Turtle et al., Engineered T cells for anti-cancer therapy Curr. Opin. Immunol., Oct. 2012; 24(5): 633-39. Epub Jul. 18, 2012.
U.S. Appl. No. 18/459,302, filed Aug. 31, 2023, Low; Philip Stewart. *
Uherek, C, et al., Chimeric antigen receptors for the retargeting of cytotoxic effector cells, J. Hematother. Stem Cell Res. (2001); 10: 523-534.
UniProtKB—043914, TYRO protein tyrosine kinase-binding protein , pp. 1-15.
UniProtKB—P01732 (CD8A_HUMAN). T-cell surface glycoprotein CD8 alpha chain; 11pages; retrieved on May 13, 2016 from http://www.uniprot.org/uniprot/P01732.
UniProtKB—P02701, AVidin Precursor—Gallus Chicken.
UniProtKB—P10747 (CD28_HUMAN).
UniProtKB—P10966 (CD8B_HUMAN).
UniProtKB—P20963 (CD3Z_HUMAN). T-cell surface glycoprotein CD3 zeta chain; 12pages; retrieved on May 13, 2016 from http://www.uniprot.org/uniprot/P20963.
UniProtKB—Q07011 (TNR9_HUMAN). Tumor necrosis factor receptor superfamily member 9: 14 pages; retrieved on May 13, 2016 from http://www.uniprot.org/uniprot/Q07011.
Urba, W.J. et al., Redirecting T cells, New Engl. J. Med., 2011, 365, 754-757.
Urbanska et al., A Universal Strategy for Adoptive Immunotherapy of Cancer through Use of a Novel T-cell Antigen Receptor, Cancer Research (2012) 72(7): 1844-1852.
Urbanska, K., et al., A Universal Immune Receptor Expressed by T Cells for the Targeting of Diverse and Multiple Tumor Associated Antigens IN Abstracts for the 26th Annual Scientific Meeting of the Society for Immunotherapy of Cancer (SITC), J Immunother, vol. 34, No. 9, Nov.-Dec. 2011 (62 pages), p. 381.
Uttenthal, B.J., et al., Challenges in T cell receptor gene therapy. J Gene Med (Jun. 2012); 14(6): 386-99.
Van Blitterswijk et al., Anticancer mechanisms and clinical application of alkylphopholipids, Biochimica et Biophysica Acta (2013) 1831(3):663-674.
Van Dam, G. et al., Intraoperative tumor-specific fluorescence imaging in ovarian cancer by folate receptor-α targeting: first in-human results, Nature Medicine, 2011, 17, 1315-1319.
Van der Luit et al., A new class of anticancer alkylphospholipids uses lipid rafts as membrane gateways to induce apoptosis in lymphoma cells, Mol Cancer Ther (2007) 6(8):2337-2345.
Van Rhijn et al., Nov. 30, 2015, Human autoreactive T cells recognize CD1b and phospholipids. Proceedings of the National Academy of Sciences 113(2):380-385.
Vaughan et al., Human antibodies with sub-nanomolar affinitis isolate from a large non-immunized phage display library, Nature Biotechnology (1996) vol. 14(3), pp. 309-314.
Verdine et al., The Challenge of Drugging Undruggable Targets in Cancer: Lessons Learned from Targeting BCL-2 Family Members Clin. Cancer Res. vol. 13, No. 24, Dec. 15, 2007, pp. 7264-7270.
Verhoeven et al. Lentiviral vector gene transfer into human T cells (2009) Methods Mol Biol. 506: 97-114.
Wang et al. Phenotypic and functional attributes of lentivirus-modified CD19-specific human CD8+ central memory T cells manufactured at clinical scale (2012) J Immunother.35(9):689-701.
Wang et al., Current status and perspectives of chimeric antigen receptor modified T cells for cancer treatment, Protein Cell 2017, 8(12):896-925.
Wayua, C. et al., Evaluation of a Cholecystokinin 2 Receptor—Targeted Near-Infrared Dye for Fluorescence—Guided Surgery of Cancer, Molecular Pharmaceutics, 2014, 11,468-476.
Weichert et al., Jun. 11, 2014, Alkylphosphocholine analogs for broad-spectrum cancer imaging and therapy. Science Translational Medicine, 6(240):240ra75, 24 pp.
Weijtens, M. E. et al., Single chain Ig/gamma gene-redirected human T lymphocytes produce cytokines, specifically lyse tumor cells, and recycle lytic capacity., J. Immunol.(Jul. 15, 1996); 157(2):836-43.
Weissman et al., Molecular cloning and chromosomal localization of the human T-cell receptor zeta chain: Distinction from the molecular CD3 complex Proc. Natl. Acad. Sci. vol. 85, Dec. 1988, pp. 9709-9713.
Weissman et al., Role of the zeta chain in the expression of the T cell antigen receptor: genetic reconstitution studies The EMBO Journal, vol. 8, No. 12, 1989, pp. 3651-3656.
Wen, T, et al., 4-1BB Ligand-Mediated Costimulation of Human T Cells Induces CD4 andCD8 T Cell Expansion, Cytokine Production, and the Development of Cytolytic Effector Function1, 4897-4906.
Wesolowski, J, et al., Single domain antibodies: promising experimental and therapeutic tools in infection and immunity, Med Microbiol Immunol (2009) 198:157-174.
Wilkie et al., Retargeting of Human T Cells to Tumor-Associated MUC1: The Evolution of a Chimeric Antigen Receptor, The Journal of Immunology Apr. 2008, pp. 4901-4909.
Wilson, et al. DAP12 and KAP10 (DAP10)-novel transmembrane adapter proteins of the CD3zeta family, Immunol Res. (2000); 22(1):21-42.
Wu et al., Adoptive T-cell therapy using An A tumor-infiltrating lymphocytes for metastatic melanoma: current status and future outlook Cancer, Mar. 18, 2012(2): 160-75.
Wu et al., Remote control of therapeutic T cells through a small molecule-gated chimeric receptor, Science (2015) vol. 350, Issue 6258, pp. 293 and aab4077-aab4077.
Wu, et al., An activating immunoreceptor complex formed by NKG2D and DAP10, Science (1999); 285:730-732.
Xu et al., Cytokine release syndrome in cancer immunotherapy with chimeric antigen receptor engineered T cells Cancer Lett. Feb. 28, 2014;343(2):172-8. Epub Oct. 16, 2013.
Xu, X.J., et al., Efficacy and safety of adoptive immunotherapy using anti-CD 19 chimeric antigen receptor transduced T-cells: a systematic review of phase I clinical trials, LeukLymphoma (2013); 54(2): 255-60 (Published online: Sep. 8, 2012).
Yamamoto et al. Interaction of poly(ethylene glycol)-conjugated phospholipids with supported lipid membranes and their influence on protein adsorption. Science and Technology of Advanced Materials 2016; 17(1): 677-684. *
Ye, H, et al., The Structural Basis for the Recognition of Diverse Receptor Sequences by TRAF2, The Weill Medical College and Graduate School of Medical Sciences of Cornell University; v: 321-330.
Yee, C., et al., Prospects for Adoptive T Cell Therapy, Current Opinion in Immunology (1997); 9(5):702-708.
Zarour, 2016, Reversing T-cell dysfunction and exhaustion in cancer, Clinical Cancer Research, 22(8): 1856-1864.
Zhang et al., Phase I Escalating-Dose Trial of CAR-T Therapy Targeting CEA + Metastatic Colorectal Cancers, Molecular Therapy (2017), 25(5): 1248-1258.
Zhang, H., et al., 4-IBB is superior to CD28 costimulation for generating CD8+ cytotoxic lymphocytes for adoptive immunotherapy. J Immunol, 2007. 179(7): p. 4910-8.
Zhao, Y. et al., A herceptin-based chimeric antigen receptor with modified signaling domains leads to enhanced survival of transduced T lymphocytes and antitumor activity, J. Immunol, 2009, 183, 5563-5574.
Zheng et al., Arming Tumor-Reactive T Cells with Costimulator B7-1 Enhances Therapeutic Efficacy of the T Cells, Cancer Research, 2006, vol. 66, No. 13, pp. 6793-6799.
Zhong, et al., Integrated CD28 and 4-1BB Signals Strongly Potentiate CD8+ T Cell Mediated Eradication of Metastatic Prostate Cancer, Molecular Therapy (Jan. 1, 2006); 13: p. S103, Abstract.

Also Published As

Publication number Publication date
CN111936518A (en) 2020-11-13
JP2025116065A (en) 2025-08-07
SG11202007426XA (en) 2020-09-29
JP2024012513A (en) 2024-01-30
WO2019156795A1 (en) 2019-08-15
IL276473A (en) 2020-09-30
CA3090089A1 (en) 2019-08-15
BR112020015884A2 (en) 2020-12-08
US20200354477A1 (en) 2020-11-12
EP3749695A4 (en) 2021-12-29
JP2021512622A (en) 2021-05-20
AU2019218729B2 (en) 2025-12-04
JP7774961B2 (en) 2025-11-25
EP3749695A1 (en) 2020-12-16
AU2019218729A1 (en) 2020-08-20

Similar Documents

Publication Publication Date Title
AU2019218729B2 (en) Fluorescein-specific CARs exhibiting optimal T cell function against FL-PLE labelled tumors
US12570716B2 (en) Anti-dinitrophenol chimeric antigen receptors
AU2019319674A1 (en) Methods and compositions for stimulation of chimeric antigen receptor T cells with hapten labelled cells
US20250313803A1 (en) Compositions and Methods for Cancer Immunotherapy
AU2021216554A1 (en) Methods and compositions for stimulation of chimeric antigen receptor T cells with hapten labelled cells
WO2020227446A1 (en) Enhancement of polypeptides and chimeric antigen receptors via hinge domains
EP4706677A1 (en) Therapeutic effect enhancer for enhancing effect of car-t therapy
HK40033024A (en) Compositions and methods for cancer immunotherapy
HK40033024B (en) Compositions and methods for cancer immunotherapy

Legal Events

Date Code Title Description
FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

STPP Information on status: patent application and granting procedure in general

Free format text: APPLICATION DISPATCHED FROM PREEXAM, NOT YET DOCKETED

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS

FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO SMALL (ORIGINAL EVENT CODE: SMAL); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS

STPP Information on status: patent application and granting procedure in general

Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT RECEIVED

STCF Information on status: patent grant

Free format text: PATENTED CASE