US12312416B2 - Fluorescein-specific cars exhibiting optimal t cell function against FL-PLE labelled tumors - Google Patents
Fluorescein-specific cars exhibiting optimal t cell function against FL-PLE labelled tumors Download PDFInfo
- Publication number
- US12312416B2 US12312416B2 US16/965,859 US201916965859A US12312416B2 US 12312416 B2 US12312416 B2 US 12312416B2 US 201916965859 A US201916965859 A US 201916965859A US 12312416 B2 US12312416 B2 US 12312416B2
- Authority
- US
- United States
- Prior art keywords
- cells
- car
- ple
- cell
- alternatives
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active, expires
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/44—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere, e.g. haptens, metals, DNA, RNA, amino acids
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/5758—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites
- G01N33/5759—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites involving compounds localised on the membrane of tumour or cancer cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/53—Hinge
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
Definitions
- compositions and methods of making and using these compositions relate to engineered chimeric antigen receptors (CARs) and compositions thereof having specificity and affinity for fluorescein containing ligands presented on the surface of tumor cells. Accordingly, provided herein are compositions and methods of making and using these compositions.
- CARs engineered chimeric antigen receptors
- Chimeric receptors are synthetic receptors that include an extracellular ligand binding domain, most commonly a single chain variable fragment of a monoclonal antibody (scFv) linked to intracellular signaling components, most commonly CD3 ⁇ alone or combined with one or more costimulatory domains.
- scFv monoclonal antibody
- Much of the research in the design of chimeric antigen receptors has focused on defining scFvs and other ligand binding elements that target malignant cells without causing serious toxicity to essential normal tissues, and on defining the optimal composition of intracellular signaling modules to activate T cell effector functions.
- CAR T cell-mediated therapy that is selective for specific targets and which minimizes adverse side effects.
- a complex comprising a chimeric antigen receptor (CAR) or a T cell receptor (TCR), wherein the CAR or TCR is joined to a lipid, wherein the lipid comprises a target moiety and the CAR is joined to said lipid through an interaction with said target moiety, and wherein the CAR or TCR comprises a spacer domain having a spacer length of 1-22 amino acids, 23-50 amino acids, 51-100 amino acids, 100 to 150 amino acids or 151-250 amino acids or a spacer length that is within a range defined by any two of the aforementioned lengths.
- the CAR or TCR comprises a sequence as set forth in any one of SEQ ID NOs: 1-6.
- the spacer domain is a IgG4 hinge connected to a CH2 domain to a CH3 domain. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 7. In some alternatives, the spacer domain is an IgG4 hinge connected to a CH3 domain. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 8. In some alternatives, the spacer domain is an IgG4 hinge only. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 9. Some embodiments include nucleic acids that encode any one of SEQ ID NO: 1-9, which may be present on a vector and/or introduced to a cell (e.g., a T cell).
- the spacer comprises a length of 229 amino acids.
- the lipid comprises a polar head group and a hydrophobic group.
- the polar head comprises a choline, a phosphatidylcholine, sphingomyelin, phosphoethanolamine group, an oligosaccharide residue, a sugar residue, phosphatidyl serine or phosphatidyl inositol.
- the polar-head group comprises phosphocholine, a piperidine moiety or a trimethylarseno-ethyl-phosphate moiety.
- the hydrophobic group is fatty acid, such as an aliphatic chain.
- the fatty acid is saturated or unsaturated.
- the hydrophobic group comprises an alkyl, alkenyl or alkynyl group.
- the hydrophobic group comprises a terpenoid lipid, such as a steroid or cholesterol.
- the hydrophobic group comprises an ether linkage, wherein the ether linkage is between the polar head group and the aliphatic chain.
- the sugar residue is a glycerol.
- the hydrophobic group comprises a carbon alkyl chain, wherein the carbon alkyl chain comprises 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 carbons or any number that is within a range defined by any two aforementioned values.
- the carbon alkyl chain comprises 18 carbons.
- the lipid is a phospholipid ether.
- the target moiety is biotin, digoxigenin, dinitrophenol or fluorescein.
- the spacer comprises a PEG spacer, a Hapten (2 ⁇ ) spacer, or an alkane chain.
- the PEG spacer comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16 PEG molecules, or any amount of PEG molecules that is within a range defined by any two aforementioned values.
- the CAR or TCR is expressed by a cell or a T cell. In some alternatives, the CAR or TCR is on the surface of a cell or a T cell.
- the cell is a precursor T cell. In some alternatives, the precursor T cell is a hematopoietic stem cell. In some alternatives, the cell is a CD8+T cytotoxic lymphocyte cell selected from the group consisting of na ⁇ ve CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells and bulk CD8+ T cells. In some alternatives, the cell is a CD4+T helper lymphocyte cell that is selected from the group consisting of na ⁇ ve CD4+ T cells, central memory CD4+ T cells, effector memory CD4+ T cells, and bulk CD4+ T cells. In some alternatives, the lipid is intercalated in a lipid bilayer of a target cell. In some alternatives, the target cell is a tumor cell. In some alternatives, the target cell is an immune cell. In some alternatives, the immune cell is a T cell or a B cell. In some alternatives, the target cell is present in a tumor microenvironment.
- a cell comprising a complex of any one of the alternatives herein, the cell comprising a chimeric antigen receptor (CAR) or T cell receptor (TCR), wherein the CAR or TCR is bound to or is configured to bind to a lipid, wherein the lipid comprises a target moiety and the cell comprising the CAR is bound to the target moiety of the lipid, and wherein the CAR or TCR comprises a spacer domain.
- CAR chimeric antigen receptor
- TCR T cell receptor
- the complex comprises a chimeric antigen receptor (CAR) or a T cell receptor (TCR), wherein the CAR or TCR is joined to or is configured to be joined to a lipid, wherein the lipid comprises a target moiety and the CAR is joined to or configured to be joined to said lipid through an interaction with said target moiety, and wherein the CAR or TCR comprises a spacer domain having a spacer length of 1-22 amino acids, 23-50 amino acids, 51-100 amino acids, 100 to 150 amino acids or 151-250 amino acids or a spacer length that is within a range defined by any two of the aforementioned lengths.
- the CAR or TCR comprises a sequence as set forth in any one of SEQ ID NOs: 1-6.
- the spacer domain is an IgG4 hinge connected to a CH2 domain to a CH3 domain. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 7. In some alternatives, the spacer domain is an IgG4 hinge connected to a CH3 domain. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 8. In some alternatives, the spacer domain is an IgG4 hinge only. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 9. In some alternatives, the cell comprises a nucleic acid encoding any one of SEQ ID. NO: 1-9). In some alternatives, the spacer comprises a length of 229 amino acids.
- the lipid comprises a polar head group and a hydrophobic group.
- the polar head comprises a choline, a phosphatidylcholine, sphingomyelin, phosphoethanolamine group, an oligosaccharide residue, a sugar residue, phosphatidyl serine or phosphatidyl inositol.
- the polar-head group comprises phosphocholine, a piperidine moiety or a trimethylarseno-ethyl-phosphate moiety.
- the hydrophobic group is fatty acid, such as an aliphatic chain. In some alternatives, the fatty acid is saturated or unsaturated.
- the hydrophobic group comprises an alkyl, alkenyl or alkynyl group. In some alternatives, the hydrophobic group comprises a terpenoid lipid, such as a steroid or cholesterol. In some alternatives, the hydrophobic group comprises an ether linkage, wherein the ether linkage is between the polar head group and the aliphatic chain. In some alternatives, the sugar residue is a glycerol or sugar alcohol. In some alternatives, the hydrophobic group comprises a carbon alkyl chain, wherein the carbon alkyl chain comprises 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 carbons or any number that is within a range defined by any two aforementioned values. In some alternatives, the carbon alkyl chain comprises 18 carbons.
- the lipid is a phospholipid ether.
- the target moiety is biotin, digoxigenin, dinitrophenol or fluorescein.
- the spacer comprises a PEG spacer, a Hapten (2 ⁇ ) spacer, or an alkane chain.
- the PEG spacer comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16 PEG molecules, or any amount of PEG molecules that is within a range defined by any two aforementioned values.
- the CAR or TCR is expressed by a cell or a T cell.
- the CAR or TCR is on the surface of a cell or a T cell.
- the cell is a precursor T cell.
- the precursor T cell is a hematopoietic stem cell.
- the cell is a CD8+T cytotoxic lymphocyte cell selected from the group consisting of na ⁇ ve CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells and bulk CD8+ T cells.
- the cell is a CD4+T helper lymphocyte cell that is selected from the group consisting of na ⁇ ve CD4+ T cells, central memory CD4+ T cells, effector memory CD4+ T cells, and bulk CD4+ T cells.
- the lipid is intercalated in a lipid bilayer of a target cell.
- the target cell is a tumor cell.
- the target cell is an immune cell.
- the immune cell is a T cell or a B cell.
- the target cell is present in a tumor microenvironment.
- the cell is a precursor T cell.
- the precursor T cell is a hematopoietic stem cell.
- the cell is a CD8+T cytotoxic lymphocyte cell selected from the group consisting of na ⁇ ve CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells and bulk CD8+ T cells.
- the cell is a CD4+T helper lymphocyte cell that is selected from the group consisting of na ⁇ ve CD4+ T cells, central memory CD4+ T cells, effector memory CD4+ T cells, and bulk CD4+ T cells.
- the lipid is intercalated in a lipid bilayer of a target cell.
- the target cell is a tumor cell.
- the target cell is an immune cell.
- the immune cell is a T cell or a B cell.
- the target cell is present in a tumor microenvironment.
- a method of treating, ameliorating, or inhibiting a cancer in a subject comprising a) introducing, providing, or administering to a subject a composition that comprises a lipid, which comprises a target moiety that is bound to a masking moiety, b) introducing, providing, or administering to said subject a cell comprising a chimeric antigen receptor (CAR) or T cell receptor (TCR), which is specific for the target moiety once the masking moiety is removed from the target moiety, and wherein the CAR or TCR comprises a spacer domain, c) removing the masking moiety from the target moiety thereby allowing the target moiety to bind to the CAR present on the cell, and, d) optionally, measuring or evaluating the binding of the cell comprising the CAR to the lipid, after steps a-c and/or e) optionally, measuring or evaluating the treatment, amelioration, or inhibition of said cancer after steps a-d, and/or
- CAR chimeric antigen receptor
- the complex or the cell is provided to the subject at the same time as the composition or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 15, 20, 24, 36 or 48 hours before or after administration of the composition, or any time within a range defined by any two aforementioned values.
- the cell is provided to the subject 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 15, 20, 24, 36 or 48 hours before administration of the composition, or any time within a range defined by any two aforementioned values.
- the cell is provided to the subject within seconds or minutes, such as less than an hour, of providing the composition to the subject.
- a boost of the cell and/or the composition is provided to the subject.
- an additional cancer therapy is provided, such as a small molecule, e.g., a chemical compound, an antibody therapy, e.g., a humanized monoclonal antibody with or without conjugation to a radionuclide, toxin, or drug, surgery, and/or radiation.
- the cancer is a solid tumor, such as colon, breast, ovarian, lung, pancreatic, prostate, melanoma, renal, pancreatic, glioblastoma, neuroblastoma, medulloblastoma, sarcoma or liver cancer; or a non-solid tumor, such as a leukemia, or a multiple myeloma.
- the spacer domain is an IgG4 hinge connected to a CH2 domain to a CH3 domain. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 7. In some alternatives, the spacer domain is an IgG4 hinge connected to a CH3 domain. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 8. In some alternatives, the spacer domain is a IgG4 hinge only. In some such embodiments, the spacer domain comprises the amino acid sequence SEQ ID NO: 9. In some alternatives, the spacer comprises a sequence set forth in SEQ ID NO: 7. In some alternatives, binding of the target moiety to the CAR present on the cell induces production of at least one cytokine. In some alternatives, the at least one cytokine comprises IL-2, TNF- ⁇ and/or INF- ⁇ .
- kits comprising a pharmaceutical grade FL-PLE.
- the pharmaceutical grade FL-PLE comprises a hapten.
- the pharmaceutical grade FL-PLE comprises fluorescein (e.g., FITC).
- FIG. 1 A and FIG. 1 B schematically depict different spacers for CAR T cells.
- FIG. 1 A shows an example of: (i) a second-generation CAR. The antigen recognition moiety (uppermost portion of molecule), which is presented at a desired distance by a short spacer domain, from the cell surface. This spacer is connected to a transmembrane domain, which is connected to two signaling domains; (ii) a medium spacer CAR, where another domain is added to the short spacer; and (iii) a long spacer CAR, where another domain is added to the medium spacer.
- FIG. 1 B shows an example of different spacers exposed on CAR T cells.
- long, medium, and short spacers can comprise a sequence as set forth in SEQ ID NO: 7, 8, and 9, respectively.
- FIG. 2 schematically depicts an example of spacer length and orientation on a surface of a tumor cell.
- a tumor cell whose surface is labeled with CART cell tumor targeting agent (CTCT).
- CTCT CART cell tumor targeting agent
- the tumor surface has proteins and other cellular debris protruding from the surface, which can impact a CTCT specific CAR's ability to recognize the CAR T cell tumor targeting agent (CTCT).
- Panels A-C depict example embodiments of a PLE-CTCT imbedded into the lipid membrane
- panels D-E depict example embodiments of a CAR T cell tumor targeting agent (CTCT) conjugated to a surface protein.
- CTCT CAR T cell tumor targeting agent
- a short CAR is unable to reach the CAR T cell tumor targeting agent (CTCT) and will not be able to activate.
- C CAR T cell tumor targeting agent
- CCT CAR T cell tumor targeting agent
- D and E the long CAR from shown in panel C and the short CAR depicted in panel B are both able to recognize and activate through a CAR T cell tumor targeting agent (CTCT) that is conjugated to a surface protein.
- FIG. 3 schematically depicts an example of a CTCT CART cell recognizing only unmasked PLE-CTCT and being activated.
- a tumor loaded with a prodrug version of PLE-CTCT.
- the prodrug provides steric hindrance to the CTCT specific CAR T cell making the Pro-PLE-CTCT unrecognizable to the CTCT specific CAR T cell.
- FIG. 4 A depicts an example embodiment of a phospholipid conjugated with a hapten, fluorescein (PLE-CTCT). Structure of phospholipid ether (PLE) tethered to the hapten fluorescein (FL-PLE).
- FL fluorescein
- FL fluorescein
- PEG Polyethylene glycol
- PLE is the polar head group
- iv is the hydrophobic tail for incorporation or tethering into the cell plasma membrane.
- FIG. 4 B depicts an example prodrug version of FL-PLE in which a Pro moiety is conjugated to the hapten (fluorescein) via a cleavable bond indicated by the arrow.
- the masked FL-PLE is substantially non-florescent.
- the bond can be cleaved by the presence of reactive oxygen species (ROS), such as in a tumor microenvironment.
- ROS reactive oxygen species
- FIG. 5 depicts examples of different antiFL scFvs that were selected to create an antiFL CAR library (upper portion).
- Lower portion depicts structures of example CARs with a long spacer (L), a medium spacer (M), or a short spacer (S).
- the structures include a leader sequence, an scFv, a hinge/spacer, a CD28tm domain, a 41BB domain, a CD3 ⁇ , a T2A sequence, and an EGFTt domain.
- L long spacer
- M medium spacer
- S short spacer
- the structures include a leader sequence, an scFv, a hinge/spacer, a CD28tm domain, a 41BB domain, a CD3 ⁇ , a T2A sequence, and an EGFTt domain.
- L long spacer
- M medium spacer
- S short spacer
- the structures include a leader sequence, an scFv, a hinge/spacer, a CD28tm domain
- FIG. 6 depicts FACS analysis of CD8+ T cells containing antiFL CARs.
- Panel (a) and (b) depict T cells staining for the selection marker EGFRt containing either an antiFL(FITC-E2) CAR, which comprises SEQ ID NO: 5 [96% positive], or an antiFL(4M5.3) CAR, which comprises SEQ ID NO: 2 [80% positive], respectively.
- Panels (c) and (d) depict T cells incubated with a mouse CD19-FITC antibody, then stained with an anti-mouse-Fc-Alexa647 antibody for the bound FITC antibody, for T cells containing either the antiFL(FITC-E2) CAR [97% positive], or the antiFL(4M5.3) CAR [79% positive], respectively.
- FIG. 7 A depicts a FACS analysis of cells treated with FL-PLE.
- FIG. 7 B depicts specific lysis of K562 cells in the presence or absence of FL-PLE, and in the presence or absence of CD8+ T cells containing an antiFL CAR.
- FIG. 7 C depicts cytokine production from K562 cells in the presence or absence of FL-PLE, and in the presence or absence of CD8+ T cells containing an antiFL CAR.
- FIG. 8 A depicts FACS of various cell lines treated with FL-PLE.
- FIG. 8 B depicts specific lysis of cells treated with FL-PLE and contacted with CD8+ T cells containing an antiFL(FITC-E2) CAR containing a long spacer.
- FIG. 9 depicts a FACS analysis of CD8+ T cells contain various antiFL CARs, and staining for a surface marker, EGFRt.
- FIG. 10 depicts a FACS analysis of CD4+ T cells contain various antiFL CARs, and staining for a surface marker, EGFRt.
- FIG. 11 depicts a FACS analysis of cells labeled with FL-PLE.
- FIG. 12 depicts specific lysis of target cells incubated with FL-PLE and contacted with CD8+ T cells containing antiFL CARs.
- FIG. 13 depicts cytokine production of cells incubated with FL-PLE and contacted with CD4+ T cells containing antiFL CARs.
- FIG. 14 A depicts specific lysis of target cells incubated with FL-PLE and contacted with CD8+ T cells containing antiFL CARs.
- FIG. 14 B depicts cytokine production of cells incubated with FL-PLE and contacted with CD4+ T cells containing antiFL CARs.
- FIG. 15 A depicts a FACS analysis of cells containing various antiFL CARs.
- FIG. 15 B depicts a FACS analysis of cells treated with FL-PLE.
- FIG. 15 C depicts a series of graphs for specific lysis of various tumor cells in the presence or absence of FL-PLE, and contacted with various antiFL CARs.
- FIG. 15 D depicts a series of graphs for cytokine production from T cells containing various antiFL CARs and contacted with various tumor cells in the presence or absence of FL-PLE.
- FIG. 15 E depicts a series of graphs for cytokine production from T cells containing various antiFL CARs and contacted with various tumor cells in the presence or absence of FL-PLE.
- FIG. 16 depicts an image of an orthotopic glioma xenograft in a subject which had been dosed intravenously with FL-PLE, and evaluated 48 hr later.
- Left lower panel is an image of the control contralateral hemisphere of the subject. Both the orthotopic glioma xenograft and the control contralateral hemisphere of the subject were evaluated by staining with an anti-fluorescein antibody. Levels of retained FL-PLE were also quantified in both the orthotopic glioma xenograft and the control contralateral hemisphere, over time (right panel).
- FIG. 17 depicts graphs demonstrating FL-PLE retention in different tumors in vivo.
- FIG. 18 A depicts a FACS analysis of cells treated with FL-PLE, or ProFL-PLE.
- FIG. 18 B depicts specific lysis of cells treated with FL-PLE or ProFL-PLE, and contacted with CD8+ T cells containing an antiFL CAR
- FIG. 18 C depicts a series of graphs for cytokine product for cells in the presence or absence of masked or unmasked ProFL-PLE and FL-PLE, in the presence or absence of CD4+ T cells containing an antiFL(FITCE2) CAR with a long spacer.
- FIG. 19 A depicts a FACS analysis of FL-PLE or ProFL-PLE binding to cells.
- FIG. 19 B depicts a series of graphs for cytokine product for cells in the presence or absence of ProFL-PLE or FL-PLE, in the presence or absence of CD4+ T cells containing an antiFL(FITCE2) CAR with a long spacer.
- FIG. 19 C depicts a FACS analysis of cells treated with FL-PLE or ProFL-PLE.
- FIG. 20 depicts a graph of relative life span of mice having a neuroblastoma (Be2) tumor and treated with ProFL-PLE, FL-PLE or control, and administered either T cells containing an antiFL(FITCE2) long spacer CAR which comprised SEQ ID NO: 5, or a control.
- FIG. 21 A depicts graphs for average tumor progression (top panel), and percent survival (bottom panel) in mice injected intra-tumorally with ProFL-PLE, and administered T cells containing an antiFL(FITCE2) CAR with a long spacer.
- FIG. 21 B depicts graphs for average tumor progression (top panel), and percent survival (bottom panel) in mice injected intravenously with ProFL-PLE, and administered T cells containing an antiFL(FITCE2) CAR with a long spacer.
- chimeric antigen receptors with specificity and a selected or designed affinity for the molecule fluorescein when presented on the surface of tumor cells loaded with exogenous FL-PLE, which results in redirected anti-tumor T cell reactivity.
- FL-PLE is a synthetic molecular structure that is designed to integrate into the plasma membrane of tumors such that the molecule's fluorescein is present adjacent to the outer leaflet of the plasma membrane in the extracellular space.
- the FL-PLE structure includes therapeutically important attributes.
- a CAR that targets the fluorescein (FL) moiety of the FL-PLE is provided, and methods of making and using the same are also contemplated. These CARs can either be constitutively expressed or placed under regulated control.
- CAR T cell therapies was hampered by the onerous task of identifying and vetting tens of hundreds of antigens, such as CAR targets, as was the development of associated CARs in order to address each type of cancer afflicting humans.
- Previous work developed a FL-PLE that integrates into all tumors displaying one synthetic target molecule for CAR T cells to recognize. This eliminates the need for validation of tens of hundreds of CARs and instead allows for the use of a single FL specific CAR.
- the present disclosure addresses the identification, creation, and engineering of suitable CAR T cells for binding to the FL moiety of FL-PLE.
- the FL moiety may be masked and unmasked such that the FL moiety can be activated to receive the CAR T cell.
- a FL specific CAR may recognize only unmasked CAR T cell tumor targeting agents (CTCTs) and not masked FLs.
- Some embodiments of the methods and compositions provided herein can include aspects disclosed in WO 2018/148224 entitled “PHOSPHOLIPID ETHER (PLE) CAR T CELL TUMOR TARGETING (CTCT) AGENTS” which is hereby expressly incorporated by reference in its entirety.
- the term “about” indicates that a value includes the inherent variation of error for the method being employed to determine a value, or the variation that exists among experiments.
- Chimeric receptor refers to a synthetically designed receptor comprising a ligand binding domain of an antibody or other protein sequence that binds to a molecule associated with the disease or disorder and is linked via a spacer domain to one or more intracellular signaling domains of a T cell or other receptors, such as a costimulatory domain. Chimeric receptor can also be referred to as artificial T cell receptors, chimeric T cell receptors, chimeric immunoreceptors, and chimeric antigen receptors (CARs).
- CARs chimeric antigen receptors
- CARs are genetically engineered T-cell receptors designed to redirect T-cells to target cells that express specific cell-surface antigens.
- T-cells can be removed from a subject and modified so that they can express receptors that can be specific for an antigen by a process called adoptive cell transfer. The T-cells are reintroduced into the patient where they can then recognize and target an antigen.
- These CARs are engineered receptors that can graft a selected specificity onto an immune receptor cell.
- CARs chimeric antigen receptors
- the term chimeric antigen receptors or “CARs” are also considered by some investigators to include the antibody or antibody fragment, the spacer, signaling domain, and transmembrane region. Due to the surprising effects of modifying the different components or domains of the CAR described herein, such as the epitope binding region (for example, antibody fragment, scFv, or portion thereof), spacer, transmembrane domain, and/or signaling domain), the components of the CAR are frequently distinguished throughout this disclosure in terms of independent elements.
- CAR T cell targeting agent is given its plain and ordinary meaning in view of the specification and can be described, for example as a composition that that can integrate into the membrane of a target cell.
- the CTCT comprises a lipid, wherein the lipid comprises a target moiety and a masking moiety.
- the masking moiety may be unmasked in the presence of low pH, ROS species and within a tumor microenvironment, for example.
- the masking moiety inhibits specific binding of a CAR to the target moiety.
- the target moiety may be recognized and bound by a chimeric antigen receptor that is specific for the target moiety.
- the masking moiety is removed at a pH of 4, 5, 6, or 6.5 or any pH in between a range defined by any two aforementioned values.
- T cell receptor or “TCR” is a molecule that is found on the surface of T lymphocytes or T cells that is responsible for the recognition of fragments of antigen bound to a major histocompatibility complex molecule.
- Target moiety refers to a specific group or site on a molecule or chemical that is a binding target for another chemical or protein of interest.
- a complex is provided, wherein the complex comprises a chimeric antigen receptor (CAR) or a T cell receptor (TCR) joined to a lipid, wherein the lipid comprises a target moiety and the CAR is joined to said lipid through an interaction with said target moiety.
- the target moiety is biotin, digoxigenin, dinitrophenol or fluorescein.
- a “single-chain variable fragment,” (scFv) is a fusion protein that can have variable regions of the heavy (VH) and light chains (VL) of immunoglobulins, connected with a short linker peptide of ten to 25 amino acids.
- the short linker peptide can comprise 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 amino acids or any number of amino acids in between a range defined by any two aforementioned values.
- the linker is usually rich in glycine for flexibility, as well as, serine or threonine for solubility, and can either connect the N-terminus of the VH with the C-terminus of the VL, or vice versa.
- the scFv can be specific for an antigen.
- Antigen or “Ag” as used herein, refers to a molecule that provokes an immune response. This immune response can involve either antibody production, or the activation of specific immunologically-competent cells, or both.
- An antigen can be generated, synthesized, produced recombinantly or can be derived from a biological sample.
- a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a biological fluid such, for example, blood, plasma or ascites fluid.
- composition comprising cells manufactured by any one of the alternative methods herein.
- the cells comprise a chimeric antigen receptor, wherein the chimeric antigen receptor comprises a scFv that is specific for an antigen.
- Some embodiments provided herein relate to a ScFv described herein as antiFL(FITCE2 TyrH133Ala) (also referred to as antiFL(FITC-E2 Mut2), or as antiFL(Mut2)), which can be incorporated into a CAR in accordance with this disclosure (SEQ ID NO: 1), having an amino acid sequence of
- Some embodiments provided herein relate to a scFv described herein as antiFL(4M5.3), which can be incorporated into a CAR in accordance with this disclosure (SEQ ID NO: 2), having an amino acid sequence of
- Some embodiments provided herein relate to a ScFv described herein as antiFL(4420), which can be incorporated into a CAR in accordance with this disclosure (SEQ ID NO: 3), having an amino acid sequence of
- Some embodiments provided herein relate to a ScFv described herein as antiFL(4D5Flu), which can be incorporated into a CAR in accordance with this disclosure (SEQ ID NO: 4), having an amino acid sequence of
- Some embodiments provided herein relate to a ScFv described herein as antiFL(FITCE2), which can be incorporated into a CAR in accordance with this disclosure (SEQ ID NO: 5), having an amino acid sequence of
- Some embodiments provided herein relate to a ScFv described herein as antiFL(FITCE2 HisH131Ala), which can be incorporated into a CAR in accordance with this disclosure (SEQ ID NO: 6), having an amino acid sequence of
- Antigen specific binding domains can include protein or protein domains that can specifically bind to an epitope on a protein at a low or high binding affinity (fM to mM binding capacity).
- the fusion protein comprises a protein or portion thereof that can modulate an immune response.
- the protein comprises an antigen specific binding domain.
- T-cells or “T lymphocytes” as used herein, can be from any mammalian species, preferably primate, including monkeys, dogs, and humans.
- the T-cells are allogeneic (from the same species but different donor) as the recipient subject; in some alternatives the T-cells are autologous (the donor and the recipient are the same); in some alternatives the T-cells are syngeneic (the donor and the recipients are different but are identical twins).
- Combination therapy refers to a therapy that uses more than one medication or modality for a treatment.
- Combination therapy for example, can also refer to multiple therapies for a single disease, and often all the therapies are pharmaceutical product combinations.
- Combination therapy can also involve prescribing and administering separate drugs in which the dosage can also have more than one active ingredient.
- a combination therapy is provided, wherein the combination therapy comprises administering a genetically modified immune cell for modifying a tumor microenvironment.
- the combination therapy comprises administering a genetically modified immune cell for modulating the suppression of the immune response in a tumor microenvironment.
- the combination therapy comprises administering a genetically modified immune cell for minimizing the proliferation of tumor and suppressive cells in a subject in need thereof e.g. a human.
- the combination therapy comprises administering a genetically modified immune cell for increasing the efficiency of an anti-cancer therapy, anti-infection therapy, antibacterial therapy, anti-viral therapy, or anti-tumoral therapy in a subject in need thereof e.g., a human.
- the combination therapy further comprises administration of an inhibitor.
- the inhibitor is not an enzymatic inhibitor.
- the inhibitor is an enzymatic inhibitor.
- the combination therapy comprises administering a therapeutic dose of an inhibitor or an antibody or a binding fragment thereof. These antibodies or binding fragments thereof can be humanized in some alternatives.
- the combination therapy can further comprise administering a CAR bearing T-cell to a subject in need e.g., a human.
- “Chemotherapeutic drugs” are a category of anti-cancer medicaments that can use, for example, chemical substances, such as anti-cancer drugs (chemotherapeutic agents), which can be administered as part of a standardized chemotherapy regimen. Chemotherapeutic drugs can be administered with a curative intent or to prolong life or to reduce symptoms (palliative chemotherapy). Additional chemotherapies can also include hormonal therapy and targeted therapy, as it is one of the major categories of medical oncology (pharmacotherapy for cancer). These modalities are often used in conjunction with other cancer therapies, such as radiation therapy, surgery, and/or hyperthermia therapy. In a few cases, cancer has been known to spread due to surgery. In some alternatives, a genetically modified immune cell is administered to the tumor site prior to or after a surgical procedure.
- Chemotherapy in which chemotherapeutic drugs are administered, can use one drug at a time (single-agent chemotherapy) or several drugs at once (combination chemotherapy or polychemotherapy). The combination of chemotherapy and radiotherapy is chemoradiotherapy. Chemotherapy using drugs that convert to cytotoxic activity only upon light exposure is called photochemotherapy or photodynamic therapy.
- the method can further comprise administering to a subject having cancer, photochemotherapy or photodynamic therapy after receiving the genetically modified immune cells or genetically engineered macrophages (GEMs).
- GEMs genetically engineered macrophages
- Chemotherapuetic drugs can include but are not limited to antibody-drug conjugates (for example, an antibody attached to a drug by a linker), nanoparticles (for example a nanoparticle can be 1-1000 nanometer sized particle for promoting tumor selectivity and aid in delivering low-solubility drugs), electochemotherapy, alkylating agents, antimetabolites (for example, 5-fluorouracil (5-FU), 6-mercaptopurine (6-MP), Capecitabine (Xeloda®), Cladribine, Clofarabine, Cytarabine (Ara-C®), Floxuridine, Fludarabine, Gemcitabine (Gemzar®), Hydroxyurea, Methotrexate, Pemetrexed (Alimta®), Pentostatin, or Thioguanine), anti-tumor antibiotics, topoisomerase inhibitors, mitotic inhibitors, corticosteroids, DNA intercalating agents, or checkpoint inhibitors (for example checkpoint kinases CHK1,
- the genetically modified immune cells or compositions comprising genetically modified immune cells are administered in combination with one or more anti-cancer agents, such as any one or more of the foregoing compounds or therapies.
- the one or more anti-cancer agent that is co-administered or administered in conjunction with the genetically modified immune cells comprises antibody-drug conjugates, nanoparticles, electrochemotherapy, alkylating agents, antimetabolites, anti-tumor antibiotics, topoisomerase inhibitors, mitotic inhibitors, corticosteroids, DNA intercalating agents, or checkpoint inhibitors.
- the antimetabolites comprise 5-fluorouracil (5-FU), 6-mercaptopurine (6-MP), Capecitabine (Xeloda®), Cladribine, Clofarabine, Cytarabine (Ara-C®), Floxuridine, Fludarabine, Gemcitabine (Gemzar®), Hydroxyurea, Methotrexate, Pemetrexed (Alimta®), Pentostatin, or Thioguanine.
- Subject refers to any organism upon which the alternatives described herein may be used or administered, e.g., for experimental, diagnostic, prophylactic, and/or therapeutic purposes.
- Subjects or patients include, for example, animals.
- the subject is mice, rats, rabbits, non-human primates, and humans.
- the subject is a cow, sheep, pig, horse, dog, cat, primate or a human.
- CCT CAR T cell tumor targeting
- FL-PLE hapten fluorescein
- fluorescein is a synthetic organic compound that is soluble in water and alcohol. It is widely used as a fluorescent tracer for many applications.
- fluorescein is a target moiety on a lipid that is specifically recognized by a chimeric antigen receptor designed and/or selected for its ability to bind or interact with the fluorescein.
- the lipid is a phospholipid ether.
- lipid as described herein, is a class of organic compounds that comprise carbon chains, fatty acids or a fatty acid derivative that is typically insoluble in water but can integrate into or mix with hydrophobic or organic solvents.
- lipids can include fats, waxes, fat soluble vitamins, monoglycerides, diglycerides, triglycerides, sphingolipids, cerebrosides, ceramides, or phospholipids. Described herein are amphiphilic lipids that can have a polar head group and a hydrophobic moiety or hydrophobic group.
- “Hydrophobic group” or hydrophobic moiety is a molecule or a part of a molecule that is repelled from a mass of water and tends to be non-polar. This can include alkanes, oils or fats.
- lipids can be glycerolipids, glycerophospholipids, sphingolipids, sterol lipids, prenol lipids, saccharolipids or polyketides.
- a complex is provided, wherein the complex comprises a lipid.
- the lipid comprises a polar head group and a hydrophobic moiety.
- the hydrophobic moiety is a hydrophobic carbon tail.
- the hydrophobic carbon tail is saturated or unsaturated. In some alternatives, the hydrophobic carbon tail comprises 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25 carbons or any number of carbons in between a range set forth in any aforementioned value. In some alternatives, the hydrophobic moiety is a steroid or a cholesterol. In some alternatives, the lipid comprises a glycerolipid, glycerophospholipid, sphingolipid, sterol lipid, prenol lipid, saccharolipid or polyketide. In some alternatives, the lipid is a phospholipid ether. In some alternatives, the lipid contains branched alkyl tails.
- the lipid can be a sphingolipid.
- the sphingolipid can contain a backbone of sphingoid bases, such as a set of aliphatic amino alcohols that includes sphingosine.
- a sphingolipid with an R group consisting of a hydrogen atom only is a ceramide.
- Other common R groups include phosphocholine, yielding a sphingomyelin, and various sugar monomers or dimers, yielding cerebrosides and globosides, respectively. Cerebrosides and globosides are collectively known as glycosphingolipids.
- the lipid is a glycosphingolipid.
- the lipid comprises a polar head group and a hydrophobic group.
- the hydrophobic group comprises a fatty acid such as an aliphatic chain. The fatty acid can be saturated or unsaturated.
- the hydrophobic group comprises an alkyl, alkenyl or alkynyl group.
- the hydrophobic group comprises a terpenoid lipid, such as a steroid or cholesterol.
- the hydrophobic group comprises an ether linkage, wherein the ether linkage is between the polar head group and the aliphatic chain.
- the lipid is a phospholipid ether.
- the polar head comprises a choline, a phosphatidylcholine, sphingomyelin, phosphoethanolamine group, an oligosaccharide residue, a sugar residue, phosphatidyl serine or phosphatidyl inositol.
- the sugar is a glycerol or sugar alcohol.
- the lipid is a single chain alkylphospholipid.
- the lipid comprises a structure of synthetic alkylphospholipids, such as edelfosine, perifosine or erucylphosphocholine.
- the lipid is a lysophosphatidylcholine, edlfosine, erucylphosphocholine, D-21805 or perfisone.
- Such lipids are described for example, in van der Lui et al (“A new class of anticancer alkylphospholipids uses lipid rafts as membrane gateways to induce apoptosis in lymphoma cells” Mol Cancer Ther 2007; 6(8), 2007; hereby expressly incorporated by reference in its entirety).
- a choline within the polar head group can be substituted with a piperidine moiety.
- the lipid is an anticancer alkylphospholipid.
- Anticancer phospholipids are described by vander Lui et al. (“A new class of anticancer alkylphospholipids uses lipid rafts as membrane gateways to induce apoptosis in lymphoma cells” Mol Cancer Ther 2007; 6(8), 2007; hereby expressly incorporated by reference in its entirety).
- the lipids provided herein are synthetic and structurally related antitumor agents that interact with a cell membrane. These types of synthetic lipids are alkylphospholipids and are described by e.g., van Blitterswijk et al. (“Anticancer mechanisms and clinical application of alkylphopholipids” Biochimica et Biophysica Acta 1831 (2013) 663-674; hereby incorporated by reference in its entirety herein).
- the synthetic alkylphospholipids can include edelfosine, miltefosine, perifosine, erucylphosphocholine or Erufosine.
- the lipid is edelfosine, miltefosine, perifosine, erucylphosphocholine or Erufosine.
- the lipid is a stable analog of lysophosphatidylcholine.
- the lipid is a thio-ether variant of edelfosine, or 1-hexadecylthio-2-methoxymethyl-rac-glycero-3-phosphocholine.
- the lipid is LysoPC, edelfosine, Ilmofosine, Miltefosine, Perifosine, Erucylphophocholine, or Erufosine.
- “Polar-head group” as described herein is the hydrophilic group of a lipid, such as a phospholipid.
- “Phospholipids” as described herein are a specific class of lipids that can form lipid bilayers due to their amphiphilic characteristic.
- the phospholipid molecule comprises at least one hydrophobic fatty acid “tail” and a hydrophilic “head” or “polar-head group.”
- the phospholipid or phospholipid ether comprises a polar-head group.
- the polar-head group comprises phosphocholine, a piperidine moiety or a trimethylarseno-ethyl-phosphate moiety.
- the lipid comprises a target moiety and the CAR is joined to or is configured to join to said lipid through an interaction with said target moiety.
- the lipid comprises a polar-head group (e.g., comprising an aromatic ring) and a carbon alkyl chain.
- a complex is provided, wherein the complex comprises one or more of said lipids.
- the lipid comprises a polar head group.
- the lipid is a phospholipid ether.
- the phospholipid ether comprises a target moiety and the CAR is joined to or is configured to join to said phospholipid ether through an interaction and/or binding with said target moiety.
- the phospholipid ether comprises a polar-head group and a carbon alkyl chain.
- the polar head group comprises a choline, a phosphatidylcholine, sphingomyelin, phosphoethanolamine group, an oligosaccharide residue, a sugar residue, phosphatidyl serine or phosphatidyl inositol.
- the polar head group comprises phosphocholine, a piperidine moiety or a trimethylarseno-ethyl-phosphate moiety.
- the lipid is a phospholipid ether.
- the sugar is a glycerol or sugar alcohol.
- the polar head group comprises a sugar group.
- the lipid comprises a mannose-containing head group.
- the polar head group comprises sphingosine.
- the polar head group comprises a glucose.
- the polar head group comprises a di-, tri- or tetra-saccharide.
- the lipid is a glucosylcerebroside.
- the lipid is a lactosylceramide.
- the lipid is a glycolipid.
- the glycolipid comprises sugar units, such as n-glucose, n-galactose or N-actyl-n-glactosamine.
- the lipid comprises a hydrocarbon ring such as a sterol.
- the polar head group of the lipid comprises glycerol or a sugar alcohol. In some alternatives, the polar head group of the lipid comprises a phosphate group. In some alternatives, the polar head group of the lipid comprises choline. In some alternatives, the lipid is a phosphatidylethanolomine. In some alternatives, the lipid is a phosphatidylinositol. In some alternatives, the lipid comprises a sphingoid base backbone. In some alternatives, the lipid comprises a sterol lipid, such as cholesterol or its derivatives. In some alternatives, the lipid comprises saccharolipids. In some alternatives, the polar head group comprises choline, phosphate and/or glycerol.
- the lipid is a glycolipid. In some alternatives, the lipid comprises a sugar. In some alternatives, the lipid is derived from sphingosine. In some alternatives, the lipid is a glycerol-glycolipid or a sphingo-glycolipid.
- the lipid is an ether lipid with branched hydrophobic chains.
- “Saturated” as described herein is a fatty acid molecule, in which there are no double bonds within the carbon molecules. Unsaturated as described herein indicates that there are one or more double bonds in a fatty acid chain.
- a complex comprising a lipid is provided.
- the lipid comprises a fatty acid chain, in which the fatty acid is saturated or unsaturated.
- Alkyl as described herein, is an alkyl substituent that has a missing hydrogen.
- alkenyl is an unsaturated hydrocarbon that contains at least one carbon-carbon double bond.
- alkynyl is an unsaturated hydrocarbon containing at least one carbon-carbon triple bond.
- Steroid as described herein, is a molecule that is derived from five carbon isoprene units. Steroids and sterols can be produced from terpenoid precursors. For example, steroids and cholesterol can be biosynthesized by terpenoid precursors.
- Phospholipid ether as described herein is a lipid in which one or more of the carbon atoms on a polar head group are bonded to an alkyl chain via an ether linkage, as opposed to the more common ester linkage.
- the polar head group is a glycerol.
- the spacer for a chimeric antigen receptor refers to a polypeptide spacer, which spacer length is configured to or is selected for its ability to promote an increase in binding or interaction with a chimeric antigen receptor or to reduce or minimizes an adverse side effect associated with CAR T cell therapy.
- a short spacer domain of a CAR has about 12 amino acids or less but greater than 1 amino acid and comprises all or a portion of a IgG4 hinge region sequence or variant thereof.
- an intermediate spacer domain of a CAR has about 119 amino acids or less but greater than 1 amino acid and comprises all or a portion of a IgG4 hinge region sequence and a CH3 region or variant thereof.
- a long spacer domain of a CAR has about 229 amino acids or less but greater than 1 amino acid and comprises all or a portion of a IgG4 hinge region sequence, a CH2 region, and a CH3 region or variant thereof.
- the lipid can also comprise a spacer that separates the target moiety from the lipid and is bound to the polar-head group of the lipid.
- the spacer of the lipid can comprise a PEG spacer, a Hapten spacer, a small peptide or an alkane chain.
- the hapten spacer comprises two haptens (hapten (2 ⁇ ) spacer).
- the lipid comprises a hydrophobic group, such as an alkane chain.
- the alkane chain can comprise 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or 18 carbons, or any number of carbons between a range defined by any two aforementioned values.
- the PEG spacer comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16 PEG molecules, or any amount of PEG molecules that is within a range defined by any two aforementioned values.
- Hapten as described herein is a small molecule that elicit an immune response only when attached to a large carrier such as a protein; the carrier may be one that also does not elicit an immune response by itself. Once the body has generated antibodies to a hapten-carrier adduct, the small-molecule hapten may also be able to bind to the antibody, but it will usually not initiate an immune response; usually only the hapten-carrier adduct can do this.
- a hapten is a small molecule binding moiety, which can be bound by or have specificity towards a scFv or antibody.
- the cells provided are cytotoxic T lymphocytes.
- “Cytotoxic T lymphocyte” (CTL) as used herein refers to a T lymphocyte that expresses CD8 on the surface thereof (e.g., a CD8 + T cell).
- such cells are preferably “memory” T cells (TM cells) that are antigen-experienced.
- the cell is a precursor T cell.
- the precursor T cell is a hematopoietic stem cell.
- the cell is a CD8+T cytotoxic lymphocyte cell selected from the group consisting of na ⁇ ve CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells and bulk CD8+ T cells.
- the cell is a CD4+T helper lymphocyte cell that is selected from the group consisting of na ⁇ ve CD4+ T cells, central memory CD4+ T cells, effector memory CD4+ T cells, and bulk CD4+ T cells.
- “Masking moiety” as used herein refers to a moiety on a lipid ether that is bound to the target moiety.
- the masking moiety functions as a protective group to prevent recognition of the lipid's target moiety by blocking binding and recognition of a chimeric antigen receptor that is specific for the target moiety.
- the masking moiety can be self-cleaved, thus allowing binding, interaction and/or recognition of the target moiety by the chimeric antigen receptor.
- the lipid is a phospholipid ether.
- the masking moiety comprises a phenolic hydroxyl group or PEG.
- the phenolic hydroxyl group is bound to a hydroxyl on a xanthene moiety of fluorescein.
- the masking moiety is bound to the target moiety by a cleavable moiety, which is optionally configured to be specifically cleavable in a tumor microenvironment.
- the cleavable moiety which is configured to be cleavable in a tumor microenvironment, is cleaved by a reactive oxygen species reaction, an acidic pH, hypoxia, or nitrosylation.
- the phospholipid ether comprises a target moiety and the CAR is joined to said phospholipid ether through an interaction with said target moiety.
- the phospholipid ether comprises a polar-head group and a carbon alkyl chain.
- Cancer is a group of diseases involving abnormal cell growth with the potential to invade or spread to other parts of the body.
- Subjects that can be addressed using the methods described herein include subjects identified or selected as having cancer, including but not limited to colon, lung, liver, breast, renal, prostate, ovarian, skin (including melanoma), bone, leukemia, multiple myeloma, or brain cancer, etc. Such identification and/or selection can be made by clinical or diagnostic evaluation.
- the tumor associated antigens or molecules are known, such as melanoma, breast cancer, brain cancer, squamous cell carcinoma, colon cancer, leukemia, myeloma, or prostate cancer.
- Examples include but are not limited to B cell lymphoma, breast cancer, brain cancer, prostate cancer, and/or leukemia.
- one or more oncogenic polypeptides are associated with kidney, uterine, colon, lung, liver, breast, renal, prostate, ovarian, skin (including melanoma), bone, brain cancer, adenocarcinoma, pancreatic cancer, chronic myelogenous leukemia or leukemia.
- a method of treating, ameliorating, or inhibiting a cancer in a subject is provided.
- the cancer is breast, ovarian, lung, pancreatic, prostate, melanoma, renal, pancreatic, glioblastoma, neuroblastoma, medulloblastoma, sarcoma, liver, colon, skin (including melanoma), bone or brain cancer.
- the subject that receives one of the therapies described herein is also selected to receive an additional cancer therapy, which can include a cancer therapeutic, radiation, chemotherapy, or a cancer therapy drug.
- the cancer therapy drug provided comprises Abiraterone, Alemtuzumab, Anastrozole, Aprepitant, Arsenic trioxide, Atezolizumab, Azacitidine, Bevacizumab, Bleomycin, Bortezomib, Cabazitaxel, Capecitabine, Carboplatin, Cetuximab, Chemotherapy drug combinations, Cisplatin, Crizotinib, Cyclophosphamide, Cytarabine, Denosumab, Docetaxel, Doxorubicin, Eribulin, Erlotinib, Etoposide, Everolimus, Exemestane, Filgrastim, Fluorouracil, Fulvestrant, Gemcitabine, Imatinib, Imiquimod, Ipilimumab, Ixabepilone, Lapatinib, Lenalidomide, Letrozole, Leuprolide, Mesna, Methotrexate, Nivolumab
- Tumor microenvironment as described herein is a cellular environment, wherein a tumor exists.
- the tumor microenvironment can include surrounding blood vessels, immune cells, fibroblasts, bone marrow-derived inflammatory cells, lymphocytes, signaling molecules or the extracellular matrix (ECM).
- ECM extracellular matrix
- the method includes human tumor therapy in which patients receive infusions of FL-PLE or derivatives thereof in combination with infusions of FL-specific CAR T cells.
- this system represents a universal target antigen used in combination with a universal CAR and/or universal CAR expressing anti-tumor effector cells.
- a PLE (18C alkyl chain) having a FL appended CAR recognition element, which is appended to the polar head group's choline via three repeat PEG spacers is provided.
- An antiFL CAR library may be generated with different single chain variable fragments (scFvs), such as 6 or more different scFvs, with dissociation constants ranging from 200 fM to 10 nM, such as 200 fM, 210 fM, 220 fM, 230 fM, 240 fM, 250 fM, 260 fM, 270 fM, 280 fM, 290 fM, 300 fM, 400 fM, 500 fM, 600 fM, 700 fM, 800 fM, 900 fM, 1 pM, 100 pM, 200 pM, 300 pM, 400 pM, 500 pM, 600 pM, 700 pM, 800 pM, 900 pM, 1 nM, 2 nM, 3 nM, 4 nM, 5 nM, 6 nM, 7 nM, 8 nM, 9 nM, or 10 nm, or
- Each scFv binds FL in a slightly different manner.
- the binding of scFv to FL is partially due to the difference in binding affinities through mutations in the binding pocket and due to the fact that some scFvs were derived from phage display compared to yeast display.
- three different spacers may be used, including, for example: long, IgG4 hinge connected to a CH2 domain to a CH3 domain; medium, IgG4 hinge connected to a CH3 domain; and short, IgG4 hinge only.
- only FL-specific scFv CAR T cells with the correct orientation and spacer length exhibit redirected anti-tumor function in both in vitro and in vivo tumors loaded with FL PLE-CTCTs.
- shape and size of the scFv's binding pocket can play a role in how well the CAR can activate.
- a FL-specific CAR T cell comprising a targeting and recognition domain presented in a correct orientation with spacing and a binding affinity selected to create a desired T cell response.
- the spacing is selected for generating a T cell response in the specific cells of interest.
- the binding affinity is selected for generating a T cell response in the specific cells of interest.
- different tumors or cells benefit from different orientation, different spacer lengths, and affinities of CAR T cells to allow for desired CAR T cell responses. Therefore, some embodiments provided herein relate to generating a desired or selected combination of orientation, spacer length, and binding affinity for a selected therapy.
- an indication or measure of successful CAR T cells in vitro include cell lysis and the production of cytokines.
- short spacer CARs typically do not produce cytokines; whereas the long spacer CARs produce a large quantity of cytokines.
- an antiFL(4D5Flu) CAR which comprises SEQ ID NO: 4, and which is not able to produce cytokines with FL-PLE, is provided; whereas when cells are labeled with FL by another approach the antiFL(4D5Flu) CAR produces cytokines highlighting that the orientation of scFv to FL moiety of FL-PLE is an important and previously unrecognized variable in T cell activity.
- lowering the dissociation constant such as improving the binding affinity, does not necessarily improve the activation of the CAR.
- asymmetric T cell antitumor reactivity does not correlate with scFv KD.
- asymmetric T cell antitumor reactivity may be spacer length dependent.
- an antiFL(FITC-E2 Mut2) CAR which comprises SEQ ID NO: 1
- is a robust CAR which could not have been predicted from any prior knowledge of CAR structure function or scFv studies. In contrast, the field teaches that the highest scFv affinity results in the best CAR.
- FL-PLE administered to tumor-bearing mammals serves as a generic tumor-targeting agent that is retained on the tumor cell plasma membrane for recognition by FL-specific CAR T cells.
- Identification of a FL-specific CAR with unexpected T cell signaling robustness upon engagement of tumor cells loaded with FL-PLE is provided herein.
- This disclosure relates, in some embodiments, to the full development of a pharmaceutical-grade FL-PLE to be used in conjunction with a CAR T cell product, including in a kit. Other haptens could replace FL with CAR designed to react with these PLEs.
- Some embodiments of the methods and compositions provided herein include methods of treating or ameliorating or inhibiting a cancer in a subject. Some such embodiments include administering an effective amount to the subject a composition comprising a lipid conjugated to a target moiety, wherein the target moiety comprises a masking moiety; and administering a cell, such as a population of the cells, to the subject, wherein the cell comprises a chimeric antigen receptor (CAR) or T cell receptor (TCR), which specifically binds to the target moiety in the absence of the masking moiety, wherein the CAR or TCR comprises: an amino acid sequence having at least 95% identity with a sequence selected from SEQ ID NO:01-06; and/or a spacer domain comprising, consisting essentially of, or consisting of: a IgG4 hinge connected to a CH2 domain to a CH3 domain, such as a long spacer having an amino acid sequence with at least 95% identity with SEQ ID NO:07, or having an amino acid sequence of SEQ ID
- the CAR or TCR comprises an amino acid sequence selected from SEQ ID NO: 1-6.
- the spacer comprises a length of 229 amino acids.
- the CAR or TCR comprises an scFv domain having the amino acid sequence of SEQ ID NO:1 (FITC-E2 Mut2); and a spacer domain having the amino acid sequence of SEQ ID NO:07 (an exemplary long spacer).
- the CAR or TCR comprises an scFv domain having the amino acid sequence of SEQ ID NO:2 (4M5.3); and a spacer domain having the amino acid sequence of SEQ ID NO:07 (an exemplary long spacer).
- the CAR or TCR comprises: an scFv domain having the amino acid sequence of SEQ ID NO:5 (FITC-E2); and a spacer domain having the amino acid sequence of SEQ ID NO:07 (an exemplary long spacer).
- Some embodiments of the methods and compositions provided herein include methods method of treating, ameliorating, or inhibiting a cancer in a subject comprising (a) introducing, providing, or administering to a subject a composition that comprises a lipid, which comprises a target moiety that is bound to a masking moiety; (b) introducing, providing, or administering to said subject a cell comprising a chimeric antigen receptor (CAR) or T cell receptor (TCR), which is specific for the target moiety once the masking moiety is removed from the target moiety, wherein the CAR or TCR comprises a spacer domain having a spacer length of 1-22 amino acids, 23-50 amino acids, 51-100 amino acids, 100 to 150 amino acids or 151-250 amino acids, wherein: the CAR or TCR comprises a sequence selected from SEQ ID NO:01-06; and/or the spacer domain comprises, consists essentially of, or consists of: an IgG4 hinge connected to a CH2 domain to a CH3 domain, such as a
- the cell is provided to the subject at the same time or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 15, 20, 24, 36 or 48 hours before or after administration of the composition, or any time within a range defined by any two aforementioned values. In some embodiments, the cell is provided to the subject 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 15, 20, 24, 36 or 48 hours before administration of the composition, or any time within a range defined by any two aforementioned values. In some embodiments, the cell is provided to the subject within seconds or minutes, such as less than an hour, of providing the composition to the subject.
- a boost of the cell and/or the composition is provided to the subject.
- an additional cancer therapy is provided to said subject, such as a small molecule, e.g., a chemical compound, an antibody therapy, e.g., a humanized monoclonal antibody with or without conjugation to a radionuclide, toxin, or drug, surgery, and/or radiation.
- a small molecule e.g., a chemical compound
- an antibody therapy e.g., a humanized monoclonal antibody with or without conjugation to a radionuclide, toxin, or drug, surgery, and/or radiation.
- the cancer is a solid tumor.
- the cancer is a colon cancer, breast cancer, ovarian cancer, lung cancer, pancreatic cancer, prostate cancer, melanoma, renal cancer, pancreatic cancer, brain cancer, glioblastoma, neuroblastoma, medulloblastoma, sarcoma, bone cancer, bladder cancer, head and neck cancer, or liver cancer.
- the cancer is a non-solid tumor, such as a leukemia or multiple myeloma. Examples of solid tumors include sarcomas, carcinomas, and lymphomas. More examples of cancers, such as solid and non-solid tumors are listed in Amin, M. B., et al., (Eds.). AJCC Cancer Staging Manual (8th edition). Springer International Publishing: American Joint Commission on Cancer; 2017 which is incorporated herein by reference in its entirety.
- binding of the target moiety to the CAR present on the cell induces production of at least one cytokine.
- the at least one cytokine comprises IL-2, TNF- ⁇ and/or INF- ⁇ .
- the lipid comprises a polar head group and a hydrophobic group.
- the polar head comprises a choline, a phosphatidylcholine, sphingomyelin, phosphoethanolamine group, an oligosaccharide residue, a sugar residue, phosphatidyl serine or phosphatidyl inositol.
- the polar-head group comprises phosphocholine, a piperidine moiety or a trimethylarseno-ethyl-phosphate moiety.
- the hydrophobic group is fatty acid, such as an aliphatic chain. In some embodiments, the fatty acid is saturated or unsaturated.
- the hydrophobic group comprises an alkyl, alkenyl or alkynyl group. In some embodiments, the hydrophobic group comprises a terpenoid lipid, such as a steroid or cholesterol. In some embodiments, the hydrophobic group comprises an ether linkage, wherein the ether linkage is between the polar head group and the aliphatic chain. In some embodiments, the sugar residue is a glycerol or a sugar alcohol. In some embodiments, the hydrophobic group comprises a carbon alkyl chain, wherein the carbon alkyl chain comprises 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 carbons or any number that is within a range defined by any two aforementioned values. In some embodiments, the carbon alkyl chain comprises 18 carbons. In some embodiments, the lipid is a phospholipid ether.
- the target moiety is biotin, digoxigenin, dinitrophenol, or fluorescein, or a derivative thereof. In some embodiments, the target moiety is fluorescein, or a derivative thereof.
- the spacer comprises a polyethylene glycol (PEG) spacer, a Hapten (2 ⁇ ) spacer, or an alkane chain.
- PEG spacer comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16 PEG molecules, or any amount of PEG molecules that is within a range defined by any two aforementioned values.
- the cell is a precursor T cell. In some embodiments, the precursor T cell is a hematopoietic stem cell. In some embodiments, na ⁇ ve CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells and bulk CD8+ T cells. In some embodiments, the cell is a CD4+T helper lymphocyte cell that is selected from the group consisting of na ⁇ ve CD4+ T cells, central memory CD4+ T cells, effector memory CD4+ T cells, and bulk CD4+ T cells.
- kits can include a pharmaceutical grade lipid conjugated with a targeting moiety.
- the lipid comprises a polar head group and a hydrophobic group.
- the polar head comprises a choline, a phosphatidylcholine, sphingomyelin, phosphoethanolamine group, an oligosaccharide residue, a sugar residue, phosphatidyl serine or phosphatidyl inositol.
- the polar-head group comprises phosphocholine, a piperidine moiety or a trimethylarseno-ethyl-phosphate moiety.
- the hydrophobic group is fatty acid, such as an aliphatic chain. In some embodiments, the fatty acid is saturated or unsaturated.
- the hydrophobic group comprises an alkyl, alkenyl or alkynyl group. In some embodiments, the hydrophobic group comprises a terpenoid lipid, such as a steroid or cholesterol. In some embodiments, the hydrophobic group comprises an ether linkage, wherein the ether linkage is between the polar head group and the aliphatic chain. In some embodiments, the sugar residue is a glycerol or a sugar alcohol. In some embodiments, the hydrophobic group comprises a carbon alkyl chain, wherein the carbon alkyl chain comprises 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 carbons or any number that is within a range defined by any two aforementioned values. In some embodiments, the carbon alkyl chain comprises 18 carbons. In some embodiments, the lipid is a phospholipid ether.
- the target moiety is biotin, digoxigenin, dinitrophenol, or fluorescein, or a derivative thereof. In some embodiments, the target moiety is fluorescein, or a derivative thereof.
- the spacer comprises a polyethylene glycol (PEG) spacer, a Hapten (2 ⁇ ) spacer, or an alkane chain.
- PEG spacer comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16 PEG molecules, or any amount of PEG molecules that is within a range defined by any two aforementioned values.
- T cells were isolated from leukocyte reduction “cones” that are normally disposed of after plateletpheresis. Specifically, Ficoll density centrifugation was used to generate the T cell-containing peripheral blood mononuclear cell (PBMC) fraction and CD8+ and CD4+ T cells were sequentially purified using the appropriate magnetic enrichment kits. T cells were either immediately placed into CAR production the same day as isolation. T cells, ranging from 0.5-5 million cells, were stimulated with anti-human CD3/CD28 activator beads at a 1:1 ratio on Day 0. In some alternatives, the concentrations of the cells can range between 0.5, 1, 2, 3, 4 or 5 million cells that are produced for use with the anti-human CD3/CD28 activator beads.
- PBMC peripheral blood mononuclear cell
- T cells were transduced with CAR-containing lentivirus at a multiplicity of infection (MOI) ranging from 1 to 6 in the presence of protamine sulfate via spinoculation.
- MOI multiplicity of infection
- Half or full-media exchanges were conducted every 2-3 days to maintain the cell cultures at appropriate cell densities and expanded to larger culture vessels as needed. In general, cells were moved to larger culture vessels when cell concentrations reach 1.5-2 million cells/mL or when cultures appear visibly dense and media is yellow.
- CD4+ T cells were reconstituted with fresh rhlL-7 and rhlL-15 at a final concentration of 50 ng/mL and 0.5 ng/mL, respectively, and CD8+ T cells were reconstituted with fresh rhlL-2 and rhlL-15 at a final concentration of 50 U/mL and 0.5 ng/mL, respectively.
- Activator beads were magnetically removed on Days 9-11 of stimulation.
- CAR T cells that did not contain DHFRdm for methotrexate-mediated selection of CAR expression such as those used in examples depicted in FIG. 8 B , FIG. 15 A , FIG. 15 C , FIG. 15 D , FIG. 15 D , FIG. 15 E , FIG. 18 C , FIG. 19 b , FIG. 19 C , FIG. 21 A and FIG. 21 B
- cells were magnetically sorted based on reporter EGFRt expression using biotinylated antibody and anti-biotin microbeads during Days 10-21 of culture.
- CAR T cells that did contain DHFRdm for methotrexate-mediated enrichment of CAR expression such as those used in examples depicted in FIG. 9 , FIG.
- cells were first treated on Days 7-14 of culture with 50 nM methotrexate, then ramped up to 100 nM methotrexate on Days 14-19 of culture, and finally brought back down to 50 nM for Days 19-21 of culture.
- methotrexate selection cells were separated on Ficol on Day 12 of culture to remove dead cells and improve culture viability.
- T cells for each CAR were placed into a rapid expansion protocol (REP) with irradiated feeder PBMCs and TM-LCL cells. If fresh, unfrozen PBMCs were used, 25 million PBMCs and 5 million TM-LCL cells were used in each REP culture. If frozen PBMCs were used, these feeder cell numbers were doubled. PBMCs and TM-LCL cells were irradiated at 3500 and 8000 rads, respectively, using a Cesium source irradiator. In addition to the normal cytokines mentioned above, cells were also supplemented with OKT3 antibody at 30 ng/ ⁇ L for Days 0-5 of REP to provide acute TCR stimulation.
- OKT3 antibody OKT3 antibody at 30 ng/ ⁇ L for Days 0-5 of REP to provide acute TCR stimulation.
- Irradiated feeder cells disintegrated by Day 5 of REP, and CAR T cells were maintained similarly to as described herein.
- CAR T cells that did contain DHFRdm for methotrexate-mediated enrichment of CAR expression such as those used in examples depicted in FIG. 9 , FIG. 10 , FIG. 12 , FIG. 13 , FIG. 14 A , and FIG. 14 B
- 100 nM methotrexate was not introduced until Day 5 of REP and was maintained until Day 12 of REP to further enrich CAR-positive cells.
- all CAR T cells described herein were introduced into functional chromium release cytotoxicity assays (CD8+ T cells only) as well as functional 3-plex cytokine release assays (CD4+ and CD8+ T cells).
- Target cells were incubated with 51 Cr overnight.
- the CTCT-PLE was also present in the media overnight with the 51 Cr.
- CD8+ antiFL and mock T cell effectors (usually in day 8-16 of a rapid expansion protocol) were washed, seeded with the target cells in triplicate at various E:T ratios (30:1, 10:1, 3:1, 1:1), and allowed to co-incubate for 4 hours at 37° C.
- E:T ratios (30:1, 10:1, 3:1, 1:1
- the CTCT-PLE was incubated overnight in media. The next day all target cells were harvested, washed, and seeded in a 96 well plate at a concentration of 5 ⁇ 10 4 cells per well. CD8+ antiFL and mock T cell effectors (usually in day 8-16 of a rapid expansion protocol) were washed and seeded (1 ⁇ 10 5 cells/well) with the target cells allowed to co-incubate for 24 hours at 37° C. After 24 hr the supernatant was harvested and IFN-gamma, TNF-alpha, and IL-2 concentration in the supernatant were measured by using a BioPlex® 200 system (Bio-Rad).
- FIG. 6 depicts cell positivity of CD8+ antiFL CARs T cell via staining for the selection marker EGFRt.
- antiFL(FITC-E2) CAR which comprised SEQ ID NO: 5 [96% positive].
- antiFL(4M5.3) CAR which comprised SEQ ID NO: 2 [80% positive].
- a mouse CD19-FITC antibody was incubated with the T cells and washed out.
- the binding domains of the CARs can comprise a sequence as set forth in SEQ ID NO: 1-6, and the spacer domains, which may also be part of the CARs, can comprise a sequence as set forth in SEQ ID NO: 7-9.
- FIG. 7 A , FIG. 7 B , and FIG. 7 C show CAR T cell recognition and activation through FL-PLE in vitro.
- K562 (leukemia) cells were incubated with FL-PLE overnight.
- Cell integration of FL-PLE was analyzed by flow cytometry ( FIG. 7 A ).
- the K562 OKT3+ cells (a cell line created to test the endogenous activation of T cells through the TCR) matched the K562 parental exactly. These cells were used in a chromium release assay ( FIG. 7 B ) and a cytokine release assay ( FIG. 7 C ) to test the activation of CD8+ antiFL(FITC-E2) CAR T cells compared with a CD8+ mock T cells from FIG. 6 . From these experiments, the antiFL (FITC-E2) CAR T cells recognized the FL moiety of the FL-PLE integrated into the plasma membrane and that the cells were activated. The amount of the activation was associated with the amount FL exposed on the surface of the cell.
- FIG. 8 A and FIG. 8 B depict the universality of FL-PLE loading in tumor cells and recognition of the fluorescein moiety by antiFL CAR T cells.
- K562 leukemia
- U87 glioblastoma
- 251T glioma
- Be2 neuroblastoma
- MDA-MB-231 adenocarcinoma
- NIH OVCAR adenocarcinoma
- 143B osteosarcoma
- FIG. 9 shows CD8+ antiFL CAR T cells selected by methotrexate, a chemotherapeutic in which antiFL CARs include CARs with FITC-E2 scFv domain and either a long, medium or short spacer, and other CARs having an antiFL scFv domain as labeled and a long spacer.
- CAR positivity of CD8+ antiFL CAR T cells staining for the surface marker EGFRt.
- These antiFL CARs also harbored a gene for a double mutant dihydrofolate reductase (DHFRdm) that confered methotrexate resistance for methotrexate-mediated enrichment of CAR-positive cells. Every cell line except minimum EGFRt+ cells were diluted with mock T cells to make equivalent stocks to use in functional assays. Target: 18.1% EGFRt+. Actual: about 13-20% EGFRt+.
- DHFRdm dihydrofolate reductase
- FIG. 10 shows another example in which CD4+ antiFL CAR T cells selected by methotrexate, a chemotherapeutic. CAR positivity of CD4+ antiFL CAR T cells via staining for the surface marker EGFRt.
- These antiFL CARs also harbor a gene for a double mutant dihydrofolate reductase (DHFRdm) that confers methotrexate resistance and, thus allows for methotrexate-mediated enrichment of CAR-positive cells. Every cell line except minimum EGFRt+ cells were diluted with mock T cells to make equivalent stocks to use in functional assays. Target: 18.1% EGFRt+. Actual: about 15-24% EGFRt+.
- DHFRdm dihydrofolate reductase
- Target cells were labelled with FL-PLE.
- FIG. 11 shows loading of cells with FL-PLE.
- Target cells for functional assays were made using K562 cells and MDA-MB-231 cells. Each cell group was labeled with FL-PLE.
- Cell integration of FL-PLE to the plasma membrane was analyzed by flow cytometry.
- FIG. 12 shows CD8+ antiFL CAR T cell cytotoxicity assays.
- MDA-MB-231 cells were incubated with FL-PLE. Cell integration of FL-PLE was analyzed by flow cytometry. These cells and the CAR T cells were used in a chromium release assay.
- the negative controls K562 Parental and MDA-MB-231) both showed no killing and the positive control (K562 OKT3+ cells) showed cell lysis as expected.
- the long CAR barely outperformed the medium; whereas only slight killing was seen with the short CAR.
- FIG. 14 A shows CD8+ antiFL CAR T cell assays with different antiFL scFv.
- MDA-MB-231 cells were incubated with FL-PLE. Cell integration of FL-PLE was analyzed by flow cytometry. These cells and the CAR T cells were used in a chromium release assay.
- the negative controls K562 Parental and MDA-MB-231) both showed no killing and the positive control (K562 OKT3+ cells) showed cell lysis as expected ( FIG. 14 A ).
- This chromium assay tested four different antiFL scFv's in the context of a long CAR.
- antiFL(4D5Flu) which comprised SEQ ID NO: 4 exhibited almost no killing.
- AntiFL (4D5Flu) in other experiments has shown the ability to lysis cells labeled with FL. Accordingly, antiFL(4D5Flu) was not orientated in the correct relationship to recognize the FL moiety on the FL-PLE when integrated into a cell membrane.
- FIG. 13 depicts CD4+ antiFL CAR T cell cytokine release assays.
- K562 and MDA-MB-231 cells were incubated with FL-PLE. Cell integration of FL-PLE was analyzed by flow cytometry. These cells and the antiFL CAR T cells were used in a cytokine release assay.
- the negative controls K562 Parental and MDA-MB-231) both showed no cytokine production and the positive control (K562 OKT3+ cells) showed production of all three cytokines for all cell lines.
- This assay was designed to study the relationship of the spacer length of CAR and FL-PLE. This data shows that only the long spacer CAR in relationship with FL-PLE was able to produce all three cytokines.
- FIG. 14 B depicts CD4+ antiFL CAR T cell cytokine release assays with different antiFL scFv.
- K562 and MDA-MB-231 cells were incubated with FL-PLE. Cell integration of FL-PLE was analyzed by flow cytometry. These cells and the CAR T cells were used in a cytokine release assay.
- the negative controls K562 Parental and MDA-MB-231) both showed no cytokine production and the positive control (K562 OKT3+ cells) showed production of all three cytokines for all cell lines.
- This cytokine release assay tested five different antiFL scFv's in the context of a long CAR.
- AntiFL(4M5.3) and antiFL(FITC-E2 Mut2) showed the best activation with FL-PLE and had vastly different disassociation constants, 270 fm and 3.1 nM respectively, showing that just lowering a CAR's disassociation constant did not necessarily make for the best CAR.
- the CAR that did not work in conjunction with FL-PLE was antiFL(4D5Flu), which comprised SEQ ID NO: 4.
- AntiFL(4D5Flu) exhibited no cytokine production in either cell line labeled with 5 ⁇ M FL-PLE.
- AntiFL(4D5Flu) in other experiments has shown the ability to lysis cells labeled with FL. Accordingly, antiFL(4D5Flu) was not orientated in the correct relationship to recognize the FL moiety on FL-PLE when integrated into a cell membrane.
- FIG. 15 A shows cell pure population of CD4+ and CD8+ antiFL CARs T cell via staining for the selection marker EGFRt.
- K562 leukemia
- MDA-MB-231 adenocarcinoma
- FIG. 16 shows in vivo targeting and integration of FL-PLE with FL moiety available for binding.
- FIG. 16 at top left shows 10 ⁇ fluorescent image, tumor was very bright compared to the normal healthy tissue, labeled as N. This showed the selective integration of FL-PLE into tumor membranes with FL moiety available for binding. Bottom left: bright signals were be seen when looking at the contralateral image of the brain. Right: To quantify this the MFI of the tumor and the contralateral side were individually calculated. This analysis was then repeated at multiple time points. These values were then plotted, generating a multiday retention time plot for FL-PLE upon this dose of FL-PLE.
- Results depicted in FIG. 17 demonstrate the universality of in vivo targeting and integration of FL-PLE.
- adenocarcinoma MDA-MB-231
- osteosarcoma 143B
- glioblastoma U87
- the adenocarcinoma and osteosarcoma each received two flank tumors in their respective groups and the glioblastoma only received one flank tumor.
- the fourth group had an adenocarcinoma tumor on one flank and an osteosarcoma on the opposite flank.
- mice received an intravenous injection of FL-PLE. Mice were sacrificed and tumors were harvested at various time points post FL-PLE injection.
- the tumors were removed and immediately fluorescently imaged for the presence of the fluorescein molecule on FL-PLE.
- the graphs of FIG. 17 for the three different types of cancer all show a multiday day retention time with FL-PLE before the tumor's fluorescence reach base line levels (tumor that has never received FL-PLE).
- the fourth group showed that FL-PLE simultaneously targeted two different types of cancers was retained for multiple days.
- FIG. 18 A and FIG. 18 B show ProFL-PLE ability to block CAR T cell recognition until unmasked.
- K562 (leukemia) cells were incubated with FL-PLE (high and low doses) or ProFL-PLE overnight.
- Cell integration of FL-PLE and ProFL-PLE was analyzed by flow cytometry ( FIG. 18 A ). There was a clear shift from the control K562 parental with the K562 parental incubated with high dose FL-PLE whereas there was a smaller shift with K562 parental incubated with low dose FL-PLE.
- FIG. 18 B shows cells used in a chromium release assay to test the activation of CD8+ antiFL CART cells compared with a CD8+ mock T cells.
- antiFL CAR T cells recognized the FL moiety of the FL-PLE integrated into the plasma membrane.
- the ProFL-PLE completely blocked the recognition of the antiFL CARs; whereas once the Pro protection was unmasked the FL moiety was available for recognition of antiFL CARs.
- the lysis of the unmasked ProFL-PLE was about the same as the Low Dose FL-PLE, which correlated with the amount of FL exposed on the surface of the k562 cells.
- FIGS. 18 A and 18 C shows cells used in a cytokine release assay to demonstrate the activation of CD4+ antiFL CAR T cells compared with a CD4+ mock T cells.
- Cell integration of FL-PLE and ProFL-PLE was analyzed by flow cytometry ( FIG. 18 A ).
- negative controls K562 Parental
- K562 OKT3+ cells showed production of all three cytokines for all cell lines.
- FL-PLE labeled cells were able to generate all three cytokines and was dependent on the amount of FL exposed on the surface.
- ProFL-PLE cells labeled with the pro moiety still intact produced no cytokine meaning the antiFL CAR T cells were not activated.
- ProFL-PLE labeled cells produced all 3 cytokines showing that upon removal of the Pro moiety the antiFL CAR T cell activated through ProFL-PLE integrated into the surface of a cancer cell.
- labelling tumor cells with a masked hapten conjugated with a lipid, such as ProFL-PLE unmasking the hapten to obtain a unmasked hapten conjugated to a lipid integrated into a tumor cell membrane, and contacting the unmasked hapten with an anti-hapten CAR T cell activates the T cell in at least an in vitro environment.
- FIG. 19 A , FIG. 19 B , and FIG. 19 C depict ProFL-PLE blocking CAR T cell recognition until unmasked, after unmasking the antiFL CAR T cell recognized the newly exposed fluorescein on the surface was then activated.
- K562 (leukemia) cells were incubated with FL-PLE or ProFL-PLE overnight. Cell integration of FL-PLE and ProFL-PLE was analyzed by flow cytometry ( FIG. 19 A ). There was a clear shift from the control K562 parental with the K562 parental incubated with FL-PLE corresponding to the amount of FL exposed on the surface of the cell for CAR T cell recognition.
- ProFL-PLE was not fluorescent due to the presence of the masking agent, a phenolic hydroxy group.
- FIG. 19 B shows cells used in a cytokine release assay to continue to prove the activation of CD4+ and CD8+ antiFL CART cells compared with a CD4+ and CD8+ mock T cells.
- the negative controls showed no cytokine production and the positive control (K562 OKT3+ cells) showed production of all three cytokines for all cell lines.
- FL-PLE labeled cells were able to generate all three cytokines.
- ProFL-PLE cells labeled with the pro moiety still intact produced no cytokine meaning the antiFL CAR T cells were not activating as designed.
- After unmasking ProFL-PLE labeled cells produced all 3 cytokines showing that upon removal of the Pro moiety the antiFL CAR T cell activated through the unmasked ProFL-PLE integrated into the surface of the cancer cell. This shows the design of the ProFL-PLE works in an in vitro environment.
- 19 C depicts results of staining cells from the co-culture of the cytokine release assay to investigate the up regulation of activation markers (LAG3, 41BB, and PD-1) on the CART cells after 24 hrs.
- the live CD8+ antiFL(FITC-E2) long spacer CAR T cells are shown.
- the negative control co-culture with k562 Parental showed no up regulation of activation markers and the positive control (K562 OKT3+ cells) showed up regulation of all three activation markers.
- the K562 cells with ProFL-PLE showed only slightly elevated amounts of the activation markers meaning the intact Pro moiety was blocking antiFL CAR T cell recognition and activation.
- K562 cells with FL-PLE or unmasked ProFL-PLE had similar levels of activation as the positive control showing that the antiFL CAR T cells were activating similarly through FL-PLE and unmasked ProFL-PLE.
- FIG. 20 shows initial FL-PLE and ProFL-PLE in vivo therapy.
- a neuroblastoma (Be2) tumor was established in 3 groups of mice by intracranial injection, the mice received an intracranial injection of T cells comprising an antiFL(FITCE2) long spacer CAR, which comprised SEQ ID NO: 5.
- the control group only received the antiFL(FITCE2) long spacer CAR T cells and the tumor progressed as normal (black bar).
- the second group receive a single intravenous injection of FL-PLE prior to T cell injection. This group lived ⁇ 20% longer than the control group.
- the third group received 3 scheduled doses of ProFL-PLE via intravenous injection (one before T cell injection and two post T cell injection), which led to ⁇ 20% longer life span for the mice. These results additionally confirmed that ProFL-PLE was safe for re-dosing.
- FIG. 21 A and FIG. 21 B show ProFL-PLE in vivo therapy for a flank tumor model.
- adenocarcinoma MDA-MB-231 eGFP:ffLuc IL2+
- tumors (2 tumors per mouse) were established in three groups of mice by subcutaneous injection, two groups of mice received injection of ProFL-PLE either intratumorally ( FIG. 21 A ) or intravenously (IV) ( FIG. 21 B ) and the control group received no injection of drug. Following the first injection of drug all three groups received IV injection of cells containing the antiFL(FITC-E2) long spacer CAR.
- FIG. 21 A The ProFL-PLE intratumorally injected group received 12 doses of ProFL-PLE over 45 days and the tumor regressed to baseline levels by day 40 for all 3 mice. The mice lived tumor free till the end of the study on day 90.
- FIG. 21 B The ProFL-PLE IV injected group received 10 doses of ProFL-PLE over 34 days and the tumor regressed to baseline levels by day ⁇ 40 for 2 mice. These mice lived tumor free till the end of the study on day 90. One mouse from this group died on day 16 with the control mice.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Cell Biology (AREA)
- Engineering & Computer Science (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- General Chemical & Material Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Food Science & Technology (AREA)
- Microbiology (AREA)
- Analytical Chemistry (AREA)
- Biotechnology (AREA)
- Pathology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Physics & Mathematics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Physics & Mathematics (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicinal Preparation (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
Description
| SVLTQPSSVSAAPGQKVTISCSGSTSNIGNNYVSWYQQHPGKAPKLMIYD |
| VSKRPSGVPDRFSGSKSGNSASLDISGLQSEDEADYYCAAWDDSLSEFLF |
| GTGTKLTVLGGGGGSGGGGSGGGGSQVQLVESGGNLVQPGGSLRLSCAAS |
| GFTFGSFSMSWVRQAPGGGLEWVAGLSARSSLTHYADSVKGRFTISRDNA |
| KNSVYLQMNSLRVEDTAVYYCARRSYDSSGYWGHFASYMDVWGQGTLVTV |
| S. |
| DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLRWYLQKPGQSPK |
| VLIYKVSNRVSGVPDRFSGSGSGTDFTLKINRVEAEDLGVYFCSQSTHVP |
| WTFGGGTKLEIKSSADDAKKDAAKKDDAKKDDAKKDGGVKLDETGGGLVQ |
| PGGAMKLSCVTSGFTFGHYWMNWVRQSPEKGLEWVAQFRNKPYNYETYYS |
| DSVKGRFTISRDDSKSSVYLQMNNLRVEDTGIYYCTGASYGMEYLGQGTS |
| VTVS. |
| DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSQGNTYLRWYLQKPGQSPK |
| VLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVP |
| WTFGGGTKLEIGGGGSGGGGSGGGGSEVKLDETGGGLVQPGRPMKLSCVA |
| SGFTFSDYWMNWVRQSPEKGLEWVAQIRNKPYNYETYYSDSVKGRFTISR |
| DDSKSSVYLQMNNLRVEDMGIYYCTGSYYGMDYWGQGTSVTVSS. |
| DYKDIQMTQSPSSLSASVGDRVTITCRASQSLVHSQGNTYLRWYQQKPGK |
| APKVLIYKVSNRFSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQST |
| HVPWTFGQGTKVELKRAGGGGSGGGGSGGGGSSGGGSGGGGSGGGGSEVQ |
| LVESGGGLVQPGGSLRLSCAASGFTFSMWMNWVRQAPGKGLEWVAQIRNK |
| PYNYETYYADSVKGRFTISRDTSKNTVYLQMNSLRAEDTAVYYCTGSYYG |
| MDYWGQGTLVTVSS. |
| SVLTQPSSVSAAPGQKVTISCSGSTSNIGNNYVSWYQQHPGKAPKLMIYD |
| VSKRPSGVPDRFSGSKSGNSASLDISGLQSEDEADYYCAAWDDSLSEFLF |
| GTGTKLTVLGGGGGSGGGGSGGGGSQVQLVESGGNLVQPGGSLRLSCAAS |
| GFTFGSFSMSWVRQAPGGGLEWVAGLSARSSLTHYADSVKGRFTISRDNA |
| KNSVYLQMNSLRVEDTAVYYCARRSYDSSGYWGHFYSYMDVWGQGTLVTV |
| S. |
| SVLTQPSSVSAAPGQKVTISCSGSTSNIGNNYVSWYQQHPGKAPKLMIYD |
| VSKRPSGVPDRFSGSKSGNSASLDISGLQSEDEADYYCAAWDDSLSEFLF |
| GTGTKLTVLGGGGGSGGGGSGGGGSQVQLVESGGNLVQPGGSLRLSCAAS |
| GFTFGSFSMSWVRQAPGGGLEWVAGLSARSSLTHYADSVKGRFTISRDNA |
| KNSVYLQMNSLRVEDTAVYYCARRSYDSSGYWGAFYSYMDVWGQGTLVTV |
| S. |
| TABLE 1 | |
| SEQ ID NO. | |
| (description) | SEQUENCE |
| SEQ ID NO: 01 | SVLTQPSSVSAAPGQKVTISCSGSTSNIGNNYVSWYQQHPGKAPKLMIY |
| (scFv of antiFL | DVSKRPSGVPDRFSGSKSGNSASLDISGLQSEDEADYYCAAWDDSLSEF |
| (FITCE2 Mut2 CAR) | LFGTGTKLTVLGGGGGSGGGGSGGGGSQVQLVESGGNLVQPGGSLRLSC |
| AASGFTFGSFSMSWVRQAPGGGLEWVAGLSARSSLTHYADSVKGRFTIS | |
| RDNAKNSVYLQMNSLRVEDTAVYYCARRSYDSSGYWGHFASYMDVWGQG | |
| TLVTVS | |
| SEQ ID NO: 02 | DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLRWYLQKPGQSPKVLI |
| (antiFL(4M5.3) CAR) | YKVSNRVSGVPDRFSGSGSGTDFTLKINRVEAEDLGVYFCSQSTHVPWTFGGG |
| TKLEIKSSADDAKKDAAKKDDAKKDDAKKDGGVKLDETGGGLVQPGGAMKL | |
| SCVTSGFTFGHYWMNWVRQSPEKGLEWVAQFRNKPYNYETYYSDSVKGRFT | |
| ISRDDSKSSVYLQMNNLRVEDTGIYYCTGASYGMEYLGQGTSVTVS | |
| SEQ ID NO: 03 | DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSQGNTYLRWYLQKPGQSPKVLI |
| (scFv of | YKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPWTFGGG |
| antiFL(4420) CAR) | TKLEIGGGGSGGGGSGGGGSEVKLDETGGGLVQPGRPMKLSCVASGFTFSDY |
| WMNWVRQSPEKGLEWVAQIRNKPYNYETYYSDSVKGRFTISRDDSKSSVYLQ | |
| MNNLRVEDMGIYYCTGSYYGMDYWGQGTSVTVSS | |
| SEQ ID NO: 04 | DYKDIQMTQSPSSLSASVGDRVTITCRASQSLVHSQGNTYLRWYQQKPGK |
| (scFv of | APKVLIYKVSNRFSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQST |
| antiFL(4D5Flu) CAR) | HVPWTFGQGTKVELKRAGGGGSGGGGSGGGGSSGGGSGGGGSGGGGSEVQ |
| LVESGGGLVQPGGSLRLSCAASGFTFSDYWMNWVRQAPGKGLEWVAQIRN | |
| KPYNYETYYADSVKGRFTISRDTSKNTVYLQMNSLRAEDTAVYYCTGSYY | |
| GMDYWGQGTLVTVSS | |
| SEQ ID NO: 05 | SVLTQPSSVSAAPGQKVTISCSGSTSNIGNNYVSWYQQHPGKAPKLMIYDV |
| (scFv of | SKRPSGVPDRFSGSKSGNSASLDISGLQSEDEADYYCAAWDDSLSEFLFGT |
| antiFL(FITCE2) CAR) | GTKLTVLGGGGGSGGGGSGGGGSQVQLVESGGNLVQPGGSLRLSCAASGFT |
| FGSFSMSWVRQAPGGGLEWVAGLSARSSLTHYADSVKGRFTISRDNAKNSV | |
| YLQMNSLRVEDTAVYYCARRSYDSSGYWGHFYSYMDVWGQGTLVTVS | |
| SEQ ID NO: 06 | SVLTQPSSVSAAPGQKVTISCSGSTSNIGNNYVSWYQQHPGKAPKLMIYDV |
| (scFv of | SKRPSGVPDRFSGSKSGNSASLDISGLQSEDEADYYCAAWDDSLSEFLFGT |
| antiFL(FITCE2 | GTKLTVLGGGGGSGGGGSGGGGSQVQLVESGGNLVQPGGSLRLSCAASGFT |
| HisH131Ala)) | FGSFSMSWVRQAPGGGLEWVAGLSARSSLTHYADSVKGRFTISRDNAKNSV |
| YLQMNSLRVEDTAVYYCARRSYDSSGYWGAFYSYMDVWGQGTLVTVS | |
| SEQ ID NO: 07 | ESKYGPPCPPCPAPEFDGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQE |
| (IgG4 hinge | DPEVQFNWYVDGVEVHNAKTKPREEQFQSTYRVVSVLTVLHQDWLNGKEYK |
| connected to a CH2 | CKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKG |
| domain to a CH3 | FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNV |
| domain spacer) | FSCSVMHEALHNHYTQKSLSLSLGK |
| SEQ ID NO: 08 | ESKYGPPCPPCPGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAV |
| (IgG4 hinge | EWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHE |
| connected to a CH3 | ALHNHYTQKSLSLSLGK |
| domain spacer) | |
| SEQ ID NO: 09 | ESKYGPPCPPCP |
| (IgG4 hinge only | |
| spacer) | |
| SEQ ID NO: 10 | ATGCTTCTCCTGGTGACAAGCCTTCTGCTCTGTGAGTTACCACACCCAGCAT |
| (E2 anti-fluorescein | TCCTCCTGATCCCAAGCGTGCTGACACAGCCTAGCTCCGTGTCTGCCGCCCC |
| antibody fragment | TGGCCAGAAAGTGACCATCAGCTGTAGCGGCAGCACCAGCAACATCGGCA |
| CAR nucleic acid | ACAACTACGTGTCCTGGTATCAGCAGCACCCCGGCAAGGCCCCCAAGCTGA |
| sequence) | TGATCTACGACGTGTCCAAGCGGCCCAGCGGCGTGCCCGATAGATTTTCCG |
| GCAGCAAGAGCGGCAACAGCGCCAGCCTGGATATCAGCGGCCTGCAGTCT | |
| GAGGACGAGGCCGACTACTATTGCGCCGCCTGGGACGATAGCCTGAGCGA | |
| GTTCCTGTTTGGCACCGGCACCAAGCTGACAGTGCTGGGCGGAGGCGGAG | |
| GATCTGGCGGCGGAGGAAGTGGCGGAGGGGGATCTCAGGTGCAGCTGGT | |
| GGAAAGCGGCGGCAACCTGGTGCAGCCTGGCGGATCTCTGAGACTGAGCT | |
| GTGCCGCCAGCGGCTTCACCTTCGGCAGCTTCAGCATGAGCTGGGTGCGC | |
| CAGGCTCCTGGGGGAGGACTGGAATGGGTGGCAGGACTGAGCGCCAGAA | |
| GCAGCCTGACCCACTACGCCGATAGCGTGAAGGGCCGGTTCACCATCAGC | |
| CGGGACAACGCCAAGAACAGCGTGTACCTGCAGATGAACAGCCTGCGGGT | |
| GGAAGATACCGCCGTGTACTACTGCGCCAGACGGTCCTACGACAGCAGCG | |
| GCTACTGGGGCCACTTCTACAGCTACATGGACGTGTGGGGCCAGGGCACC | |
| CTCGTGACAGTGTCTGAGAGCAAGTACGGACCGCCCTGCCCCCCTTGCCCT | |
| GCCCCCGAGTTCGACGGCGGACCCAGCGTGTTCCTGTTCCCCCCCAAGCCC | |
| AAGGACACCCTGATGATCAGCCGGACCCCCGAGGTGACCTGCGTGGTGGT | |
| GGACGTGAGCCAGGAAGATCCCGAGGTCCAGTTCAATTGGTACGTGGACG | |
| GCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGAGGAACAGTTCCA | |
| GAGCACCTACCGGGTGGTGTCTGTGCTGACCGTGCTGCACCAGGACTGGC | |
| TGAACGGCAAAGAATACAAGTGCAAGGTGTCCAACAAGGGCCTGCCCAGC | |
| AGCATCGAAAAGACCATCAGCAAGGCCAAGGGCCAGCCTCGCGAGCCCCA | |
| GGTGTACACCCTGCCTCCCTCCCAGGAAGAGATGACCAAGAACCAGGTGT | |
| CCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGT | |
| GGGAGAGCAACGGCCAGCCTGAGAACAACTACAAGACCACCCCTCCCGTG | |
| CTGGACAGCGACGGCAGCTTCTTCCTGTACAGCCGGCTGACCGTGGACAA | |
| GAGCCGGTGGCAGGAAGGCAACGTCTTTAGCTGCAGCGTGATGCACGAG | |
| GCCCTGCACAACCACTACACCCAGAAGAGCCTGAGCCTGTCCCTGGGCAA | |
| GATGTTCTGGGTGCTGGTGGTGGTGGGCGGGGTGCTGGCCTGCTACAGCC | |
| TGCTGGTGACAGTGGCCTTCATCATCTTTTGGGTGAAACGGGGCAGAAAG | |
| AAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTC | |
| AAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGG | |
| ATGTGAACTGCGGGTGAAGTTCAGCAGAAGCGCCGACGCCCCTGCCTACC | |
| AGCAGGGCCAGAATCAGCTGTACAACGAGCTGAACCTGGGCAGAAGGGA | |
| AGAGTACGACGTCCTGGATAAGCGGAGAGGCCGGGACCCTGAGATGGGC | |
| GGCAAGCCTCGGCGGAAGAACCCCCAGGAAGGCCTGTATAACGAACTGCA | |
| GAAAGACAAGATGGCCGAGGCCTACAGCGAGATCGGCATGAAGGGCGAG | |
| CGGAGGCGGGGCAAGGGCCACGACGGCCTGTATCAGGGCCTGTCCACCG | |
| CCACCAAGGATACCTACGACGCCCTGCACATGCAGGCCCTGCCCCCAAGGC | |
| TCGAGGGCGGCGGAGAGGGCAGAGGAAGTCTTCTAACATGCGGTGACGT | |
| GGAGGAGAATCCCGGCCCTAGGATGCTTCTCCTGGTGACAAGCCTTCTGCT | |
| CTGTGAGTTACCACACCCAGCATTCCTCCTGATCCCACGCAAAGTGTGTAAC | |
| GGAATAGGTATTGGTGAATTTAAAGACTCACTCTCCATAAATGCTACGAAT | |
| ATTAAACACTTCAAAAACTGCACCTCCATCAGTGGCGATCTCCACATCCTGC | |
| CGGTGGCATTTAGGGGTGACTCCTTCACACATACTCCTCCTCTGGATCCACA | |
| GGAACTGGATATTCTGAAAACCGTAAAGGAAATCACAGGGTTTTTGCTGAT | |
| TCAGGCTTGGCCTGAAAACAGGACGGACCTCCATGCCTTTGAGAACCTAGA | |
| AATCATACGCGGCAGGACCAAGCAACATGGTCAGTTTTCTCTTGCAGTCGT | |
| CAGCCTGAACATAACATCCTTGGGATTACGCTCCCTCAAGGAGATAAGTGA | |
| TGGAGATGTGATAATTTCAGGAAACAAAAATTTGTGCTATGCAAATACAAT | |
| AAACTGGAAAAAACTGTTTGGGACCTCCGGTCAGAAAACCAAAATTATAA | |
| GCAACAGAGGTGAAAACAGCTGCAAGGCCACAGGCCAGGTCTGCCATGCC | |
| TTGTGCTCCCCCGAGGGCTGCTGGGGCCCGGAGCCCAGGGACTGCGTCTC | |
| TTGCCGGAATGTCAGCCGAGGCAGGGAATGCGTGGACAAGTGCAACCTTC | |
| TGGAGGGTGAGCCAAGGGAGTTTGTGGAGAACTCTGAGTGCATACAGTG | |
| CCACCCAGAGTGCCTGCCTCAGGCCATGAACATCACCTGCACAGGACGGG | |
| GACCAGACAACTGTATCCAGTGTGCCCACTACATTGACGGCCCCCACTGCG | |
| TCAAGACCTGCCCGGCAGGAGTCATGGGAGAAAACAACACCCTGGTCTGG | |
| AAGTACGCAGACGCCGGCCATGTGTGCCACCTGTGCCATCCAAACTGCACC | |
| TACGGATGCACTGGGCCAGGTCTTGAAGGCTGTCCAACGAATGGGCCTAA | |
| GATCCCGTCCATCGCCACTGGGATGGTGGGGGCCCTCCTCTTGCTGCTGGT | |
| GGTGGCCCTGGGGATCGGCCTCTTCATGTGA | |
| SEQ ID NO: 11 | MLLLVTSLLLCELPHPAFLLIPSVLTQPSSVSAAPGQKVTISCSGSTSNIGN |
| (E2 anti-fluorescein | NYVSWYQQHPGKAPKLMIYDVSKRPSGVPDRFSGSKSGNSASLDISGLQSED |
| antibody fragment | EADYYCAAWDDSLSEFLFGTGTKLTVLGGGGGSGGGGSGGGGSQVQLVESGG |
| CAR amino acid | NLVQPGGSLRLSCAASGFTFGSFSMSWVRQAPGGGLEWVAGLSARSSLTHYA |
| sequence) | DSVKGRFTISRDNAKNSVYLQMNSLRVEDTAVYYCARRSYDSSGYWGHFYSY |
| MDVWGQGTLVTVSESKYGPPCPPCPAPEFDGGPSVFLFPPKPKDTLMISRTP | |
| EVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFQSTYRVVSVLTVL | |
| HQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN | |
| QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVD | |
| KSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKMFWVLVVVGGVLACYSLL | |
| VTVAFIIFWVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL | |
| RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRK | |
| NPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDAL | |
| HMQALPPRLEGGGEGRGSLLTCGDVEENPGPRMLLLVTSLLLCELPHPAFLL | |
| IPRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTH | |
| TPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQ | |
| FSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQK | |
| TKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKC | |
| NLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHC | |
| VKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKI | |
| PSIATGMVGALLLLLVVALGIGLFM | |
| SEQ ID NO: 12 | MLLLVTSLLLCELPHPAFLLIPDVVMTQTPLSLPVSLGDQASISCRSSQS |
| (4M5.3-CAR amino | LVHSNGNTYLRWYLQKPGQSPKVLIYKVSNRVSGVPDRFSGSGSGTDFTL |
| acid sequence) | KINRVEAEDLGVYFCSQSTHVPWTFGGGTKLEIKSSADDAKKDAAKKDDA |
| KKDDAKKDGGVKLDETGGGLVQPGGAMKLSCVTSGFTFGHYWMNWVRQSP | |
| EKGLEWVAQFRNKPYNYETYYSDSVKGRFTISRDDSKSSVYLQMNNLRVE | |
| DTGIYYCTGASYGMEYLGQGTSVTVSESKYGPPCPPCPAPEFDGGPSVFL | |
| FPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPR | |
| EEQFQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQ | |
| PREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK | |
| TTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLS | |
| LSLGKMFWVLVVVGGVLACYSLLVTVAFIIFWVKRGRKKLLYIFKQPFMR | |
| PVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELN | |
| LGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIG | |
| MKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRLEGGGEGRGSLLT | |
| CGDVEENPGPRMLLLVTSLLLCELPHPAFLLIPRKVCNGIGIGEFKDSLS | |
| INATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKE | |
| ITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGL | |
| RSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCK | |
| ATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFV | |
| ENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVM | |
| GENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSIATGM | |
| VGALLLLLVVALGIGLFM | |
| SEQ ID NO: 13 | ATGCTTCTCCTGGTGACAAGCCTTCTGCTCTGTGAGTTACCACACCCAGCAT |
| (4M 5.3-CAR | TCCTCCTGATCCCAGACGTTGTAATGACCCAGACCCCTCTGTCTCTCCCCGT |
| nucleotide | AAGCTTGGGCGACCAGGCGAGCATCTCTTGTCGGTCTTCCCAGTCCCTGGT |
| seq uence) | CCATTCAAACGGCAATACTTACTTGCGGTGGTACTTGCAGAAGCCCGGTCA |
| ATCCCCAAAAGTGCTGATATACAAGGTTAGCAATCGGGTCAGTGGAGTGC | |
| CCGACCGCTTCAGCGGAAGCGGATCCGGGACTGACTTCACTCTGAAGATC | |
| AACCGGGTAGAAGCTGAAGACCTGGGGGTGTACTTCTGCTCTCAGTCAAC | |
| ACACGTGCCATGGACCTTTGGAGGTGGCACCAAGCTGGAAATCAAATCAT | |
| CAGCGGACGATGCCAAAAAAGACGCGGCCAAGAAGGACGATGCCAAGAA | |
| GGATGATGCTAAAAAGGATGGCGGAGTCAAATTGGACGAGACAGGCGGG | |
| GGACTGGTGCAGCCCGGCGGTGCCATGAAACTGTCTTGTGTGACCAGCGG | |
| CTTTACCTTCGGGCATTATTGGATGAACTGGGTGCGACAGTCTCCAGAGAA | |
| AGGGCTCGAGTGGGTGGCCCAGTTTCGAAATAAACCGTACAATTATGAGA | |
| CCTACTATTCAGATTCTGTGAAAGGGCGCTTCACTATTTCACGCGACGACA | |
| GCAAAAGTTCCGTCTACCTTCAGATGAACAACCTTAGAGTGGAGGATACCG | |
| GAATATACTACTGCACGGGTGCCAGTTATGGCATGGAGTACTTGGGGCAG | |
| GGGACATCTGTGACCGTTTCTGAGAGCAAGTACGGACCGCCCTGCCCCCCT | |
| TGCCCTGCCCCCGAGTTCGACGGCGGACCCAGCGTGTTCCTGTTCCCCCCC | |
| AAGCCCAAGGACACCCTGATGATCAGCCGGACCCCCGAGGTGACCTGCGT | |
| GGTGGTGGACGTGAGCCAGGAAGATCCCGAGGTCCAGTTCAATTGGTACG | |
| TGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCCAGAGAGGAACA | |
| GTTCCAGAGCACCTACCGGGTGGTGTCTGTGCTGACCGTGCTGCACCAGG | |
| ACTGGCTGAACGGCAAAGAATACAAGTGCAAGGTGTCCAACAAGGGCCTG | |
| CCCAGCAGCATCGAAAAGACCATCAGCAAGGCCAAGGGCCAGCCTCGCGA | |
| GCCCCAGGTGTACACCCTGCCTCCCTCCCAGGAAGAGATGACCAAGAACCA | |
| GGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGT | |
| GGAGTGGGAGAGCAACGGCCAGCCTGAGAACAACTACAAGACCACCCCTC | |
| CCGTGCTGGACAGCGACGGCAGCTTCTTCCTGTACAGCCGGCTGACCGTG | |
| GACAAGAGCCGGTGGCAGGAAGGCAACGTCTTTAGCTGCAGCGTGATGCA | |
| CGAGGCCCTGCACAACCACTACACCCAGAAGAGCCTGAGCCTGTCCCTGG | |
| GCAAGATGTTCTGGGTGCTGGTGGTGGTGGGCGGGGTGCTGGCCTGCTAC | |
| AGCCTGCTGGTGACAGTGGCCTTCATCATCTTTTGGGTGAAACGGGGCAG | |
| AAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAAC | |
| TACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAG | |
| GAGGATGTGAACTGCGGGTGAAGTTCAGCAGAAGCGCCGACGCCCCTGCC | |
| TACCAGCAGGGCCAGAATCAGCTGTACAACGAGCTGAACCTGGGCAGAAG | |
| GGAAGAGTACGACGTCCTGGATAAGCGGAGAGGCCGGGACCCTGAGATG | |
| GGCGGCAAGCCTCGGCGGAAGAACCCCCAGGAAGGCCTGTATAACGAACT | |
| GCAGAAAGACAAGATGGCCGAGGCCTACAGCGAGATCGGCATGAAGGGC | |
| GAGCGGAGGCGGGGCAAGGGCCACGACGGCCTGTATCAGGGCCTGTCCA | |
| CCGCCACCAAGGATACCTACGACGCCCTGCACATGCAGGCCCTGCCCCCAA | |
| GGCTCGAGGGCGGCGGAGAGGGCAGAGGAAGTCTTCTAACATGCGGTGA | |
| CGTGGAGGAGAATCCCGGCCCTAGGATGCTTCTCCTGGTGACAAGCCTTCT | |
| GCTCTGTGAGTTACCACACCCAGCATTCCTCCTGATCCCACGCAAAGTGTGT | |
| AACGGAATAGGTATTGGTGAATTTAAAGACTCACTCTCCATAAATGCTACG | |
| AATATTAAACACTTCAAAAACTGCACCTCCATCAGTGGCGATCTCCACATCC | |
| TGCCGGTGGCATTTAGGGGTGACTCCTTCACACATACTCCTCCTCTGGATCC | |
| ACAGGAACTGGATATTCTGAAAACCGTAAAGGAAATCACAGGGTTTTTGCT | |
| GATTCAGGCTTGGCCTGAAAACAGGACGGACCTCCATGCCTTTGAGAACCT | |
| AGAAATCATACGCGGCAGGACCAAGCAACATGGTCAGTTTTCTCTTGCAGT | |
| CGTCAGCCTGAACATAACATCCTTGGGATTACGCTCCCTCAAGGAGATAAG | |
| TGATGGAGATGTGATAATTTCAGGAAACAAAAATTTGTGCTATGCAAATAC | |
| AATAAACTGGAAAAAACTGTTTGGGACCTCCGGTCAGAAAACCAAAATTAT | |
| AAGCAACAGAGGTGAAAACAGCTGCAAGGCCACAGGCCAGGTCTGCCAT | |
| GCCTTGTGCTCCCCCGAGGGCTGCTGGGGCCCGGAGCCCAGGGACTGCGT | |
| CTCTTGCCGGAATGTCAGCCGAGGCAGGGAATGCGTGGACAAGTGCAACC | |
| TTCTGGAGGGTGAGCCAAGGGAGTTTGTGGAGAACTCTGAGTGCATACAG | |
| TGCCACCCAGAGTGCCTGCCTCAGGCCATGAACATCACCTGCACAGGACG | |
| GGGACCAGACAACTGTATCCAGTGTGCCCACTACATTGACGGCCCCCACTG | |
| CGTCAAGACCTGCCCGGCAGGAGTCATGGGAGAAAACAACACCCTGGTCT | |
| GGAAGTACGCAGACGCCGGCCATGTGTGCCACCTGTGCCATCCAAACTGC | |
| ACCTACGGATGCACTGGGCCAGGTCTTGAAGGCTGTCCAACGAATGGGCC | |
| TAAGATCCCGTCCATCGCCACTGGGATGGTGGGGGCCCTCCTCTTGCTGCT | |
| GGTGGTGGCCCTGGGGATCGGCCTCTTCATGTGA | |
Methods of Therapy
- 1. Ma, J. S. et al. (2016). Versatile strategy for controlling the specificity and activity of engineered T cells. Versatile strategy for controlling the specificity and activity of engineered T cells. Proceedings of the National Academy of Sciences of the United States of America, 113(4), E450-E458.
- 2. Kim, M. S. et al. (2015). Redirection of Genetically Engineered CAR-T Cells Using Bifunctional Small Molecules. Journal of the American Chemical Society, 137(8), 2832-2835.
- 3. Urbanska, K. et al. (2012). A universal strategy for adoptive immunotherapy of cancer through use of a novel T-cell antigen receptor. Cancer Research, 72(7), 1844-1852.
- 4. Wu, C. Y. et al. (2015). Remote control of therapeutic T cells through a small molecule-gated chimeric receptor. Science, 350(6258), aab4077-aab4077.
- 5. Kranz et al. (1981). Partial elucidation of an anti-hapten repertoire in BALB/c mice: comparative characterization of several monoclonal antiFLuorescyl antibodies. Mol Immunol, 18(10), 889-898.
- 6. Jung et al. (1997). Improving in vivo folding and stability of a single-chain Fv antibody fragment by loop grafting. Protein Engineering Design & Selection, 10(8), 956-966.
- 7. Schwesinger et al. (2000). Unbinding forces of single antibody-antigen complexes correlate with their thermal dissociation rates. PNAS, 97(18), 9972-9977.
- 8. Boder et al. (2000). Directed evolution of antibody fragments with monovalent femtomolar antigen-binding affinity. PNAS, 97(20), 10701-10705.
- 9. Honegger et al. (2005). A mutation designed to alter crystal packing permits structural analysis of a tight-binding fluorescein-scFv complex. Prot Sci, 14(10), 2537-2549.
Claims (18)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/965,859 US12312416B2 (en) | 2018-02-06 | 2019-01-17 | Fluorescein-specific cars exhibiting optimal t cell function against FL-PLE labelled tumors |
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862627147P | 2018-02-06 | 2018-02-06 | |
| PCT/US2019/014054 WO2019156795A1 (en) | 2018-02-06 | 2019-01-17 | Fluorescein-specific cars exhibiting optimal t cell function against fl-ple labelled tumors |
| US16/965,859 US12312416B2 (en) | 2018-02-06 | 2019-01-17 | Fluorescein-specific cars exhibiting optimal t cell function against FL-PLE labelled tumors |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| US20200354477A1 US20200354477A1 (en) | 2020-11-12 |
| US12312416B2 true US12312416B2 (en) | 2025-05-27 |
Family
ID=67549567
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/965,859 Active 2042-04-19 US12312416B2 (en) | 2018-02-06 | 2019-01-17 | Fluorescein-specific cars exhibiting optimal t cell function against FL-PLE labelled tumors |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US12312416B2 (en) |
| EP (1) | EP3749695A4 (en) |
| JP (3) | JP7774961B2 (en) |
| CN (1) | CN111936518A (en) |
| AU (1) | AU2019218729B2 (en) |
| BR (1) | BR112020015884A2 (en) |
| CA (1) | CA3090089A1 (en) |
| IL (1) | IL276473A (en) |
| SG (1) | SG11202007426XA (en) |
| WO (1) | WO2019156795A1 (en) |
Families Citing this family (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4282419A1 (en) | 2012-12-20 | 2023-11-29 | Purdue Research Foundation | Chimeric antigen receptor-expressing t cells as anti-cancer therapeutics |
| US10611837B2 (en) | 2014-04-10 | 2020-04-07 | Seattle Children's Hospital | Transgene genetic tags and methods of use |
| EP3439675A4 (en) | 2016-04-08 | 2019-12-18 | Purdue Research Foundation | METHODS AND COMPOSITIONS FOR T CAR LYMPHOCYTE THERAPY |
| US11649288B2 (en) | 2017-02-07 | 2023-05-16 | Seattle Children's Hospital | Phospholipid ether (PLE) CAR T cell tumor targeting (CTCT) agents |
| WO2018160622A1 (en) | 2017-02-28 | 2018-09-07 | Endocyte, Inc. | Compositions and methods for car t cell therapy |
| US11311576B2 (en) | 2018-01-22 | 2022-04-26 | Seattle Children's Hospital | Methods of use for CAR T cells |
| US12312416B2 (en) | 2018-02-06 | 2025-05-27 | Seattle Children's Hospital | Fluorescein-specific cars exhibiting optimal t cell function against FL-PLE labelled tumors |
| AU2019225174B2 (en) | 2018-02-23 | 2025-11-20 | Endocyte, Inc. | Sequencing method for CAR T cell therapy |
| CA3096458A1 (en) | 2018-04-12 | 2019-10-17 | Umoja Biopharma, Inc. | Viral vectors and packaging cell lines |
| US20220017920A1 (en) | 2018-11-21 | 2022-01-20 | Umoja Biopharma, Inc. | Multicistronic vector for surface engineering lentiviral particles |
| CA3154281A1 (en) * | 2019-10-16 | 2021-04-22 | Andrew Scharenberg | Retroviral vector for universal receptor therapy |
| AU2021213735A1 (en) | 2020-01-30 | 2022-09-22 | Umoja Biopharma, Inc. | Bispecific transduction enhancer |
| CN115210252A (en) * | 2020-02-04 | 2022-10-18 | 西雅图儿童医院(Dba西雅图儿童研究所) | Chimeric antigen receptor against dinitrophenol |
| CN115397440A (en) * | 2020-02-04 | 2022-11-25 | 西雅图儿童医院(Dba西雅图儿童研究所) | Methods and compositions for stimulating chimeric antigen receptor T cells with hapten-labeled cells |
| CA3186029A1 (en) * | 2020-06-08 | 2021-12-16 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Anti-cd171 chimeric antigen receptors |
| EP4178626A4 (en) * | 2020-07-13 | 2024-08-14 | University of Southern California | UNIVERSAL CAR-NK CELL TARGETING VARIOUS HIV-1 GP160 EPITOPES |
| WO2022015955A1 (en) | 2020-07-16 | 2022-01-20 | Umoja Biopharma, Inc. | Gated adapter targeting receptor |
Citations (294)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1986004356A1 (en) | 1985-01-28 | 1986-07-31 | International Genetic Engineering, Inc. | AraB PROMOTERS AND METHOD OF PRODUCING POLYPEPTIDES, INCLUDINN CECROPINS, BY MICROBIOLOGICAL TECHNIQUES |
| US5116964A (en) | 1989-02-23 | 1992-05-26 | Genentech, Inc. | Hybrid immunoglobulins |
| WO1992010591A1 (en) | 1990-12-14 | 1992-06-25 | Cell Genesys, Inc. | Chimeric chains for receptor-associated signal transduction pathways |
| WO1992015671A1 (en) | 1991-03-08 | 1992-09-17 | Cytomed, Inc. | Soluble cd28 proteins and methods of treatment therewith |
| US5202238A (en) | 1987-10-27 | 1993-04-13 | Oncogen | Production of chimeric antibodies by homologous recombination |
| US5216132A (en) | 1990-01-12 | 1993-06-01 | Protein Design Labs, Inc. | Soluble t-cell antigen receptor chimeric antigens |
| US5514582A (en) | 1989-02-23 | 1996-05-07 | Genentech, Inc. | Recombinant DNA encoding hybrid immunoglobulins |
| US5525503A (en) | 1993-09-28 | 1996-06-11 | Dana-Farber Cancer Institute, Inc. | Signal transduction via CD28 |
| US5538866A (en) | 1992-11-05 | 1996-07-23 | Sloan-Kettering Institute For Cancer Research | Prostate-specific membrane antigen |
| US5670148A (en) | 1991-10-21 | 1997-09-23 | Cell Genesys, Inc. | Combined cellular and immunosuppressive therapies |
| US5686281A (en) | 1995-02-03 | 1997-11-11 | Cell Genesys, Inc. | Chimeric receptor molecules for delivery of co-stimulatory signals |
| US5741899A (en) | 1995-02-02 | 1998-04-21 | Cell Genesys, Inc. | Chimeric receptors comprising janus kinase for regulating cellular pro liferation |
| US5747292A (en) | 1993-04-06 | 1998-05-05 | Fred Hutchinson Cancer Research Center | Chimeric cytokine receptors in lymphocytes |
| US5830755A (en) | 1995-03-27 | 1998-11-03 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | T-cell receptors and their use in therapeutic and diagnostic methods |
| US5834256A (en) | 1993-06-11 | 1998-11-10 | Cell Genesys, Inc. | Method for production of high titer virus and high efficiency retroviral mediated transduction of mammalian cells |
| US5843728A (en) | 1991-03-07 | 1998-12-01 | The General Hospital Corporation | Redirection of cellular immunity by receptor chimeras |
| US5851828A (en) | 1991-03-07 | 1998-12-22 | The General Hospital Corporation | Targeted cytolysis of HIV-infected cells by chimeric CD4 receptor-bearing cells |
| US5906936A (en) | 1988-05-04 | 1999-05-25 | Yeda Research And Development Co. Ltd. | Endowing lymphocytes with antibody specificity |
| US5912170A (en) | 1991-03-07 | 1999-06-15 | The General Hospital Corporation | Redirection of cellular immunity by protein-tyrosine kinase chimeras |
| US5914109A (en) | 1990-06-15 | 1999-06-22 | New York University | Heterohybridomas producing human monoclonal antibodies to HIV-1 |
| US5935818A (en) | 1995-02-24 | 1999-08-10 | Sloan-Kettering Institute For Cancer Research | Isolated nucleic acid molecule encoding alternatively spliced prostate-specific membrane antigen and uses thereof |
| US5969102A (en) | 1997-03-03 | 1999-10-19 | St. Jude Children's Research Hospital | Lymphocyte surface receptor that binds CAML, nucleic acids encoding the same and methods of use thereof |
| US6004781A (en) | 1988-01-22 | 1999-12-21 | The General Hospital Corporation | Nucleic acid encoding Ig-CD4 fusion proteins |
| US6005004A (en) | 1994-08-05 | 1999-12-21 | Molecular / Structural Biotechnologies, Inc. | Lipophilic-polycationic delivery systems |
| US6004811A (en) | 1991-03-07 | 1999-12-21 | The Massachussetts General Hospital | Redirection of cellular immunity by protein tyrosine kinase chimeras |
| US6083751A (en) | 1994-11-01 | 2000-07-04 | Targeted Genetics Corporation | Chimeric receptors for the generation of selectively-activatable TH-independent cytotoxic T cells |
| US6103521A (en) | 1995-02-06 | 2000-08-15 | Cell Genesys, Inc. | Multispecific chimeric receptors |
| US6132718A (en) | 1994-07-06 | 2000-10-17 | Immunomedics, Inc. | Multi-stage cascade boosting vaccine |
| US6218187B1 (en) | 1993-06-11 | 2001-04-17 | Cell Genesys, Inc. | Method for production of high titer virus and high efficiency retroviral mediated transduction of mammalian cells |
| US6261787B1 (en) | 1996-06-03 | 2001-07-17 | Case Western Reserve University | Bifunctional molecules for delivery of therapeutics |
| US20010031252A1 (en) | 2000-03-31 | 2001-10-18 | Low Philip Stewart | Method of treatment using ligand-immunogen conjugates |
| US6319494B1 (en) | 1990-12-14 | 2001-11-20 | Cell Genesys, Inc. | Chimeric chains for receptor-associated signal transduction pathways |
| WO2001091625A2 (en) | 2000-04-21 | 2001-12-06 | Rutgers, The State University Of New Jersey | Methods and compositions for the diagnosis of schizophrenia |
| US20020004052A1 (en) | 1990-05-08 | 2002-01-10 | David Berd | Composition comprising a tumor cell extract and method of using the composition |
| US6395152B1 (en) | 1998-07-09 | 2002-05-28 | Acm Research, Inc. | Methods and apparatus for electropolishing metal interconnections on semiconductor devices |
| US6407221B1 (en) | 1990-12-14 | 2002-06-18 | Cell Genesys, Inc. | Chimeric chains for receptor-associated signal transduction pathways |
| US6406697B1 (en) | 1989-02-23 | 2002-06-18 | Genentech, Inc. | Hybrid immunoglobulins |
| US6410319B1 (en) | 1998-10-20 | 2002-06-25 | City Of Hope | CD20-specific redirected T cells and their use in cellular immunotherapy of CD20+ malignancies |
| US6432403B1 (en) | 1997-06-11 | 2002-08-13 | New York University | Antibodies to polypeptides having prenylcysteine carboxyl methlytransferase activity or inhibiting activity |
| US20020111474A1 (en) | 1990-12-14 | 2002-08-15 | Capon Daniel J. | Chimeric chains for receptor-associated signal transduction pathways |
| WO2002088334A1 (en) | 2001-04-30 | 2002-11-07 | City Of Hope | Chimeric immunoreceptor useful in treating human cancers |
| US6521602B1 (en) | 1999-03-01 | 2003-02-18 | Gpc Biotech Inc. | Anti-neoplastic compositions and uses thereof |
| US6524572B1 (en) | 2000-06-26 | 2003-02-25 | Rainbow Therapeutic Company | Targeting recombinant virus with a bispecific fusion protein ligand in coupling with an antibody to cells for gene therapy |
| US20030175288A1 (en) | 2000-07-31 | 2003-09-18 | Kyogo Itoh | Tumor antigen |
| US6699972B1 (en) | 1999-06-25 | 2004-03-02 | Academia Sinica | Chimeric protein and method of controlling tumor growth using the protein |
| JP2004113062A (en) | 2002-09-25 | 2004-04-15 | Teruyuki Nagamune | Animal cell having chimera receptor and its utilization |
| US6753162B1 (en) | 1991-03-07 | 2004-06-22 | The General Hospital Corporation | Targeted cytolysis of HIV-infected cells by chimeric CD4 receptor-bearing cells |
| US6759243B2 (en) | 1998-01-20 | 2004-07-06 | Board Of Trustees Of The University Of Illinois | High affinity TCR proteins and methods |
| US6770749B2 (en) | 2000-02-22 | 2004-08-03 | City Of Hope | P53-specific T cell receptor for adoptive immunotherapy |
| US20040171096A1 (en) * | 2002-12-10 | 2004-09-02 | Echelon Biosciences Incorporated | Compounds and methods of use thereof for assaying lysophospholipase D activity |
| US20050113564A1 (en) | 2003-11-05 | 2005-05-26 | St. Jude Children's Research Hospital | Chimeric receptors with 4-1BB stimulatory signaling domain |
| WO2005084716A2 (en) | 2004-03-02 | 2005-09-15 | Cellectar, Llc | Phospholipid analogs for diagnosis and treatment of cancer |
| US6953668B1 (en) | 1992-11-05 | 2005-10-11 | Sloan-Kettering Institute For Cancer Research | Prostate-specific membrane antigen |
| WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
| US7037647B1 (en) | 1995-02-24 | 2006-05-02 | Sloan-Kettering Institute For Cancer Research | Prostate-specific membrane antigen and uses thereof |
| US7049136B2 (en) | 1991-03-07 | 2006-05-23 | The General Hospital Corporation | Redirection of cellular immunity by receptor chimeras |
| US7052906B1 (en) | 1999-04-16 | 2006-05-30 | Celltech R & D Limited | Synthetic transmembrane components |
| US7070995B2 (en) | 2001-04-11 | 2006-07-04 | City Of Hope | CE7-specific redirected immune cells |
| US20060155115A1 (en) | 1998-05-19 | 2006-07-13 | Avidex Limited | Multivalent T cell receptor complexes |
| US7105159B1 (en) | 1992-11-05 | 2006-09-12 | Sloan-Kettering Institute For Cancer Research | Antibodies to prostate-specific membrane antigen |
| US7217421B1 (en) | 1998-11-03 | 2007-05-15 | Cell Genesys, Inc. | Cancer-associated antigens and methods of their identification and use |
| US20080051380A1 (en) | 2006-08-25 | 2008-02-28 | Auerbach Alan H | Methods and compositions for treating cancer |
| US7348004B2 (en) | 2003-05-06 | 2008-03-25 | Syntonix Pharmaceuticals, Inc. | Immunoglobulin chimeric monomer-dimer hybrids |
| US7354587B1 (en) | 1994-07-06 | 2008-04-08 | Immunomedics, Inc. | Use of immunoconjugates to enhance the efficacy of multi-stage cascade boosting vaccines |
| WO2008057437A2 (en) | 2006-11-03 | 2008-05-15 | Purdue Research Foundation | Ex vivo flow cytometry method and device |
| US7381408B2 (en) | 2003-05-06 | 2008-06-03 | Syntonix Pharmaceuticals, Inc. | Methods for chemically synthesizing immunoglobulin chimeric proteins |
| US7435596B2 (en) | 2004-11-04 | 2008-10-14 | St. Jude Children's Research Hospital, Inc. | Modified cell line and method for expansion of NK cell |
| US7446179B2 (en) | 2000-11-07 | 2008-11-04 | City Of Hope | CD19-specific chimeric T cell receptor |
| US7446190B2 (en) | 2002-05-28 | 2008-11-04 | Sloan-Kettering Institute For Cancer Research | Nucleic acids encoding chimeric T cell receptors |
| US20090011984A1 (en) | 1998-02-23 | 2009-01-08 | Seppo Yla-Herttuala | Biotin-binding receptor molecules |
| US7482005B2 (en) | 1991-03-29 | 2009-01-27 | Genentech, Inc. | Methods of treating diseases with anti-VEGF antibodies |
| US7514537B2 (en) | 2001-04-30 | 2009-04-07 | City Of Hope | Chimeric immunoreceptor useful in treating human gliomas |
| WO2009091826A2 (en) | 2008-01-14 | 2009-07-23 | The Board Of Regents Of The University Of Texas System | Compositions and methods related to a human cd19-specific chimeric antigen receptor (h-car) |
| US7569663B2 (en) | 2000-01-03 | 2009-08-04 | Mark L. Tykocinski | Chimeric proteins and methods for using the same |
| US7572891B2 (en) | 2000-02-14 | 2009-08-11 | The Regents Of The University Of California | Kidney-specific tumor vaccine directed against kidney tumor antigen G-250 |
| US20090202501A1 (en) | 2004-09-24 | 2009-08-13 | Tong Zhang | Chimeric NK receptor and methods for treating cancer |
| WO2009117117A1 (en) | 2008-03-19 | 2009-09-24 | Altor Bioscience Corporation | T cell receptor fusions and conjugates and methods of use there of |
| US7618817B2 (en) | 2004-07-10 | 2009-11-17 | Fox Chase Cancer Center | Genetically modified human natural killer cell lines |
| US7632497B2 (en) | 2004-11-10 | 2009-12-15 | Macrogenics, Inc. | Engineering Fc Antibody regions to confer effector function |
| US7655461B2 (en) | 2004-12-07 | 2010-02-02 | University of Pittsbugh — Of the Commonwealth System of Higher Education | Therapeutic and diagnostic cloned MHC-unrestricted receptor specific for the MUC1 tumor associated antigen |
| US7666424B2 (en) | 2001-10-17 | 2010-02-23 | Sloan-Kettering Institute For Cancer Research | Methods of preparing and using single chain anti-tumor antibodies |
| WO2010025177A1 (en) | 2008-08-26 | 2010-03-04 | City Of Hope | Method and compositions for enhanced anti-tumor effector functioning of t cells |
| EP2177230A1 (en) | 2007-08-09 | 2010-04-21 | Daiichi Sankyo Company, Limited | Immunoliposome inducing apoptosis into cell expressing death domain-containing receptor |
| US7723111B2 (en) | 2001-03-09 | 2010-05-25 | The United States Of America As Represented By The Department Of Health And Human Services | Activated dual specificity lymphocytes and their methods of use |
| US20100135974A1 (en) | 2007-01-31 | 2010-06-03 | Yeda Research And Development Co. Ltd. | Redirected, genetically-engineered t regulatory cells and their use in suppression of autoimmune and inflammatory disease |
| US7741465B1 (en) | 1992-03-18 | 2010-06-22 | Zelig Eshhar | Chimeric receptor genes and cells transformed therewith |
| US20100278830A1 (en) | 2007-02-20 | 2010-11-04 | Shoemaker Charles B | Methods and systems for multi-antibody therapies |
| US7871817B2 (en) | 2002-09-24 | 2011-01-18 | Johannes Gutenberg-Universitat Mainz | Method for rational mutagenesis of α/β t-cell receptors and correspondingly mutated mdm2-protein specific α/β t-cell receptors |
| US7906620B2 (en) | 2002-08-16 | 2011-03-15 | Yeda Research And Development Co. Ltd. | Tumor associated antigen, peptides thereof, and use of same as anti-tumor vaccines |
| US7919079B2 (en) | 2006-03-31 | 2011-04-05 | Biosante Pharmaceuticals, Inc. | Cancer immunotherapy compositions and methods of use |
| US7939059B2 (en) | 2001-12-10 | 2011-05-10 | California Institute Of Technology | Method for the generation of antigen-specific lymphocytes |
| US20110172254A1 (en) | 2008-09-17 | 2011-07-14 | Endocyte, Inc. | Folate receptor binding conjugates of antifolates |
| US20110178279A1 (en) | 2009-08-03 | 2011-07-21 | Williams John C | Development of masked therapeutic antibodies to limit off-target effects: application to anti-egfr antibodies |
| US7998736B2 (en) | 2004-10-08 | 2011-08-16 | The United States Of America As Represented By The Department Of Health And Human Services | Adoptive immunotherapy with enhanced T lymphocyte survival |
| US8105830B2 (en) | 1998-10-21 | 2012-01-31 | Altor Bioscience Corporation | Polyspecific binding molecules and uses thereof |
| US20120093842A1 (en) | 1992-03-18 | 2012-04-19 | The United States of America, as represented by the Secretary, Dept. of Health & Human Service | Chimeric receptor genes and cells transformed therewith |
| WO2012054825A1 (en) | 2010-10-22 | 2012-04-26 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-mage-a3 t cell receptors and related materials and methods of use |
| WO2012082841A2 (en) | 2010-12-14 | 2012-06-21 | University Of Maryland, Baltimore | Universal anti-tag chimeric antigen receptor-expressing t cells and methods of treating cancer |
| WO2012138475A1 (en) | 2011-04-08 | 2012-10-11 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-epidermal growth factor receptor variant iii chimeric antigen receptors and use of same for the treatment of cancer |
| CN102775500A (en) | 2012-08-03 | 2012-11-14 | 郑骏年 | Chimeric antigen receptor iRGD-scFv (G250)-CD8-CD28-CD137-CD3zeta and application thereof |
| US20120302466A1 (en) | 2009-10-29 | 2012-11-29 | Sentman Charles L | T cell receptor-deficient t cell compositions |
| US8324353B2 (en) | 2001-04-30 | 2012-12-04 | City Of Hope | Chimeric immunoreceptor useful in treating human gliomas |
| US8389282B2 (en) | 2007-03-30 | 2013-03-05 | Memorial Sloan-Kettering Cancer Center | Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes |
| WO2013039889A1 (en) | 2011-09-15 | 2013-03-21 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | T cell receptors recognizing hla-a1- or hla-cw7-restricted mage |
| US8409577B2 (en) | 2006-06-12 | 2013-04-02 | Emergent Product Development Seattle, Llc | Single chain multivalent binding proteins with effector function |
| US8450112B2 (en) | 2008-04-09 | 2013-05-28 | Maxcyte, Inc. | Engineering and delivery of therapeutic compositions of freshly isolated cells |
| US20130143895A1 (en) | 2010-02-17 | 2013-06-06 | Andrès Mc Allister | Bicyclic compounds and their uses as dual c-src / jak inhibitors |
| US8465743B2 (en) | 2009-10-01 | 2013-06-18 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-vascular endothelial growth factor receptor-2 chimeric antigen receptors and use of same for the treatment of cancer |
| US20130156794A1 (en) | 2010-05-04 | 2013-06-20 | Yeda Research And Development Co. Ltd. | Immunotherapy using redirected allogeneic cells |
| US8486911B2 (en) | 2009-06-17 | 2013-07-16 | University of Pittsburgh—of the Commonwealth System of Higher Education | Th1-associated microRNAs and their use for tumor immunotherapy |
| EP2614077A1 (en) | 2010-09-08 | 2013-07-17 | Chemotherapeutisches Forschungsinstitut Georg-Speyer-Haus | Chimeric antigen receptors with an optimized hinge region |
| US20130309258A1 (en) | 2010-12-09 | 2013-11-21 | The Trustees Of The University Of Pennsylvania | Methods for Treatment of Cancer |
| WO2013177247A1 (en) | 2012-05-22 | 2013-11-28 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Murine anti-ny-eso-1 t cell receptors |
| US20130323834A1 (en) | 2010-05-21 | 2013-12-05 | Bellicum Pharmaceuticals, Inc. | Methods for inducing selective apoptosis |
| US20130344066A1 (en) | 2008-11-07 | 2013-12-26 | Sequenta, Inc. | Methods of monitoring conditions by sequence analysis |
| US20140004132A1 (en) | 2010-09-08 | 2014-01-02 | Malcolm Brenner | Immunotherapy of cancer using genetically engineered gd2-specific t cells |
| US20140004137A1 (en) | 2010-12-09 | 2014-01-02 | Stichting Sanquin Bloedvoorziening | Immune restricted peptides with increased efficacy |
| WO2014011984A1 (en) | 2012-07-13 | 2014-01-16 | The Trustees Of The University Of Pennsylvania | Toxicity management for anti-tumor activity of cars |
| US20140017170A1 (en) | 2008-11-24 | 2014-01-16 | Massachusetts Institute Of Technology | Methods and compositions for localized agent delivery |
| WO2014031687A1 (en) | 2012-08-20 | 2014-02-27 | Jensen, Michael | Method and compositions for cellular immunotherapy |
| WO2014043441A1 (en) | 2012-09-14 | 2014-03-20 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | T cell receptors recognizing mhc class ii-restricted mage-a3 |
| WO2014055771A1 (en) | 2012-10-05 | 2014-04-10 | The Trustees Of The University Of Pennsylvania | Human alpha-folate receptor chimeric antigen receptor |
| US20140120136A1 (en) | 2012-10-12 | 2014-05-01 | The Babraham Institute | Mir-155 enhancement of cd8+ t cell immunity |
| WO2014068388A1 (en) | 2012-10-29 | 2014-05-08 | Glaxo Group Limited | 2 substituted cephem compounds |
| US20140134142A1 (en) | 2012-05-25 | 2014-05-15 | Cellectis | Multi-Chain Chimeric Antigen Receptor and Uses Thereof |
| US20140134720A1 (en) | 2011-05-17 | 2014-05-15 | Ucl Business Plc | Method |
| WO2014100615A1 (en) | 2012-12-20 | 2014-06-26 | Purdue Research Foundation | Chimeric antigen receptor-expressing t cells as anti-cancer therapeutics |
| US8802374B2 (en) | 2009-11-03 | 2014-08-12 | City Of Hope | Truncated epiderimal growth factor receptor (EGFRt) for transduced T cell selection |
| US20140227237A1 (en) | 2011-09-16 | 2014-08-14 | The Trustees Of The University Of Pennsylvania | Rna engineered t cells for the treatment of cancer |
| US8809050B2 (en) | 2009-12-08 | 2014-08-19 | Wilson Wolf Manufacturing | Methods of cell culture for adoptive cell therapy |
| WO2014127261A1 (en) | 2013-02-15 | 2014-08-21 | The Regents Of The University Of California | Chimeric antigen receptor and methods of use thereof |
| US20140255363A1 (en) | 2011-09-16 | 2014-09-11 | Baylor College Of Medicine | Targeting the tumor microenvironment using manipulated nkt cells |
| US20140271582A1 (en) | 2013-03-15 | 2014-09-18 | City Of Hope | Cd123-specific chimeric antigen receptor redirected t cells and methods of their use |
| US20140274909A1 (en) | 2011-10-20 | 2014-09-18 | The Usa, As Represented By The Secretary, Department Of Health And Human Service | Anti-cd22 chimeric antigen receptors |
| US20140271635A1 (en) | 2013-03-16 | 2014-09-18 | The Trustees Of The University Of Pennsylvania | Treatment of cancer using humanized anti-cd19 chimeric antigen receptor |
| US20140286973A1 (en) | 2013-03-15 | 2014-09-25 | The Trustees Of The University Of Pennsylvania | Chimeric antigen receptor specific for folate receptor beta |
| US20140286987A1 (en) | 2013-03-14 | 2014-09-25 | Bellicum Pharmaceuticals, Inc. | Methods for controlling t cell proliferation |
| US8859229B2 (en) | 2007-02-02 | 2014-10-14 | Yale University | Transient transfection with RNA |
| US20140308259A1 (en) | 2011-11-03 | 2014-10-16 | The Trustees Of The University Of Pennsylvania | Isolated b7-h4 specific compositions and methods of use thereof |
| US20140322275A1 (en) | 2013-02-20 | 2014-10-30 | Jennifer Brogdon | TREATMENT OF CANCER USING HUMANIZED ANTI-EGFRvIII CHIMERIC ANTIGEN RECEPTOR |
| US20140322183A1 (en) | 2013-03-15 | 2014-10-30 | The Trustees Of The University Of Pennsylvania | Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy |
| US20140322212A1 (en) | 2013-02-20 | 2014-10-30 | Jennifer Brogdon | Effective targeting of primary human leukemia using anti-cd123 chimeric antigen receptor engineered t cells |
| US8877199B2 (en) | 2009-05-15 | 2014-11-04 | The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services | B cell surface reactive antibodies |
| US8946385B2 (en) | 2007-01-30 | 2015-02-03 | Chugai Seiyaku Kabushiki Kaisha | Chimeric Fcγ receptor and method for determination of ADCC activity by using the receptor |
| US8956860B2 (en) | 2009-12-08 | 2015-02-17 | Juan F. Vera | Methods of cell culture for adoptive cell therapy |
| WO2015057852A1 (en) | 2013-10-15 | 2015-04-23 | The California Institute For Biomedical Research | Chimeric antigen receptor t cell switches and uses thereof |
| WO2015057834A1 (en) | 2013-10-15 | 2015-04-23 | The California Institute For Biomedical Research | Peptidic chimeric antigen receptor t cell switches and uses thereof |
| US20150110760A1 (en) | 2011-08-31 | 2015-04-23 | Trustees Of Dartmouth College | Nkp30 receptor targeted therapeutics |
| US9023621B2 (en) | 2010-02-12 | 2015-05-05 | Oncomed Pharmaceuticals, Inc. | Methods for identifying and isolating cells expressing a polypeptide |
| US20150139943A1 (en) | 2013-10-17 | 2015-05-21 | National University Of Singapore | Chimeric receptors and uses thereof in immune therapy |
| US9040669B2 (en) | 2011-02-11 | 2015-05-26 | Memorial Sloan Kettering Cancer Center | HLA-restricted, peptide-specific antigen binding proteins |
| US20150152181A1 (en) | 2012-05-07 | 2015-06-04 | The Trustees Of Dartmouth College | Anti-b7-h6 antibody, fusion proteins, and methods of using the same |
| US9074000B2 (en) | 2011-04-01 | 2015-07-07 | Memorial Sloan Kettering Cancer Center | T cell receptor-like antibodies specific for a WT1 peptide presented by HLA-A2 |
| US9101609B2 (en) | 2008-04-11 | 2015-08-11 | Emergent Product Development Seattle, Llc | CD37 immunotherapeutic and combination with bifunctional chemotherapeutic thereof |
| US9133436B2 (en) | 2010-02-04 | 2015-09-15 | The Trustees Of The University Of Pennsylvania | ICOS critically regulates the expansion and function of inflammatory human Th17 cells |
| US20150283178A1 (en) | 2014-04-07 | 2015-10-08 | Carl H. June | Treatment of cancer using anti-cd19 chimeric antigen receptor |
| US9156915B2 (en) | 2012-04-26 | 2015-10-13 | Thomas Jefferson University | Anti-GCC antibody molecules |
| US9163258B2 (en) | 2010-07-23 | 2015-10-20 | Fred Hutchinson Cancer Research Center | Method for the treatment of obesity |
| WO2015164594A1 (en) | 2014-04-23 | 2015-10-29 | Board Of Regents, The University Of Texas System | Chimeric antigen receptors (car) for use in therapy and methods for making the same |
| US20150307842A1 (en) | 2009-10-29 | 2015-10-29 | The Trustees Of Dartmouth College | T cell receptor-deficient t cell compositions |
| US9175308B2 (en) | 2011-10-07 | 2015-11-03 | Mie University | Chimeric antigen receptor |
| US20150314014A1 (en) | 2002-09-03 | 2015-11-05 | Vit Lauermann | Inhibitor which is deactivatable by a reagent produced by a target cell |
| US20150328292A1 (en) | 2014-03-07 | 2015-11-19 | Bellicum Pharmaceuticals, Inc. | Caspase polypeptides having modified activity and uses thereof |
| US9211321B2 (en) | 2009-10-27 | 2015-12-15 | Immunicum Ab | Method for proliferation of antigen-specific T cells |
| US9226936B2 (en) | 2011-10-28 | 2016-01-05 | The Wistar of Anatomy and Biology | Methods and compositions for enhancing the therapeutic effect of anti-tumor T cells |
| US9242014B2 (en) | 2010-06-15 | 2016-01-26 | The Regents Of The University Of California | Receptor tyrosine kinase-like orphan receptor 1 (ROR1) single chain Fv antibody fragment conjugates and methods of use thereof |
| US20160046700A1 (en) | 2014-02-14 | 2016-02-18 | Bellicum Pharmaceuticals, Inc. | Methods for activating t cells using an inducible chimeric polypeptide |
| WO2016025322A1 (en) | 2014-08-09 | 2016-02-18 | Purdue Research Foundation | Design and development of neurokinin-1 receptor-binding agent delivery conjugates |
| US20160046724A1 (en) | 2014-07-21 | 2016-02-18 | The Trustees Of The University Of Pennsylvania | Treatment of cancer using humanized anti-bcma chimeric antigen receptor |
| US20160051651A1 (en) | 2014-07-21 | 2016-02-25 | The Trustees Of The University Of Pennsylvania | Treatment of cancer using a cll-1 chimeric antigen receptor |
| US9272002B2 (en) | 2011-10-28 | 2016-03-01 | The Trustees Of The University Of Pennsylvania | Fully human, anti-mesothelin specific chimeric immune receptor for redirected mesothelin-expressing cell targeting |
| US20160058857A1 (en) | 2014-09-02 | 2016-03-03 | Bellicum Pharmaceuticals, Inc. | Costimulation of chimeric antigen receptors by myd88 and cd40 polypeptides |
| US20160068601A1 (en) | 2014-08-19 | 2016-03-10 | The Trustees Of The University Of Pennsylvania | Treatment of cancer using a cd123 chimeric antigen receptor |
| US20160096892A1 (en) | 2014-07-21 | 2016-04-07 | The Trustees Of The University Of Pennsylvania | Treatment of cancer using a cd33 chimeric antigen receptor |
| WO2016054520A2 (en) | 2014-10-03 | 2016-04-07 | The California Institute For Biomedical Research | Engineered cell surface proteins and uses thereof |
| US9334330B2 (en) | 2006-10-10 | 2016-05-10 | Universite De Nantes | Use of monoclonal antibodies specific to the O-acetylated form of GD2 ganglioside for the treatment of certain cancers |
| US20160136190A1 (en) | 2014-11-17 | 2016-05-19 | Cellectar Biosciences, Inc. | Phospholipid Ether Analogs as Cancer-Targeting Drug Vehicles |
| US9345748B2 (en) | 2010-09-21 | 2016-05-24 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-SSX-2 T cell receptors and related materials and methods of use |
| US9352036B2 (en) | 2004-02-13 | 2016-05-31 | Immunomedics, Inc. | Delivery system for cytotoxic drugs by bispecific antibody pretargeting |
| US20160151465A1 (en) | 2013-06-05 | 2016-06-02 | Bellicum Pharmaceuticals, Inc. | Methods for inducing partial apoptosis using caspase polypeptides |
| US9359447B2 (en) | 2012-03-23 | 2016-06-07 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-mesothelin chimeric antigen receptors |
| US9365641B2 (en) | 2012-10-01 | 2016-06-14 | The Trustees Of The University Of Pennsylvania | Compositions and methods for targeting stromal cells for the treatment of cancer |
| US20160166613A1 (en) | 2014-12-15 | 2016-06-16 | Bellicum Pharmaceuticals, Inc. | Methods for controlled elimination of therapeutic cells |
| US20160175359A1 (en) | 2014-12-15 | 2016-06-23 | Bellicum Pharmaceuticals, Inc. | Methods for controlled activation or elimination of therapeutic cells |
| WO2016098078A2 (en) | 2014-12-19 | 2016-06-23 | Novartis Ag | Dimerization switches and uses thereof |
| WO2016102965A1 (en) | 2014-12-24 | 2016-06-30 | Ucl Business Plc | Cell |
| US9393268B2 (en) | 2013-03-15 | 2016-07-19 | Thomas Jefferson University | Cell-based anti-cancer compositions with reduced toxicity and methods of making and using the same |
| US9394364B2 (en) | 2011-04-19 | 2016-07-19 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Human monoclonal antibodies specific for glypican-3 and use thereof |
| US9402888B2 (en) | 2013-03-14 | 2016-08-02 | The Wistar Institute Of Anatomy And Biology | Methods and compositions for treating cancer |
| US9409992B2 (en) | 2012-08-21 | 2016-08-09 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Mesothelin domain-specific monoclonal antibodies and use thereof |
| US9408904B2 (en) | 2010-01-28 | 2016-08-09 | The Children's Hospital Of Philadelphia | Scalable manufacturing platform for viral vector purification and viral vectors so purified for use in gene therapy |
| US9409994B2 (en) | 2012-06-01 | 2016-08-09 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | High-affinity monoclonal antibodies to glypican-3 and use thereof |
| US9416190B2 (en) | 2012-09-27 | 2016-08-16 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Mesothelin antibodies and methods for eliciting potent antitumor activity |
| US9434935B2 (en) | 2013-03-10 | 2016-09-06 | Bellicum Pharmaceuticals, Inc. | Modified caspase polypeptides and uses thereof |
| US9447194B2 (en) | 2012-02-13 | 2016-09-20 | Seattle Children's Hospital | Bispecific chimeric antigen receptors and encoding polynucleotides thereof |
| WO2016149665A1 (en) | 2015-03-18 | 2016-09-22 | Baylor College Of Medicine | Her2/erbb2 chimeric antigen receptor |
| WO2016168769A1 (en) | 2015-04-15 | 2016-10-20 | The California Institute For Biomedical Research | Chimeric receptor t cell switches for her2 |
| US9476028B2 (en) | 2011-04-13 | 2016-10-25 | Immunicum Ab | Method for proliferation of antigen-specific T cells |
| US9487800B2 (en) | 2010-09-08 | 2016-11-08 | Chemotherapeutisches Forschunginstitut Georg-Speyer-Haus | Interleukin 15 as selectable marker for gene transfer in lymphocytes |
| US9492529B2 (en) | 2011-04-13 | 2016-11-15 | Immunicum Ab | Method for priming of T cells |
| US9492499B2 (en) | 2014-10-14 | 2016-11-15 | Riptide Bioscience, Inc. | Peptides having anti-inflammatory properties |
| US9499855B2 (en) | 2013-03-14 | 2016-11-22 | Elwha Llc | Compositions, methods, and computer systems related to making and administering modified T cells |
| US20160340649A1 (en) | 2014-09-19 | 2016-11-24 | City Of Hope | Costimulatory Chimeric Antigen Receptor T Cells Targeting IL13Rx2 |
| US9511092B2 (en) | 2013-01-28 | 2016-12-06 | St. Jude Children's Research Hospital, Inc. | Chimeric receptor with NKG2D specificity for use in cell therapy against cancer and infectious disease |
| US20160361360A1 (en) | 2015-06-12 | 2016-12-15 | Immunomedics, Inc. | Disease therapy with chimeric antigen receptor (car) constructs and t cells (car-t) or nk cells (car-nk) expressing car constructs |
| WO2016210447A1 (en) | 2015-06-26 | 2016-12-29 | University Of Southern California | Masking chimeric antigen receptor t cells for tumor-specific activation |
| US9561291B2 (en) | 2013-03-15 | 2017-02-07 | Imre Kovesdi | Methods of targeting T-cells to tumors |
| US9562087B2 (en) | 2014-08-08 | 2017-02-07 | The Board Of Trustees Of The Leland Stanford Junior University | High affinity PD-1 agents and methods of use |
| US9567399B1 (en) | 2016-06-20 | 2017-02-14 | Kymab Limited | Antibodies and immunocytokines |
| US9572837B2 (en) | 2015-03-02 | 2017-02-21 | Innovative Cellular Therapeutics CO., LTD. | Reducing immune tolerance induced by PD-L1 |
| US9574014B2 (en) | 2015-05-15 | 2017-02-21 | City Of Hope | Chimeric antigen receptor compositions |
| US9572836B2 (en) | 2012-07-13 | 2017-02-21 | The Trustees Of The University Of Pennsylvania | Methods for assessing the suitability of transduced T cells for administration |
| WO2017029512A1 (en) | 2015-08-20 | 2017-02-23 | Autolus Ltd | Chimeric cytokine receptor |
| WO2017029511A1 (en) | 2015-08-20 | 2017-02-23 | Autolus Ltd | Cell |
| US9587237B2 (en) | 2013-03-14 | 2017-03-07 | Elwha Llc | Compositions, methods, and computer systems related to making and administering modified T cells |
| US9597357B2 (en) | 2012-10-10 | 2017-03-21 | Sangamo Biosciences, Inc. | T cell modifying compounds and uses thereof |
| US9624292B2 (en) | 2011-03-24 | 2017-04-18 | Universitätsmedizin Der Johannes Gutenberg-Universität Mainz | Single chain antigen recognizing constructs (scARCs) stabilized by the introduction of novel disulfide bonds |
| US9629877B2 (en) | 2013-05-14 | 2017-04-25 | Board Of Regents, The University Of Texas System | Human application of engineered chimeric antigen receptor (CAR) T-cells |
| WO2017068360A1 (en) | 2015-10-23 | 2017-04-27 | Autolus Ltd | Receptor |
| WO2017068361A1 (en) | 2015-10-23 | 2017-04-27 | Autolus Ltd | Cell |
| US9636388B2 (en) | 2015-05-19 | 2017-05-02 | Morphogenesis, Inc. | Multi-indication mRNA cancer immunotherapy |
| US9642906B2 (en) | 2016-09-16 | 2017-05-09 | Baylor College Of Medicine | Generation of HPV-specific T-cells |
| US9650428B2 (en) | 2014-12-02 | 2017-05-16 | Roger Williams Hospital | Methods and compositions for treating cancer |
| US9663756B1 (en) | 2016-02-25 | 2017-05-30 | Flodesign Sonics, Inc. | Acoustic separation of cellular supporting materials from cultured cells |
| US9670281B2 (en) | 2015-02-24 | 2017-06-06 | The Regents Of The University Of California | Binding-triggered transcriptional switches and methods of use thereof |
| US9676867B2 (en) | 2005-12-02 | 2017-06-13 | Dana-Farber Cancer Institute Inc. | Chimeric T cell receptor comprising carbonic anhydrase IX (G250) antibody |
| US20170166877A1 (en) | 2015-12-14 | 2017-06-15 | Bellicum Pharmaceuticals, Inc. | Dual controls for therapeutic cell activation or elimination |
| US9688760B2 (en) | 2013-02-08 | 2017-06-27 | Amgen Research (Munich) Gmbh | Anti-leukocyte adhesion for the mitigation of potential adverse events caused by CD3-specific binding domains |
| US9688740B2 (en) | 2011-10-26 | 2017-06-27 | National Cancer Center | Mutant CTLA4 gene transfected T cell and composition including same for anticancer immunotherapy |
| US9694033B2 (en) | 2014-01-24 | 2017-07-04 | The Cleveland Clinic Foundation | IL-9 secreting CD8+ Tc9 cells and methods of treating cancer |
| US9701758B2 (en) | 2013-05-24 | 2017-07-11 | Board Of Regents, The University Of Texas System | Anti-CD19 scFv (FMC63) polypeptide |
| US9708384B2 (en) | 2011-09-22 | 2017-07-18 | The Trustees Of The University Of Pennsylvania | Universal immune receptor expressed by T cells for the targeting of diverse and multiple antigens |
| US9714278B2 (en) | 2012-02-22 | 2017-07-25 | The Trustees Of The University Of Pennsylvania | Use of ICOS-based CARs to enhance antitumor activity and CAR persistence |
| US9717745B2 (en) | 2015-03-19 | 2017-08-01 | Zhejiang DTRM Biopharma Co. Ltd. | Pharmaceutical compositions and their use for treatment of cancer and autoimmune diseases |
| US9725519B2 (en) | 2012-06-08 | 2017-08-08 | Kinki University | Antibody against transporter and use thereof |
| WO2017137758A1 (en) | 2016-02-12 | 2017-08-17 | Autolus Limited | Signalling system |
| WO2017137759A1 (en) | 2016-02-12 | 2017-08-17 | Autolus Limited | Signalling system |
| US9738726B2 (en) | 2013-06-11 | 2017-08-22 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | HER2-specific monoclonal antibodies and conjugates thereof |
| WO2017143094A1 (en) | 2016-02-16 | 2017-08-24 | Dana-Farber Cancer Institute, Inc. | Immunotherapy compositions and methods |
| US9765156B2 (en) | 2012-07-13 | 2017-09-19 | The Trustees Of The University Of Pennsylvania | Enhancing activity of CAR T cells by co-introducing a bispecific antibody |
| US9765142B2 (en) | 2013-10-11 | 2017-09-19 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | TEM8 antibodies and their use in treatment and detection of tumors |
| US9765342B2 (en) | 2012-04-11 | 2017-09-19 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Chimeric antigen receptors targeting B-cell maturation antigen |
| US9765330B1 (en) | 2015-01-09 | 2017-09-19 | Nant Holdings Ip, Llc | Compositions and methods for reduction of allograft recognition and rejection |
| WO2017165245A2 (en) | 2016-03-19 | 2017-09-28 | F1 Oncology, Inc. | Methods and compositions for transducing lymphocytes and regulated expansion thereof |
| WO2017165571A1 (en) | 2016-03-22 | 2017-09-28 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Early intervention methods to prevent or ameliorate toxicity |
| US9777064B2 (en) | 2015-03-17 | 2017-10-03 | Chimera Bioengineering, Inc. | Smart CAR devices, DE CAR polypeptides, side CARs and uses thereof |
| US9783591B2 (en) | 2012-02-22 | 2017-10-10 | The Trustees Of The University Of Pennsylvania | Use of the CD2 signaling domain in second-generation chimeric antigen receptors |
| WO2017177149A2 (en) | 2016-04-08 | 2017-10-12 | Purdue Research Foundation | Methods and compositions for car t cell therapy |
| US9790467B2 (en) | 2015-09-22 | 2017-10-17 | Qt Holdings Corp | Methods and compositions for activation or expansion of T lymphocytes |
| US9790267B2 (en) | 2011-11-08 | 2017-10-17 | The Trustees Of The University Of Pennsylvania | Glypican-3-specific antibody and uses thereof |
| US9790282B2 (en) | 2013-03-25 | 2017-10-17 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-CD276 polypeptides, proteins, and chimeric antigen receptors |
| WO2017180587A2 (en) | 2016-04-11 | 2017-10-19 | Obsidian Therapeutics, Inc. | Regulated biocircuit systems |
| US9796783B2 (en) | 2014-03-05 | 2017-10-24 | Cantargia Ab | Anti human interleukin-1 receptor accessory protein (IL1 RAP) antibodies and uses thereof |
| US20170306303A1 (en) | 2016-01-08 | 2017-10-26 | The Regents Of The University Of California | Conditionally active heterodimeric polypeptides and methods of use thereof |
| US9802997B2 (en) | 2015-03-27 | 2017-10-31 | Immatics Biotechnologies Gmbh | Peptides and combination of peptides for use in immunotherapy against various tumors |
| US9809581B2 (en) | 2015-11-19 | 2017-11-07 | Chemocentryx, Inc. | Inhibitors of CXCR2 |
| US9808486B2 (en) | 2013-08-30 | 2017-11-07 | Board Of Regents, The University Of Texas System | Administration of kynurenine depleting enzymes for tumor therapy |
| US9828399B2 (en) | 2014-02-28 | 2017-11-28 | The Royal Institution For The Advancement Of Learning/Mcgill University | TC-PTP inhibitors as APC activators for immunotherapy |
| US9828435B2 (en) | 2013-06-25 | 2017-11-28 | Vaccinex, Inc. | Use of antibodies or antigen-binding fragments thereof that specifically bind semaphorin-4D to increase tumor infiltrating leukocyte frequency |
| US9834545B2 (en) | 2015-11-19 | 2017-12-05 | Chemocentryx, Inc. | Modulators of chemokine receptors |
| US9833480B2 (en) | 2010-04-14 | 2017-12-05 | Prospect Chartercare, Llc | Methods and compositions for treating HIV |
| US20170356010A1 (en) | 2016-03-19 | 2017-12-14 | F1 Oncology, Inc. | Methods and compositions for transducing lymphocytes and regulating the activity thereof |
| US9845362B2 (en) | 2010-10-08 | 2017-12-19 | The University Of North Carolina At Charlotte | Compositions comprising chimeric antigen receptors, T cells comprising the same, and methods of using the same |
| WO2017216561A1 (en) | 2016-06-16 | 2017-12-21 | Autolus Limited | Chimeric antigen receptor |
| WO2017216562A1 (en) | 2016-06-16 | 2017-12-21 | Autolus Limited | Tunable chimeric antigen receptors |
| US9849092B2 (en) | 2015-12-21 | 2017-12-26 | Gholam A. Peyman | Early cancer detection and enhanced immunotherapy |
| US9855298B2 (en) | 2015-05-28 | 2018-01-02 | Kite Pharma, Inc. | Methods of conditioning patients for T cell therapy |
| US9855297B2 (en) | 2013-05-29 | 2018-01-02 | Cellectis | Methods for engineering T cells for immunotherapy by using RNA-guided CAS nuclease system |
| US9856322B2 (en) | 2003-11-05 | 2018-01-02 | St Jude Children's Research Hospital, Inc. | Chimeric receptors with 4-1BB stimulatory signaling domain |
| US9856501B2 (en) | 2010-09-26 | 2018-01-02 | Da Yu Enterprises, L.L.C. | Method of recombinant macromolecular production |
| US9856497B2 (en) | 2016-01-11 | 2018-01-02 | The Board Of Trustee Of The Leland Stanford Junior University | Chimeric proteins and methods of regulating gene expression |
| US9862775B2 (en) | 2014-03-05 | 2018-01-09 | Eutilex Co., Ltd. | Monoclonal antibody which specifically recognizes B cell lymphoma and use thereof |
| WO2018013797A1 (en) | 2016-07-13 | 2018-01-18 | President And Fellows Of Harvard College | Antigen-presenting cell-mimetic scaffolds and methods for making and using the same |
| US9873894B2 (en) | 2013-05-15 | 2018-01-23 | Sangamo Therapeutics, Inc. | Methods and compositions for treatment of a genetic condition |
| US9879087B2 (en) | 2014-11-12 | 2018-01-30 | Siamab Therapeutics, Inc. | Glycan-interacting compounds and methods of use |
| US9885021B2 (en) | 2014-06-12 | 2018-02-06 | Children's National Medical Center | Generation of broadly-specific, virus-immune cells targeting multiple HIV antigens for preventive and therapeutic use |
| US9889160B2 (en) | 2015-10-05 | 2018-02-13 | Precision Biosciences, Inc. | Genetically-modified cells comprising a modified human T cell receptor alpha constant region gene |
| US9890393B2 (en) | 2013-05-29 | 2018-02-13 | Cellectis | Methods for engineering T cells for immunotherapy by using RNA-guided CAS nuclease system |
| WO2018111763A1 (en) | 2016-12-12 | 2018-06-21 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Chimeric transcription factor variants with augmented sensitivity to drug ligand induction of transgene expression in mammalian cells |
| WO2018111834A1 (en) | 2016-12-13 | 2018-06-21 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Methods of exogenous drug activation of chemical-induced signaling complexes expressed in engineered cells in vitro and in vivo |
| WO2018115146A1 (en) | 2016-12-21 | 2018-06-28 | Danmarks Tekniske Universitet | Antigen presenting scaffolds for immune-cell manipulation |
| WO2018148224A1 (en) | 2017-02-07 | 2018-08-16 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Phospholipid ether (ple) car t cell tumor targeting (ctct) agents |
| WO2018152451A1 (en) | 2017-02-17 | 2018-08-23 | Purdue Research Foundation | Targeted ligand-payload based drug delivery for cell therapy |
| WO2018160622A1 (en) | 2017-02-28 | 2018-09-07 | Endocyte, Inc. | Compositions and methods for car t cell therapy |
| WO2019060425A1 (en) | 2017-09-19 | 2019-03-28 | Massachusetts Institute Of Technology | Compositions for chimeric antigen receptor t cell therapy and uses thereof |
| US10279047B2 (en) | 2014-01-20 | 2019-05-07 | University Of Utah Research Foundation | Compositions and methods for modifying the surface of cells and methods of use |
| US20190209611A1 (en) | 2016-10-20 | 2019-07-11 | Miltenyi Biotec Gmbh | Chimeric antigen receptor specific for tumor cells |
| US20190224237A1 (en) | 2018-01-22 | 2019-07-25 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Methods of use for car t cells |
| WO2019156795A1 (en) | 2018-02-06 | 2019-08-15 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Fluorescein-specific cars exhibiting optimal t cell function against fl-ple labelled tumors |
| US20190388468A1 (en) | 2016-12-15 | 2019-12-26 | Miltenyi Biotec Gmbh | Immune cells expressing an antigen binding receptor and a chimeric costimulatory receptor |
| US20210317407A1 (en) * | 2018-08-06 | 2021-10-14 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Methods and compositions for stimulation of chimeric antigen receptor t cells with hapten labelled cells |
| US20220125841A1 (en) * | 2019-03-13 | 2022-04-28 | Seattle Children's Hospital (dba Seattle Children'a Research Institute) | Sodium fluorescein as a reversal agent for an anti-fluorescein car t cells and fluorescein-phospholipid-ethers or profluorescein-phospholipid-ethers |
| US20220280648A1 (en) * | 2019-07-05 | 2022-09-08 | Purdue Research Foundation | Design and efficient synthesis of lipid-fluorescein conjugates for car-t cell therapy |
| US20230172981A1 (en) * | 2020-02-04 | 2023-06-08 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Methods and compositions for stimulation of chimeric antigen receptor t cells with hapten labelled cells |
-
2019
- 2019-01-17 US US16/965,859 patent/US12312416B2/en active Active
- 2019-01-17 AU AU2019218729A patent/AU2019218729B2/en active Active
- 2019-01-17 CN CN201980023542.1A patent/CN111936518A/en active Pending
- 2019-01-17 CA CA3090089A patent/CA3090089A1/en active Pending
- 2019-01-17 BR BR112020015884-4A patent/BR112020015884A2/en unknown
- 2019-01-17 SG SG11202007426XA patent/SG11202007426XA/en unknown
- 2019-01-17 EP EP19750515.9A patent/EP3749695A4/en active Pending
- 2019-01-17 WO PCT/US2019/014054 patent/WO2019156795A1/en not_active Ceased
- 2019-01-17 JP JP2020542634A patent/JP7774961B2/en active Active
-
2020
- 2020-08-03 IL IL276473A patent/IL276473A/en unknown
-
2023
- 2023-11-02 JP JP2023188894A patent/JP2024012513A/en active Pending
-
2025
- 2025-05-26 JP JP2025086907A patent/JP2025116065A/en active Pending
Patent Citations (393)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1986004356A1 (en) | 1985-01-28 | 1986-07-31 | International Genetic Engineering, Inc. | AraB PROMOTERS AND METHOD OF PRODUCING POLYPEPTIDES, INCLUDINN CECROPINS, BY MICROBIOLOGICAL TECHNIQUES |
| US5482856A (en) | 1987-10-27 | 1996-01-09 | Oncogen Inc. | Production of chimeric antibodies by homologous recombination |
| US5202238A (en) | 1987-10-27 | 1993-04-13 | Oncogen | Production of chimeric antibodies by homologous recombination |
| US6004781A (en) | 1988-01-22 | 1999-12-21 | The General Hospital Corporation | Nucleic acid encoding Ig-CD4 fusion proteins |
| US6117656A (en) | 1988-01-22 | 2000-09-12 | General Hospital Corporation | Cloned genes encoding IG-CD4 fusion proteins and the use thereof |
| US5912172A (en) | 1988-05-04 | 1999-06-15 | Yeda Research And Development Co. Ltd. | Endowing lymphocytes with antibody specificity |
| US5906936A (en) | 1988-05-04 | 1999-05-25 | Yeda Research And Development Co. Ltd. | Endowing lymphocytes with antibody specificity |
| US5514582A (en) | 1989-02-23 | 1996-05-07 | Genentech, Inc. | Recombinant DNA encoding hybrid immunoglobulins |
| US6406697B1 (en) | 1989-02-23 | 2002-06-18 | Genentech, Inc. | Hybrid immunoglobulins |
| US5714147A (en) | 1989-02-23 | 1998-02-03 | Genentech Inc. | Hybrid immunoglobulins |
| US5116964A (en) | 1989-02-23 | 1992-05-26 | Genentech, Inc. | Hybrid immunoglobulins |
| US5216132A (en) | 1990-01-12 | 1993-06-01 | Protein Design Labs, Inc. | Soluble t-cell antigen receptor chimeric antigens |
| US20020004052A1 (en) | 1990-05-08 | 2002-01-10 | David Berd | Composition comprising a tumor cell extract and method of using the composition |
| US5914109A (en) | 1990-06-15 | 1999-06-22 | New York University | Heterohybridomas producing human monoclonal antibodies to HIV-1 |
| US5359046A (en) | 1990-12-14 | 1994-10-25 | Cell Genesys, Inc. | Chimeric chains for receptor-associated signal transduction pathways |
| US6407221B1 (en) | 1990-12-14 | 2002-06-18 | Cell Genesys, Inc. | Chimeric chains for receptor-associated signal transduction pathways |
| US6319494B1 (en) | 1990-12-14 | 2001-11-20 | Cell Genesys, Inc. | Chimeric chains for receptor-associated signal transduction pathways |
| US20020111474A1 (en) | 1990-12-14 | 2002-08-15 | Capon Daniel J. | Chimeric chains for receptor-associated signal transduction pathways |
| WO1992010591A1 (en) | 1990-12-14 | 1992-06-25 | Cell Genesys, Inc. | Chimeric chains for receptor-associated signal transduction pathways |
| US6392013B1 (en) | 1991-03-07 | 2002-05-21 | The General Hospital Corporation | Redirection of cellular immunity by protein tyrosine kinase chimeras |
| US6753162B1 (en) | 1991-03-07 | 2004-06-22 | The General Hospital Corporation | Targeted cytolysis of HIV-infected cells by chimeric CD4 receptor-bearing cells |
| US5851828A (en) | 1991-03-07 | 1998-12-22 | The General Hospital Corporation | Targeted cytolysis of HIV-infected cells by chimeric CD4 receptor-bearing cells |
| US7049136B2 (en) | 1991-03-07 | 2006-05-23 | The General Hospital Corporation | Redirection of cellular immunity by receptor chimeras |
| US7320787B2 (en) | 1991-03-07 | 2008-01-22 | The General Hospital Corporation | Redirection of cellular immunity by protein tyrosine kinase chimeras |
| US5912170A (en) | 1991-03-07 | 1999-06-15 | The General Hospital Corporation | Redirection of cellular immunity by protein-tyrosine kinase chimeras |
| US5843728A (en) | 1991-03-07 | 1998-12-01 | The General Hospital Corporation | Redirection of cellular immunity by receptor chimeras |
| US6410014B1 (en) | 1991-03-07 | 2002-06-25 | The General Hospital Corporation | Redirection of cellular immunity by protein-tyrosine kinase chimeras |
| US6004811A (en) | 1991-03-07 | 1999-12-21 | The Massachussetts General Hospital | Redirection of cellular immunity by protein tyrosine kinase chimeras |
| WO1992015671A1 (en) | 1991-03-08 | 1992-09-17 | Cytomed, Inc. | Soluble cd28 proteins and methods of treatment therewith |
| US7482005B2 (en) | 1991-03-29 | 2009-01-27 | Genentech, Inc. | Methods of treating diseases with anti-VEGF antibodies |
| US5670148A (en) | 1991-10-21 | 1997-09-23 | Cell Genesys, Inc. | Combined cellular and immunosuppressive therapies |
| US20120093842A1 (en) | 1992-03-18 | 2012-04-19 | The United States of America, as represented by the Secretary, Dept. of Health & Human Service | Chimeric receptor genes and cells transformed therewith |
| US7741465B1 (en) | 1992-03-18 | 2010-06-22 | Zelig Eshhar | Chimeric receptor genes and cells transformed therewith |
| US8211422B2 (en) | 1992-03-18 | 2012-07-03 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Chimeric receptor genes and cells transformed therewith |
| USRE43586E1 (en) | 1992-11-05 | 2012-08-14 | Sloan-Kettering Institute For Cancer Research | Antibodies to prostate-specific membrane antigen |
| US5538866A (en) | 1992-11-05 | 1996-07-23 | Sloan-Kettering Institute For Cancer Research | Prostate-specific membrane antigen |
| US6953668B1 (en) | 1992-11-05 | 2005-10-11 | Sloan-Kettering Institute For Cancer Research | Prostate-specific membrane antigen |
| US7105159B1 (en) | 1992-11-05 | 2006-09-12 | Sloan-Kettering Institute For Cancer Research | Antibodies to prostate-specific membrane antigen |
| US5747292A (en) | 1993-04-06 | 1998-05-05 | Fred Hutchinson Cancer Research Center | Chimeric cytokine receptors in lymphocytes |
| US5834256A (en) | 1993-06-11 | 1998-11-10 | Cell Genesys, Inc. | Method for production of high titer virus and high efficiency retroviral mediated transduction of mammalian cells |
| US5858740A (en) | 1993-06-11 | 1999-01-12 | Cell Genesys, Inc. | Method for production of high titer virus and high efficiency retroviral mediated transduction of mammalian cells |
| US6218187B1 (en) | 1993-06-11 | 2001-04-17 | Cell Genesys, Inc. | Method for production of high titer virus and high efficiency retroviral mediated transduction of mammalian cells |
| US5525503A (en) | 1993-09-28 | 1996-06-11 | Dana-Farber Cancer Institute, Inc. | Signal transduction via CD28 |
| US7354587B1 (en) | 1994-07-06 | 2008-04-08 | Immunomedics, Inc. | Use of immunoconjugates to enhance the efficacy of multi-stage cascade boosting vaccines |
| US8163887B2 (en) | 1994-07-06 | 2012-04-24 | Immunomedics, Inc. | Use of immunoconjugates to enhance the efficacy of multi-stage cascade boosting vaccines |
| US6132718A (en) | 1994-07-06 | 2000-10-17 | Immunomedics, Inc. | Multi-stage cascade boosting vaccine |
| US6005004A (en) | 1994-08-05 | 1999-12-21 | Molecular / Structural Biotechnologies, Inc. | Lipophilic-polycationic delivery systems |
| US6083751A (en) | 1994-11-01 | 2000-07-04 | Targeted Genetics Corporation | Chimeric receptors for the generation of selectively-activatable TH-independent cytotoxic T cells |
| US5837544A (en) | 1995-02-02 | 1998-11-17 | Cell Genesys, Inc. | Method of inducing a cell to proliferate using a chimeric receptor comprising janus kinase |
| US5741899A (en) | 1995-02-02 | 1998-04-21 | Cell Genesys, Inc. | Chimeric receptors comprising janus kinase for regulating cellular pro liferation |
| US6077947A (en) | 1995-02-02 | 2000-06-20 | Cell Genesys, Inc. | DNA encoding an intracellular chimeric receptor comprising Janus kinase |
| US5712149A (en) | 1995-02-03 | 1998-01-27 | Cell Genesys, Inc. | Chimeric receptor molecules for delivery of co-stimulatory signals |
| US5686281A (en) | 1995-02-03 | 1997-11-11 | Cell Genesys, Inc. | Chimeric receptor molecules for delivery of co-stimulatory signals |
| US6103521A (en) | 1995-02-06 | 2000-08-15 | Cell Genesys, Inc. | Multispecific chimeric receptors |
| US5935818A (en) | 1995-02-24 | 1999-08-10 | Sloan-Kettering Institute For Cancer Research | Isolated nucleic acid molecule encoding alternatively spliced prostate-specific membrane antigen and uses thereof |
| US7037647B1 (en) | 1995-02-24 | 2006-05-02 | Sloan-Kettering Institute For Cancer Research | Prostate-specific membrane antigen and uses thereof |
| US5830755A (en) | 1995-03-27 | 1998-11-03 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | T-cell receptors and their use in therapeutic and diagnostic methods |
| US6261787B1 (en) | 1996-06-03 | 2001-07-17 | Case Western Reserve University | Bifunctional molecules for delivery of therapeutics |
| US5969102A (en) | 1997-03-03 | 1999-10-19 | St. Jude Children's Research Hospital | Lymphocyte surface receptor that binds CAML, nucleic acids encoding the same and methods of use thereof |
| US6432403B1 (en) | 1997-06-11 | 2002-08-13 | New York University | Antibodies to polypeptides having prenylcysteine carboxyl methlytransferase activity or inhibiting activity |
| US6759243B2 (en) | 1998-01-20 | 2004-07-06 | Board Of Trustees Of The University Of Illinois | High affinity TCR proteins and methods |
| US20090011984A1 (en) | 1998-02-23 | 2009-01-08 | Seppo Yla-Herttuala | Biotin-binding receptor molecules |
| US20060155115A1 (en) | 1998-05-19 | 2006-07-13 | Avidex Limited | Multivalent T cell receptor complexes |
| US6395152B1 (en) | 1998-07-09 | 2002-05-28 | Acm Research, Inc. | Methods and apparatus for electropolishing metal interconnections on semiconductor devices |
| US6410319B1 (en) | 1998-10-20 | 2002-06-25 | City Of Hope | CD20-specific redirected T cells and their use in cellular immunotherapy of CD20+ malignancies |
| US8105830B2 (en) | 1998-10-21 | 2012-01-31 | Altor Bioscience Corporation | Polyspecific binding molecules and uses thereof |
| US7217421B1 (en) | 1998-11-03 | 2007-05-15 | Cell Genesys, Inc. | Cancer-associated antigens and methods of their identification and use |
| US6521602B1 (en) | 1999-03-01 | 2003-02-18 | Gpc Biotech Inc. | Anti-neoplastic compositions and uses thereof |
| US7052906B1 (en) | 1999-04-16 | 2006-05-30 | Celltech R & D Limited | Synthetic transmembrane components |
| US6699972B1 (en) | 1999-06-25 | 2004-03-02 | Academia Sinica | Chimeric protein and method of controlling tumor growth using the protein |
| US7569663B2 (en) | 2000-01-03 | 2009-08-04 | Mark L. Tykocinski | Chimeric proteins and methods for using the same |
| US7572891B2 (en) | 2000-02-14 | 2009-08-11 | The Regents Of The University Of California | Kidney-specific tumor vaccine directed against kidney tumor antigen G-250 |
| US8741306B2 (en) | 2000-02-14 | 2014-06-03 | The Regents Of The University Of California | Kidney specific tumor vaccine directed against kidney tumor antigen G-250 |
| US6770749B2 (en) | 2000-02-22 | 2004-08-03 | City Of Hope | P53-specific T cell receptor for adoptive immunotherapy |
| US20010031252A1 (en) | 2000-03-31 | 2001-10-18 | Low Philip Stewart | Method of treatment using ligand-immunogen conjugates |
| WO2001091625A2 (en) | 2000-04-21 | 2001-12-06 | Rutgers, The State University Of New Jersey | Methods and compositions for the diagnosis of schizophrenia |
| US6524572B1 (en) | 2000-06-26 | 2003-02-25 | Rainbow Therapeutic Company | Targeting recombinant virus with a bispecific fusion protein ligand in coupling with an antibody to cells for gene therapy |
| US20030175288A1 (en) | 2000-07-31 | 2003-09-18 | Kyogo Itoh | Tumor antigen |
| US7446179B2 (en) | 2000-11-07 | 2008-11-04 | City Of Hope | CD19-specific chimeric T cell receptor |
| US7723111B2 (en) | 2001-03-09 | 2010-05-25 | The United States Of America As Represented By The Department Of Health And Human Services | Activated dual specificity lymphocytes and their methods of use |
| US7070995B2 (en) | 2001-04-11 | 2006-07-04 | City Of Hope | CE7-specific redirected immune cells |
| US7446191B2 (en) | 2001-04-11 | 2008-11-04 | City Of Hope | DNA construct encoding CE7-specific chimeric T cell receptor |
| US7354762B2 (en) | 2001-04-11 | 2008-04-08 | City Of Hope | Method for producing CE7-specific redirected immune cells |
| US7265209B2 (en) | 2001-04-11 | 2007-09-04 | City Of Hope | CE7-specific chimeric T cell receptor |
| WO2002088334A1 (en) | 2001-04-30 | 2002-11-07 | City Of Hope | Chimeric immunoreceptor useful in treating human cancers |
| US8497118B2 (en) | 2001-04-30 | 2013-07-30 | City Of Hope | Chimeric immunoreceptor useful in treating human cancers |
| US7514537B2 (en) | 2001-04-30 | 2009-04-07 | City Of Hope | Chimeric immunoreceptor useful in treating human gliomas |
| US8324353B2 (en) | 2001-04-30 | 2012-12-04 | City Of Hope | Chimeric immunoreceptor useful in treating human gliomas |
| US8148154B2 (en) | 2001-10-17 | 2012-04-03 | Sloan-Kettering Institute For Cancer Research | Method for preparation of single chain antibodies |
| US7666424B2 (en) | 2001-10-17 | 2010-02-23 | Sloan-Kettering Institute For Cancer Research | Methods of preparing and using single chain anti-tumor antibodies |
| US7939059B2 (en) | 2001-12-10 | 2011-05-10 | California Institute Of Technology | Method for the generation of antigen-specific lymphocytes |
| US7446190B2 (en) | 2002-05-28 | 2008-11-04 | Sloan-Kettering Institute For Cancer Research | Nucleic acids encoding chimeric T cell receptors |
| US7906620B2 (en) | 2002-08-16 | 2011-03-15 | Yeda Research And Development Co. Ltd. | Tumor associated antigen, peptides thereof, and use of same as anti-tumor vaccines |
| US20150314014A1 (en) | 2002-09-03 | 2015-11-05 | Vit Lauermann | Inhibitor which is deactivatable by a reagent produced by a target cell |
| US9062127B2 (en) | 2002-09-24 | 2015-06-23 | Johannes Gutenberg-Universitat Mainz | Method for rational mutagenesis of α/βT-cell receptors and correspondingly mutated MDM2-protein specific α/βT-cell receptors |
| US7871817B2 (en) | 2002-09-24 | 2011-01-18 | Johannes Gutenberg-Universitat Mainz | Method for rational mutagenesis of α/β t-cell receptors and correspondingly mutated mdm2-protein specific α/β t-cell receptors |
| JP2004113062A (en) | 2002-09-25 | 2004-04-15 | Teruyuki Nagamune | Animal cell having chimera receptor and its utilization |
| US20040171096A1 (en) * | 2002-12-10 | 2004-09-02 | Echelon Biosciences Incorporated | Compounds and methods of use thereof for assaying lysophospholipase D activity |
| US7404956B2 (en) | 2003-05-06 | 2008-07-29 | Syntonix Pharmaceuticals, Inc. | Immunoglobulin chimeric monomer-dimer hybrids |
| US7348004B2 (en) | 2003-05-06 | 2008-03-25 | Syntonix Pharmaceuticals, Inc. | Immunoglobulin chimeric monomer-dimer hybrids |
| US8932830B2 (en) | 2003-05-06 | 2015-01-13 | Biogen Idec Hemophilia, Inc. | Immunoglobulin chimeric monomer-dimer hybrids |
| US9636416B2 (en) | 2003-05-06 | 2017-05-02 | Bioverativ Therapeutics Inc. | Immunoglobulin chimeric monomer-dimer hybrids |
| US7381408B2 (en) | 2003-05-06 | 2008-06-03 | Syntonix Pharmaceuticals, Inc. | Methods for chemically synthesizing immunoglobulin chimeric proteins |
| US20050113564A1 (en) | 2003-11-05 | 2005-05-26 | St. Jude Children's Research Hospital | Chimeric receptors with 4-1BB stimulatory signaling domain |
| US8399645B2 (en) | 2003-11-05 | 2013-03-19 | St. Jude Children's Research Hospital, Inc. | Chimeric receptors with 4-1BB stimulatory signaling domain |
| US9605049B2 (en) | 2003-11-05 | 2017-03-28 | St. Jude Children's Research Hospital, Inc. | Chimeric receptors with 4-1BB stimulatory signaling domain |
| US9856322B2 (en) | 2003-11-05 | 2018-01-02 | St Jude Children's Research Hospital, Inc. | Chimeric receptors with 4-1BB stimulatory signaling domain |
| US9352036B2 (en) | 2004-02-13 | 2016-05-31 | Immunomedics, Inc. | Delivery system for cytotoxic drugs by bispecific antibody pretargeting |
| WO2005084716A2 (en) | 2004-03-02 | 2005-09-15 | Cellectar, Llc | Phospholipid analogs for diagnosis and treatment of cancer |
| US7618817B2 (en) | 2004-07-10 | 2009-11-17 | Fox Chase Cancer Center | Genetically modified human natural killer cell lines |
| WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
| US7994298B2 (en) | 2004-09-24 | 2011-08-09 | Trustees Of Dartmouth College | Chimeric NK receptor and methods for treating cancer |
| US20150225470A1 (en) | 2004-09-24 | 2015-08-13 | Trustees Of Dartmouth College | Chimeric NK receptor and methods for treating cancer |
| US20090202501A1 (en) | 2004-09-24 | 2009-08-13 | Tong Zhang | Chimeric NK receptor and methods for treating cancer |
| US8252914B2 (en) | 2004-09-24 | 2012-08-28 | Trustees Of Dartmouth College | Chimeric NK receptor and methods for treating cancer |
| US7998736B2 (en) | 2004-10-08 | 2011-08-16 | The United States Of America As Represented By The Department Of Health And Human Services | Adoptive immunotherapy with enhanced T lymphocyte survival |
| US9834590B2 (en) | 2004-11-04 | 2017-12-05 | St. Jude Children's Research Hospital, Inc. | Chimeric receptors with 4-1BB stimulatory signaling domain |
| US7435596B2 (en) | 2004-11-04 | 2008-10-14 | St. Jude Children's Research Hospital, Inc. | Modified cell line and method for expansion of NK cell |
| US7632497B2 (en) | 2004-11-10 | 2009-12-15 | Macrogenics, Inc. | Engineering Fc Antibody regions to confer effector function |
| US9469684B2 (en) | 2004-12-07 | 2016-10-18 | University of Pittsburgh—of the Commonwealth System of Higher Education | Therapeutic and diagnostic cloned MHC-unrestricted receptor specific for the MUC1 tumor associated antigen |
| US7655461B2 (en) | 2004-12-07 | 2010-02-02 | University of Pittsbugh — Of the Commonwealth System of Higher Education | Therapeutic and diagnostic cloned MHC-unrestricted receptor specific for the MUC1 tumor associated antigen |
| US9676867B2 (en) | 2005-12-02 | 2017-06-13 | Dana-Farber Cancer Institute Inc. | Chimeric T cell receptor comprising carbonic anhydrase IX (G250) antibody |
| US7919079B2 (en) | 2006-03-31 | 2011-04-05 | Biosante Pharmaceuticals, Inc. | Cancer immunotherapy compositions and methods of use |
| US20130309267A1 (en) | 2006-03-31 | 2013-11-21 | The Regents Of The University Of California | Cancer immunotherapy compositions and methods of use |
| US8409577B2 (en) | 2006-06-12 | 2013-04-02 | Emergent Product Development Seattle, Llc | Single chain multivalent binding proteins with effector function |
| US20080051380A1 (en) | 2006-08-25 | 2008-02-28 | Auerbach Alan H | Methods and compositions for treating cancer |
| US9334330B2 (en) | 2006-10-10 | 2016-05-10 | Universite De Nantes | Use of monoclonal antibodies specific to the O-acetylated form of GD2 ganglioside for the treatment of certain cancers |
| WO2008057437A2 (en) | 2006-11-03 | 2008-05-15 | Purdue Research Foundation | Ex vivo flow cytometry method and device |
| US8946385B2 (en) | 2007-01-30 | 2015-02-03 | Chugai Seiyaku Kabushiki Kaisha | Chimeric Fcγ receptor and method for determination of ADCC activity by using the receptor |
| US9733245B2 (en) | 2007-01-30 | 2017-08-15 | Chugai Seiyaku Kabushiki Kaisha | Chimeric Fc-gamma receptor and method for determination of ADCC activity by using the receptor |
| US20100135974A1 (en) | 2007-01-31 | 2010-06-03 | Yeda Research And Development Co. Ltd. | Redirected, genetically-engineered t regulatory cells and their use in suppression of autoimmune and inflammatory disease |
| US8859229B2 (en) | 2007-02-02 | 2014-10-14 | Yale University | Transient transfection with RNA |
| US20100278830A1 (en) | 2007-02-20 | 2010-11-04 | Shoemaker Charles B | Methods and systems for multi-antibody therapies |
| US8389282B2 (en) | 2007-03-30 | 2013-03-05 | Memorial Sloan-Kettering Cancer Center | Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes |
| US9220728B2 (en) | 2007-03-30 | 2015-12-29 | Memorial Sloan-Kettering Cancer Center | Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes |
| EP2177230A1 (en) | 2007-08-09 | 2010-04-21 | Daiichi Sankyo Company, Limited | Immunoliposome inducing apoptosis into cell expressing death domain-containing receptor |
| WO2009091826A2 (en) | 2008-01-14 | 2009-07-23 | The Board Of Regents Of The University Of Texas System | Compositions and methods related to a human cd19-specific chimeric antigen receptor (h-car) |
| WO2009117117A1 (en) | 2008-03-19 | 2009-09-24 | Altor Bioscience Corporation | T cell receptor fusions and conjugates and methods of use there of |
| US9669058B2 (en) | 2008-04-09 | 2017-06-06 | Maxcyte, Inc. | Engineering and delivery of therapeutic compositions of freshly isolated cells |
| US8450112B2 (en) | 2008-04-09 | 2013-05-28 | Maxcyte, Inc. | Engineering and delivery of therapeutic compositions of freshly isolated cells |
| US9101609B2 (en) | 2008-04-11 | 2015-08-11 | Emergent Product Development Seattle, Llc | CD37 immunotherapeutic and combination with bifunctional chemotherapeutic thereof |
| US8822647B2 (en) | 2008-08-26 | 2014-09-02 | City Of Hope | Method and compositions using a chimeric antigen receptor for enhanced anti-tumor effector functioning of T cells |
| WO2010025177A1 (en) | 2008-08-26 | 2010-03-04 | City Of Hope | Method and compositions for enhanced anti-tumor effector functioning of t cells |
| US20110172254A1 (en) | 2008-09-17 | 2011-07-14 | Endocyte, Inc. | Folate receptor binding conjugates of antifolates |
| US20130344066A1 (en) | 2008-11-07 | 2013-12-26 | Sequenta, Inc. | Methods of monitoring conditions by sequence analysis |
| US20140017170A1 (en) | 2008-11-24 | 2014-01-16 | Massachusetts Institute Of Technology | Methods and compositions for localized agent delivery |
| US8877199B2 (en) | 2009-05-15 | 2014-11-04 | The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services | B cell surface reactive antibodies |
| US8486911B2 (en) | 2009-06-17 | 2013-07-16 | University of Pittsburgh—of the Commonwealth System of Higher Education | Th1-associated microRNAs and their use for tumor immunotherapy |
| US20110178279A1 (en) | 2009-08-03 | 2011-07-21 | Williams John C | Development of masked therapeutic antibodies to limit off-target effects: application to anti-egfr antibodies |
| US9522955B2 (en) | 2009-10-01 | 2016-12-20 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-vascular endothelial growth factor receptor-2 chimeric antigen receptors and use of same for the treatment of cancer |
| US8822196B2 (en) | 2009-10-01 | 2014-09-02 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-vascular endothelial growth factor receptor-2 chimeric antigen receptors and use of same for the treatment of cancer |
| US8465743B2 (en) | 2009-10-01 | 2013-06-18 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-vascular endothelial growth factor receptor-2 chimeric antigen receptors and use of same for the treatment of cancer |
| US9211321B2 (en) | 2009-10-27 | 2015-12-15 | Immunicum Ab | Method for proliferation of antigen-specific T cells |
| US9663763B2 (en) | 2009-10-29 | 2017-05-30 | The Trustees Of Dartmouth College | T-cell receptor-deficient T cell compositions |
| US20150307842A1 (en) | 2009-10-29 | 2015-10-29 | The Trustees Of Dartmouth College | T cell receptor-deficient t cell compositions |
| US20160120907A1 (en) | 2009-10-29 | 2016-05-05 | The Trustees Of Dartmouth College | T cell receptor-deficient t cell compositions |
| US9273283B2 (en) | 2009-10-29 | 2016-03-01 | The Trustees Of Dartmouth College | Method of producing T cell receptor-deficient T cells expressing a chimeric receptor |
| US20120302466A1 (en) | 2009-10-29 | 2012-11-29 | Sentman Charles L | T cell receptor-deficient t cell compositions |
| US9821011B1 (en) | 2009-10-29 | 2017-11-21 | The Trustees Of Dartmouth College | T-cell receptor-deficient T cell compositions |
| US9822340B1 (en) | 2009-10-29 | 2017-11-21 | The Trustees Of Dartmouth College | T-cell receptor-deficient T cell compositions |
| US8802374B2 (en) | 2009-11-03 | 2014-08-12 | City Of Hope | Truncated epiderimal growth factor receptor (EGFRt) for transduced T cell selection |
| US8956860B2 (en) | 2009-12-08 | 2015-02-17 | Juan F. Vera | Methods of cell culture for adoptive cell therapy |
| US8809050B2 (en) | 2009-12-08 | 2014-08-19 | Wilson Wolf Manufacturing | Methods of cell culture for adoptive cell therapy |
| US9408904B2 (en) | 2010-01-28 | 2016-08-09 | The Children's Hospital Of Philadelphia | Scalable manufacturing platform for viral vector purification and viral vectors so purified for use in gene therapy |
| US9133436B2 (en) | 2010-02-04 | 2015-09-15 | The Trustees Of The University Of Pennsylvania | ICOS critically regulates the expansion and function of inflammatory human Th17 cells |
| US9023621B2 (en) | 2010-02-12 | 2015-05-05 | Oncomed Pharmaceuticals, Inc. | Methods for identifying and isolating cells expressing a polypeptide |
| US20130143895A1 (en) | 2010-02-17 | 2013-06-06 | Andrès Mc Allister | Bicyclic compounds and their uses as dual c-src / jak inhibitors |
| US9833480B2 (en) | 2010-04-14 | 2017-12-05 | Prospect Chartercare, Llc | Methods and compositions for treating HIV |
| US20130156794A1 (en) | 2010-05-04 | 2013-06-20 | Yeda Research And Development Co. Ltd. | Immunotherapy using redirected allogeneic cells |
| US9089520B2 (en) | 2010-05-21 | 2015-07-28 | Baylor College Of Medicine | Methods for inducing selective apoptosis |
| US20130323834A1 (en) | 2010-05-21 | 2013-12-05 | Bellicum Pharmaceuticals, Inc. | Methods for inducing selective apoptosis |
| US9393292B2 (en) | 2010-05-21 | 2016-07-19 | Baylor College Of Medicine | Methods for inducing selective apoptosis |
| US9242014B2 (en) | 2010-06-15 | 2016-01-26 | The Regents Of The University Of California | Receptor tyrosine kinase-like orphan receptor 1 (ROR1) single chain Fv antibody fragment conjugates and methods of use thereof |
| US9163258B2 (en) | 2010-07-23 | 2015-10-20 | Fred Hutchinson Cancer Research Center | Method for the treatment of obesity |
| EP2614077A1 (en) | 2010-09-08 | 2013-07-17 | Chemotherapeutisches Forschungsinstitut Georg-Speyer-Haus | Chimeric antigen receptors with an optimized hinge region |
| US20140004132A1 (en) | 2010-09-08 | 2014-01-02 | Malcolm Brenner | Immunotherapy of cancer using genetically engineered gd2-specific t cells |
| US9487800B2 (en) | 2010-09-08 | 2016-11-08 | Chemotherapeutisches Forschunginstitut Georg-Speyer-Haus | Interleukin 15 as selectable marker for gene transfer in lymphocytes |
| US9493740B2 (en) | 2010-09-08 | 2016-11-15 | Baylor College Of Medicine | Immunotherapy of cancer using genetically engineered GD2-specific T cells |
| US9212229B2 (en) | 2010-09-08 | 2015-12-15 | Chemotherapeutisches Forschungsinstitut Georg-Speyer-Haus | Chimeric antigen receptors with an optimized hinge region |
| US9345748B2 (en) | 2010-09-21 | 2016-05-24 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-SSX-2 T cell receptors and related materials and methods of use |
| US9856501B2 (en) | 2010-09-26 | 2018-01-02 | Da Yu Enterprises, L.L.C. | Method of recombinant macromolecular production |
| US9845362B2 (en) | 2010-10-08 | 2017-12-19 | The University Of North Carolina At Charlotte | Compositions comprising chimeric antigen receptors, T cells comprising the same, and methods of using the same |
| WO2012054825A1 (en) | 2010-10-22 | 2012-04-26 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-mage-a3 t cell receptors and related materials and methods of use |
| US9481728B2 (en) | 2010-12-09 | 2016-11-01 | The Trustees Of The University Of Pennsylvania | Compositions and methods for treatment of cancer |
| US8906682B2 (en) | 2010-12-09 | 2014-12-09 | The Trustees Of The University Of Pennsylvania | Methods for treatment of cancer |
| US20130309258A1 (en) | 2010-12-09 | 2013-11-21 | The Trustees Of The University Of Pennsylvania | Methods for Treatment of Cancer |
| US9518123B2 (en) | 2010-12-09 | 2016-12-13 | The Trustees Of The University Of Pennsylvania | Compositions and methods for treatment of cancer |
| US9499629B2 (en) | 2010-12-09 | 2016-11-22 | The Trustees Of The University Of Pennsylvania | Use of chimeric antigen receptor-modified T-cells to treat cancer |
| US9464140B2 (en) | 2010-12-09 | 2016-10-11 | The Trustees Of The University Of Pennsylvania | Compositions and methods for treatment of cancer |
| US9540445B2 (en) | 2010-12-09 | 2017-01-10 | The Trustees Of The University Of Pennsylvania | Compositions and methods for treatment of cancer |
| US20140004137A1 (en) | 2010-12-09 | 2014-01-02 | Stichting Sanquin Bloedvoorziening | Immune restricted peptides with increased efficacy |
| US20130287752A1 (en) * | 2010-12-14 | 2013-10-31 | University Of Maryland, Baltimore | Universal anti-tag chimeric antigen receptor-expressing t cells and methods of treating cancer |
| WO2012082841A2 (en) | 2010-12-14 | 2012-06-21 | University Of Maryland, Baltimore | Universal anti-tag chimeric antigen receptor-expressing t cells and methods of treating cancer |
| US9453075B2 (en) | 2011-02-11 | 2016-09-27 | Memorial Sloan-Kettering Cancer Center | HLA-restricted, peptide-specific antigen binding proteins |
| US9040669B2 (en) | 2011-02-11 | 2015-05-26 | Memorial Sloan Kettering Cancer Center | HLA-restricted, peptide-specific antigen binding proteins |
| US9624292B2 (en) | 2011-03-24 | 2017-04-18 | Universitätsmedizin Der Johannes Gutenberg-Universität Mainz | Single chain antigen recognizing constructs (scARCs) stabilized by the introduction of novel disulfide bonds |
| US9540448B2 (en) | 2011-04-01 | 2017-01-10 | Memorial Sloan Kettering Cancer Center | T cell receptor-like antibodies specific for a WTI peptide presented by HLA-A2 |
| US9074000B2 (en) | 2011-04-01 | 2015-07-07 | Memorial Sloan Kettering Cancer Center | T cell receptor-like antibodies specific for a WT1 peptide presented by HLA-A2 |
| US9266960B2 (en) | 2011-04-08 | 2016-02-23 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-epidermal growth factor receptor variant III chimeric antigen receptors and use of same for the treatment of cancer |
| US9624306B2 (en) | 2011-04-08 | 2017-04-18 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-epidermal growth factor receptor variant III chimeric antigen receptors and use of same for the treatment of cancer |
| WO2012138475A1 (en) | 2011-04-08 | 2012-10-11 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-epidermal growth factor receptor variant iii chimeric antigen receptors and use of same for the treatment of cancer |
| US9492529B2 (en) | 2011-04-13 | 2016-11-15 | Immunicum Ab | Method for priming of T cells |
| US9476028B2 (en) | 2011-04-13 | 2016-10-25 | Immunicum Ab | Method for proliferation of antigen-specific T cells |
| US9789174B2 (en) | 2011-04-13 | 2017-10-17 | Immunicum Ab | Method for proliferation of antigen-specific T cells |
| US9394364B2 (en) | 2011-04-19 | 2016-07-19 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Human monoclonal antibodies specific for glypican-3 and use thereof |
| US20140134720A1 (en) | 2011-05-17 | 2014-05-15 | Ucl Business Plc | Method |
| US20150110760A1 (en) | 2011-08-31 | 2015-04-23 | Trustees Of Dartmouth College | Nkp30 receptor targeted therapeutics |
| US9833476B2 (en) | 2011-08-31 | 2017-12-05 | The Trustees Of Dartmouth College | NKP30 receptor targeted therapeutics |
| WO2013039889A1 (en) | 2011-09-15 | 2013-03-21 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | T cell receptors recognizing hla-a1- or hla-cw7-restricted mage |
| US20140378389A1 (en) | 2011-09-15 | 2014-12-25 | The United States Of America, As Represented By The Secretary, Dept. Of Health And Human Services | T cell receptors recognizing hla-a1- or hla-cw7-restricted mage |
| US20140255363A1 (en) | 2011-09-16 | 2014-09-11 | Baylor College Of Medicine | Targeting the tumor microenvironment using manipulated nkt cells |
| US20140227237A1 (en) | 2011-09-16 | 2014-08-14 | The Trustees Of The University Of Pennsylvania | Rna engineered t cells for the treatment of cancer |
| US9708384B2 (en) | 2011-09-22 | 2017-07-18 | The Trustees Of The University Of Pennsylvania | Universal immune receptor expressed by T cells for the targeting of diverse and multiple antigens |
| US9175308B2 (en) | 2011-10-07 | 2015-11-03 | Mie University | Chimeric antigen receptor |
| US20140274909A1 (en) | 2011-10-20 | 2014-09-18 | The Usa, As Represented By The Secretary, Department Of Health And Human Service | Anti-cd22 chimeric antigen receptors |
| US9868774B2 (en) | 2011-10-20 | 2018-01-16 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-CD22 chimeric antigen receptors |
| US9688740B2 (en) | 2011-10-26 | 2017-06-27 | National Cancer Center | Mutant CTLA4 gene transfected T cell and composition including same for anticancer immunotherapy |
| US9226936B2 (en) | 2011-10-28 | 2016-01-05 | The Wistar of Anatomy and Biology | Methods and compositions for enhancing the therapeutic effect of anti-tumor T cells |
| US9272002B2 (en) | 2011-10-28 | 2016-03-01 | The Trustees Of The University Of Pennsylvania | Fully human, anti-mesothelin specific chimeric immune receptor for redirected mesothelin-expressing cell targeting |
| US9868951B2 (en) | 2011-10-28 | 2018-01-16 | The Wistar Institute Of Anatomy And Biology | Methods and compositions for enhancing the therapeutic effect of anti-tumor T cells |
| US20140308259A1 (en) | 2011-11-03 | 2014-10-16 | The Trustees Of The University Of Pennsylvania | Isolated b7-h4 specific compositions and methods of use thereof |
| US9279008B2 (en) | 2011-11-03 | 2016-03-08 | The Trustees Of The University Of Pennsylvania | Isolated B7-H4 specific compositions and methods of use thereof |
| US9422351B2 (en) | 2011-11-03 | 2016-08-23 | The Trustees Of The University Of Pennsylvania | Isolated B7-H4 specific compositions and methods of use thereof |
| US9790267B2 (en) | 2011-11-08 | 2017-10-17 | The Trustees Of The University Of Pennsylvania | Glypican-3-specific antibody and uses thereof |
| US9447194B2 (en) | 2012-02-13 | 2016-09-20 | Seattle Children's Hospital | Bispecific chimeric antigen receptors and encoding polynucleotides thereof |
| US9714278B2 (en) | 2012-02-22 | 2017-07-25 | The Trustees Of The University Of Pennsylvania | Use of ICOS-based CARs to enhance antitumor activity and CAR persistence |
| US9783591B2 (en) | 2012-02-22 | 2017-10-10 | The Trustees Of The University Of Pennsylvania | Use of the CD2 signaling domain in second-generation chimeric antigen receptors |
| US9359447B2 (en) | 2012-03-23 | 2016-06-07 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-mesothelin chimeric antigen receptors |
| US9765342B2 (en) | 2012-04-11 | 2017-09-19 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Chimeric antigen receptors targeting B-cell maturation antigen |
| US9662405B2 (en) | 2012-04-26 | 2017-05-30 | Thomas Jefferson University | Method of treating cancer by administering chimeric antigen receptor comprising anti-GCC antibody |
| US9156915B2 (en) | 2012-04-26 | 2015-10-13 | Thomas Jefferson University | Anti-GCC antibody molecules |
| US20150152181A1 (en) | 2012-05-07 | 2015-06-04 | The Trustees Of Dartmouth College | Anti-b7-h6 antibody, fusion proteins, and methods of using the same |
| US9790278B2 (en) | 2012-05-07 | 2017-10-17 | The Trustees Of Dartmouth College | Anti-B7-H6 antibody, fusion proteins, and methods of using the same |
| WO2013177247A1 (en) | 2012-05-22 | 2013-11-28 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Murine anti-ny-eso-1 t cell receptors |
| US20140134142A1 (en) | 2012-05-25 | 2014-05-15 | Cellectis | Multi-Chain Chimeric Antigen Receptor and Uses Thereof |
| US9409994B2 (en) | 2012-06-01 | 2016-08-09 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | High-affinity monoclonal antibodies to glypican-3 and use thereof |
| US9725519B2 (en) | 2012-06-08 | 2017-08-08 | Kinki University | Antibody against transporter and use thereof |
| US9765156B2 (en) | 2012-07-13 | 2017-09-19 | The Trustees Of The University Of Pennsylvania | Enhancing activity of CAR T cells by co-introducing a bispecific antibody |
| WO2014011984A1 (en) | 2012-07-13 | 2014-01-16 | The Trustees Of The University Of Pennsylvania | Toxicity management for anti-tumor activity of cars |
| US9572836B2 (en) | 2012-07-13 | 2017-02-21 | The Trustees Of The University Of Pennsylvania | Methods for assessing the suitability of transduced T cells for administration |
| CN102775500A (en) | 2012-08-03 | 2012-11-14 | 郑骏年 | Chimeric antigen receptor iRGD-scFv (G250)-CD8-CD28-CD137-CD3zeta and application thereof |
| US20150306141A1 (en) * | 2012-08-20 | 2015-10-29 | Fred Hutchinson Cancer Resesarch Center | Method and compositions for cellular immunotherapy |
| WO2014031687A1 (en) | 2012-08-20 | 2014-02-27 | Jensen, Michael | Method and compositions for cellular immunotherapy |
| US9409992B2 (en) | 2012-08-21 | 2016-08-09 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Mesothelin domain-specific monoclonal antibodies and use thereof |
| US9803022B2 (en) | 2012-08-21 | 2017-10-31 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Mesothelin domain-specific monoclonal antibodies and use thereof |
| WO2014043441A1 (en) | 2012-09-14 | 2014-03-20 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | T cell receptors recognizing mhc class ii-restricted mage-a3 |
| US9416190B2 (en) | 2012-09-27 | 2016-08-16 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Mesothelin antibodies and methods for eliciting potent antitumor activity |
| US9365641B2 (en) | 2012-10-01 | 2016-06-14 | The Trustees Of The University Of Pennsylvania | Compositions and methods for targeting stromal cells for the treatment of cancer |
| WO2014055771A1 (en) | 2012-10-05 | 2014-04-10 | The Trustees Of The University Of Pennsylvania | Human alpha-folate receptor chimeric antigen receptor |
| US9597357B2 (en) | 2012-10-10 | 2017-03-21 | Sangamo Biosciences, Inc. | T cell modifying compounds and uses thereof |
| US20140120136A1 (en) | 2012-10-12 | 2014-05-01 | The Babraham Institute | Mir-155 enhancement of cd8+ t cell immunity |
| WO2014068388A1 (en) | 2012-10-29 | 2014-05-08 | Glaxo Group Limited | 2 substituted cephem compounds |
| US20170290900A1 (en) | 2012-12-20 | 2017-10-12 | Purdue Research Foundation | Chimeric antigen receptor-expressing t cells as anti-cancer therapeutics |
| WO2014100615A1 (en) | 2012-12-20 | 2014-06-26 | Purdue Research Foundation | Chimeric antigen receptor-expressing t cells as anti-cancer therapeutics |
| US20150320799A1 (en) | 2012-12-20 | 2015-11-12 | Purdue Research Foundation | Chimeric antigen receptor-expressing t cells as anti-cancer therapeutics |
| US9511092B2 (en) | 2013-01-28 | 2016-12-06 | St. Jude Children's Research Hospital, Inc. | Chimeric receptor with NKG2D specificity for use in cell therapy against cancer and infectious disease |
| US9688760B2 (en) | 2013-02-08 | 2017-06-27 | Amgen Research (Munich) Gmbh | Anti-leukocyte adhesion for the mitigation of potential adverse events caused by CD3-specific binding domains |
| US20150368342A1 (en) | 2013-02-15 | 2015-12-24 | The Regents Of The University Of California | Chimeric antigen receptor and methods of use thereof |
| US9587020B2 (en) | 2013-02-15 | 2017-03-07 | The Regents Of The University Of California | Chimeric antigen receptor and methods of use thereof |
| WO2014127261A1 (en) | 2013-02-15 | 2014-08-21 | The Regents Of The University Of California | Chimeric antigen receptor and methods of use thereof |
| US9821012B2 (en) | 2013-02-15 | 2017-11-21 | The Regents Of The University Of California | Chimeric antigen receptor and methods of use thereof |
| US20170340672A1 (en) | 2013-02-15 | 2017-11-30 | The Regents Of The University Of California | Chimeric antigen receptor and methods of use thereof |
| US9394368B2 (en) | 2013-02-20 | 2016-07-19 | Novartis Ag | Treatment of cancer using humanized anti-EGFRvIII chimeric antigen receptor |
| US9573988B2 (en) | 2013-02-20 | 2017-02-21 | Novartis Ag | Effective targeting of primary human leukemia using anti-CD123 chimeric antigen receptor engineered T cells |
| US20140322275A1 (en) | 2013-02-20 | 2014-10-30 | Jennifer Brogdon | TREATMENT OF CANCER USING HUMANIZED ANTI-EGFRvIII CHIMERIC ANTIGEN RECEPTOR |
| US20140322212A1 (en) | 2013-02-20 | 2014-10-30 | Jennifer Brogdon | Effective targeting of primary human leukemia using anti-cd123 chimeric antigen receptor engineered t cells |
| US9434935B2 (en) | 2013-03-10 | 2016-09-06 | Bellicum Pharmaceuticals, Inc. | Modified caspase polypeptides and uses thereof |
| US20140286987A1 (en) | 2013-03-14 | 2014-09-25 | Bellicum Pharmaceuticals, Inc. | Methods for controlling t cell proliferation |
| US9587237B2 (en) | 2013-03-14 | 2017-03-07 | Elwha Llc | Compositions, methods, and computer systems related to making and administering modified T cells |
| US9499855B2 (en) | 2013-03-14 | 2016-11-22 | Elwha Llc | Compositions, methods, and computer systems related to making and administering modified T cells |
| US9402888B2 (en) | 2013-03-14 | 2016-08-02 | The Wistar Institute Of Anatomy And Biology | Methods and compositions for treating cancer |
| US20140322183A1 (en) | 2013-03-15 | 2014-10-30 | The Trustees Of The University Of Pennsylvania | Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy |
| US20140271582A1 (en) | 2013-03-15 | 2014-09-18 | City Of Hope | Cd123-specific chimeric antigen receptor redirected t cells and methods of their use |
| US20140286973A1 (en) | 2013-03-15 | 2014-09-25 | The Trustees Of The University Of Pennsylvania | Chimeric antigen receptor specific for folate receptor beta |
| US9393268B2 (en) | 2013-03-15 | 2016-07-19 | Thomas Jefferson University | Cell-based anti-cancer compositions with reduced toxicity and methods of making and using the same |
| US9745368B2 (en) | 2013-03-15 | 2017-08-29 | The Trustees Of The University Of Pennsylvania | Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy |
| US9561291B2 (en) | 2013-03-15 | 2017-02-07 | Imre Kovesdi | Methods of targeting T-cells to tumors |
| US9657105B2 (en) | 2013-03-15 | 2017-05-23 | City Of Hope | CD123-specific chimeric antigen receptor redirected T cells and methods of their use |
| US9446105B2 (en) | 2013-03-15 | 2016-09-20 | The Trustees Of The University Of Pennsylvania | Chimeric antigen receptor specific for folate receptor β |
| US20140271635A1 (en) | 2013-03-16 | 2014-09-18 | The Trustees Of The University Of Pennsylvania | Treatment of cancer using humanized anti-cd19 chimeric antigen receptor |
| US9790282B2 (en) | 2013-03-25 | 2017-10-17 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-CD276 polypeptides, proteins, and chimeric antigen receptors |
| US9629877B2 (en) | 2013-05-14 | 2017-04-25 | Board Of Regents, The University Of Texas System | Human application of engineered chimeric antigen receptor (CAR) T-cells |
| US9873894B2 (en) | 2013-05-15 | 2018-01-23 | Sangamo Therapeutics, Inc. | Methods and compositions for treatment of a genetic condition |
| US9701758B2 (en) | 2013-05-24 | 2017-07-11 | Board Of Regents, The University Of Texas System | Anti-CD19 scFv (FMC63) polypeptide |
| US9890393B2 (en) | 2013-05-29 | 2018-02-13 | Cellectis | Methods for engineering T cells for immunotherapy by using RNA-guided CAS nuclease system |
| US9855297B2 (en) | 2013-05-29 | 2018-01-02 | Cellectis | Methods for engineering T cells for immunotherapy by using RNA-guided CAS nuclease system |
| US20160151465A1 (en) | 2013-06-05 | 2016-06-02 | Bellicum Pharmaceuticals, Inc. | Methods for inducing partial apoptosis using caspase polypeptides |
| US9738726B2 (en) | 2013-06-11 | 2017-08-22 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | HER2-specific monoclonal antibodies and conjugates thereof |
| US9828435B2 (en) | 2013-06-25 | 2017-11-28 | Vaccinex, Inc. | Use of antibodies or antigen-binding fragments thereof that specifically bind semaphorin-4D to increase tumor infiltrating leukocyte frequency |
| US9808486B2 (en) | 2013-08-30 | 2017-11-07 | Board Of Regents, The University Of Texas System | Administration of kynurenine depleting enzymes for tumor therapy |
| US9765142B2 (en) | 2013-10-11 | 2017-09-19 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | TEM8 antibodies and their use in treatment and detection of tumors |
| US20150307564A1 (en) | 2013-10-15 | 2015-10-29 | The California Institute For Biomedical Research | Peptidic chimeric antigen receptor t cell switches and uses thereof |
| WO2015057852A1 (en) | 2013-10-15 | 2015-04-23 | The California Institute For Biomedical Research | Chimeric antigen receptor t cell switches and uses thereof |
| WO2015057834A1 (en) | 2013-10-15 | 2015-04-23 | The California Institute For Biomedical Research | Peptidic chimeric antigen receptor t cell switches and uses thereof |
| US20150238631A1 (en) | 2013-10-15 | 2015-08-27 | The California Institute For Biomedical Research | Chimeric antigen receptor t cell switches and uses thereof |
| US20150139943A1 (en) | 2013-10-17 | 2015-05-21 | National University Of Singapore | Chimeric receptors and uses thereof in immune therapy |
| US10279047B2 (en) | 2014-01-20 | 2019-05-07 | University Of Utah Research Foundation | Compositions and methods for modifying the surface of cells and methods of use |
| US9694033B2 (en) | 2014-01-24 | 2017-07-04 | The Cleveland Clinic Foundation | IL-9 secreting CD8+ Tc9 cells and methods of treating cancer |
| US20160046700A1 (en) | 2014-02-14 | 2016-02-18 | Bellicum Pharmaceuticals, Inc. | Methods for activating t cells using an inducible chimeric polypeptide |
| US9828399B2 (en) | 2014-02-28 | 2017-11-28 | The Royal Institution For The Advancement Of Learning/Mcgill University | TC-PTP inhibitors as APC activators for immunotherapy |
| US9796783B2 (en) | 2014-03-05 | 2017-10-24 | Cantargia Ab | Anti human interleukin-1 receptor accessory protein (IL1 RAP) antibodies and uses thereof |
| US9862775B2 (en) | 2014-03-05 | 2018-01-09 | Eutilex Co., Ltd. | Monoclonal antibody which specifically recognizes B cell lymphoma and use thereof |
| US20150328292A1 (en) | 2014-03-07 | 2015-11-19 | Bellicum Pharmaceuticals, Inc. | Caspase polypeptides having modified activity and uses thereof |
| US20150283178A1 (en) | 2014-04-07 | 2015-10-08 | Carl H. June | Treatment of cancer using anti-cd19 chimeric antigen receptor |
| WO2015164594A1 (en) | 2014-04-23 | 2015-10-29 | Board Of Regents, The University Of Texas System | Chimeric antigen receptors (car) for use in therapy and methods for making the same |
| US9885021B2 (en) | 2014-06-12 | 2018-02-06 | Children's National Medical Center | Generation of broadly-specific, virus-immune cells targeting multiple HIV antigens for preventive and therapeutic use |
| US20160096892A1 (en) | 2014-07-21 | 2016-04-07 | The Trustees Of The University Of Pennsylvania | Treatment of cancer using a cd33 chimeric antigen receptor |
| US20160046724A1 (en) | 2014-07-21 | 2016-02-18 | The Trustees Of The University Of Pennsylvania | Treatment of cancer using humanized anti-bcma chimeric antigen receptor |
| US20160051651A1 (en) | 2014-07-21 | 2016-02-25 | The Trustees Of The University Of Pennsylvania | Treatment of cancer using a cll-1 chimeric antigen receptor |
| US9777061B2 (en) | 2014-07-21 | 2017-10-03 | Novartis Ag | Treatment of cancer using a CD33 chimeric antigen receptor |
| US9562087B2 (en) | 2014-08-08 | 2017-02-07 | The Board Of Trustees Of The Leland Stanford Junior University | High affinity PD-1 agents and methods of use |
| WO2016025322A1 (en) | 2014-08-09 | 2016-02-18 | Purdue Research Foundation | Design and development of neurokinin-1 receptor-binding agent delivery conjugates |
| US9815901B2 (en) | 2014-08-19 | 2017-11-14 | Novartis Ag | Treatment of cancer using a CD123 chimeric antigen receptor |
| US20160068601A1 (en) | 2014-08-19 | 2016-03-10 | The Trustees Of The University Of Pennsylvania | Treatment of cancer using a cd123 chimeric antigen receptor |
| US20160058857A1 (en) | 2014-09-02 | 2016-03-03 | Bellicum Pharmaceuticals, Inc. | Costimulation of chimeric antigen receptors by myd88 and cd40 polypeptides |
| US20160340649A1 (en) | 2014-09-19 | 2016-11-24 | City Of Hope | Costimulatory Chimeric Antigen Receptor T Cells Targeting IL13Rx2 |
| WO2016054520A2 (en) | 2014-10-03 | 2016-04-07 | The California Institute For Biomedical Research | Engineered cell surface proteins and uses thereof |
| US9492499B2 (en) | 2014-10-14 | 2016-11-15 | Riptide Bioscience, Inc. | Peptides having anti-inflammatory properties |
| US9879087B2 (en) | 2014-11-12 | 2018-01-30 | Siamab Therapeutics, Inc. | Glycan-interacting compounds and methods of use |
| US20160136190A1 (en) | 2014-11-17 | 2016-05-19 | Cellectar Biosciences, Inc. | Phospholipid Ether Analogs as Cancer-Targeting Drug Vehicles |
| US9650428B2 (en) | 2014-12-02 | 2017-05-16 | Roger Williams Hospital | Methods and compositions for treating cancer |
| US20160166613A1 (en) | 2014-12-15 | 2016-06-16 | Bellicum Pharmaceuticals, Inc. | Methods for controlled elimination of therapeutic cells |
| US20160175359A1 (en) | 2014-12-15 | 2016-06-23 | Bellicum Pharmaceuticals, Inc. | Methods for controlled activation or elimination of therapeutic cells |
| WO2016098078A2 (en) | 2014-12-19 | 2016-06-23 | Novartis Ag | Dimerization switches and uses thereof |
| WO2016102965A1 (en) | 2014-12-24 | 2016-06-30 | Ucl Business Plc | Cell |
| US20190161531A1 (en) | 2014-12-24 | 2019-05-30 | Ucl Business Plc | Cell |
| US9765330B1 (en) | 2015-01-09 | 2017-09-19 | Nant Holdings Ip, Llc | Compositions and methods for reduction of allograft recognition and rejection |
| US9670281B2 (en) | 2015-02-24 | 2017-06-06 | The Regents Of The University Of California | Binding-triggered transcriptional switches and methods of use thereof |
| US9572837B2 (en) | 2015-03-02 | 2017-02-21 | Innovative Cellular Therapeutics CO., LTD. | Reducing immune tolerance induced by PD-L1 |
| US9777064B2 (en) | 2015-03-17 | 2017-10-03 | Chimera Bioengineering, Inc. | Smart CAR devices, DE CAR polypeptides, side CARs and uses thereof |
| WO2016149665A1 (en) | 2015-03-18 | 2016-09-22 | Baylor College Of Medicine | Her2/erbb2 chimeric antigen receptor |
| US9717745B2 (en) | 2015-03-19 | 2017-08-01 | Zhejiang DTRM Biopharma Co. Ltd. | Pharmaceutical compositions and their use for treatment of cancer and autoimmune diseases |
| US9802997B2 (en) | 2015-03-27 | 2017-10-31 | Immatics Biotechnologies Gmbh | Peptides and combination of peptides for use in immunotherapy against various tumors |
| US9862756B2 (en) | 2015-03-27 | 2018-01-09 | Immatics Biotechnologies Gmbh | Peptides and combination of peptides for use in immunotherapy against various tumors |
| US9840548B2 (en) | 2015-03-27 | 2017-12-12 | Immatics Biotechnologies Gmbh | Peptides and combination of peptides for use in immunotherapy against various tumors |
| WO2016168769A1 (en) | 2015-04-15 | 2016-10-20 | The California Institute For Biomedical Research | Chimeric receptor t cell switches for her2 |
| WO2016168766A1 (en) | 2015-04-15 | 2016-10-20 | The California Institute For Biomedical Research | Optimized chimeric receptor t cell switches and uses thereof |
| US9574014B2 (en) | 2015-05-15 | 2017-02-21 | City Of Hope | Chimeric antigen receptor compositions |
| US9636388B2 (en) | 2015-05-19 | 2017-05-02 | Morphogenesis, Inc. | Multi-indication mRNA cancer immunotherapy |
| US9855298B2 (en) | 2015-05-28 | 2018-01-02 | Kite Pharma, Inc. | Methods of conditioning patients for T cell therapy |
| US20160361360A1 (en) | 2015-06-12 | 2016-12-15 | Immunomedics, Inc. | Disease therapy with chimeric antigen receptor (car) constructs and t cells (car-t) or nk cells (car-nk) expressing car constructs |
| WO2016201300A1 (en) | 2015-06-12 | 2016-12-15 | Immunomedics, Inc. | Disease therapy with chimeric antigen receptor (car) constructs and t cells (car-t) or nk cells (car-nk) expressing car constructs |
| WO2016210447A1 (en) | 2015-06-26 | 2016-12-29 | University Of Southern California | Masking chimeric antigen receptor t cells for tumor-specific activation |
| WO2017029511A1 (en) | 2015-08-20 | 2017-02-23 | Autolus Ltd | Cell |
| WO2017029512A1 (en) | 2015-08-20 | 2017-02-23 | Autolus Ltd | Chimeric cytokine receptor |
| US9790467B2 (en) | 2015-09-22 | 2017-10-17 | Qt Holdings Corp | Methods and compositions for activation or expansion of T lymphocytes |
| US9889160B2 (en) | 2015-10-05 | 2018-02-13 | Precision Biosciences, Inc. | Genetically-modified cells comprising a modified human T cell receptor alpha constant region gene |
| US9889161B2 (en) | 2015-10-05 | 2018-02-13 | Precision Biosciences, Inc. | Genetically-modified cells comprising a modified human T cell receptor alpha constant region gene |
| WO2017068361A1 (en) | 2015-10-23 | 2017-04-27 | Autolus Ltd | Cell |
| WO2017068360A1 (en) | 2015-10-23 | 2017-04-27 | Autolus Ltd | Receptor |
| US9834545B2 (en) | 2015-11-19 | 2017-12-05 | Chemocentryx, Inc. | Modulators of chemokine receptors |
| US9809581B2 (en) | 2015-11-19 | 2017-11-07 | Chemocentryx, Inc. | Inhibitors of CXCR2 |
| US20170166877A1 (en) | 2015-12-14 | 2017-06-15 | Bellicum Pharmaceuticals, Inc. | Dual controls for therapeutic cell activation or elimination |
| US9849092B2 (en) | 2015-12-21 | 2017-12-26 | Gholam A. Peyman | Early cancer detection and enhanced immunotherapy |
| US20170306303A1 (en) | 2016-01-08 | 2017-10-26 | The Regents Of The University Of California | Conditionally active heterodimeric polypeptides and methods of use thereof |
| US9856497B2 (en) | 2016-01-11 | 2018-01-02 | The Board Of Trustee Of The Leland Stanford Junior University | Chimeric proteins and methods of regulating gene expression |
| WO2017137758A1 (en) | 2016-02-12 | 2017-08-17 | Autolus Limited | Signalling system |
| WO2017137759A1 (en) | 2016-02-12 | 2017-08-17 | Autolus Limited | Signalling system |
| WO2017143094A1 (en) | 2016-02-16 | 2017-08-24 | Dana-Farber Cancer Institute, Inc. | Immunotherapy compositions and methods |
| US9663756B1 (en) | 2016-02-25 | 2017-05-30 | Flodesign Sonics, Inc. | Acoustic separation of cellular supporting materials from cultured cells |
| US20170356010A1 (en) | 2016-03-19 | 2017-12-14 | F1 Oncology, Inc. | Methods and compositions for transducing lymphocytes and regulating the activity thereof |
| WO2017165245A2 (en) | 2016-03-19 | 2017-09-28 | F1 Oncology, Inc. | Methods and compositions for transducing lymphocytes and regulated expansion thereof |
| WO2017165571A1 (en) | 2016-03-22 | 2017-09-28 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Early intervention methods to prevent or ameliorate toxicity |
| WO2017177149A2 (en) | 2016-04-08 | 2017-10-12 | Purdue Research Foundation | Methods and compositions for car t cell therapy |
| WO2017180587A2 (en) | 2016-04-11 | 2017-10-19 | Obsidian Therapeutics, Inc. | Regulated biocircuit systems |
| WO2017216562A1 (en) | 2016-06-16 | 2017-12-21 | Autolus Limited | Tunable chimeric antigen receptors |
| WO2017216561A1 (en) | 2016-06-16 | 2017-12-21 | Autolus Limited | Chimeric antigen receptor |
| US9567399B1 (en) | 2016-06-20 | 2017-02-14 | Kymab Limited | Antibodies and immunocytokines |
| US20190292517A1 (en) | 2016-07-13 | 2019-09-26 | President And Fellows Of Harvard College | Antigen-presenting cell-mimetic scaffolds and methods for making and using the same |
| WO2018013797A1 (en) | 2016-07-13 | 2018-01-18 | President And Fellows Of Harvard College | Antigen-presenting cell-mimetic scaffolds and methods for making and using the same |
| US9642906B2 (en) | 2016-09-16 | 2017-05-09 | Baylor College Of Medicine | Generation of HPV-specific T-cells |
| US20190209611A1 (en) | 2016-10-20 | 2019-07-11 | Miltenyi Biotec Gmbh | Chimeric antigen receptor specific for tumor cells |
| WO2018111763A1 (en) | 2016-12-12 | 2018-06-21 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Chimeric transcription factor variants with augmented sensitivity to drug ligand induction of transgene expression in mammalian cells |
| WO2018111834A1 (en) | 2016-12-13 | 2018-06-21 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Methods of exogenous drug activation of chemical-induced signaling complexes expressed in engineered cells in vitro and in vivo |
| US20190388468A1 (en) | 2016-12-15 | 2019-12-26 | Miltenyi Biotec Gmbh | Immune cells expressing an antigen binding receptor and a chimeric costimulatory receptor |
| WO2018115146A1 (en) | 2016-12-21 | 2018-06-28 | Danmarks Tekniske Universitet | Antigen presenting scaffolds for immune-cell manipulation |
| WO2018148224A1 (en) | 2017-02-07 | 2018-08-16 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Phospholipid ether (ple) car t cell tumor targeting (ctct) agents |
| US20230322925A1 (en) * | 2017-02-07 | 2023-10-12 | Seattle Children’S Hospital (Dba Seattle Children’S Research Institute) | Phospholipid ether (ple) car t cell tumor targeting (ctct) agents |
| US11649288B2 (en) * | 2017-02-07 | 2023-05-16 | Seattle Children's Hospital | Phospholipid ether (PLE) CAR T cell tumor targeting (CTCT) agents |
| US20200087399A1 (en) | 2017-02-07 | 2020-03-19 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Phospholipid ether (ple) car t cell tumor targeting (ctct) agents |
| WO2018152451A1 (en) | 2017-02-17 | 2018-08-23 | Purdue Research Foundation | Targeted ligand-payload based drug delivery for cell therapy |
| WO2018160622A1 (en) | 2017-02-28 | 2018-09-07 | Endocyte, Inc. | Compositions and methods for car t cell therapy |
| WO2019060425A1 (en) | 2017-09-19 | 2019-03-28 | Massachusetts Institute Of Technology | Compositions for chimeric antigen receptor t cell therapy and uses thereof |
| US20190255109A1 (en) * | 2018-01-22 | 2019-08-22 | Endocyte, Inc. | Methods of use for car t cells |
| US11311576B2 (en) * | 2018-01-22 | 2022-04-26 | Seattle Children's Hospital | Methods of use for CAR T cells |
| US20220257652A1 (en) * | 2018-01-22 | 2022-08-18 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Methods of use for car t cells |
| US11779602B2 (en) * | 2018-01-22 | 2023-10-10 | Endocyte, Inc. | Methods of use for CAR T cells |
| US20190224237A1 (en) | 2018-01-22 | 2019-07-25 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Methods of use for car t cells |
| WO2019156795A1 (en) | 2018-02-06 | 2019-08-15 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Fluorescein-specific cars exhibiting optimal t cell function against fl-ple labelled tumors |
| US20210317407A1 (en) * | 2018-08-06 | 2021-10-14 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Methods and compositions for stimulation of chimeric antigen receptor t cells with hapten labelled cells |
| US20220125841A1 (en) * | 2019-03-13 | 2022-04-28 | Seattle Children's Hospital (dba Seattle Children'a Research Institute) | Sodium fluorescein as a reversal agent for an anti-fluorescein car t cells and fluorescein-phospholipid-ethers or profluorescein-phospholipid-ethers |
| US20220280648A1 (en) * | 2019-07-05 | 2022-09-08 | Purdue Research Foundation | Design and efficient synthesis of lipid-fluorescein conjugates for car-t cell therapy |
| US20230172981A1 (en) * | 2020-02-04 | 2023-06-08 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Methods and compositions for stimulation of chimeric antigen receptor t cells with hapten labelled cells |
Non-Patent Citations (358)
| Title |
|---|
| Abken, H. et al. Chimeric T-Cell Receptors: Highly Specific Tools to Target Cytotoxic T-Lymphocytes to Tumour Cells, Cancer Treatment Reviews (1997); 23:97-112. |
| Abken, H., et al., Tuning tumor-specific T-cell activation: a matter of costimulation? Trends in Immunology vol. 23 No. 5 May 2002: 240-45. |
| Abstracts for the 26th Annual Scientific Meeting of the Society for Immunotherapy of Cancer (SITC), J Immunother., vol. 34, No. 9, Nov.-Dec. 2011 (62 pp.). |
| Airenne et al., Recombinant avidin and avidin-fusion proteins , Biomolecular Engineering16 (1999) 87-92. |
| Alcover et al., A soluble form of the human CD8 alpha chain expressed in the baculovirus system: Biochemical characterization and binding to MHC Class I , Molecular Immunology, vol. 30, No. 1, pp. 55-67, 1993. |
| Alexander et al., Indoleamine 2,3-Dioxygenase Expression in Transplanted NOD Islets Prolongs Graft Survival After Adoptive Transfer of Diabetogenic Splenocytes, Diabetes2002, vol. 51 pp. 356-365. |
| Alonso-Camino et al. CARbodies: Human Antibodies Against Cell Surface Tumor Antigens Selected From Repertoires Displayed on T Cell Chimeric Antigen Receptors. (2013) Mol Ther Nucl Acids 2, e93 (11 pages). |
| Altenschmidt, U. et al. Adoptive transfer of in vitro-targeted, activated T lymphocytes results in total tumor regression, J. Immunol. (1997); 159:5509-15. |
| Altenschmidt, U., et al., Specific cytotoxic T lymphocytes in gene therapy, J. Mol. Med. (1997); 75, 259-266. |
| Altschul et al., "Local Alignment Statistics, [27] Multiple Alignment and Phylogenetic Trees," Methods in Enzymology (1996) 266:460-480. |
| Altschul, S. et al., Basic local alignment search tool, J. Mol. Bio., 1990, 215, 403-410. |
| Altvater, B., et al., 284 (CD244) Signaling by Recombinant Antigen-specific Chimeric Receptors Costimulates Natural Killer Cell Activation to Leukemia and Neuroblastoma Cells , Clin Cancer Res 2009;15(15) Aug. 1, 2009: 4857-66. |
| Alvarez-Vallina, L. et al., Antigen-specific targeting of CD28-mediated T cell co-stimulation using chimeric single-chain antibody variable fragment-CD28 receptors, Eur. J. Immunol, 1996, 26, 2304-2309. |
| Amin et al., The Eighth Edition AJCC Cancer Staging Manual: Continuing to Build a Bridge From a Population-Based to a More Personalized Approach to Cancer Staging, CA Cancer J Clin (2017) vol. 67, No. 2, pp. 93-99. |
| An et al., IgG2m4, an engineered antibody isotype with reduced Fc function, mAbs 2009, Landes Bioscience, 1:6, 572-579. |
| Ang et al., Generating a Chimeric Antigen Receptor to Redirect T-Cell Specificity after Infusion , Molecular Therapy vol. 19, Supplement 1, May 2011, S137-S138. |
| Arch, R, et al., 4-1BB and Ox40 Are Members of a Tumor Necrosis Factor (TNF)-Nerve Growth Factor Receptor Subfamily That Bind TNF Receptor-Associated Factors and Activate Nuclear Factor kB, Molecular and Cellular Biology (1998); 558-565. |
| Aruffo, A, et al., Molecular cloning of a CD28 cDNA by a high-efficiency COS cell expression system, Proc. Nati. Acad. Sci. USA (1987); 84: 8573-8577. |
| Baba et al., N-Linked Carbohydrate on Human Leukocyte Antigen-C and Recognition by Natural Killer Cell Inhibitory Receptors , Human Immunology 61, 1202-1218 (2000). |
| Baiu et al. (Published online Jul. 26, 2017) Targeted Molecular Radiotherapy of Pediatric Solid Tumors Using a Radioiodinated Alkyl-Phospholipid Ether Analog. J Nucl Med 2018; 59: 244-250. * |
| Baniyash et al., The T Cell Antigen Receptor Zeta Chain is Tyrosine Phosphorylated open Activation the Journal of Biological Chemistry, vol. 263, No. 34, Issue of Dec. 5, pp. 18225-18230. |
| Barber, et al., Chimeric NKG2D Receptor-Expressing T Cells as an Immunotherapy for Multiple Myeloma, Exp Hematol. (Oct. 2008); 36(10):1318-28. |
| Barocas et al., A population-based study of renal cell carcinoma and prostate cancer in the same patients, BJU International, (2006) 97(1): 33-36. |
| Barrett et al., Chimeric Antigen Receptor Therapy for Cancer Annual Review of Medicine vol. 65: 333-347 (2014). |
| Bauer et al., Activation of NK Cells and T Cells by NKG2D, a Receptor for Stress-Inducible MICA, Science 1999, vol. 285 pp. 727-729. |
| Bauer, A, et al., Differential signal transduction via T-cell receptor CD3′2, CD3C-,v,and CD3′q2 isoforms, Proc. Nati. Acad. Sci. USA (1991); 88: 3842-3846. |
| Baum et al. Retrovirus vectors: toward the plentivirus? (2006) Molecular Therapy: The Journal of the American Society of Gene Therapy. 13:1050-1063. |
| Becker, M. L. B., et al., Expression of a hybrid immunoglobulin-T cell receptor protein in transgenic mice, Cell (1989); 58:911-921. |
| Bedzyk, WD et al., Active site structure and antigen binding properties of idiotypically cross-reactive anti-fluorescein monoclonal antibodies, J Biol Chem., 1990, 265, 133-138. |
| Bejcek, B, et al., Development and Characterization of Three Recombinant Single Chain Antibody Fragments (scFvs) Directed against the CD19 Antigen1, Cancer Research55, (1995); 2346-2351. |
| Berg et al., Section 3.2 Primary Structure: Amino Acids Are Linked by Peptide Bonds to Form Polypeptide Chains Biochemistry. 5th Ed. New York. W.H. Freeman; 2002, pp. 1-16. |
| Berger et al., Feb. 2015, Safety of targeting ROR1 in primates with chimeric antigen receptor modified T cells, Cancer Immunology Research, 3(2):206-216. |
| Berger, C., et al., Analysis of trans gene-specific immune responses that limit the in vivopersistence of adoptively transferred HSV-TK-modified donor T cells after allogeneic hematopoietic cell transplantation. Blood, 2006, 107(6): p. 2294-302. |
| Bio-Rad 2016, The T Cell Marker, CD3 Antigen and Antibodies, retrieved on May 4, 2024 from the Internet: <URL: https://www.bio-rad-antibodies.com/static/2016/innate/the-t-cell-marker-cd3-antigen-and-antibodies.pdf>, 5 pp. |
| Bluemel, C., et al., Epitope distance to the target cell membrane and antigen size determine the potency of T cell-mediated lysis by BiTE antibodies specific for a large melanoma surface antigen. Cancer Immunol Immunother (2010); 59(8): 1197-209. |
| Boder et al., Directed evolution of antibody fragments with monovalent femtomolar antigen-binding affinity, PNAS (Sep. 26, 2000) vol. 97, No. 20, pp. 10701-10705. |
| Bolhuis, R. L. et al. Preparation for a phase I/II study using autologous gene modified T lymphocytes for treatment of metastatic renal cancer patients., Adv. Exp. Med. Biol. (1998); 451:547-55. |
| Boomer et al., Cutting Edge: A Double-Mutant Knockin of the CD28 YMNM and PYAP Motifs Reveals a Critical Role for the YMNM Motif in Regulation of T Cell Proliferation andBcl-x L Expression The Journal of Immunology. 2014; 192, pp. 3465-3469. |
| Boomer, J, et al.,, An Enigmatic Tail of CD28 Signaling, Washington University School of Medicine (2010); 1-20. |
| Boursier et al., Evidence for an Extended Structure of the T-cell Co-receptor CD8α as Deduced from the Hydrodynamic Properties of Soluble Forms of the Extracellular Region*, The Journal of Biological Chemistry 1993, vol. 268, No. 3, Issue of Jan. 25, pp. 2013-2020. |
| Brennan et al., Carbohydrate Recognition by a Natural Killer Cell Receptor, Ly-49C*, The Journal of Biological Chemistry 1995, vol. 270, No. 17, Issue of Apr. 28, pp. 9691-9694. |
| Brentjens et al., CD19-targeted T cells rapidly induce molecular remissions in adults with chemotherapy-refractory acute lymphoblastic leukemia. Sci Transl Med. 2013 5(177)ra38 (11 pages). |
| Brentjens, et al., Eradication of systemic B-cell tumors by genetically targeted human T lymphocytes co-stimulated by CD80 and interleukin-15, Nat. Med. (2003); 9: 279-286. |
| Bruhns et al., Differential Roles of N- and C-Terminal Immunoreceptor Tyrosine-Based Inhibition Motifs During Inhibition of Cell Activation by Killer Cell Inhibitory Receptors, The Journal of Immunology 1999; 162:3168-3175. |
| Bukczynski et al., Costimulatory ligand 4-1 BBL (CD137L) as an efficient adjuvant of human antiviral cytotoxic T cell responses, Proc. Natl. Acad. Sci. USA, 2004, 101:1291-1296. |
| Cambier, et al., Antigen and Fc receptor signaling. The awesome power of the immunoreceptor tyrosine-based activation motif (ITAM), J Immunol. (Oct. 1, 1995); 155(7):3281-5. |
| Camerini, D, et al.,. The T cell activation antigen CD27 is a member of the nerve growth factor/tumor necrosis factor receptor gene family, The Journal of Immunology (1991);3165-3169. |
| Cameron, B.J., et al., Identification of a Titin-Derived HLA-A1-Presented Peptide as a Cross-Reactive Target for Engineered MAGE A3-Directed T Cells, Sci Transl Med (Aug. 7, 2013); 5(197): 197ra103 (11 pages). |
| Canfield et al., The Binding Affinity of Human IgG for its High Affinity Fc Receptor is Determined by Multiple Amino Acids in the CH2 Domain and Is Modulated by the Hinge Region, J. Exp. Med. 1991, vol. 173 pp. 1483-1491. |
| Cannons et al., 4-1BB ligand induces cell division, sustains survival, and enhances effector function of CD4 and CD8 T cells with similar efficacy, J Immunol. Aug. 2001, 167(3): 1313-1324. |
| Carlens et al. Ex vivo T lymphocyte expansion for retroviral transduction: influence of serum-free media on variations in cell expansion rates and lymphocyte subset distribution. (2000) Exp Hernatol 28(10): 1137-46. |
| Cartellieri, M. et al., Chimeric antigen receptor-engineered T cells for immunotherapy of cancer, J. Biomedicine and Biotechnology, 2010, Article ID 956304, 13 pages. |
| Caruana et al., 2013, Boosting in vivo CAR-redirected virus-specific CTLs with universal-artificial antigen presenting cells, Blood, 122(21):4204. |
| Cavalieri et al. Human T lymphocytes transduced by lentiviral vectors in the absence of TCR activation maintain an intact immune competence. (2003) Blood. 102(2): 497-505. |
| Chalupny et al., T-cell activation molecule 4-1BB binds to extracellular matrix proteins, Proc. Natl. Acad. Sci., USA, 89: 103360-10364 (Nov. 1992). |
| Chang et al., A Chimeric Receptor with NKG2D Specificity Enhances Natural Killer Cell Activation and Killing of Tumor Cells , Cancer Res 2013;73:1777-1786. Published online Jan. 9, 2013. |
| Cheadle et al., Chimeric antigen receptors for T-cell based therapy Methods Mol Biol. 2012; 907:645-66. |
| Chen et al. Fusion protein linkers: property, design and functionality, Adv Drug Deliv Rev.(2013); 65: 1357-1369 (Epub Sep. 29, 2012). |
| Cheng et al., Mar. 26, 2004, Hapten-directed targeting to single-chain antibody receptors, Cancer Gene Therapy, 11(5):380-388. |
| Cho C. Rapid identification of cytokine release syndrome after haploidentical PBSC transplantation and successful therapy with tocilizumab. Bone Marrow Transplant. Dec. 2016;51(12):1620-1621, Epub Sep. 26, 2016. |
| Cho et al., Macromolecular versus small-molecule therapeutics: drug discovery, development and clinical considerations TIBTECH, vol. 14, May 1996, pp. 153-158. |
| Chothia et al., December 1989, Conformations of immunoglobulin hypervariable regions, Nature, 342:877-883. |
| Cohen et al. Recognition of fresh human tumor by human peripheral blood lymphocytes transduced with a bicistronic retroviral vector encoding a murine anti-p53 TCR (2005) J Immunol. 175:5799-5808. |
| Colcher, D. et al. In vivo tumor targeting of a recombinant single-chain antigen-binding protein., J. Nat. Cancer Inst. (1990); 82:1191-1197. |
| Cole et al., The molecular determinants of CD8 co-receptor function , 2012, Immunology, 137, 139-148. |
| Common Terminology Criteria for Adverse Events (CTCAE), National Cancer Institute Common Toxicity Criteria version 4.03 (NCI-CTCAE v4.03 (2010) (196 pages). |
| Cooper et al. T-cell clones can be rendered specific for CD19: toward the selective augmentation of the graft-versus-B-lineage leukemia effect (2003) Blood. 101(4): 1637-1644. |
| Cooper et al., Enhanced antilymphoma efficacy of CD19-redirected influenza MP1—specific CTLs by cotransfer of T cells modified to present influenza MP1, Blood 2005, vol. 105 No. 4 pp. 1622-1631. |
| Cordaro, T. A et al. Tumor size at the time of adoptive transfer determines whether tumor rejection occurs, Eur. J. Immunol. (2000); 30: 1297-1307. |
| Croft, M., The role of TNF superfamily members in T-cell function and diseases Nature Reviews, Immunology, vol. 9, Apr. 2009, pp. 271-285. |
| Dall, Peter et al., In vivo cervical cancer growth inhibition by genetically engineered cytotoxic T cells. Cancer Immunol. Immunother. (Jan. 2005); 54(1):51-60. |
| Darcy, P. K. et al., Expression in cytotoxic T lymphocytes of a single-chain anti-carcinoembryonic antigen antibody, Redirected Fas ligand-mediated lysis of colon carcinoma, Eur. J. Immunol. (1998); 28:1663-72. |
| Davila M. L. et al: Efficacy and toxicity management of 19-28z CAR T cell therapy in B cell acute lymphoblastic leukemia Sci Transl Med. Feb. 19, 2014;6(224):224-25. |
| Davila Marco L. et al: CD19-Targeted T Cells for Hematologic Malignancies Clinical Experience to Date , Cancer Journal, vol. 21, No. 6, Jan. 1, 2015 (Jan. 1, 2015),pp. 470-474. |
| Debelouchina et al., A molecular engineering toolbox for the structural biologist Quarterly Reviews of Biophysics, 2017, 50, e7, pp. 1-41. |
| Deming et al., Oct. 6, 2014, Phospholipid ether analogs for the detection of colorectal tumors. PLOS One, 9(10):e109668. |
| Deng et al., 2019, Antitumor activity of NKG2D CAR-T cells against human colorectal cancer cells in vitro and in vivo, Am J. Cancer Res, 9(5):945-958. |
| Diefenbach et al., The innate immune response to tumors and its role in the induction of T-cell immunity, Immunological Reviews 2002, vol. 188: 9-21. |
| Dissanayake et al., Mar. 19, 2014, Peptide-pulsed dendritic cells have superior ability to induce immune-mediated tissue destruction compared to peptide with adjuvant. PLOS One, 9(3):e92380, 10 pp. |
| Dotti, et al. Design and development of therapies using chimeric antigen receptor-expressing T cells. Immun Rev (Jan. 2014); 257(1): 107-126. |
| Dubrovska, A., et al., A chemically induced vaccine strategy for prostate cancer, ACS Chem Biol (2011); 6(11): 1223-31. |
| Duncan et al., Localization of the binding site for the human high-affinity Fc receptor onlg G, Nature 1998, vol. 332 pp. 563-564. |
| Elsaid et al. Enhanced Radiosensitivity in Solid Tumors using a Tumor-selective Alkyl Phospholipid Ether Analog. Mol Cancer Ther. Nov. 2018; 17(11): 2320-2328. * |
| Ertl, H. C. et al., Considerations for the clinical application of chimeric antigen receptor T cells: observations from a recombinant DNA advisory committee symposium held Jun. 15, 2010, Cancer Res., 2011, 71, 3175-3181. |
| Eshhar, et al., Design of Cytotoxic T Lymphocytes with Antibody-Type Specificity against Tumor Cells Using Chimeric TcR, Journal of Cellular Biochemistry, Supplement 14B, UCLA Symposia on Molecular & Cellular Biology, Abstracts, 19th Annual Meeting, Jan. 27-Feb. 8, 1990, p. 70. |
| Eshhar, Z., et al., Functional expression of chimeric receptor genes in human T cells, J. Immunol. Meth. (2001); 248: 67-76. |
| Fang et al., Jul. 17, 2013, Lipid-insertion enables targeting functionalization of erythrocyte membrane- cloaked nanoparticles, Nanoscale, 5(19): 8884-8888. |
| Fedorov VD, et al., PD-1- and CTLA-4-based inhibitory chimeric antigen receptors (ICARs) divert off—target immunotherapy responses, Sci Transl Med. (Dec. 11, 2013);5(215):215ra172 (12 pages). |
| Feng et al., Convergence on a Distinctive Assembly Mechanism by Unrelated Families of Activating Immune Receptors , Immunity, vol. 22, 427-438, Apr. 2005. |
| Feng et al., The Assembly of Diverse Immune Receptors is Focused on a Polar Membrane-Embedded Interaction Site , 2006. PLoS Biol 4(5):e142. |
| Ferrone, S., et al., How much longer will tumor cells fool the immune system, Immunol. Today (2000); 21: 70-72. |
| Figini, M, et al., Conversion of murine antibodies to human antibodies and their optimization for ovarian cancer therapy targeted to the folate receptor, Cancer ImmunolImmunother (Apr. 2009); 58(4):531-46 (Epub Aug. 15, 2008). |
| Foell et al., CD137-mediated T cell co-stimulation terminates existing autoimmune disease in SLE-prone NZB/NZW F1 mice., Ann N Y Acad Sci. Apr. 2003; 987:230-5. |
| Frecha et al. Advances in the field of lentivector-based transduction of T and B lymphocytes for gene therapy (2010) Molecular Therapy: The Journal of the American Society of Gene Therapy. 18:1748-1757. |
| Frost et al., In Vitro Evaluation of Avidin Antibody Pretargeting Using 211At-Labeled andBiotinylated Poly-L-Lysine as Effector Molecule*, Cancer 2010, Cancer Therapy With Antibodies and Immunoconjugates, Supplement to Cancer, pp. 1101-1110. |
| Fujita, K. et al., Prolonged disease-free period in patients with advanced epithelial ovarian cancer after adoptive transfer of tumor-infiltrating lymphocytes. Clin. Cancer Res., 1995, 1, 501-507. |
| Gargalionis et al., The molecular rationale of Src inhibition in colorectal carcinomas, Int. J.Cancer, 134:2019-2029 (2013). |
| Gargett, T., et al., GD2-specific CART Cells Undergo Potent Activation and Deletion Following Antigen Encounter but can be Protected From Activation-induced Cell Death by PD-1 Blockade. Mol Ther, 2016. 24(6): p. 1135-49. |
| Gilboa, E., How tumors escape immune destruction and what we can do about it, Cancer Immunol. Immunother. (1999); 48: 382-385. |
| Gilham et al., CAR-T cells and solid tumors: tuning T cells to challenge an inveterate foe, Trends in Molecular Medicine (2012); 18(7): 377-384 (Epub May 19, 2012). |
| Gilham et al., Primary polyclonal human T lymphocytes targeted to carcino-embryonicantigens and neural cell adhesion molecule tumor antigens by CD3zeta-based chimeric immune receptors, J. Immunother, (Mar.-Apr. 2000); 25 (2): 139-151. |
| Gillies, S.D. et al., Targeting Human Cytotoxic T Lymphocytes to Kill Heterologous Epidermal Growth Factor Receptor-Bearing Tumor Cells, The Journal of Immunology (1991); 146(3): 1067-1071. |
| Gong, M. C., et al., Prostate-specific membrane antigen (PSMA)-specific monoclonal antibodies in the treatment of prostate and other cancers, Cancer Metastasis Rev. (1999); 18: 483-490. |
| Gonzalez et al., Genetic engineering of cytolytic T lymphocytes for adoptive T-cell therapy of neuroblastoma, The Journal of Gene Medicine (Jun. 2004) vol. 6, Issue 6, 704-711. |
| Goverman, J. et al., Chimeric immunoglobulin-T cell receptor proteins form functional receptors: implications for T cell receptor complex formation and activation, Cell (1990); 60:929-939. |
| Greenfield, E. A, Nguyen, K. A & Kuchroo, V. K. CD28/B7 co-stimulation: a review. Crit. Rev. Immunol. 18, 389-41 8 (1998). |
| Griffiths et al., The Nature of DNA Modern Genetic Analysis. New York: W.H. Freeman; 1999, pp. 1-11. |
| Grosenbach et al., A recombinant vector expressing transgenes for four T-cell costimulatory molecules (OX40L, B7-1, ICAM-1, LFA-3) induces sustained CD4+ and CD8+ T-cell activation, protection from apoptosis, and enhanced cytokine production, Cellular Immunology 222 (2003) 45-57. |
| Gross et al., Development and study of chimeric immunoglobulin/T cell receptor molecules as functional receptors that endow T cells with antibody-type specificity, Ph.D. Thesis presented to the Feinberg Graduate School, The Wiezmann Institute of Science, Rehovot, Israel (1990); 1-70. |
| Gross, G. et al., Endowing T cells with antibody specific using chimeric T cell receptors, Department of Chemical Immunology, FASEB J. (Dec. 1992); 6(15):3370-8. |
| Gross, G. et al., Expression of immunoglobuling-T-cell receptor chimeric molecules as functional receptors with antibody-type specificity, Proc. Natl. Acad. Sci., 1989, 86, 10024-10028. |
| Gross, G. et al., Generation of effector T cells expressing chimeric T cell receptor with antibody type-specificity, Transplant. Proc. (1989); 21 (1 Pt 1):127-130. |
| Grupp et al., Chimeric Antigen Receptor-Modified T Cells for Acute Lymphoid Leukemia, N. Engl. J. Med. (Apr. 18, 2013) 368(16):1509-1518. |
| Grupp Stephan A .: Advances in T-cell therapy for All, Best Practice & Research Clinical Haematology, vol. 27, No. 3-4, Sep. 1, 2014(Sep. 1, 2014), pp. 222-228. |
| Gruss et al., Tumor Necrosis Factor Ligand Superfamily: Involvement in the Pathology of Malignant Lymphomas Blood, vol. 85, No. 12, Jun. 15, 1995, pp. 3378-3404. |
| Guinn et al., 4-1BBL Cooperates with B7-1 and B7-2 in Converting a B Cell Lymphoma Cell Line into a Long-Lasting Antitumor Vaccine, The Journal of Immunology162:5003-5010 (1999). |
| Habib-Agahi,H., Phan, T.T. and Searle,P.F. Co-stimulation with 4-1BB ligand allows extended T-cell proliferation, synergizes with CD80/CD86 and can reactivate anergic T cells Int. Immunol. 19 (12), 1383-1394 (2007). |
| Hackett et al. A transposon and transposase system for human application (2010) Molecular Therapy: The Journal of the American Society of Gene Therapy. 18:674-683. |
| Hanson, H. L. et al. Eradication of established tumors by CD8+ T cell adoptive immunotherapy. Immunity 13, 265-276 (2000). |
| Harper et al., CTLA-4 and CD28 Activated Lymphocyte Molecules are Closely Related in Both Mouse and Human as to Sequence, Message, Expression, Gene Structure, and Chromosomal Location , The Journal of Immunology, vol. 147, 1037-1044, No. 3, Aug. 1, 1991. |
| Hatakeyama et al., Transmembrane Signaling of Interleukin 2 Receptor, J. Exp. Med. 1987, vol. 166 pp. 362-375. |
| Haynes et al., Redirecting Mouse CTL Against Colon Carcinoma: Superior Signaling Efficacy of Single-Chain Variable Domain Chimeras Containing TOR-zeta vs Fcepsilon RI-gamma J Immunol 2001; 166:182-187 (Haynes 2001). |
| Hege et al., Safety, tumor trafficking and immunogenicity of chimeric antigen receptor (CAR)-T cells specific for TAG-72 in colorectal cancer, Journal for Immunotherapy of Cancer 2017, 5:22. |
| Hege et al., Systemic T Cell-independent Tumor Immunity after Transplantation of Universal Receptor—modified Bone Marrow into SCID Mice , J. Exp. Med. vol. 184 Dec. 1996 pp. 2261-2269. |
| Herron, J.N., et al., High resolution structures of the Apr. 4, 20 Fab-fluorescein complex in two solvent systems: effects of solvent on structure and antigen-binding affinity . Biophys J, 1994. 67(6): p. 2167-83. |
| Heuser, et al., T-cell activation by recombinant immunoreceptors: impact of the intracellular signalling domain on the stability of receptor expression and antigen-specific activation of grafted T-cells, Gene Therapy (2003); 10: 1408-1419. |
| Hombach et al., T cell activation by recombinant FcεRl γ-chain immune receptors: an extracellular spacer domain impairs antigen-dependent T cell activation but not antigen recognition, Gene Therapy (2000) 7, 1067-1075. |
| Hombach, et al., Adoptive Immunotherapy with Genetically Engineered T Cells: Modification of the IgG1 Fc ‘Spacer’ Domain in the Extracellular Molety of Chimeric Antigen Receptors Avoids ‘Off-Target’ Activation and Unintended Initiation of an Innate Immune Response, Gene Ther. (Oct. 2010); 17(10):1206-13. |
| Honegger et al., A mutation designed to alter crystal packing permits structural analysis of a tight-binding fluorescein-scFv complex, Protein Science (2005) 14(10), 2537-2549. |
| Huang, J., et al., Modulation by IL-2 of CD70 and CD27 expression on CD8+ T cells: importance for the therapeutic effectiveness of cell transfer immunotherapy J. Immunol. 176 (12), 7726-7735 (2006). |
| Hudecek et al. Jun. 15, 2013, Receptor affinity and extracellular domain modifications affect tumor recognition by ROR1-specific chimeric antigen receptor T-cells. Clin Cancer Res. 19(12):3153-3164. |
| Hughes M. S. et al., Transfer of a TCR gene derived from a patient with a marked antitumor response conveys highly active T-cell effector functions. Hum Gene Ther Apr. 2005; 16(4):457-72). |
| Hunter et al., Inhibition of Fcγ Receptor-Mediated Phagocytosis by a Nonphagocytic FcγReceptor, Blood, vol. 91, No. 5 Mar. 1, 1998: pp. 1762-1768. |
| Hutchins, B. et al., Site-specific coupling and sterically controlled formation of multimeric antibody fab fragments with unnatural amino acids, J. Mol. Biol., 2011, 406, 595-603. |
| Hutloff, A. et al., ICOS is an inducible T-cell costimulator structurally and functionally related to CD28. Nature, 1999, 397, 263-266. |
| Hwu, et al., The Genetic Modification of T Cells for Cancer Therapy: An Overview of Laboratory and Clinical Trials, Cancer Detection and Prevention (1994); 18(1):43-50. |
| Hyman et al. Probing oxidative stress: Small molecule fluorescent sensors of metal ions, reactive oxygen species, and thiols. Coordination Chemistry Reviews (2012) 256: 2333-2356. * |
| Imai, C. et al., Chimeric receptors with 4-1BB signaling capacity provoke potent cytotoxicity against acute lymphoblastic leukemia, Leukemia, 2004, 18, 676-684. |
| Imai, K., et al., Comparing Antibody and Small-Molecule Therapies for Cancer ; https://www.medscape.com/viewarticle/550008 (26 pages). |
| International Search Report for PCT/US2019/014054 dated May 31, 2019. |
| Irving, B. A., et al., The cytoplasmic domain of the T cell receptor zeta chain is sufficient to couple to receptor-associated signal transduction pathways' Cell (1991); 64:891-901. |
| Isakov et al., PKC-theta-mediated signal delivery from the TCR/CD28 surface receptors , Frontiers in Immunology, T Cell Biology, Aug. 2012, vol. 3, Article 273, pp. 1-12. |
| Janeway et al., Appendix I. Immunologists' Toolbox Immunobiology: The Immune System in Health and Disease. 5th ed. New York: Garland Science; 2001 (101 pages). |
| Janeway et al., The structure of a typical antibody molecule Immunobiology: The Immune System in Health and Disease. 5th Ed. New York: Garland Science; 2001, pp. 1-11. |
| Jang, I, et al., Human 4-1BB (CD137) Signals Are Mediated by TRAF2 and Activate Nuclear Factor-kB, Biochemical and Biophysical Research Communications (1998);613-620. |
| Jena et al., Redirecting T-cell specificity by introducing a tumor-specific chimeric antigen Receptor, Blood 2010, vol. 116, No. 7, pp. 1035-1044. |
| Jensen, M. C., et al., Abstract #98: Targeting Pre-B Acute Lymphoblastic Leukemia With T Cell Clones Engineered To Express A CD19-Specific Chimeric Immunoreceptor, Blood (Nov. 16, 2000); 96(11):26A. |
| Jensen, M. et al. CD20 is a Molecular Target For scFvFc[zeta] Receptor Redirected T Cells: Implications for Cellular Immunotherapy of CD20+ Malignancy, Biology of Blood and Marrow Transplantation (1998); 4:75-83. |
| Jensen, M.C., et al., Antitransgene rejection responses contribute to attenuated persistence of adoptively transferred CD20/CD19-specific chimeric antigen receptor redirected T cells in humans. Biol Blood Marrow Transplant, 2010. 16(9): p. 1245-56. |
| Johnson et al., 2000, Kabat database and its applications: 30 years after the first variability plot, Nucleic Acids Res., 28(1): 214-218. |
| Jonnalagadda et al., Chimeric Antigen Receptors With Mutated IgG4 Fc Spacer Avoid Fc Receptor Binding and Improve T Cell Persistence and Antitumor Efficacy, Molecular Therapy 2015, vol. 23, No. 4, pp. 757-768. |
| Jung et al., Improving in vivo folding and stability of a single-chain Fv antibody fragment by loop grafting, Protein Engineering (1997) vol. 10, No. 8, pp. 956-966. |
| Jung, S. et al., Selection for improved protein stability by phage display, J. Mol. Biol., 1999, 294, 163-180. |
| Kabat et al., 1991, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (TOC). |
| Kagoya, Y., et al., Transient stimulation expands superior antitumor T cells for adoptive therapy. JCI Insight, 2017. 2(2): p. e89580 (13 pages). |
| Kalos et al., T Cells with Chimeric Antigen Receptors Have Potent Antitumor Effects and Can Establish Memory in Patients with Advanced Leukemia, Sci. Transl. Med. (Aug. 10, 2011) 3(95):1-21. |
| Kandalaft, L. et al., A phase I clinical trial of adoptive transfer of folate receptor-alpha redirected autologous T cells for recurrent ovarian cancer, Journal of Translational Medicine, 2012, 10:157, 10 pages. |
| Kang, S. et al: Therapeutic uses of anti-interleukin-6 receptor antibody, International Immunology, vol. 27, No. 1, Aug. 20, 2014 (Aug. 20, 2014), pp. 21-29. |
| Karachaliou et al., Common Co-activation of AXL and CDCP1 in EGFR-mutation-positive Non-small cell Lung Cancer Associated with Poor Prognosis, EBioMedicine (2017) https://doi.org/10/1016/j.ebiom.2018.02.001. |
| Kariv et al., Analysis of the Site of Interaction of CD28 with Its Counterreceptors CD80 and CD86 and Correlation with Function, 157 J. Immunol.29-38 (1996). |
| Katz et al., Recognition of HLA-Cw4 but Not HLA-Cw6 by the NK Cell Receptor Killer Celllg-Like Receptor Two-Domain Short Tail No. 4 , J Immunol 2001; 166:7260-7267. |
| Kennedy, M. et al., Optical imaging of metastatic tumors using a folate-targeted fluorescent probe, J. Biomed. Opt., 2003, 8, 636-641. |
| Kim el al. Redirection of Genetically Engineered CAR⋅T Cells Using Bifunctional Small Molecules, Journal of the American Chemical Society (Feb. 18, 2015) vol. 137, No. 8, pp. 2832-2835, with 8 page supporting document. |
| Kim et al., NMR Structural Studies of Interactions of a Small, Nonpeptidyl Tpo Mimic with the Thrombopoietin Receptor Extracellular Juxtamembrane and Transmembrane Domains, J Biol Chem (2007) 282(19):14253-14261. |
| Kim et al., Protein conjugation with genetically encoded unnatural amino acids, Curr OpinChem Biol (2013); 17:412-419 (Epub May 9, 2013). |
| Kim et al., Therapeutic Potential of 4-1BB (CD137) As a Regulator for Effector CD8+ T Cells, Journal of Hematotherapy & Stem Cell Research (2001) 10:441-449. |
| Kintzing et al., Emerging Strategies for Developing Next-Generation Protein Therapeutics for Cancer Treatment Trends in Pharmacological Sciences, vol. 37, No. 12, Dec. 2016, pp. 993-1008. |
| Klotz et al., Macromolecule-Small Molecule Interactions. Strong Binding by Intramolecularly Cross-Linked Polylysine Biochemistry. vol. 10, No. 6, Mar. 16, 1971, pp. 923-926. |
| Kochenderfer et al., Construction and pre-clinical evaluation of an anti-CD19 chimeric antigen receptor, Journal of Immunotherapy (2009); 32(7): 689-702. |
| Kochenderfer et al., Treating B-cell cancer with T cells expressing anti-CD19chimeric antigen receptors 2013, Nature Reviews Clinical Oncology, 10, 267-276 (2013). |
| Kochenderfer, J. et al., B-cell depletion and remissions of malignancy along with cytokine-associated toxicity in a clinical trial of anti-CD19 chimeric-antigen-receptor-transduced T cells, Blood, 2012, 119, 2709-2720. |
| Kochenderfer, J. et al., Eradication of B-lineage cells and regression of lymphoma in a patient treated with autologous T cells genetically engineered to recognize CD19, Blood, 2010, 116, 4099-4102. |
| Kolmar, H. et al., Alternative binding proteins: biological activity and therapeutic potential of cystine-knot miniproteins, The FEBS Journal, 2008, 275, 26684-26690. |
| Kozer et al., 2011, Evidence for extended YFP-EGFR dimers in the absence of ligand on the surface of living cells, Physical Biology, 8:066002, 12 pp. |
| Kranz et al., Partial elucidation of an anti-hapten repertoire in BALB/c mice: comparative characterization of several monoclonal antiFLuorescyl antibodies, Mol Immunol (1981) 18(10), 889-898. |
| Krause, A., et al., Genetic approaches to sustain the function of tumor-specific T-lymphocytes, Mol. Ther. (2000); 1 (S260): 713. |
| Kularatne, S.A. et al., Prostate-specific membrane antigen targeted imaging and therapy of prostate cancer using a PSMA Inhibitor as a homing ligand, Mol. Pharm., 2009, 6,780-789. |
| Kunik et al., Jun. 6, 2012, Paratome: an online tool for systematic identification of antigen-binding regions in antibodies based on sequence or structure, Nucl Acids Res. 40:W521-W524. |
| Kuwana, Y. et al., Expression of chimeric receptor composed of immunoglobulin-derived V regions and T-cell receptor-derived C regions, Biochem. Biophys. Res. Comm. (1987); 149:960-968. |
| Kwon, B, et al., cDNA sequences of two inducible T-cell genes, cDNA sequences of two inducible T-cell genes (1989); 86: 1963-1967. |
| Kwon, B, et al., Expression Characteristics of Two Potential T Cell Mediator Genes, Cellular Immunology (1989): 414-422. |
| Lafage-Pochitaloff M, Costello R, Couez D, Simonetti J, Mannoni P, Mawas C, Olive D. Human CD28 and CTLA-4 lg superfamily genes are located on chromosome 2 at bands q33-q34 Immunogenetics 1190;31(3):198-201. |
| Lamers et al., Immune responses to transgene and retroviral vector in patients treated withex vivo-engineered T cells, Blood (2011) 117(1): 72-82. |
| Lamers, C. et al., Treatment of Metastatic Renal Cell Carcinoma With Autologous T-Lymphocytes Genetically Retargeted Against Carbonic Anhydrase IX: First Clinical Experience, J. Clin. Oncol., 2006, 24, e20-22. |
| Laroche et al., Characterization of a Recombinant Single-chain Molecule Comprising the Variable Domains of a Monoclonal Antibody Specific for Human Fibrin Fragment D-dimer*, The Journal of Biological Chemistry 1991, vol. 266, No. 25, Issue of Sep. 5, pp. 16343-16349. |
| Latza, U. et al., The human OX40 homolog: cDNA structure, expression and chromosomal assignment of the ACT35 antigen, Eur. J. Immunol., 1994, 24, 677-683. |
| Lee et al., Current concepts in the diagnosis and management of cytokine release syndrome Blood. Jul. 10, 2014;124(2):188-95. doi: 10.1182/blood-2014-05-552729. Epub May 29, 2014, with errata. |
| Lee et al., Jan. 15, 2019, Use of a single CAR T cell and several bispecific adapters facilitates eradication of multiple antigenically different solid tumors, Cancer Research, 79(2):387-396. |
| Lee, D, et al., 4-1BB Signaling Activates the T Cell Factor 1 Effector/b-Catenin Pathway with Delayed Kinetics via ERK Signaling and Delayed PI3K/AKT Activation to Promote the Proliferation of CD8+ T Cells, PLOS One (2013); 8: 1-11. |
| Lefranc et al., 2003, IMGT unique numbering for immunoglobulin and T cell receptor variable domains and Ig superfamily V-like domains, Dev Comp Immunol. 27:55-77. |
| Li et al., Jan. 2020, CAIZ-specific CAR-T cells and sunitinib show synergistic effects against metastatic renal cancer models, J Immunother, 43(1): 16-28. |
| Liebowitz, D. N., Lee, K. P. & June, C. H. Co-stimulatory approaches to adoptive immunotherapy. Curr. Opin. Oncol. 10, 533-541 (1998). |
| Lin et al., Transglutaminase-catalyzed site-specific conjugation of small-molecule probes to proteins in vitro and on the surface of living cells, J. Am. Chem. Soc. (2006); 128:4542-4543. |
| Linenberger, CD33-directed therapy with gemtuzumab ozogamicin in acute myeloid leukemia: progress in understanding cytotoxicity and potential mechanisms of drug resistance , Leukemia (2005) 19, 176-182. |
| Liou et al., A chimeric mouse-human antibody that retains specificity for HIV gp 120 and mediates the lysis of HIV-infected cells, J Immunol 1989; 143: 3967-3975. |
| Liu et al. Phospholipid-Graphene Nanoassembly as a Fluorescence Biosensor for Sensitive Detection of Phospholipase D Activity. Anal. Chem. 2012, 84, 14, 5944-5950. * |
| Lodish et al., Hierarchical Structure of Proteins Molecular Cell Biology. 4th Ed. New York: W.H. Freeman; 2000. pp. 1-25. |
| Lohmueller et al., 2018, mSA2 affinity-enhanced biotin-binding CAR T cells for universal tumor targeting, Oncoimmunology, 7(1):e1368604. |
| Long, A.H., et al., 4-IBB costimulation ameliorates T cell exhaustion induced by tonic signaling of chimeric antigen receptors. Nat Med, 2015. 21(6): p. 581-90. |
| Love et al., ITAM-mediated Signaling by the T-Cell Antigen Receptor , Cold Spring HarbPerspect Biol 2010;2:a002485. |
| Lowin-Kropf et al., Cytoskeletal Polarization of T Cells is Regulated by an Immunoreceptor Tyrosine-based Activation Motif—dependent Mechanism, The Journal of Cell Biology 1998, vol. 140, No. 4, pp. 861-871. |
| Lu et al., Mar. 2019, Preclinical Evaluation of Bispecific Adaptor Molecule Controlled Folate Receptor CAR-T Cell Therapy with Special Focus on Pediatric Malignancies. Frontiers in Oncology, 9(51): 1-20. |
| Lu, Y. et al., Folate-targeted dinitrophenyl hapten immunotherapy: effect of linkerchemistry on antitumor activity and allergic potential, Mol. Pharm., 2007, 695-706. |
| Lu, Y. et al., Preclinical pharmacokinetics, tissue distribution, and antitumor activity of afolate-hapten conjugate-targeted immunotheraphy in hapten-immunized mice, Molecular Cancer Therapeutics, 2006, 5, 3258-3267. |
| Lueders et al., The Long Terminal Repeat of an Endogenous Intracisternal A—ParticleGene Functions as a Promoter When Introduced into Eucaryotic Cells by Transfection Molecular and Cellular Biology, vol. 4, No. 10, Oct. 1984, pp. 2128-2135. |
| Lustgarten, J., et al., Specific Elimination of IgE Production Using T Cell Lines Expressing Chimeric T Cell Receptor Genes, European Journal of Immunology (1995); 25(10):2985-2991. |
| Ma et al., Jul. 12, 2019, Enhanced CAR-T cell activity against solid tumors by vaccine boosting through the chimeric receptor, Science, 365(6449): 162-168. |
| Ma et al., Versatile strategy for controlling the specificity and activity of engineered T cells, Proc. Nat. Acad. Sci. U.S.A (Jan. 12, 2016) vol. 113, No. 4, pp. 450-458. |
| Ma, Q. et al., Carcinoembryonic antigen-immunoglobulin Fc fusion protein (CEA-Fc) for identification and activation of anti-CEA immunoglobulin-T-cell receptor-modified T cells, representative of a new class of lg fusion proteins, Cancer Gene Therapy (2004); 11: 297-306. |
| Ma, Q., et al., Genetically engineered T cells as adoptive immunotherapy of cancer, Cancer Chemother Biol Response Modif (2002); 20: 315-41. |
| Maeda et al., Tumor vascular permeability and the EPR effect in macromolecular therapeutics: a review, Journal of Controlled Release 65 (2000), pp. 271-284 (14 pages). |
| Maher, et al., Human T-lymphocyte cytotoxicity and proliferation directed by a single chimeric TCRzeta/CD28 receptor, Nature Biotechnology (2002); 20: 70-75. |
| Makabe et al., Jan. 11, 2008, Thermodynamic consequences of mutations in Vernier zone residues of a humanized anti-human epidermal growth factor receptor murine antibody, 528, Journal of Biological Chemistry, 283(2): 1156-1166. |
| Marincola, F. M., et al., Escape of human solid tumors from T cell recognition: molecular mechanisms and functional significance, Adv. Immunol. (2000); 74: 181-273. |
| Martin et al., Dec. 1989, Modeling antibody hypervariable loops: a combined algorithm, Proc Natl Acad Sci (USA), 86:9268-9272. |
| Maude Shannon L. et al. Chimeric Antigen Receptor T Cells for Sustained Remissions in Leukemia N Engl J Med. Oct. 16, 2014;371(16):1507-17. |
| Maude Shannon L. et al. Managing Cytokine Release Syndrome Associated With Novel T Cell-Engaging Therapies Cancer J. Mar.-Apr. 2014;20(2):119-22. |
| Maus et al., Ex vivo expansion of polyclonal and antigen-specific cytotoxic T lymphocytes by artificial APCs expressing ligands for the T-cell receptor, CD28 and 4-1BB, Nature Biotechnology, Nature Publishing Group, New York, NY, US, vol. 20, No. 2, Feb. 1, 2002, pp. 143-148. |
| Maus, M.V., et al., T cells expressing chimeric antigen receptors can cause anaphylaxis in humans. Cancer Immunol Res, 2013. 1(1): p. 26-31. |
| McEnaney et al., Jul. 20, 2012, Antibody-recruiting molecules: an emerging paradigm for engaging immune function in treating human disease. ACS Chem Biol. 7(7): 1139-1151. |
| Mcguinness RP, et al., Anti-tumor activity of human T cells expressing the CC49-zeta chimeric immune receptor, Hum Gene Ther. (Jan. 20, 1999); 10(2):165-73. |
| Medstrand et al., Long Terminal Repeats Are Used as Alternative Promoters for the Endothelin B Receptor and Apolipoprotein C-I Genes in Humans , The Journal of Biological Chemistry, vol. 276, No. 3, Issue of Jan. 19, pp. 1896-1903, 2001. |
| Melero, I, et al., Amplification of tumor immunity by gene transfer of the co-stimulatory 4-1BB ligand: synergy with the CD28 co-stimulatory pathway, Bristol-Myers Squibb Pharmaceutical Research Institute (1998); 1116-1121. |
| Melief, C. J. et al., Strategies for immunotherapy of cancer, Adv. Immunol. (2000); 75:235-282. |
| Mooney et al., Concise Review: Neural Stem Cell-Mediated Targeted Cancer Therapies Stem Cells Translational Medicine, 2018, pp. 740-747. |
| Moore et al., Characterisation of salmon and trout CD8α and CD8β, Molecular Immunology 42 (2005) 1225-1234. |
| Moretta et al., Activating Receptors and Coreceptors Involved in Human Natural Killer Cell-Mediated Cytolysis, Annu. Rev. Immunol. 2001. 19:197-223. |
| Morgan RA, et al., Cancer regression in patients after transfer of genetically engineered lymphocytes, Science (Oct. 6, 2006); 314(5796): 126-9. |
| Morrison, C, CAR-T Field Booms as Next-Generation Platforms Attract Big Players, Nature Biotechnology (Jun. 2015); 33: 571-72. |
| Muller T, et al., Expression of a CD20-specific chimeric antigen receptor enhances cytotoxic activity of NK cells and overcomes NK-resistance of lymphoma and leukemia cells, Cancer Immunol. Immunother. (2008); 57: 411-423. |
| Mungra et al., Targeted human cytolytic fusion proteins at the cutting edge: harnessing the apoptosis-inducing properties of human enzymes for the selective elimination of tumor cells Oncotarget, vol. 10, No. 8, 2019, pp. 897-915. |
| Munn et al., Role of Low-Affinity Fc Receptors in Antibody-dependent Tumor Cell Phagocytosis by Human Monocyte-derived Macrophages, Cancer Research 51, 1117-1123, Feb. 15, 1991. |
| Nam, K, et al., Cross-Linking of 4-1BB Activates TCR-Signaling Pathways in CD8 T Lymphocytes1, The Journal of Immunology; 1898-1905. |
| National Cancer Institute. CAR T-Cell Therapy: Engineering Patients' Immune Cells to Treat Their Cancers, Cancer Research Updates, Updated: Oct. 16, 2014; 5 pages; retrieved Nov. 17, 2014 fromhttp://www.cancer.gov/cancertopics/research-updates/2013/CAR-T-Cells. |
| Nelson, Aaron L., Antibody fragments, mAbs 2010, Landes Bioscience, vol. 2, Issue 1, pp. 77-83. |
| Nieba, L. et al., Disrupting the hydrophobic patches at the antibody variable/constant domain interface: improved in vivo folding and physical characterization of an engineered scFv fragment, Protein Eng., 1997, 10, 435-444. |
| Oelke et al., Ex vivo induction and expansion of antigen-specific cytotoxic T cells by HLA-Ig-coated artificial antigen-presenting cells, Nature Medicine (2003); 9(5):619-624. |
| Oelsner, S., et al., Continuously expanding CAR NK-92 cells display selective cytotoxicity against B-cell leukemia and lymphoma , Cytotherapy, 2017; 19: 235-249. |
| Ohgaki et al. Ratiometric fluorescence imaging of cell surface pH by poly(ethylene glycol)-phospholipid conjugated with fluorescein isothiocyanate. Scientific Reports 2017; 7: 17484, p. 1-9. * |
| Okazaki et al., PD-1 immunoreceptor inhibits B cell receptor mediated signaling by recruiting src homology2-domain-containing tyrosine phosphatase 2 to phosphotyrosine , PNAS Nov. 20, 2001, vol. 98, No. 24, 13866-13871. |
| Orr, B. et al., Rapid method for measuring ScFv thermal stability by yeast surface display, Biotechnol Prog., 2003. 19, 631-638. |
| Pages et al., Two Distinct Intracytoplasmic Regions of the T-cell Adhesion Molecule CD28 Participate in Phosphatidylinositol 3-Kinase Association The Journal of Biological Chemistry, vol. 271, No. 16, Apr. 19, 1996, pp. 9403-9409. |
| Paillard, F. Immunotherapy with T cells bearing chimeric antitumor receptors, Hum. Gene Ther. (1999); 10: 151-153. |
| Paillasse, M, et al., Insights into the Cholecystokinin 2 Receptor Binding Site and Processes of Activation, The American Society for Pharmacology and Experimental Therapeutics (2006); 70:1935-1945. |
| Pameijer, C.R., et al., Conversion of a tumor-binding peptide identified by phage display to a functional chimeric T cell antigen receptor, Cancer Gene Ther., 2007, 14, 91-07. |
| Park et al., Treating cancer with genetically engineered T cells Trends Biotechnol. Nov. 29, 2011(11): 550-557. |
| Parkhurst et al. Characterization of genetically modified T-cell receptors that recognize the CEA:691-699 peptide in the context of HLA-A2.1 on human colorectal cancer cells (2009) Clin Cancer Res. Jan. 1, 2009;15(1):169-80. |
| Patel Jaina M et al: Cancer CARtography: charting out a new approach to cancer immunotherapy, Immunotherapy. 2014;6(6):675-8. |
| Pollock et al., Inducible T cell antigen 4-1BB. Analysis of expression and function, J Immunol 1993; 150:771-781. |
| Porter DL, et al. Chimeric antigen receptor T cells persist and induce sustained remissions in relapsed refractory chronic lymphocytic leukemia . Science translational medicine. 2015;7(303):303-39. doi: 10. I 126/scitransimed.aac5415. PubMed PMID:26333935. |
| Porter, D.L. et al., Chimeric antigen receptor-modified T cells in chronic lymphoid leukemia, N. Engl. J. Med., 2011, 365, 725-733. |
| Prasad et al., T-cell antigen CD28 interacts with the lipid kinase phosphatidylinositol3-kinase by a cytoplasmic Tyr(P)-Met-Xaa-Met motif, Proc. Natl. Acad. Sci. USA, vol. 91, pp. 2834-2838, Mar. 1994. |
| Product brochure for the Engineered Autologous Cell Therapy (eACT™) Platform, available from Kite Pharma, retrieved Oct. 25, 2015 from http://www.kitepharma.com/c/products/eact.php. |
| Pule et al., Artificial T-cell receptors, Cytotherapy (2003) 5(3):211-226. |
| Pule et al., Virus-specific T cells engineered to coexpress tumor-specific receptors: persistence and antitumor activity in individuals with neuroblastoma, Nat. Med. (2008); 14: 1264-1270. |
| Qin et al., Incorporation of a hinge domain improves the expansion of chimeric antigen receptor T cells, Journal of Hematology & Oncology (2017) 10:68. |
| Rai et al., Expression systems for production of heterologous proteins, Current Science2001, vol. 80, No. 9, pp. 1121-1128. |
| Recent patent applications in chimeric antigen receptors, Nature Biotechnology 32(3): 239 (2014). |
| Reddy et al., Elimination of Fc Receptor-Dependent Effector Functions of a Modified IgG4Monoclonal Antibody to Human CD4, J Immunol 2000; 164: 1925-1933. |
| Redmond et al., The role of OX40-mediated co-stimulation in T cell activation and survival, Crit. Rev. Immunol. 2009, 29(3): 187-201. |
| Reichert, J. Day 1, Emerging Disruptive Technologies and Cutting-Edge Analytical Techniques, MAbs, 2009, 1, 190-209. |
| Restifo et al., Adoptive immunotherapy for cancer: harnessing the T cell response, Nat. Rev. Immunol. (Mar. 22, 2012) 12(4):269-281. |
| Reubi, Jean Claude, Peptide Receptors as Molecular Targets for Cancer Diagnosis and Therapy, Endocrine Reviews 24(4): 389-427. |
| Riha et al., CD28 co-signaling in the adaptive immune response Self/Nonself 1:3,231-240; Jul./Aug./Sep. 2010. |
| Riley et al., The CD28 family: a T-cell rheostat for therapeutic control of T-cell activation, Blood, Jan. 1, 2005, vol. 105, No. 1, pp. 13-21. |
| Riviere, I., Gallardo, H. F., Hagani, A B. & Sadelain, M. Retroviral-mediated gene transfer in primary murine and human T-lymphocytes. Mol. Biotechnol. 15, 133-142 (2000). |
| Roberts et al., Chemistry for peptide and protein PEGylation, Advanced Drug Delivery Reviews (2002); 54:459-476. |
| Rodgers, D. et al., Switch-mediated activation and retargeting of CAR-T cells for B-cell malignancies, Proc. Natl. Acad. Sci., 2016, 113, E459-468. |
| Romeo, C. at al., Sequence requirements for induction of cytolysis by the T cell antigen/Fc receptor zeta chain, Cell (1992); 68:889-897. |
| Romeo, C., et al., Cellular immunity to HIV activated by CD4 fused to T cell or Fc receptor polypeptides, Cell (1991); 64:1037-1046. |
| Rosenberg Cell transfer immunotherapy for metastatic solid cancer—what clinicians need to know (2011) Nat Rev Clin Oncol. 8(10):577-85). |
| Rosenberg et al. Adoptive cell transfer: a clinical path to effective cancer immunotherapy. Nat Rev Cancer. Apr. 2008; 8(4):299-308. |
| Rosenberg, S. A. et al., Adoptive cell therapy for the treatment of patients with metastatic melanoma, Current Opinion in Immunology, 2009, 21, 233-240. |
| Rotz Seth J. et al. Severe cytokine release syndrome in a patient receivingPD-1-directed therapy Pediatr Blood Cancer. Dec. 2017;64(12). Epub May 24, 2017 (4 pages). |
| Rueckert S, et al., A monoclonal antibody as an effective therapeutic agent in breast cancer: trastuzumab Expert Opin Biol Ther. Jun. 2005;5(6):853-66. |
| Ruella et al., 2016, Dual CD19 and CD123 targeting prevents antigen-loss relapses after cd19-directed immunotherapies, J Clin Invest. 126(10): 3814-3826. |
| Sadelain et al., Targeting Tumours with Genetically Enhanced T Lymphocytes, Nat Rev Cancer (Jan. 2003): 3(1): 35-45. |
| Sadelain, et al., The promise and potential pitfalls of chimeric antigen receptors, Current Opinion in Immunology (2009): 21: 215-223. |
| Sadelain, M. et al., The basic principles of chimeric antigen receptor design, Cancer Discov., 2013, 3, 388-398. |
| Samudrala et al., 1999, Ab Initio Protein Structure Prediction Using a Combined Hierarchical Approach, Proteins, Structure, Function and Genetics Suppl., 3:194-198. |
| Saoulli, C, et al., CD28-Independent, TRAF2-dependent Costimulation of Resting T Cells by 4-1BB Ligand, Master of Science Thesis, Department of Immunology University of Toronto (1998), 77 pp. |
| Saraswat et al., DNA as Therapeutics; an Update, Indian J Pharm Sci. Sep.-Oct. 2009;71(5): 488-498. |
| Scholler, J., et al., Decade-long safety and function of retroviral-modified chimeric antigen receptor T cells, Sci Transl Med (May 2, 2012); 4(132): 132ra53 (7 pages). |
| Schonfeld, K, et al., Selective Inhibition of Tumor Growth by Clonal NK Cells Expressing an Erb82/HER2-Specific Chimeric Antigen Receptor , Mol. Ther., vol. 23 No. 2, 330-338 Feb. 2015. |
| Schreiber, S.L., Organic synthesis toward small-molecule probes and drugs PNAS, vol. 108, No. 17, Apr. 26, 2011, pp. 6699-6702. |
| Schwesinger et al., Unbinding forces of single antibody-antigen complexes correlate with their thermal dissociation rates, PNAS (2000) 97(18), 9972-9977. |
| Scott, D., et al., Immunogenicity of biotinylated hapten-avidin complexes, Mol Immunol(1984); 21(11): 1055-60. |
| Sega, E. et al., Tumor detection using folate receptor-targeted imaging agents, Cancer Metastasis Rev., 2008, 27, 655-664. |
| Sentman Challenges of creating effective chimeric antigen receptors for cancer therapy Immunotherapy. Aug. 2013;5(8):783-5. |
| Serghides et al., Evaluation of OX40 Ligand as a Costimulator of Human Antiviral Memory CD8 T Cell Responses: Comparison with B7.1 and 4-1BBL, The Journal of Immunology 175:6368-6377 (2005). |
| Shields et al., High Resolution Mapping of the Binding Site on Human IgG1 for FcyRI, FcyRII, FcyRIII, and FcRn and Design of IgG1 Variants with Improved Binding to the FcyR*, The Journal of Biological Chemistry 2001, vol. 276, No. 9, Issue of Mar. 2, pp. 6591-6604. |
| Shirasu, N. et al., Construction and Molecular Characterization of Human Chimeric T-Cell Antigen Receptors Specific for Carcinoembryonic Antigen, Anticancer Research (2010); 30:2731-2738. |
| Sobota et al., Binding of IgG-Opsonized Particles to FcyR Is an Active Stage of Phagocytosis That Involves Receptor Clustering and Phosphorylation, The Journal of Immunology 2005; 175:4450-4457. |
| Stancovski et al., Targeting of T Lymphocytes to Neu/HER2-Expressing Cells Using Chimeric Single Chain Fv Receptors, J. Immunol. (1993); 151(11):6577-6582. |
| Stein, P, et al., The Cytoplasmic Domain of CD28 Is both Necessary and Sufficient for Costimulation of Interleukin-2 Secretion and Association with Phosphatidylinositol3′-Kinase, American Society for Microbiology (1994); 14: 3392-3402. |
| Stephan et al., T cell-encoded CD80 and 4-1BBL induce auto- and transcostimulation, resulting in potent tumor rejection, Nature Medicine (Dec. 2007); 13(12): 1440-1449. |
| Stevens et al., Generation of Tumor-Specific CTLs from Melanoma Patients by Using Peripheral Blood Stimulated with Allogeneic Melanoma Tumor Cell Lines, J. Immunol(1995); 154:762-771. |
| Suhoski, M.M., et al., Engineering artificial antigen-presenting cells to express a diverse array of co-stimulatory molecules. Mol Ther, 2007. 15(5): p. 981-8. |
| Sun et al., Jan. 2018, Immunotherapy with CAR-Modified T cells: toxicities and overcoming strategies, Journal of Immunology Research, 2018:1-10. |
| Sutherland et al. Modular Chimeric Antigen Receptor Systems for Universal Car T Cell Retargeting. Int. J. Mol. Sci. 2020, 21(19), 7222, p. 1-14. * |
| Swanson et al. Fluorescent Cancer-Selective Alkylphosphocholine Analogs for Intraoperative Glioma Detection. Neurosurgery 2015; 76: 115-124. * |
| Swanson et al., The coordination of signaling during Fc receptor-mediated phagocytosis, Journal of Leukocyte Biology, vol. 76, Dec. 2004, pp. 1093-1103. |
| Tam et al., Functional, Biophysical, and Structural Characterization of Human IgG1 andIgG4 Fc Variants with Ablated Immune Functionality, Antibodies 2017, 6, 12. |
| Tamada et al. Redirecting Gene-Modified T Cells toward Various Cancer Types Using Tagged Antibodies, Clinical Cancer Research (Oct. 2, 2012) vol. 18, Iss. 23, pp. 6436-6445, with correction. |
| Tanaka, Toshio et al. Immunotherapeutic implications of IL-6 blockade for cytokine storm. Immunotherapy. Jul. 2016;8(8):959-70. |
| Tapeinos et al. Physical, Chemical, and Biological Structures based on ROS-Sensitive Moieties that are Able to Respond to Oxidative Microenvironments. Adv. Mater. 2016, 28: 5553-5585. * |
| Tatsumi et al., 2012, he non-invasive cell surface modification of hepatocytes with PEG-lipid derivatives, Biomaterials, 33:821-828. |
| Teachey D. T. et al. Cytokine release syndrome after blinatumomab treatment related to abnormal macrophage activation and ameliorated with cytokine-directed therapy Blood. Jun. 27, 2013;121(26):5154-7. doi: 10.1182/blood-2013-02-485623. Epub May 15, 2013. |
| Themeli, M., et al., Generation of tumor-targeted human T lymphocytes from induced pluripotent stem cells for cancer therapy, Nat Biotechnol (2013); 31(10):928-33 (Epub Aug. 11, 2013). |
| Tsukahara et al. CD19 target-engineered T-cells accumulate at tumor lesions in human B-cell lymphoma xenograft mouse models (2013) Biochem Biophys Res Commun 438(1): 84-9. Epub Jul. 17, 2013. |
| Tumor necrosis factor receptor superfamily, HUGO Gene Nomenclature Committee, 2 pp. |
| Turatti, F., et al., Redirected activity of human antitumor chimeric immune receptors is governed by antigen and receptor expression levels and affinity of interaction, J Immunother (2007); 30(7): 684-93. |
| Turtle et al., Engineered T cells for anti-cancer therapy Curr. Opin. Immunol., Oct. 2012; 24(5): 633-39. Epub Jul. 18, 2012. |
| U.S. Appl. No. 18/459,302, filed Aug. 31, 2023, Low; Philip Stewart. * |
| Uherek, C, et al., Chimeric antigen receptors for the retargeting of cytotoxic effector cells, J. Hematother. Stem Cell Res. (2001); 10: 523-534. |
| UniProtKB—043914, TYRO protein tyrosine kinase-binding protein , pp. 1-15. |
| UniProtKB—P01732 (CD8A_HUMAN). T-cell surface glycoprotein CD8 alpha chain; 11pages; retrieved on May 13, 2016 from http://www.uniprot.org/uniprot/P01732. |
| UniProtKB—P02701, AVidin Precursor—Gallus Chicken. |
| UniProtKB—P10747 (CD28_HUMAN). |
| UniProtKB—P10966 (CD8B_HUMAN). |
| UniProtKB—P20963 (CD3Z_HUMAN). T-cell surface glycoprotein CD3 zeta chain; 12pages; retrieved on May 13, 2016 from http://www.uniprot.org/uniprot/P20963. |
| UniProtKB—Q07011 (TNR9_HUMAN). Tumor necrosis factor receptor superfamily member 9: 14 pages; retrieved on May 13, 2016 from http://www.uniprot.org/uniprot/Q07011. |
| Urba, W.J. et al., Redirecting T cells, New Engl. J. Med., 2011, 365, 754-757. |
| Urbanska et al., A Universal Strategy for Adoptive Immunotherapy of Cancer through Use of a Novel T-cell Antigen Receptor, Cancer Research (2012) 72(7): 1844-1852. |
| Urbanska, K., et al., A Universal Immune Receptor Expressed by T Cells for the Targeting of Diverse and Multiple Tumor Associated Antigens IN Abstracts for the 26th Annual Scientific Meeting of the Society for Immunotherapy of Cancer (SITC), J Immunother, vol. 34, No. 9, Nov.-Dec. 2011 (62 pages), p. 381. |
| Uttenthal, B.J., et al., Challenges in T cell receptor gene therapy. J Gene Med (Jun. 2012); 14(6): 386-99. |
| Van Blitterswijk et al., Anticancer mechanisms and clinical application of alkylphopholipids, Biochimica et Biophysica Acta (2013) 1831(3):663-674. |
| Van Dam, G. et al., Intraoperative tumor-specific fluorescence imaging in ovarian cancer by folate receptor-α targeting: first in-human results, Nature Medicine, 2011, 17, 1315-1319. |
| Van der Luit et al., A new class of anticancer alkylphospholipids uses lipid rafts as membrane gateways to induce apoptosis in lymphoma cells, Mol Cancer Ther (2007) 6(8):2337-2345. |
| Van Rhijn et al., Nov. 30, 2015, Human autoreactive T cells recognize CD1b and phospholipids. Proceedings of the National Academy of Sciences 113(2):380-385. |
| Vaughan et al., Human antibodies with sub-nanomolar affinitis isolate from a large non-immunized phage display library, Nature Biotechnology (1996) vol. 14(3), pp. 309-314. |
| Verdine et al., The Challenge of Drugging Undruggable Targets in Cancer: Lessons Learned from Targeting BCL-2 Family Members Clin. Cancer Res. vol. 13, No. 24, Dec. 15, 2007, pp. 7264-7270. |
| Verhoeven et al. Lentiviral vector gene transfer into human T cells (2009) Methods Mol Biol. 506: 97-114. |
| Wang et al. Phenotypic and functional attributes of lentivirus-modified CD19-specific human CD8+ central memory T cells manufactured at clinical scale (2012) J Immunother.35(9):689-701. |
| Wang et al., Current status and perspectives of chimeric antigen receptor modified T cells for cancer treatment, Protein Cell 2017, 8(12):896-925. |
| Wayua, C. et al., Evaluation of a Cholecystokinin 2 Receptor—Targeted Near-Infrared Dye for Fluorescence—Guided Surgery of Cancer, Molecular Pharmaceutics, 2014, 11,468-476. |
| Weichert et al., Jun. 11, 2014, Alkylphosphocholine analogs for broad-spectrum cancer imaging and therapy. Science Translational Medicine, 6(240):240ra75, 24 pp. |
| Weijtens, M. E. et al., Single chain Ig/gamma gene-redirected human T lymphocytes produce cytokines, specifically lyse tumor cells, and recycle lytic capacity., J. Immunol.(Jul. 15, 1996); 157(2):836-43. |
| Weissman et al., Molecular cloning and chromosomal localization of the human T-cell receptor zeta chain: Distinction from the molecular CD3 complex Proc. Natl. Acad. Sci. vol. 85, Dec. 1988, pp. 9709-9713. |
| Weissman et al., Role of the zeta chain in the expression of the T cell antigen receptor: genetic reconstitution studies The EMBO Journal, vol. 8, No. 12, 1989, pp. 3651-3656. |
| Wen, T, et al., 4-1BB Ligand-Mediated Costimulation of Human T Cells Induces CD4 andCD8 T Cell Expansion, Cytokine Production, and the Development of Cytolytic Effector Function1, 4897-4906. |
| Wesolowski, J, et al., Single domain antibodies: promising experimental and therapeutic tools in infection and immunity, Med Microbiol Immunol (2009) 198:157-174. |
| Wilkie et al., Retargeting of Human T Cells to Tumor-Associated MUC1: The Evolution of a Chimeric Antigen Receptor, The Journal of Immunology Apr. 2008, pp. 4901-4909. |
| Wilson, et al. DAP12 and KAP10 (DAP10)-novel transmembrane adapter proteins of the CD3zeta family, Immunol Res. (2000); 22(1):21-42. |
| Wu et al., Adoptive T-cell therapy using An A tumor-infiltrating lymphocytes for metastatic melanoma: current status and future outlook Cancer, Mar. 18, 2012(2): 160-75. |
| Wu et al., Remote control of therapeutic T cells through a small molecule-gated chimeric receptor, Science (2015) vol. 350, Issue 6258, pp. 293 and aab4077-aab4077. |
| Wu, et al., An activating immunoreceptor complex formed by NKG2D and DAP10, Science (1999); 285:730-732. |
| Xu et al., Cytokine release syndrome in cancer immunotherapy with chimeric antigen receptor engineered T cells Cancer Lett. Feb. 28, 2014;343(2):172-8. Epub Oct. 16, 2013. |
| Xu, X.J., et al., Efficacy and safety of adoptive immunotherapy using anti-CD 19 chimeric antigen receptor transduced T-cells: a systematic review of phase I clinical trials, LeukLymphoma (2013); 54(2): 255-60 (Published online: Sep. 8, 2012). |
| Yamamoto et al. Interaction of poly(ethylene glycol)-conjugated phospholipids with supported lipid membranes and their influence on protein adsorption. Science and Technology of Advanced Materials 2016; 17(1): 677-684. * |
| Ye, H, et al., The Structural Basis for the Recognition of Diverse Receptor Sequences by TRAF2, The Weill Medical College and Graduate School of Medical Sciences of Cornell University; v: 321-330. |
| Yee, C., et al., Prospects for Adoptive T Cell Therapy, Current Opinion in Immunology (1997); 9(5):702-708. |
| Zarour, 2016, Reversing T-cell dysfunction and exhaustion in cancer, Clinical Cancer Research, 22(8): 1856-1864. |
| Zhang et al., Phase I Escalating-Dose Trial of CAR-T Therapy Targeting CEA + Metastatic Colorectal Cancers, Molecular Therapy (2017), 25(5): 1248-1258. |
| Zhang, H., et al., 4-IBB is superior to CD28 costimulation for generating CD8+ cytotoxic lymphocytes for adoptive immunotherapy. J Immunol, 2007. 179(7): p. 4910-8. |
| Zhao, Y. et al., A herceptin-based chimeric antigen receptor with modified signaling domains leads to enhanced survival of transduced T lymphocytes and antitumor activity, J. Immunol, 2009, 183, 5563-5574. |
| Zheng et al., Arming Tumor-Reactive T Cells with Costimulator B7-1 Enhances Therapeutic Efficacy of the T Cells, Cancer Research, 2006, vol. 66, No. 13, pp. 6793-6799. |
| Zhong, et al., Integrated CD28 and 4-1BB Signals Strongly Potentiate CD8+ T Cell Mediated Eradication of Metastatic Prostate Cancer, Molecular Therapy (Jan. 1, 2006); 13: p. S103, Abstract. |
Also Published As
| Publication number | Publication date |
|---|---|
| JP7774961B2 (en) | 2025-11-25 |
| EP3749695A1 (en) | 2020-12-16 |
| AU2019218729B2 (en) | 2025-12-04 |
| SG11202007426XA (en) | 2020-09-29 |
| AU2019218729A1 (en) | 2020-08-20 |
| WO2019156795A1 (en) | 2019-08-15 |
| CN111936518A (en) | 2020-11-13 |
| EP3749695A4 (en) | 2021-12-29 |
| JP2024012513A (en) | 2024-01-30 |
| JP2021512622A (en) | 2021-05-20 |
| BR112020015884A2 (en) | 2020-12-08 |
| IL276473A (en) | 2020-09-30 |
| JP2025116065A (en) | 2025-08-07 |
| US20200354477A1 (en) | 2020-11-12 |
| CA3090089A1 (en) | 2019-08-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12312416B2 (en) | Fluorescein-specific cars exhibiting optimal t cell function against FL-PLE labelled tumors | |
| US12570716B2 (en) | Anti-dinitrophenol chimeric antigen receptors | |
| AU2019319674A1 (en) | Methods and compositions for stimulation of chimeric antigen receptor T cells with hapten labelled cells | |
| US20250313803A1 (en) | Compositions and Methods for Cancer Immunotherapy | |
| AU2021216554A1 (en) | Methods and compositions for stimulation of chimeric antigen receptor T cells with hapten labelled cells | |
| US20220218751A1 (en) | Enhancement of polypeptides and chimeric antigen receptors via hinge domains | |
| EP4706677A1 (en) | Therapeutic effect enhancer for enhancing effect of car-t therapy | |
| HK40033024B (en) | Compositions and methods for cancer immunotherapy | |
| HK40033024A (en) | Compositions and methods for cancer immunotherapy |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| FEPP | Fee payment procedure |
Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: APPLICATION DISPATCHED FROM PREEXAM, NOT YET DOCKETED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS |
|
| FEPP | Fee payment procedure |
Free format text: ENTITY STATUS SET TO SMALL (ORIGINAL EVENT CODE: SMAL); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT RECEIVED |
|
| STCF | Information on status: patent grant |
Free format text: PATENTED CASE |