US11208487B2 - Anti-HLA-G antibodies, compositions comprising anti-HLA-G antibodies and methods of using anti-HLA-G antibodies - Google Patents

Anti-HLA-G antibodies, compositions comprising anti-HLA-G antibodies and methods of using anti-HLA-G antibodies Download PDF

Info

Publication number
US11208487B2
US11208487B2 US16/584,421 US201916584421A US11208487B2 US 11208487 B2 US11208487 B2 US 11208487B2 US 201916584421 A US201916584421 A US 201916584421A US 11208487 B2 US11208487 B2 US 11208487B2
Authority
US
United States
Prior art keywords
sequence
seq
aspects
cdr
antibody
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active, expires
Application number
US16/584,421
Other versions
US20200102390A1 (en
Inventor
Courtney BEERS
John Corbin
Doug Hodges
Achim Moesta
Vanessa Soros
Paul Fredrick Widboom
Joseph Robert Warfield
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Tizona Therapeutics
Original Assignee
Tizona Therapeutics
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=68296637&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=US11208487(B2) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to US16/584,421 priority Critical patent/US11208487B2/en
Application filed by Tizona Therapeutics filed Critical Tizona Therapeutics
Assigned to TIZONA THERAPEUTICS reassignment TIZONA THERAPEUTICS ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: BEERS, Courtney, CORBIN, JOHN, HODGES, Doug, MOESTA, Achim, SOROS, VANESSA
Assigned to ADIMAB, LLC reassignment ADIMAB, LLC ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: WARFIELD, Joseph Robert, WIDBOOM, Paul Fredrick
Assigned to TIZONA THERAPEUTICS reassignment TIZONA THERAPEUTICS ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: ADIMAB, LLC
Assigned to TIZONA THERAPEUTICS reassignment TIZONA THERAPEUTICS ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: ADIMAB, LLC
Publication of US20200102390A1 publication Critical patent/US20200102390A1/en
Priority to US17/530,072 priority patent/US12264199B2/en
Publication of US11208487B2 publication Critical patent/US11208487B2/en
Application granted granted Critical
Priority to US19/065,819 priority patent/US20250353913A1/en
Active legal-status Critical Current
Adjusted expiration legal-status Critical

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2833Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against MHC-molecules, e.g. HLA-molecules
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/04Antineoplastic agents specific for metastasis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/286Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against neuromediator receptors, e.g. serotonin receptor, dopamine receptor
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56966Animal cells
    • G01N33/56977HLA or MHC typing
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/54F(ab')2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/626Diabody or triabody
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • antibodies with binding specificity for HLA-G and compositions comprising the antibodies, including pharmaceutical compositions, diagnostic compositions, and kits. Also provided are methods of using anti-HLA-G antibodies for therapeutic and diagnostic purposes.
  • HLA-G histocompatibility antigen, class I, G also known as human leukocyte antigen G (HLA-G)
  • HLA-G is a protein that in humans is encoded by the HLA-G gene.
  • HLA-G belongs to the HLA nonclassical class I heavy chain paralogues.
  • HLA-G is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). There are membrane bound and soluble forms of HLA-G.
  • HLA-G is normally expressed at the maternal-fetal interface and other immune-privileged sites. HLA-G may play a role in immune tolerance in pregnancy, being expressed in the placenta by extravillous trophoblast cells, while the classical MHC class I genes (HLA-A and HLA-B) are not. As HLA-G was first identified in placenta samples, many studies have evaluated its role in pregnancy disorders, such as preeclampsia and recurrent pregnancy loss. See, Michita, Rafael Tomoyaet al., Human Immunology. 2016, 77 (10): 892-897, which is incorporated by reference herein in its entirety, including any drawings.
  • HLA-G has been shown to be immune-suppressive. By binding receptors expressed on various myeloid and lymphoid cells. HLA-G may directly inhibit the functions of NK cells, cytotoxic T-lymphocytes, B cells, neutrophils, monocytes, macrophages and dendritic cells. HLA-G also inhibits T and NK cell proliferation and cytolytic activities. HLA-G suppresses phagocytosis and induces the generation or expansion of regulatory T cells.
  • HLA-G mediates immune function through at least three ITIM-containing inhibitory receptors, ILT2, ILT4, and KIR2DL4.
  • ILT2, ILT4, and KIR2DL4 On lymphoid and myeloid cells, for example, HLA-G mediates function through ILT2.
  • myeloid cells HLA-G mediates function through ILT4.
  • ILT4 and ILT2 On lymphoid and myeloid cells, HLA-G mediates function through ILT4.
  • ILT2DL4 ILT2DL4
  • ILT2DL4 ILT2DL4
  • HLA-G is an immune checkpoint target.
  • HLA-G can directly inhibit immune cell function through receptor binding and/or trogocytosis and impairment of chemotaxis.
  • HLA-G can lend tumor cells a higher invasive and metastatic potential.
  • HLA-G promotes evasion of tumor immune surveillance, and enhances metastasis and the progression of malignancies.
  • HLA-G has other effects, such as, inhibition of immune cell cytolysis, induction of immune cell apoptosis, and/or the generation of regulatory cells through receptor binding and/or trogocytosis.
  • HLA-G expression is upregulated on a broad spectrum of tumors and is associated with poor prognosis and disease progression. Serum HLA-G levels are elevated in breast, lung, colorectal cancer (CRC), gastric, esophageal, neuroblastoma, cervical, and hematological cancers. HLA-G has also been found to be correlated with clinical parameters in advanced disease, such as, tumor metastasis, poor prognosis, immune escape, and tumor invasiveness.
  • HLA-G is an attractive target for diseases, such as, for example, cancer.
  • the antibodies that selectively bind HLA-G.
  • the antibodies bind human HLA-G.
  • the antibodies comprise at least one CDR sequence defined by a consensus sequence provided in this disclosure.
  • the antibodies comprise one or more of an illustrative CDR, V H , or V L sequence provided in this disclosure, or a variant thereof.
  • the variant is a variant with one or more conservative amino acid substitutions.
  • compositions and kits comprising the antibodies.
  • the compositions are pharmaceutical compositions. Any suitable pharmaceutical composition may be used.
  • the pharmaceutical composition is a composition for parenteral administration.
  • the method is a method of treatment. In some embodiments, the method is an analytical method. In some embodiments, the method is a method of purifying and/or quantifying HLA-G.
  • the method is a diagnostic method.
  • the diagnostic method comprises or consists of detecting tumor expressed HLA-G.
  • the diagnostic method comprises or consists of detecting soluble HLA-G.
  • the detection method comprises of consists of detecting HLA-G expression on immune cells.
  • the antibodies are used to treat a disease or condition.
  • the disease or condition is selected from a cancer, autoimmune disease, and infection.
  • Some aspects provide for the use of any of the antibodies or pharmaceutical compositions provided herein to treat a disease or condition selected from a cancer, autoimmune disease, and infection.
  • FIG. 1 provides a table showing avid and monomeric affinities of anti-HLA-G antibodies to recombinant HLA-G protein.
  • FIG. 2A and FIG. 2B provide biolayer interferometry sensorgrams showing anti-HLA-G antibodies that bind to HLA-G and can be separated into three biochemical bins based on their ability to cross-block each other when tested for binding in pairwise fashion.
  • FIG. 3 provide biolayer interferometry sensorgrams showing antibodies that bind and block HLA-G interaction with ILT2 and ILT4 at varying levels of effectiveness.
  • FIG. 4 shows evaluation of anti-HLA-G antibodies binding to naturally expressed HLA-G found on JEG-3 tumor cells.
  • FIG. 5A , FIG. 5B , FIG. 5C , and FIG. 5D provide data showing anti-HLA-G Fabs and antibodies that restore NKL killing activity by blocking suppression mediated through interaction of HLA-G with ILT2 or ILT4.
  • FIG. 6B , FIG. 6C , and FIG. 6D provides evaluation of anti-HLA-G antibodies to reverse HLA-G mediated suppression of primary human cells.
  • FIG. 6A and FIG. 6B provide evaluation of phagocytosis in a human macrophage assay.
  • FIG. 6C provides evaluation of primary human NK cell cytotoxic activity.
  • FIG. 6D provides evaluation of primary human CD8 + T cell function.
  • FIG. 7A and FIG. 7B shows results representing values for binding of anti-HLA-G antibodies to individual recombinant HLA class Ia antigens immobilized on beads.
  • FIG. 8 shows the evaluation of anti-HLA-G antibodies binding to a panel of 28 HLA-typed B-LCL lines.
  • FIG. 9A and FIG. 9B show the evaluation of anti-HLA-G antibodies binding to various forms of HLA-G after site-directed mutagenesis.
  • FIG. 10 provides evidence for tumor growth inhibition by an anti-HLA-G antibody with and Fe effector function in a mouse tumor xenograft tumor model using 721.221 cells expressing HLA-G.
  • the term “about” indicates and encompasses an indicated value and a range above and below that value. In certain embodiments, the term “about” indicates the designated value ⁇ 10%, ⁇ 5%, or ⁇ 1%. In certain embodiments, the term “about” indicates the designated value ⁇ one standard deviation of that value.
  • immunoglobulin refers to a class of structurally related proteins generally comprising two pairs of polypeptide chains: one pair of light (L) chains and one pair of heavy (H) chains. In an “intact immunoglobulin,” all four of these chains are interconnected by disulfide bonds. The structure of immunoglobulins has been well characterized. See, e.g., Paul, Fundamental Immunology 7th ed., Ch. 5 (2013) Lippincott Williams & Wilkins, Philadelphia, Pa. Briefly, each heavy chain typically comprises a heavy chain variable region (V H ) and a heavy chain constant region (CH). The heavy chain constant region typically comprises three domains, C H1 , C H2 , and C H3 . Each light chain typically comprises a light chain variable region (V L ) and a light chain constant region. The light chain constant region typically comprises one domain, abbreviated C L .
  • antibody describes a type of immunoglobulin molecule and is used herein in its broadest sense.
  • An antibody specifically includes intact antibodies (e.g., intact immunoglobulins), and antibody fragments and antigen binding proteins.
  • Antibodies comprise at least one antigen-binding domain.
  • One example of an antigen-binding domain is an antigen binding domain formed by a V H -V L dimer.
  • An “HLA-G antibody,” “anti-HLA-G antibody,” “HLA-G Ab,” “HLA-G-specific antibody,” or “anti-HLA-G Ab” is an antibody, as described herein, which binds specifically to the antigen HLA-G.
  • the V H and V L regions may be further subdivided into regions of hypervariability (“hypervariable regions (HVRs);” also called “complementarity determining regions” (CDRs)) interspersed with regions that are more conserved.
  • the more conserved regions are called framework regions (FRs).
  • Each V H and V L generally comprises three CDRs and four FRs, arranged in the following order (from N-terminus to C-terminus): FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4.
  • the CDRs are involved in antigen binding, and confer antigen specificity and binding affinity to the antibody. See Kabat et al., Sequences of Proteins of Immunological Interest 5th ed. (1991) Public Health Service, National Institutes of Health, Bethesda, Md., incorporated by reference in its entirety.
  • the light chain from any vertebrate species can be assigned to one of two types, called kappa and lambda, based on the sequence of the constant domain.
  • the heavy chain from any vertebrate species can be assigned to one of five different classes (or isotypes): IgA, IgD, IgE, IgG, and IgM. These classes are also designated ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
  • the IgG and IgA classes are further divided into subclasses on the basis of differences in sequence and function. Humans express the following subclasses: IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2.
  • the amino acid sequence boundaries of a CDR can be determined by one of skill in the art using any of a number of known numbering schemes, including those described by Kabat et al., supra (“Kabat” numbering scheme); Al-Lazikani et al., 1997 , J. Mol. Biol., 273:927-948 (“Chothia” numbering scheme); MacCallum et al., 1996 , J. Mol. Biol. 262:732-745 (“Contact” numbering scheme); Lefranc et al., Dev. Comp. Immunol., 2003, 27:55-77 (“IMGT” numbering scheme); and Honegge and Plückthun, J. Mol. Biol., 2001, 309:657-70 (“AHo” numbering scheme), each of which is incorporated by reference in its entirety.
  • Kabat numbering scheme
  • Al-Lazikani et al. 1997 , J. Mol. Biol., 273:927-948
  • Chothia numbering scheme
  • Table 1 provides the positions of CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, and CDR-H3 as identified by the Kabat and Chothia schemes.
  • residue numbering is provided using both the Kabat and Chothia numbering schemes.
  • the numbering scheme used for identification of a particular CDR herein is the Kabat/Chothia numbering scheme. Where the residues encompassed by these two numbering schemes diverge, the numbering scheme is specified as either Kabat or Chothia.
  • EU numbering scheme is generally used when referring to a residue in an antibody heavy chain constant region (e.g., as reported in Kabat et al., supra). Unless stated otherwise, the EU numbering scheme is used to refer to residues in antibody heavy chain constant regions described herein.
  • antibody fragment comprises a portion of an intact antibody, such as the antigen binding or variable region of an intact antibody.
  • Antibody fragments include, for example, Fv fragments, Fab fragments, F(ab′) 2 fragments, Fab′ fragments, scFv (sFv) fragments, and scFv-Fc fragments.
  • “Fv” fragments comprise a non-covalently-linked dimer of one heavy chain variable domain and one light chain variable domain.
  • Fab fragments comprise, in addition to the heavy and light chain variable domains, the constant domain of the light chain and the first constant domain (Cm) of the heavy chain.
  • Fab fragments may be generated, for example, by papain digestion of a full-length antibody.
  • F(ab′) 2 ” fragments contain two Fab′ fragments joined, near the hinge region, by disulfide bonds.
  • F(ab′) 2 fragments may be generated, for example, by pepsin digestion of an intact antibody.
  • the F(ab′) fragments can be dissociated, for example, by treatment with ⁇ -mercaptoethanol.
  • Single-chain Fv or “sFv” or “scFv” antibody fragments comprise a V H domain and a V L domain in a single polypeptide chain.
  • the V H and V L are generally linked by a peptide linker.
  • scFv-Fc” fragments comprise an scFv attached to an Fc domain.
  • an Fc domain may be attached to the C-terminal of the scFv.
  • the Fc domain may follow the V H or V L , depending on the orientation of the variable domains in the scFv (i.e., V H -V L or V L -V H ). Any suitable Fc domain known in the art or described herein may be used.
  • a monoclonal antibody refers to an antibody from a population of substantially homogeneous antibodies.
  • a population of substantially homogeneous antibodies comprises antibodies that are substantially similar and that bind the same epitope(s), except for variants that may normally arise during production of the monoclonal antibody. Such variants are generally present in only minor amounts.
  • a monoclonal antibody is typically obtained by a process that includes the selection of a single antibody from a plurality of antibodies.
  • the selection process can be the selection of a unique clone from a plurality of clones, such as a pool of hybridoma clones, phage clones, yeast clones, bacterial clones, or other recombinant DNA clones.
  • the selected antibody can be further altered, for example, to improve affinity for the target (“affinity maturation”), to humanize the antibody, to improve its production in cell culture, and/or to reduce its immunogenicity in a subject.
  • chimeric antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
  • “Humanized” forms of non-human antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody.
  • a humanized antibody is generally a human immunoglobulin (recipient antibody) in which residues from one or more CDRs are replaced by residues from one or more CDRs of a non-human antibody (donor antibody).
  • the donor antibody can be any suitable non-human antibody, such as a mouse, rat, rabbit, chicken, or non-human primate antibody having a desired specificity, affinity, or biological effect.
  • selected framework region residues of the recipient antibody are replaced by the corresponding framework region residues from the donor antibody.
  • Humanized antibodies may also comprise residues that are not found in either the recipient antibody or the donor antibody. Such modifications may be made to further refine antibody function.
  • a “human antibody” is one which possesses an amino acid sequence corresponding to that of an antibody produced by a human or a human cell, or derived from a non-human source that utilizes a human antibody repertoire or human antibody-encoding sequences (e.g., obtained from human sources or designed de novo). Human antibodies specifically exclude humanized antibodies.
  • an “isolated antibody” is one that has been separated and/or recovered from a component of its natural environment. Components of the natural environment may include enzymes, hormones, and other proteinaceous or nonproteinaceous materials.
  • an isolated antibody is purified to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence, for example by use of a spinning cup sequenator.
  • an isolated antibody is purified to homogeneity by gel electrophoresis (e.g., SDS-PAGE) under reducing or nonreducing conditions, with detection by Coomassie blue or silver stain.
  • An isolated antibody includes an antibody in situ within recombinant cells, since at least one component of the antibody's natural environment is not present.
  • an isolated antibody is prepared by at least one purification step.
  • an isolated antibody is purified to at least 80%, 85%, 90%, 95%, or 99% by weight. In some embodiments, an isolated antibody is provided as a solution comprising at least 85%, 90%, 95%, 98%, 99% to 100% by weight of an antibody, the remainder of the weight comprising the weight of other solutes dissolved in the solvent.
  • Affinity refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity, which reflects a 1:1 interaction between members of a binding pair (e.g., antibody and antigen).
  • the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (K D ).
  • K D dissociation constant
  • Affinity can be measured by common methods known in the art, including those described herein. Affinity can be determined, for example, using surface plasmon resonance (SPR) technology, such as a Biacore® instrument, or using bio-layer interferometry technology, such as an Octet® instrument.
  • the terms “specific binding,” “specifically binds to,” “specific for,” “selectively binds.” and “selective for” a particular antigen (e.g., a polypeptide target) or an epitope on a particular antigen mean binding that is measurably different from a non-specific or non-selective interaction.
  • Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule.
  • Specific binding can also be determined by competition with a control molecule that is similar to the target, such as an excess of non-labeled target. In that case, specific binding is indicated if the binding of the labeled target to a probe is competitively inhibited by the excess non-labeled target.
  • k d (sec ⁇ 1 ), as used herein, refers to the dissociation rate constant of a particular antibody-antigen interaction. This value is also referred to as the k off value.
  • k a (M ⁇ 1 ⁇ sec ⁇ 1 ), as used herein, refers to the association rate constant of a particular antibody-antigen interaction. This value is also referred to as the k on value.
  • K D K d /k a .
  • an “affinity matured” antibody is one with one or more alterations in one or more CDRs or FRs that result in an improvement in the affinity of the antibody for its antigen, compared to a parent antibody which does not possess the alteration(s).
  • an affinity matured antibody has nanomolar or picomolar affinity for the target antigen.
  • Affinity matured antibodies may be produced using a variety of methods known in the art. For example. Marks et al. ( Bio/Technology, 1992, 10:779-783, incorporated by reference in its entirety) describes affinity maturation by V H and V L domain shuffling. Random mutagenesis of CDR and/or framework residues is described by, for example, Barbas et al. ( Proc. Nat. Acad.
  • the term “competes with” or “cross-competes with” indicates that the two or more antibodies compete for binding to an antigen (e.g., HLA-G).
  • HLA-G is coated on a plate and allowed to bind a first antibody, after which a second, labeled antibody is added. If the presence of the first antibody reduces binding of the second antibody, then the antibodies compete.
  • the term “competes with” also includes combinations of antibodies where one antibody reduces binding of another antibody, but where no competition is observed when the antibodies are added in the reverse order. However, in some embodiments, the first and second antibodies inhibit binding of each other, regardless of the order in which they are added. In some embodiments, one antibody reduces binding of another antibody to its antigen by at least 50%, at least 60%, at least 70%, at least 80%, or at least 900%.
  • epitope means a portion of an antigen capable of specific binding to an antibody.
  • Epitopes frequently consist of surface-accessible amino acid residues and/or sugar side chains and may have specific three-dimensional structural characteristics, as well as specific charge characteristics. Conformational and non-conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.
  • An epitope may comprise amino acid residues that are directly involved in the binding, and other amino acid residues, which are not directly involved in the binding.
  • the epitope to which an antibody binds can be determined using known techniques for epitope determination such as, for example, testing for antibody binding to HLA-G variants with different point-mutations.
  • Percent “identity” between a polypeptide sequence and a reference sequence is defined as the percentage of amino acid residues in the polypeptide sequence that are identical to the amino acid residues in the reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, MEGALIGN (DNASTAR), CLUSTALW, or CLUSTAL OMEGA software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
  • a “conservative substitution” or a “conservative amino acid substitution,” refers to the substitution of one or more amino acids with one or more chemically or functionally similar amino acids. Conservative substitution tables providing similar amino acids are well known in the art. Polypeptide sequences having such substitutions are known as “conservatively modified variants.” By way of example, the following groups of amino acids are considered conservative substitutions for one another.
  • amino acid refers to the twenty common naturally occurring amino acids.
  • Naturally occurring amino acids include alanine (Ala; A), arginine (Arg; R), asparagine (Asn; N), aspartic acid (Asp; D), cysteine (Cys; C); glutamic acid (Glu; E), glutamine (Gin; Q), Glycine (Gly; G); histidine (His; H), isoleucine (Ile; I), leucine (Leu; L), lysine (Lys; K), methionine (Met; M), phenylalanine (Phe; F), proline (Pro; P), serine (Ser; S), threonine (Thr, T), tryptophan (Trp; W), tyrosine (Tyr; Y), and valine (Val; V).
  • Naturally occurring amino acids include alanine (Ala; A), arginine (Arg; R), asparagine (Asn; N), aspart
  • Treating” or “treatment” of any disease or disorder refers, in certain embodiments, to ameliorating a disease or disorder that exists in a subject.
  • “treating” or “treatment” includes ameliorating at least one physical parameter, which may be indiscernible by the subject.
  • “treating” or “treatment” includes modulating the disease or disorder, either physically (e.g., stabilization of a discernible symptom) or physiologically (e.g., stabilization of a physical parameter) or both.
  • “treating” or “treatment” includes delaying or preventing the onset of the disease or disorder.
  • terapéuticaally effective amount refers to an amount of an antibody or composition that when administered to a subject is effective to treat a disease or disorder.
  • the term “subject” means a mammalian subject. Exemplary subjects include, but are not limited to humans, monkeys, dogs, cats, mice, rats, cows, horses, camels, avians, goats and sheep. In certain embodiments, the subject is a human. In some embodiments, the subject has cancer, an autoimmune disease or condition, and/or an infection that can be treated with an antibody provided herein. In some embodiments, the subject is a human that is suspected to have cancer, an autoimmune disease or condition, and/or an acute infection and chronic infection.
  • antibodies that selectively bind human HLA-G.
  • the antibody selectively binds to the extracellular domain of human HLA-G.
  • the antibody has one or more CDRs having particular lengths, in terms of the number of amino acid residues.
  • the Chothia CDR-H1 of the antibody is 6, 7, 8, or 9 residues in length.
  • the Kabat CDR-H1 of the antibody is 4, 5, 6, or 7 residues in length.
  • the Chothia CDR-H2 of the antibody is 5, 6, or 7 residues in length.
  • the Kabat CDR-H2 of the antibody is 15, 16, 17, or 18 residues in length.
  • the Kabat/Chothia CDR-H3 of the antibody is 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 residues in length.
  • the Kabat/Chothia CDR-L1 of the antibody is 9, 10, 11, 12, 13, 14, 15, or 16 residues in length. In some aspects, the Kabat/Chothia CDR-L2 of the antibody is 6, 7, or 8 residues in length. In some aspects, the Kabat/Chothia CDR-L3 of the antibody is 8, 9, 10, 1, or 12 residues in length.
  • the antibody comprises a light chain.
  • the light chain is a kappa light chain.
  • the light chain is a lambda light chain.
  • the antibody comprises a heavy chain.
  • the heavy chain is an IgA.
  • the heavy chain is an IgD.
  • the heavy chain is an IgE.
  • the heavy chain is an IgG.
  • the heavy chain is an IgM.
  • the heavy chain is an IgG1.
  • the heavy chain is an IgG2.
  • the heavy chain is an IgG3.
  • the heavy chain is an IgG4.
  • the heavy chain is an IgA1. In some aspects, the heavy chain is an IgA2.
  • the antibody is an antibody fragment. In some aspects, the antibody fragment is an Fv fragment. In some aspects, the antibody fragment is a Fab fragment. In some aspects, the antibody fragment is a F(ab′) 2 fragment. In some aspects, the antibody fragment is a Fab′ fragment. In some aspects, the antibody fragment is an scFv (sFv) fragment. In some aspects, the antibody fragment is an scFv-Fc fragment.
  • the antibody is a monoclonal antibody. In some embodiments, the antibody is a polyclonal antibody.
  • the antibody is a chimeric antibody. In some embodiments, the antibody is a humanized antibody. In some embodiments, the antibody is a human antibody.
  • the antibody is an affinity matured antibody. In some aspects, the antibody is an affinity matured antibody derived from an illustrative sequence provided in this disclosure.
  • the antibody blocks HLA-G interaction and/or binding to an ITIM inhibitory receptor. In some embodiments, the antibody blocks HLA-G interaction and/or binding to ILT2. In some embodiments, the antibody blocks HLA-G interaction and/or binding to ILT4. In some embodiments, the antibody blocks HLA-G interaction and/or binding to KIR2DL4. In embodiments, the antibody binds HLA-G but does not block the interaction between HLA-G and ILT2, ILT4, and/or KIRDL4. In some embodiments, the antibody disrupts HLA-G heterodimer and/or prevents dimerization of HLA-G.
  • the antibody inhibits immune suppressive function. In some embodiments, the antibody inhibits HLA-G mediated suppression of NK cells. In some embodiments, the antibody inhibits HLA-G mediated suppression of cytotoxic T lymphocytes. In some embodiments, the antibody inhibits HLA-G mediated suppression of B cells. In some embodiments, the antibody inhibits HLA-G mediated suppression of neutrophils. In some embodiments, the antibody inhibits HLA-G mediated suppression of dendritic cells. In some embodiments, the antibody inhibits HLA-G mediated suppression of macrophages. In some embodiments, the antibody inhibits HLA-G mediated suppression of monocytes. In some embodiments, the antibody inhibits HLA-G mediated suppression of NK and/or T cell cytolysis and/or proliferation.
  • the antibody prevents or inhibits HLA-G mediated suppression of phagocytosis. In some embodiments, the antibody mediates HLA-G mediated induction of T regulatory cells. In some embodiments, the antibody prevents or inhibits the generation or expansion of regulatory T cells.
  • the antibodies provided herein may be useful for the treatment of a variety of diseases and conditions, including cancers, autoimmune diseases, and infections.
  • the antibody inhibits HLA-G function on tumor cells.
  • the antibody inhibits HLA-G function on immune cells.
  • the antibody inhibits HLA-G function on myeloid cells.
  • the antibody inhibits HLA-G function on Tcell subsets.
  • the antibody inhibits metastasis.
  • the antibody inhibits angiogenesis.
  • the antibody competes or is capable of competing for binding to human HLA-G with another antibody.
  • the antibody comprises or consists an antibody that is capable of competing for binding to human HLA-G with a reference antibody, wherein the reference antibody binds to an epitope comprising position 195, 197, and/or 198 of SEQ ID NO: 342 on a human HLA-G polypeptide.
  • the antibody and the reference antibody cross-compete or are capable of cross-competing for binding to human HLA-G with another antibody.
  • the antibody binds to an epitope comprising position 195, 197, and/or 198 of SEQ ID NO: 342 on a human HLA-G polypeptide.
  • the epitope comprises or consists of a contiguous or non-contiguous span of amino acids including residues 195, 197, and/or 198 of the sequence set forth in SEQ ID NO: 342.
  • the epitope comprises a sequence that is identical or corresponds to residues 195, 197, and/or 198 of a sequence that is within the sequence set forth in SEQ ID NO: 342.
  • the epitope has a sequence that has a 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% identity to a sequence that is within the sequence set forth in SEQ ID NO: 342. In some aspects, the epitope has 1, 2, 3, 4, 5, 6, 7, 8, or 9 substitutions from a sequence that is within the sequence set forth in forth in SEQ ID NO: 342. In some aspects, the epitope has 1, 2, or 3 substitutions from residues a sequence that is within the sequence set forth in SEQ ID NO: 342. In some aspects, the antibody makes contact with any of the residues set forth in FIG. 9 .
  • the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 76. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 77. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 78. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 79.
  • the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 80. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 81. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 82. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 83. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 84.
  • the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 85. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 86. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 87. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 88. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 89.
  • the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 90. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 91. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 92. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 93. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 94.
  • the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 95. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 96. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 97. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 98. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 99.
  • the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 100. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 101.
  • the CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-H3 sequence provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-H3 sequences provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
  • the antibody comprises a V H sequence comprising one or more CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative CDR-H sequences provided in this disclosure, and variants thereof.
  • the antibody comprises a V H sequence comprising one or more Kabat CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative Kabat CDR-H sequences provided in this disclosure, and variants thereof.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 76. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 77. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 78.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 79. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 80. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 81. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 82.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 83. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 84. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 85. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 86.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 87. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 88. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 89. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 90.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 91. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 92. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 94. In some aspects, the antibody comprises a VF sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 95.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising consisting of, or consisting essentially of SEQ ID NO: 96. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 97. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 98. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 99.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 54-71. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 54. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 55. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 56.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 57. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 58. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 59. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 60.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 61. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 62. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 63. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 64.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 65. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 66. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 67. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 68.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 69. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 70. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 71.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 18-34. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 18. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 19. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 20.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 21. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 22. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 23. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 24.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 25. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 26. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 27. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 28.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 29. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 30. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 31. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 32.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 33. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 34.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101, and a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 54-71.
  • the Kabat CDR-H3 sequence and the Kabat CDR-H2 sequence are both from a single illustrative V H sequence provided in this disclosure.
  • the Kabat CDR-H3 and Kabat CDR-H2 are both from a single illustrative V H sequence selected from SEQ ID NOS: 170-200.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101, and a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 18-34.
  • the Kabat CDR-H3 sequence and the Kabat CDR-H1 sequence are both from a single illustrative V H sequence provided in this disclosure.
  • the Kabat CDR-H3 and Kabat CDR-H1 are both from a single illustrative V H sequence selected from SEQ ID NOS: 170-200.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 18-34 and a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 54-71.
  • the Kabat CDR-H1 sequence and the Kabat CDR-H2 sequence are both from a single illustrative V H sequence provided in this disclosure.
  • the Kabat CDR-H1 and Kabat CDR-H2 are both from a single illustrative V H sequence selected from SEQ ID NOS: 170-200.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 18-34, a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 54-71, and a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101.
  • the Kabat CDR-H1 sequence, Kabat CDR-H2 sequence, and Kabat CDR-H3 sequence are all from a single illustrative V H sequence provided in this disclosure.
  • the Kabat CDR-H1, Kabat CDR-H2, and Kabat CDR-H3 are all from a single illustrative V H sequence selected from SEQ ID NOS: 170-200.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 18, a Kabat CDR-H2 sequence comprising SEQ ID NO: 54, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 76.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 19, a Kabat CDR-H2 sequence comprising SEQ ID NO: 55, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 77.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 20, a Kabat CDR-H2 sequence comprising SEQ ID NO: 56, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 78. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 21, a Kabat CDR-H2 sequence comprising SEQ ID NO: 57, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 79.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 22, a Kabat CDR-H2 sequence comprising SEQ ID NO: 58, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 80.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 21, a Kabat CDR-H2 sequence comprising SEQ ID NO: 57, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 76.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 59, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 76. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 60, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 81.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 59, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 82. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 59, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 76.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 59, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 81.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 21, a Kabat CDR-H2 sequence comprising SEQ ID NO: 57, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 83.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 21, a Kabat CDR-H2 sequence comprising SEQ ID NO: 57, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 84.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 24, a Kabat CDR-H2 sequence comprising SEQ ID NO: 61, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 85.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 24, a Kabat CDR-H2 sequence comprising SEQ ID NO: 61, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 86. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 25, a Kabat CDR-H2 sequence comprising SEQ ID NO: 62, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 63, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 88. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 63, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 89.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 25, a Kabat CDR-H2 sequence comprising SEQ ID NO: 63, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 90.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 27, a Kabat CDR-H2 sequence comprising SEQ ID NO: 64, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 90.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 28, a Kabat CDR-H2 sequence comprising SEQ ID NO: 62, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 91. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 29, a Kabat CDR-H2 sequence comprising SEQ ID NO: 64, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 92.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 25, a Kabat CDR-H2 sequence comprising SEQ ID NO: 65, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 93. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 30, a Kabat CDR-H2 sequence comprising SEQ ID NO: 66, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 94.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 31, a Kabat CDR-H2 sequence comprising SEQ ID NO: 67, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 95.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 32, a Kabat CDR-H2 sequence comprising SEQ ID NO: 68, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 96.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 33, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 97. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 34, a Kabat CDR-H2 sequence comprising SEQ ID NO: 70, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 98.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 18, a Kabat CDR-H2 sequence comprising SEQ ID NO: 54, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 99.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 31, a Kabat CDR-H2 sequence comprising SEQ ID NO: 71, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 100.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 24, a Kabat CDR-H2 sequence comprising SEQ ID NO: 61, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 101.
  • the V H sequences provided herein comprise a variant of an illustrative Kabat CDR-H3, CDR-H2, and/or CDR-H1 sequence provided in this disclosure.
  • the Kabat CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative Kabat CDR-H3 sequence provided in this disclosure. In some aspects, the Kabat CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Kabat CDR-H3 sequences provided in this disclosure. In some aspects, the Kabat CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative Kabat CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
  • the Kabat CDR-H2 sequence comprises, consists of, or consists essentially of a variant of an illustrative Kabat CDR-H2 sequence provided in this disclosure. In some aspects, the Kabat CDR-H2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Kabat CDR-H2 sequences provided in this disclosure. In some aspects, the Kabat CDR-H2 sequence comprises, consists of, or consists essentially of any of the illustrative Kabat CDR-H2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
  • the Kabat CDR-H1 sequence comprises, consists of, or consists essentially of a variant of an illustrative Kabat CDR-H1 sequence provided in this disclosure. In some aspects, the Kabat CDR-H1 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Kabat CDR-H1 sequences provided in this disclosure. In some aspects, the Kabat CDR-H1 sequence comprises, consists of, or consists essentially of any of the illustrative Kabat CDR-H1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
  • the antibody comprises a V H sequence comprising one or more Chothia CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative Chothia CDR-H sequences provided in this disclosure, and variants thereof.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 76. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 77.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 78. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 79. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 80. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 81.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 82. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 83. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 84. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 85.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 86. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 87. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 88. In some aspects, the antibody comprises a Vii sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 89.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 90. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 91. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 92. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 93.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 94. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 95. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 96. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 97.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 98. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 99. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 100. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 101.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 38-50. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 38. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 39. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 40.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 41. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 42. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 43. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 44.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 45. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 46. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 47. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 48.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 49. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 50.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 1-14. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 1. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 2. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 3.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 4. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 5. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 6. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 7.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 8. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 9. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 10. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 11.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 12. In some aspects, the antibody comprises a VF sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 13. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 14.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101, and a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 38-50.
  • the Chothia CDR-H3 sequence and the Chothia CDR-H2 sequence are both from a single illustrative V H sequence provided in this disclosure.
  • the Chothia CDR-H3 and Chothia CDR-H2 are both from a single illustrative V H sequence selected from SEQ ID NOS: 170-200.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101, and a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 1-14.
  • the Chothia CDR-H3 sequence and the Chothia CDR-H1 sequence are both from a single illustrative V H sequence provided in this disclosure.
  • the Chothia CDR-H3 and Chothia CDR-H1 are both from a single illustrative V H sequence selected from SEQ ID NOS: 170-200.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 1-14 and a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 38-50.
  • the Chothia CDR-H1 sequence and the Chothia CDR-H2 sequence are both from a single illustrative V H sequence provided in this disclosure.
  • the Chothia CDR-H1 and Chothia CDR-H2 are both from a single illustrative V H sequence selected from SEQ ID NOS: 170-200.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 1-14, a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 38-50, and a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101.
  • the Chothia CDR-H1 sequence, Chothia CDR-H2 sequence, and Chothia CDR-H3 sequence are all from a single illustrative V H sequence provided in this disclosure.
  • the Chothia CDR-H1, Chothia CDR-H2, and Chothia CDR-H3 are all from a single illustrative V H sequence selected from SEQ ID NOS: 170-200.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 1, a Chothia CDR-H2 sequence comprising SEQ ID NO: 38, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 76.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 39, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 77.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 40, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 78.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 79.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 4, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 80.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 76.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 42, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 76.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 43, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 81.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 42, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 82.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 5, a Chothia CDR-H2 sequence comprising SEQ ID NO: 42, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 76.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 42, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 81.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 83.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 84.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 85.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 86.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 7, a Chothia CDR-H2 sequence comprising SEQ ID NO: 45, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 8, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 88.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 8, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 89.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 7, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 90.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 9, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 90.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 45, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 91.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 8, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 92.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 7, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 93.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 10, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 94.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 11, a Chothia CDR-H2 sequence comprising SEQ ID NO: 47, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 95.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 12, a Chothia CDR-H2 sequence comprising SEQ ID NO: 48, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 96.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 13, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 97.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 14, a Chothia CDR-H2 sequence comprising SEQ ID NO: 49, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 98.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 1, a Chothia CDR-H2 sequence comprising SEQ ID NO: 38, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 99.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 11, a Chothia CDR-H2 sequence comprising SEQ ID NO: 50, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 100.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 101.
  • the V H sequences provided herein comprise a variant of an illustrative Chothia CDR-H3, CDR-H2, and/or CDR-H1 sequence provided in this disclosure.
  • the Chothia CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia CDR-H3 sequence provided in this disclosure. In some aspects, the Chothia CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia CDR-H3 sequences provided in this disclosure. In some aspects, the Chothia CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
  • the Chothia CDR-H2 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia CDR-H2 sequence provided in this disclosure. In some aspects, the Chothia CDR-H2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia CDR-H2 sequences provided in this disclosure. In some aspects, the Chothia CDR-H2 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia CDR-H2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
  • the Chothia CDR-H1 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia CDR-H1 sequence provided in this disclosure. In some aspects, the Chothia CDR-H1 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia CDR-H1 sequences provided in this disclosure. In some aspects, the Chothia CDR-H1 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia CDR-H1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
  • the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 170-200. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 170. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 171. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 172. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 173.
  • the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 174. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 175. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 176. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 177. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 178.
  • the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 179. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 180. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 181. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 182. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 183.
  • the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 184. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 185. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 186. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 187. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 188.
  • the antibody comprises a V H sequence comprising, consisting of or consisting essentially of SEQ ID NO: 189. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 190. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 191. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 192. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 193.
  • the antibody comprises a V H sequence comprising, consisting of or consisting essentially of SEQ ID NO: 194. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 195. In some aspects, the antibody comprises a Vii sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 196. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 197. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 198.
  • the antibody comprises a V H sequence comprising, consisting of or consisting essentially of SEQ ID NO: 199. In some aspects, the antibody comprises a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 200.
  • V H sequences provided herein comprise, consist of, or consist essentially of a variant of an illustrative V H sequence provided in this disclosure.
  • the V H sequence comprises, consists of, or consists essentially of a variant of an illustrative V H sequence provided in this disclosure. In some aspects, the V H sequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identity with any of the illustrative V H sequences provided in this disclosure.
  • the V H sequence comprises, consists of, or consists essentially of any of the illustrative V H sequences provided in this disclosure, 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions.
  • the amino acid substitutions are conservative amino acid substitutions.
  • the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 149-166. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 149. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 150. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 151. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 152.
  • the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 153. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 154. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 155. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 156. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 157.
  • the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 158. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 159. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 160. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 161. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 162.
  • the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 163. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 164. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 165. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 166.
  • the CDR-L3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L3 sequence provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L3 sequences provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
  • the antibody comprises a V L sequence comprising one or more CDR-L sequences comprising, consisting of, or consisting essentially of one or more illustrative CDR-L sequences provided in this disclosure, and variants thereof.
  • the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 149-166. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 149. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 150. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 151.
  • the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 152. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 153. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 154. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 155.
  • the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 156. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 157. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 158. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 159.
  • the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 160. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 161. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 162. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 163.
  • the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 164. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 165. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 166.
  • the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 128-145. In some aspects, the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 128. In some aspects, the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 129. In some aspects, the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 130.
  • the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 131. In some aspects, the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 132. In some aspects, the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 133. In some aspects, the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 134.
  • the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 135. In some aspects, the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 136. In some aspects, the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 137. In some aspects, the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 138.
  • the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 139. In some aspects, the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 140. In some aspects, the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 141. In some aspects, the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 142.
  • the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 143. In some aspects, the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 144. In some aspects, the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 145.
  • the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 105-124. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 105. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 106. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 107.
  • the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 108. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 109. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 110. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 111.
  • the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 112. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 113. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 114. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 115.
  • the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 116. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 117. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 18. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 119.
  • the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 120. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 121. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 122. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 123. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 124.
  • the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 149-166 and a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 128-145.
  • the CDR-L3 sequence and the CDR-L2 sequence are both from a single illustrative V L sequence provided in this disclosure.
  • the CDR-L3 and CDR-L2 are both from a single illustrative V L sequence selected from SEQ ID NOS: 204-228.
  • the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 149-166 and a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 105-124.
  • the CDR-L3 sequence and the CDR-L1 sequence are both from a single illustrative V L sequence provided in this disclosure.
  • the CDR-L3 and CDR-L1 are both from a single illustrative V L sequence selected from SEQ ID NOS: 204-228.
  • the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 105-124 and a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 128-145.
  • the CDR-L1 sequence and the CDR-L2 sequence are both from a single illustrative V L sequence provided in this disclosure.
  • the CDR-L1 and CDR-L2 are both from a single illustrative V L sequence selected from SEQ ID NOS: 204-228.
  • the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 105-124, a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 128-145, and a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 149-166.
  • the CDR-L1 sequence, CDR-L2 sequence, and CDR-L3 sequence are all from a single illustrative V L sequence provided in this disclosure.
  • the CDR-L1, CDR-L2, and CDR-L3 are all from a single illustrative V L sequence selected from SEQ ID NOS: 204-228.
  • the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 106, a CDR-L2 sequence comprising SEQ ID NO: 129, and a CDR-L3 sequence SEQ ID NO: 150.
  • the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 107, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 151. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 108, a CDR-L2 sequence comprising SEQ ID NO: 130, and a CDR-L3 sequence SEQ ID NO: 151.
  • the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 109, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 152. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 107, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence SEQ ID NO: 153.
  • the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence SEQ ID NO: 151. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 111, a CDR-L2 sequence comprising SEQ ID NO: 133, and a CDR-L3 sequence SEQ ID NO: 151.
  • the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 154. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 112, a CDR-L2 sequence comprising SEQ ID NO: 134, and a CDR-L3 sequence SEQ ID NO: 155.
  • the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 113, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 156. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 114, a CDR-L2 sequence comprising SEQ ID NO: 136, and a CDR-L3 sequence SEQ ID NO: 157.
  • the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 157. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 116, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 155.
  • the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 117, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 155. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 158.
  • the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence SEQ ID NO: 155. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 119, a CDR-L2 sequence comprising SEQ ID NO: 139, and a CDR-L3 sequence SEQ ID NO: 159.
  • the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 120, a CDR-L2 sequence comprising SEQ ID NO: 140, and a CDR-L3 sequence SEQ ID NO: 160. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 141, and a CDR-L3 sequence SEQ ID NO: 161.
  • the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 122, a CDR-L2 sequence comprising SEQ ID NO: 142, and a CDR-L3 sequence SEQ ID NO: 162.
  • the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 143, and a CDR-L3 sequence SEQ ID NO: 163.
  • the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 143, and a CDR-L3 sequence SEQ ID NO: 164. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 123, a CDR-L2 sequence comprising SEQ ID NO: 144, and a CDR-L3 sequence SEQ ID NO: 165.
  • the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 124, a CDR-L2 sequence comprising SEQ ID NO: 145, and a CDR-L3 sequence SEQ ID NO: 166.
  • the V L sequences provided herein comprise a variant of an illustrative CDR-L3, CDR-L2, and/or CDR-L1 sequence provided in this disclosure.
  • the CDR-L3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L3 sequence provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L3 sequences provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
  • the CDR-L2 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L2 sequence provided in this disclosure. In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L2 sequences provided in this disclosure. In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
  • the CDR-L1 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L1 sequence provided in this disclosure. In some aspects, the CDR-L sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L sequences provided in this disclosure. In some aspects, the CDR-L1 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
  • the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 204-228. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 204. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 205. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 206. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 207.
  • the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 208. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 209. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 210. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 211. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 212.
  • the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 213. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 214. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 215. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 216. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 217.
  • the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 218. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 219. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 220. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 221. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 222.
  • the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 223. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 224. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 225. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 226. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 227. In some aspects, the antibody comprises a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 228.
  • V L sequences provided herein comprise, consist of, or consist essentially of a variant of an illustrative V L sequence provided in this disclosure.
  • the V L sequence comprises, consists of, or consists essentially of a variant of an illustrative V L sequence provided in this disclosure. In some aspects, the V L sequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.05% identity with any of the illustrative V L sequences provided in this disclosure.
  • the V L sequence comprises, consists of, or consists essentially of any of the illustrative V L sequences provided in this disclosure, 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions.
  • the amino acid substitutions are conservative amino acid substitutions.
  • the antibody comprises a CDR-H3 sequence and a CDR-L3 sequence.
  • the CDR-H3 sequence is part of a V H and the CDR-L3 sequence is part of a V L .
  • the CDR-H3 sequence is a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 76-101
  • the CDR-L3 sequence is a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 149-166.
  • the CDR-H3 sequence is SEQ ID NO: 76 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 77 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 78 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166.
  • the CDR-L3 sequence is SEQ ID NO: 149.
  • the CDR-L3 sequence is SEQ ID NO: 150.
  • the CDR-L3 sequence is SEQ ID NO: 151.
  • the CDR-L3 sequence is SEQ ID NO: 152.
  • the CDR-L3 sequence is SEQ ID NO: 153.
  • the CDR-L3 sequence is SEQ ID NO: 154.
  • the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 79 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166.
  • the CDR-L3 sequence is SEQ ID NO: 149.
  • the CDR-L3 sequence is SEQ ID NO: 150.
  • the CDR-L3 sequence is SEQ ID NO: 151.
  • the CDR-L3 sequence is SEQ ID NO: 152.
  • the CDR-L3 sequence is SEQ ID NO: 153.
  • the CDR-L3 sequence is SEQ ID NO: 154.
  • the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 80 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166.
  • the CDR-L3 sequence is SEQ ID NO: 149.
  • the CDR-L3 sequence is SEQ ID NO: 150.
  • the CDR-L3 sequence is SEQ ID NO: 151.
  • the CDR-L3 sequence is SEQ ID NO: 152.
  • the CDR-L3 sequence is SEQ ID NO: 153.
  • the CDR-L3 sequence is SEQ ID NO: 154.
  • the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 81 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 82 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 83 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166.
  • the CDR-L3 sequence is SEQ ID NO: 149.
  • the CDR-L3 sequence is SEQ ID NO: 150.
  • the CDR-L3 sequence is SEQ ID NO: 151.
  • the CDR-L3 sequence is SEQ ID NO: 152.
  • the CDR-L3 sequence is SEQ ID NO: 153.
  • the CDR-L3 sequence is SEQ ID NO: 154.
  • the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 84 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166.
  • the CDR-L3 sequence is SEQ ID NO: 149.
  • the CDR-L3 sequence is SEQ ID NO: 150.
  • the CDR-L3 sequence is SEQ ID NO: 151.
  • the CDR-L3 sequence is SEQ ID NO: 152.
  • the CDR-L3 sequence is SEQ ID NO: 153.
  • the CDR-L3 sequence is SEQ ID NO: 154.
  • the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 85 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166.
  • the CDR-L3 sequence is SEQ ID NO: 149.
  • the CDR-L3 sequence is SEQ ID NO: 150.
  • the CDR-L3 sequence is SEQ ID NO: 151.
  • the CDR-L3 sequence is SEQ ID NO: 152.
  • the CDR-L3 sequence is SEQ ID NO: 153.
  • the CDR-L3 sequence is SEQ ID NO: 154.
  • the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 86 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 87 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 88 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166.
  • the CDR-L3 sequence is SEQ ID NO: 149.
  • the CDR-L3 sequence is SEQ ID NO: 150.
  • the CDR-L3 sequence is SEQ ID NO: 151.
  • the CDR-L3 sequence is SEQ ID NO: 152.
  • the CDR-L3 sequence is SEQ ID NO: 153.
  • the CDR-L3 sequence is SEQ ID NO: 154.
  • the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 89 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166.
  • the CDR-L3 sequence is SEQ ID NO: 149.
  • the CDR-L3 sequence is SEQ ID NO: 150.
  • the CDR-L3 sequence is SEQ ID NO: 151.
  • the CDR-L3 sequence is SEQ ID NO: 152.
  • the CDR-L3 sequence is SEQ ID NO: 153.
  • the CDR-L3 sequence is SEQ ID NO: 154.
  • the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 90 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166.
  • the CDR-L3 sequence is SEQ ID NO: 149.
  • the CDR-L3 sequence is SEQ ID NO: 150.
  • the CDR-L3 sequence is SEQ ID NO: 151.
  • the CDR-L3 sequence is SEQ ID NO: 152.
  • the CDR-L3 sequence is SEQ ID NO: 153.
  • the CDR-L3 sequence is SEQ ID NO: 154.
  • the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 91 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 92 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 93 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166.
  • the CDR-L3 sequence is SEQ ID NO: 149.
  • the CDR-L3 sequence is SEQ ID NO: 150.
  • the CDR-L3 sequence is SEQ ID NO: 151.
  • the CDR-L3 sequence is SEQ ID NO: 152.
  • the CDR-L3 sequence is SEQ ID NO: 153.
  • the CDR-L3 sequence is SEQ ID NO: 154.
  • the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 94 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166.
  • the CDR-L3 sequence is SEQ ID NO: 149.
  • the CDR-L3 sequence is SEQ ID NO: 150.
  • the CDR-L3 sequence is SEQ ID NO: 151.
  • the CDR-L3 sequence is SEQ ID NO: 152.
  • the CDR-L3 sequence is SEQ ID NO: 153.
  • the CDR-L3 sequence is SEQ ID NO: 154.
  • the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 95 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166.
  • the CDR-L3 sequence is SEQ ID NO: 149.
  • the CDR-L3 sequence is SEQ ID NO: 150.
  • the CDR-L3 sequence is SEQ ID NO: 151.
  • the CDR-L3 sequence is SEQ ID NO: 152.
  • the CDR-L3 sequence is SEQ ID NO: 153.
  • the CDR-L3 sequence is SEQ ID NO: 154.
  • the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 96 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 97 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 98 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166.
  • the CDR-L3 sequence is SEQ ID NO: 149.
  • the CDR-L3 sequence is SEQ ID NO: 150.
  • the CDR-L3 sequence is SEQ ID NO: 151.
  • the CDR-L3 sequence is SEQ ID NO: 152.
  • the CDR-L3 sequence is SEQ ID NO: 153.
  • the CDR-L3 sequence is SEQ ID NO: 154.
  • the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 99 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166.
  • the CDR-L3 sequence is SEQ ID NO: 149.
  • the CDR-L3 sequence is SEQ ID NO: 150.
  • the CDR-L3 sequence is SEQ ID NO: 151.
  • the CDR-L3 sequence is SEQ ID NO: 152.
  • the CDR-L3 sequence is SEQ ID NO: 153.
  • the CDR-L3 sequence is SEQ ID NO: 154.
  • the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 100 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3 sequence is SEQ ID NO: 101 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155.
  • the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
  • the CDR-H3-CDR-L3 pairs provided herein comprise a variant of an illustrative CDR-H3 and/or CDR-L1 sequence provided in this disclosure.
  • the CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-H3 sequence provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-H3 sequences provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
  • the CDR-L3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L3 sequence provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L3 sequences provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
  • the antibody comprises a V H sequence and a V L sequence.
  • the V H sequence is a V H sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 170-200 and the V L sequence is a V L sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 204-228.
  • the V H sequence is SEQ ID NO: 170 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V H sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 171 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 172 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V H sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 173 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 174 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 175 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 176 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 177 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 178 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 179 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 180 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 181 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 182 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V H sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 183 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the VF sequence is SEQ ID NO: 184 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 185 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 186 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 187 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 188 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 189 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V H sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 190 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 191 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 192 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the VF sequence is SEQ ID NO: 193 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 194 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 195 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L , sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213.
  • the V H sequence is SEQ ID NO: 214.
  • the V L sequence is SEQ ID NO: 215.
  • the V L sequence is SEQ ID NO: 216.
  • the V L sequence is SEQ ID NO: 217.
  • the V L sequence is SEQ ID NO: 218.
  • the V L sequence is SEQ ID NO: 219.
  • the V L sequence is SEQ ID NO: 220.
  • the V L sequence is SEQ ID NO: 221.
  • the V L sequence is SEQ ID NO: 222.
  • the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 196 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 197 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V L sequence is SEQ ID NO: 198 and the V L sequence is selected from SEQ ID NOS: 204-228. In some aspects, the V L sequence is SEQ ID NO: 204. In some aspects, the V L sequence is SEQ ID NO: 205. In some aspects, the V L sequence is SEQ ID NO: 206. In some aspects, the V L sequence is SEQ ID NO: 207. In some aspects, the V L sequence is SEQ ID NO: 208. In some aspects, the V L sequence is SEQ ID NO: 209. In some aspects, the V L sequence is SEQ ID NO: 210. In some aspects, the V L sequence is SEQ ID NO: 211. In some aspects, the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 199 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V L sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the V H sequence is SEQ ID NO: 200 and the V L sequence is selected from SEQ ID NOS: 204-228.
  • the V L sequence is SEQ ID NO: 204.
  • the V L sequence is SEQ ID NO: 205.
  • the V L sequence is SEQ ID NO: 206.
  • the V L sequence is SEQ ID NO: 207.
  • the V L sequence is SEQ ID NO: 208.
  • the V L sequence is SEQ ID NO: 209.
  • the V L sequence is SEQ ID NO: 210.
  • the V L sequence is SEQ ID NO: 211.
  • the V L sequence is SEQ ID NO: 212.
  • the V L sequence is SEQ ID NO: 213. In some aspects, the V L sequence is SEQ ID NO: 214. In some aspects, the V L sequence is SEQ ID NO: 215. In some aspects, the V L sequence is SEQ ID NO: 216. In some aspects, the V L sequence is SEQ ID NO: 217. In some aspects, the V L sequence is SEQ ID NO: 218. In some aspects, the V L sequence is SEQ ID NO: 219. In some aspects, the V L sequence is SEQ ID NO: 220. In some aspects, the V L sequence is SEQ ID NO: 221. In some aspects, the V L sequence is SEQ ID NO: 222. In some aspects, the V L sequence is SEQ ID NO: 223.
  • the V H sequence is SEQ ID NO: 224. In some aspects, the V L sequence is SEQ ID NO: 225. In some aspects, the V L sequence is SEQ ID NO: 226. In some aspects, the V L sequence is SEQ ID NO: 227. In some aspects, the V L sequence is SEQ ID NO: 228.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 18, a Kabat CDR-H2 sequence comprising SEQ ID NO: 54, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 76 and a V L sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 19, a Kabat CDR-H2 sequence comprising SEQ ID NO: 55, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 77 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 20, a Kabat CDR-H2 sequence comprising SEQ ID NO: 56, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 78 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 21, a Kabat CDR-H2 sequence comprising SEQ ID NO: 57, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 79 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 22, a Kabat CDR-H2 sequence comprising SEQ ID NO: 58, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 80 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 21, a Kabat CDR-H2 sequence comprising SEQ ID NO: 57, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 106, a CDR-L2 sequence comprising SEQ ID NO: 129, and a CDR-L3 sequence SEQ ID NO: 150.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 59, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 107, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 151.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 60, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 81 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 108, a CDR-L2 sequence comprising SEQ ID NO: 130, and a CDR-L3 sequence SEQ ID NO: 151.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 59, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 109, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 152.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 59, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 107, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence SEQ ID NO:153.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 59, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 81 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence SEQ ID NO: 151.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 21, a Kabat CDR-H2 sequence comprising SEQ ID NO: 57, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 83 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 111, a CDR-L2 sequence comprising SEQ ID NO: 133, and a CDR-L3 sequence SEQ ID NO: 151.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 21, a Kabat CDR-H2 sequence comprising SEQ ID NO: 57, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 84 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 24, a Kabat CDR-H2 sequence comprising SEQ ID NO: 61, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 85 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 154.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 24, a Kabat CDR-H2 sequence comprising SEQ ID NO: 61, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 86 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 154.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 25, a Kabat CDR-H2 sequence comprising SEQ ID NO: 62, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 112, a CDR-L2 sequence comprising SEQ ID NO: 134, and a CDR-L3 sequence SEQ ID NO: 155.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 63, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 88 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 113, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 156.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 63, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 89 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 114, a CDR-L2 sequence comprising SEQ ID NO: 136, and a CDR-L3 sequence SEQ ID NO: 157.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 25, a Kabat CDR-H2 sequence comprising SEQ ID NO: 63, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 90 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 157.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H sequence comprising SEQ ID NO: 27, a Kabat CDR-H2 sequence comprising SEQ ID NO: 64, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 90 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 116, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 155.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 28, a Kabat CDR-H2 sequence comprising SEQ ID NO: 62, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 91 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 117, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 155.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 29, a Kabat CDR-H2 sequence comprising SEQ ID NO: 64, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 92 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 158.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 25, a Kabat CDR-H2 sequence comprising SEQ ID NO: 65, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 93 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence SEQ ID NO: 155.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 30, a Kabat CDR-H2 sequence comprising SEQ ID NO: 66, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 94 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 119, a CDR-L2 sequence comprising SEQ ID NO: 139, and a CDR-L3 sequence SEQ ID NO: 159.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 31, a Kabat CDR-H2 sequence comprising SEQ ID NO: 67, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 95 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 120, a CDR-L2 sequence comprising SEQ ID NO: 140, and a CDR-L3 sequence SEQ ID NO: 160.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 32, a Kabat CDR-H2 sequence comprising SEQ ID NO: 68, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 96 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 141, and a CDR-L3 sequence SEQ ID NO: 161.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 33, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 97 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 122, a CDR-L2 sequence comprising SEQ ID NO: 142, and a CDR-L3 sequence SEQ ID NO: 162.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 34, a Kabat CDR-H2 sequence comprising SEQ ID NO: 70, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 98 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 143, and a CDR-L3 sequence SEQ ID NO: 163.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 18, a Kabat CDR-H2 sequence comprising SEQ ID NO: 54, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 99 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 143, and a CDR-L3 sequence SEQ ID NO: 164.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 31, a Kabat CDR-H2 sequence comprising SEQ ID NO: 71, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 100 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 123, a CDR-L2 sequence comprising SEQ ID NO: 144, and a CDR-L3 sequence SEQ ID NO: 165.
  • the antibody comprises a V H sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 24, a Kabat CDR-H2 sequence comprising SEQ ID NO: 61, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 101 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 124, a CDR-L2 sequence comprising SEQ ID NO: 145, and a CDR-L3 sequence SEQ ID NO: 166.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 1, a Chothia CDR-H2 sequence comprising SEQ ID NO: 38, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 39, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 77 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 40, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 78 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 79 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 4, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 80 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 106, a CDR-L2 sequence comprising SEQ ID NO: 129, and a CDR-L3 sequence SEQ ID NO: 150.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 42, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 107, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 151.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 43, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 81 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 108, a CDR-L2 sequence comprising SEQ ID NO: 130, and a CDR-L3 sequence SEQ ID NO: 151.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 42, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 109, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 152.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 5, a Chothia CDR-H2 sequence comprising SEQ ID NO: 42, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 107, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence SEQ ID NO: 153.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 42, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 81 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence SEQ ID NO: 151.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 83 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 111, a CDR-L2 sequence comprising SEQ ID NO: 133, and a CDR-L3 sequence SEQ ID NO: 151.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 84 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 85 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 154.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 86 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 154.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 7, a Chothia CDR-H2 sequence comprising SEQ ID NO: 45, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 112, a CDR-L2 sequence comprising SEQ ID NO: 134, and a CDR-L3 sequence SEQ ID NO: 155.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 8, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 88 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 113, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 156.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 8, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 89 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 114, a CDR-L2 sequence comprising SEQ ID NO: 136, and a CDR-L3 sequence SEQ ID NO: 157.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 7, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 90 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 157.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 9, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 90 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 116, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 155.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 45, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 91 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 117, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 155.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 8, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 92 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 158.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 7, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 93 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence SEQ ID NO: 155.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 10, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 94 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 119, a CDR-L2 sequence comprising SEQ ID NO: 139, and a CDR-L3 sequence SEQ ID NO: 159.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 11, a Chothia CDR-H2 sequence comprising SEQ ID NO: 47, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 95 and a VL sequence comprising a CDR-L sequence comprising SEQ ID NO: 120, a CDR-L2 sequence comprising SEQ ID NO: 140, and a CDR-L3 sequence SEQ ID NO: 160.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 12, a Chothia CDR-H2 sequence comprising SEQ ID NO: 48, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 96 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 141, and a CDR-L3 sequence SEQ ID NO: 161.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 13, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 97 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 122, a CDR-L2 sequence comprising SEQ ID NO: 142, and a CDR-L3 sequence SEQ ID NO: 162.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 14, a Chothia CDR-H2 sequence comprising SEQ ID NO: 49, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 98 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 143, and a CDR-L3 sequence SEQ ID NO: 163.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 1, a Chothia CDR-H2 sequence comprising SEQ ID NO: 38, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 99 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 143, and a CDR-L3 sequence SEQ ID NO: 164.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 11, a Chothia CDR-H2 sequence comprising SEQ ID NO: 50, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 100 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 123, a CDR-L2 sequence comprising SEQ ID NO: 144, and a CDR-L3 sequence SEQ ID NO: 165.
  • the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 101 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 124, a CDR-L2 sequence comprising SEQ ID NO: 145, and a CDR-L3 sequence SEQ ID NO: 166.
  • V H -V L pairs provided herein comprise a variant of an illustrative V H and/or V L sequence provided in this disclosure.
  • the V H sequence comprises, consists of, or consists essentially of a variant of an illustrative V H sequence provided in this disclosure. In some aspects, the V H sequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.1% identity with any of the illustrative V H sequences provided in this disclosure.
  • the V H sequence comprises, consists of, or consists essentially of any of the illustrative V H sequences provided in this disclosure, 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions.
  • the amino acid substitutions are conservative amino acid substitutions.
  • the V L sequence comprises, consists of, or consists essentially of a variant of an illustrative V L sequence provided in this disclosure. In some aspects, the V L sequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.05% identity with any of the illustrative V L sequences provided in this disclosure.
  • the V L sequence comprises, consists of, or consists essentially of any of the illustrative V L sequences provided in this disclosure, 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions.
  • the amino acid substitutions are conservative amino acid substitutions.
  • the antibody comprises or consists of one or more heavy chains consisting of an HC sequence and one or more light chains consisting of an LC sequence. In some aspects, the antibody comprises or consists of two identical heavy chains consisting of an HC sequence and two identical light chains consisting of an LC sequence.
  • the HC sequence is an HC sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 232-262 and the LC sequence is an LC sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 300-330.
  • the HC sequence is an HC sequence consisting of a sequence selected from SEQ ID NOS: 232-262 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the HC sequence is an HC sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 266-296 and the LC sequence is an LC sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 300-330.
  • the HC sequence is an HC sequence consisting of a sequence selected from SEQ ID NOS: 266-296 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 232 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 233 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 234 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 235 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 236 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 237 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 238 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 239 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 240 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 241 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 242 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 243 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 244 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 245 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 246 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 247 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 248 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 249 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 250 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 251 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 252 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 253 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 254 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 255 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 256 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 257 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 258 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 259 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 260 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 261 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 262 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 266 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 267 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 268 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 269 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 270 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 271 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 272 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 273 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 274 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 275 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 276 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 277 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 278 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 279 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 280 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 281 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 282 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 283 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 284 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 285 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 286 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 287 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 288 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 289 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 290 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 291 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 292 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 293 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 294 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 295 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 296 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
  • the LC sequence is SEQ ID NO: 300.
  • the LC sequence is SEQ ID NO: 301.
  • the LC sequence is SEQ ID NO: 302.
  • the LC sequence is SEQ ID NO: 303.
  • the LC sequence is SEQ ID NO: 304.
  • the LC sequence is SEQ ID NO: 305.
  • the LC sequence is SEQ ID NO: 306.
  • the LC sequence is SEQ ID NO: 307.
  • the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318.
  • the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 232 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 300. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 233 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 301. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 234 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 302. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 235 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 303.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 236 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 304. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 237 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 305. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 238 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 306. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 239 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 307.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 240 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 308.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 241 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 309.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 242 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 310.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 243 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 311.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 244 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 312. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 245 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 313. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 246 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 314. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 247 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 315.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 248 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 316. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 249 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 317. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 250 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 318. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 251 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 319.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 252 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 320. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 253 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 321. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 254 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 322. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 255 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 323.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 256 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 324. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 257 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 325. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 258 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 326. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 259 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 327.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 260 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 328. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 261 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 329. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 262 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 330.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 266 and the LC sequence is an LC sequence consisting of a sequence SEQ ID NO: 300. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 267 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 301. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 268 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 302. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 269 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 303.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 270 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 304. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 271 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 305. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 272 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 306. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 273 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 307.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 274 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 308. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 275 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 309. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 276 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 310. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 277 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 311.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 278 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 312. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 279 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 313. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 280 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 314. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 281 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 315.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 282 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 316. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 283 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 317. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 284 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 318. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 285 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 319.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 286 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 320. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 287 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 321. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 288 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 322. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 289 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 323.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 290 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 324. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 291 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 325. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 292 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 326. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 293 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 327.
  • the HC sequence is an HC sequence consisting of SEQ ID NO: 294 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 328. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 295 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 329. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 296 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 330.
  • anti-HLA-G antibodies comprising one or more sequences defined by consensus sequences.
  • Each consensus sequence is based, at least in part, on one or more alignments of two or more useful anti-HLA-G CDR sequences provided in this disclosure. Based on such alignments, a person of skill in the art would recognize that different amino acid residues may useful in certain positions of the CDRs. Accordingly, each consensus sequence encompasses two or more useful anti-HLA-G CDR sequences.
  • the antibody comprises a CDR-H3 sequence defined by the consensus sequence G-y 2 -y 3 -R-A-V-P-F-y 9 -y 10 (SEQ ID NOS: 76-84), where y 2 is I, P, Q, T, or V; y 3 is A, F, K, or R; y 9 is A, D, Q, or V; y 10 is D, R, or Y.
  • y 2 when y 2 is I; y 3 is A or R; y 9 is F; and y 10 is Y.
  • y 2 when y 2 is V; y 3 is R; y 9 is A, D, Q, or V; and y 10 is D, R, or Y.
  • y 3 when y 3 is R; y 2 is 1, T, or V; y 9 is A, D, or Q; and y 10 is D, R, or Y.
  • y 10 when y 10 is Y; y 2 is I, P, R, or V; y 3 is A, F, K, or R; and y 9 is D. In some aspects, when Yon is D; y 2 is V; y 3 is R; and y 9 is A or V.
  • y 2 when y 2 is V; y 3 is R: y 9 is D; and y 10 is Y.
  • y 2 when y 2 is I; y 3 is A; Y is D; and y 10 is Y.
  • y 2 when y 2 is V; y 3 is R; Y is Q; and y 10 is R.
  • y 2 when y 2 is T; y 3 is R; y 9 is D; and y 10 is Y.
  • y 2 when y 2 is V; y 3 is R; y 9 is A; and y 10 is D. In some aspects, when y 2 is I; y 3 is R; y 9 is D; and y 10 is Y. In some aspects, when y 2 is Q; y 3 is F; y 9 is D; and y 10 is Y.
  • the antibody comprises a CDR-H3 sequence defined by the consensus sequence G-G- ⁇ 3 - ⁇ 4 - ⁇ 5 -Y-S-R-G-P- ⁇ 11 -D-V (SEQ ID NOS: 85-93), where ⁇ 3 is E, G, Q, or T; ⁇ 4 is A, H, P, Q. or V; ⁇ 5 is K or T; and ⁇ 11 is F, L, or M.
  • ⁇ 3 is G; when ⁇ 4 is A or Q; ⁇ 5 is T; and ⁇ 11 is V.
  • ⁇ 3 is T; when ⁇ 4 is H, P, or V; ⁇ 5 is I, T, or Y; and ⁇ 11 is V.
  • ⁇ 4 is H; when ⁇ 3 is T; ⁇ 5 is T; and ⁇ 11 is F, L, or M.
  • ⁇ 4 is V; when ⁇ 3 is E, T, or Q; ⁇ 5 is K or T; and ⁇ 11 is L.
  • ⁇ 5 is T; when ⁇ 3 is E, G.
  • ⁇ 4 is A, H, Q, or V; and ⁇ 11 is F, L, or M.
  • ⁇ 11 is L; when ⁇ 3 is E, G, T, or Q; ⁇ 4 is A, H, P, Q, or V; and ⁇ 5 is I, K, or T.
  • the antibody comprises a Chothia CDR-H2 sequence defined by the consensus sequence Y- ⁇ 2 -S- ⁇ 4 -S(SEQ ID NOS: 38 and 44-45), where ⁇ 2 is H or Y and ⁇ 4 is A or G.
  • ⁇ 2 when ⁇ 2 is H; ⁇ 4 is A or G. In some aspects, when ⁇ 4 is G, ⁇ 2 is H or Y.
  • ⁇ 2 when ⁇ 2 is Y; ⁇ 4 is G. In some aspects, when ⁇ 2 is H; ⁇ 4 is G. In some aspects, when ⁇ 2 is H; ⁇ 4 is A.
  • the antibody comprises a Chothia CDR-H2 sequence defined by the consensus sequence ⁇ 1 - ⁇ 2 -S-G-S(SEQ ID NOS: 39, 41-42, and 49), where ⁇ 1 is A, H, or S; and ⁇ 2 is S or Y.
  • ⁇ 1 is S; ⁇ 2 is S or Y.
  • ⁇ 1 when ⁇ 1 is S; ⁇ 2 is S. In some aspects, when ⁇ 1 is S; ⁇ 2 is Y. In some aspects, when ⁇ 1 is H; ⁇ 2 is Y. In some aspects, when ⁇ 1 is A; ⁇ 2 is Y.
  • the antibody comprises a Chothia CDR-H2 sequence defined by the consensus sequence ⁇ 1 - ⁇ 2 -S-G- ⁇ 5 - ⁇ 6 (SEQ ID NOS: 56-60), where ⁇ 1 is A or S; ⁇ 2 is G or S; ⁇ 5 is 1 or S; and ⁇ 6 is T or V.
  • ⁇ 1 when ⁇ 1 is S, ⁇ 2 is G or S; ⁇ 5 is I or S; and ⁇ 6 is T or V.
  • ⁇ 2 when ⁇ 1 is A or S; ⁇ 5 is S; and ⁇ 6 is T or V.
  • ⁇ 5 when ⁇ 1 is S, ⁇ 1 is A or S; ⁇ 2 is S; and ⁇ 6 is T or V.
  • ⁇ 6 when ⁇ 6 is T, ⁇ 1 is S; ⁇ 2 is G or S; and ⁇ 5 is I or T.
  • ⁇ 1 is A; ⁇ 2 is S; ⁇ 5 is S; and ⁇ 6 is V. In some aspects, when ⁇ 1 is S; ⁇ 2 is G; ⁇ 5 is I; and ⁇ 6 is T. In some aspects, when ⁇ 1 is S; ⁇ 2 is S; ⁇ 5 is S; and ⁇ 6 is T.
  • the antibody comprises a Chothia CDR-H1 sequence defined by the consensus sequence G-G-S-I-S-S- ⁇ 7 - ⁇ 8 - ⁇ 9 (SEQ ID NOS: 1-4 and 13-14), where ⁇ 7 is S or A; Us is D, S, or N; and ⁇ 9 is T, N, Y, or is absent.
  • ⁇ 7 is S
  • ⁇ 8 is D, N. or S
  • ⁇ 9 is T. Y, or is absent.
  • ⁇ 8 is D
  • ⁇ 7 is S or A
  • ⁇ 9 is N, T, or Y.
  • ⁇ 8 when ⁇ 8 is T; ⁇ 7 is S; and ⁇ 8 is D or S. In some aspects, when ⁇ 9 is Y; ⁇ 7 is S; and ⁇ 8 is D or S.
  • the antibody comprises a Chothia CDR-H1 sequence defined by the consensus sequence G-Y-S-I- ⁇ 5 -S-G- ⁇ 8 (SEQ ID NOS: 6-9), where ⁇ 5 is S or L and ⁇ 8 is F, H, or Y.
  • ⁇ 5 when ⁇ 5 is S, ⁇ 5 is F, H, or Y.
  • ⁇ 5 when ⁇ 5 is S, ⁇ 8 is F. In some aspects, when ⁇ 5 is S, ⁇ 8 is H. In some aspects, when ⁇ 5 is S. ⁇ 8 is Y. In some aspects, when ⁇ 5 is L. ⁇ 8 is Y.
  • the antibody comprises a Chothia CDR-H1 sequence defined by the consensus sequence G-F-T-F- ⁇ 5 - ⁇ 6 - ⁇ 7 (SEQ ID NOS: 10-12), where ⁇ 5 is D or s; ⁇ 6 is D, N, or S; and ⁇ 7 is S or Y.
  • ⁇ 5 when ⁇ 5 is S; ⁇ 6 is D or S; and ⁇ 7 is S or Y. In some aspects, when ⁇ 7 is Y; ⁇ 5 is D or S; and ⁇ 6 is N or D.
  • ⁇ 5 when ⁇ 5 is D; ⁇ 6 is N; and ⁇ 7 is Y. In some aspects, when ⁇ 5 is S; ⁇ 6 is D; and ⁇ 7 is Y. In some aspects, when ⁇ 5 is S; ⁇ 6 is S; and ⁇ 7 is S.
  • the antibody comprises a Kabat CDR-H2 sequence defined by the consensus sequence ⁇ 1 -I- ⁇ 3 - ⁇ 4 - ⁇ 5 - ⁇ 6 - ⁇ 7 -T- ⁇ 9 -Y-N-P-S-L-K-S(SEQ ID NOS: 54-65 and 69-70) where ⁇ 1 is A, E, G, or S; ⁇ 3 is A, H, S, or Y; ⁇ 4 , is H, S, or Y; ⁇ 5 is N or S; ⁇ 2 is A or G; ⁇ 7 is A, L, or S; and ⁇ 9 is A, N, L, V, or Y.
  • ⁇ 1 is S
  • ⁇ 3 is A, H, S, or Y
  • ⁇ 4 is H, S, or Y
  • ⁇ 5 is N or S
  • ⁇ 6 is A or G
  • ⁇ 7 is A, L, or S
  • ⁇ 9 is A, N, L, V, or Y.
  • ⁇ 1 is G
  • ⁇ 3 is A or Y
  • ⁇ 4 is H or Y
  • ⁇ 5 is G or S
  • ⁇ 6 is A or G
  • ⁇ 7 is S
  • ⁇ 9 is A or Y.
  • ⁇ 3 when ⁇ 3 is Y; ⁇ 1 is A, E, G, or S; ⁇ 4 is H or Y; ⁇ 5 is S; ⁇ 6 is A or G; ⁇ 7 is S; and ⁇ 9 is A, N, V, or Y.
  • ⁇ 3 when ⁇ 3 is S. ⁇ 1 is S; is S or Y; ⁇ 5 is N or S; ⁇ 6 is A or G; ⁇ 7 is L or S; and ⁇ 9 is Y.
  • ⁇ 3 when ⁇ 3 is H; ⁇ 1 is S; ⁇ 4 is H or Y; ⁇ 5 is S; ⁇ 6 is G; ⁇ 7 is A or S; and ⁇ 9 is L or Y.
  • ⁇ 4 when ⁇ 4 is Y; ⁇ 1 is S or G; ⁇ 3 is A, H, S, or Y; s is N or S; ⁇ 6 is A or G; ⁇ 7 is L or S; and ⁇ 9 is L or Y.
  • ⁇ 4 s H when ⁇ 4 s H; ⁇ 1 is A, E, G, S; ⁇ 3 is H or Y; ⁇ 5 is S; ⁇ 6 is A or G; ⁇ 7 is A or S; and ⁇ 9 is A, N, Y or V.
  • ⁇ 5 when ⁇ 5 is S; ⁇ 1 is A, E, G, or S; ⁇ 3 is A, H, S, or Y; ⁇ 4 is H, S, or Y; ⁇ 6 is A or G; ⁇ 7 is A or S; and ⁇ 9 is A, L, N, Y, or V.
  • ⁇ 6 when ⁇ 6 is G; ⁇ 1 is A, E, G, or S; ⁇ 3 is A, H, S, or Y; ⁇ 4 is H, S, or Y; ⁇ 5 is S; ⁇ 7 is S; and ⁇ 9 is A, N, L, V, or Y.
  • ⁇ 6 when ⁇ 6 is A; ⁇ 1 is G or S; ⁇ 3 is S or Y; ⁇ 4 is H or Y; ⁇ 5 is N or S; ⁇ 7 is L or S; and ⁇ 9 is A or Y.
  • ⁇ 7 when ⁇ 7 is S; ⁇ 1 is A, E, G, or S; ⁇ 3 is A, H, S, or Y; ⁇ 4 is H, S, or Y; ⁇ 5 is S; ⁇ 6 is A or G; and ⁇ 9 is A, L, N, V, or Y.
  • ⁇ 9 when ⁇ 9 is Y; ⁇ 1 is G or S; ⁇ 3 is A, H, S, or Y; ⁇ 4 is H, S or Y; ⁇ 5 is N or S; ⁇ 6 is A or G; and ⁇ 7 is A, L, or S.
  • ⁇ 9 when ⁇ 9 is A; ⁇ 1 is G; ⁇ 3 is Y; ⁇ 4 is H; ⁇ 5 is S; ⁇ 6 is A or G; and ⁇ 7 is S.
  • ⁇ 1 when ⁇ 1 is G; ⁇ 3 is Y; ⁇ 4 is H; ⁇ 5 is S; ⁇ 6 is G; and ⁇ 7 is S; and ⁇ 9 is Y.
  • ⁇ 1 when ⁇ 1 is A; ⁇ 3 is Y; ⁇ 4 is H; ⁇ 5 is S; ⁇ 6 is G; and ⁇ 7 is S; and ⁇ 9 is V.
  • ⁇ 1 when ⁇ 1 is G; ⁇ 3 is Y; ⁇ 4 is H; ⁇ 5 is S; ⁇ 6 is G; and ⁇ 7 is S: and ⁇ 9 is A.
  • ⁇ 1 is E; ⁇ 3 is Y; ⁇ 4 is H; ⁇ 5 is S; ⁇ 6 is G; and ⁇ 7 is S; and ⁇ 9 is N.
  • the antibody comprises a Kabat CDR-H1 sequence defined by the consensus sequence S-S- ⁇ 3 - ⁇ 4 -Y-W- ⁇ 7 (SEQ ID NOS: 18-21, 23, and 34), where ⁇ 3 is D or S; ⁇ 4 is T or Y; and ⁇ 7 is A, G, or S.
  • ⁇ 3 when ⁇ 3 is D; ⁇ 4 is T or Y; and ⁇ 7 is G. In some aspects, when ⁇ 3 is S; ⁇ 4 is T or Y; and ⁇ 7 is A, G, or S. In some aspects, when ⁇ 4 is T; ⁇ 3 is D or S; and ⁇ 7 is A, G, or S. In some aspects, when ⁇ 4 is Y; ⁇ 3 is D or S; and ⁇ 7 is G. In some aspects, when ⁇ 7 is G; ⁇ 3 is D or S; and ⁇ 4 is T or Y.
  • the antibody comprises a Kabat CDR-H1 sequence defined by the consensus sequence S-G- ⁇ 3 -Y-W- ⁇ 6 (SEQ ID NOS: 24-29), where ⁇ 3 is F, H, or Y; and ⁇ 6 is F, G, I, L, or T.
  • ⁇ 3 when ⁇ 3 is H, ⁇ 6 is I or T. In some aspects, when ⁇ 3 is Y, ⁇ 6 is F, G, or L. In some aspects, when ⁇ 6 is T, ⁇ 3 is F or H.
  • ⁇ 3 when ⁇ 3 is Y, ⁇ 6 is G. In some aspects, when ⁇ 3 is Y, ⁇ 6 is F. In some aspects, when ⁇ 3 is H, ⁇ 6 is I. In some aspects, when ⁇ 3 is F, ⁇ 6 is T. In some aspects, when ⁇ 3 is Y, ⁇ 6 is L. In some aspects, when ⁇ 3 is H, ⁇ 6 is T.
  • the antibody comprises a CDR-L3 sequence defined by the consensus sequence Q- ⁇ 2 - ⁇ 3 - ⁇ 4 -H-S-P-Y-T (SEQ ID NOS: 149-153), where ⁇ 2 is Q or W; ⁇ 3 is A, T, or V; and ⁇ 4 is I or V.
  • ⁇ 2 when ⁇ 2 is Q; ⁇ 3 is A, T, or V; and ⁇ 4 is I or V. In some aspects, when ⁇ 3 is A; ⁇ 2 is Q or W; and ⁇ 4 is I or V. In some aspects, when ⁇ 4 is V; ⁇ 2 is Q or W; and ⁇ 3 is A, T, or V.
  • ⁇ 2 when ⁇ 2 is Q; ⁇ 3 is A; and ⁇ 4 is V. In some aspects, when ⁇ 2 is W; A; is A; and ⁇ 4 is V. In some aspects, when ⁇ 2 is Q; ⁇ 3 is V; and ⁇ 4 is V. In some aspects, when ⁇ 2 is Q; ⁇ 3 is T; and ⁇ 4 is V. In some aspects, when ⁇ 2 is Q; ⁇ 3 is A; and ⁇ 4 is I.
  • the antibody comprises a CDR-L3 sequence defined by the consensus sequence Q-Q- ⁇ 3 -S- ⁇ 5 -Y-P-P-T (SEQ ID NOS: 154-158), where ⁇ 3 is F, H, or V; and ⁇ 5 is I, L, or S.
  • ⁇ 3 when ⁇ 3 is H; ⁇ 5 is I, L, or S. In some aspects, when ⁇ 5 is H; ⁇ 3 is F, H, or V.
  • ⁇ 3 when ⁇ 3 is H, ⁇ 5 is S. In some aspects, when ⁇ 3 is H, ⁇ 5 is L. In some aspects, when ⁇ 3 is F, ⁇ 5 is S. In some aspects, when ⁇ 3 is V, ⁇ 5 is S. In some aspects, when ⁇ 3 is H, ⁇ 5 is I.
  • the antibody comprises a CDR-L3 sequence defined by the consensus sequence Q-Q- ⁇ 3 - ⁇ 4 - ⁇ 5 - ⁇ 6 -P-I-T (SEQ ID NOS: 160-161 and 163-164), where ⁇ 3 is A, L, V, or Y; ⁇ 4 is G, P, V, or Y; ⁇ 5 is S, L, or F; and ⁇ 6 is D, L, S, or Y.
  • ⁇ 5 is S
  • ⁇ 3 is V or Y
  • ⁇ 4 is G or V
  • ⁇ 6 is D or S.
  • ⁇ 3 when ⁇ 3 is A; ⁇ 4 is Y; ⁇ 5 is L; and ⁇ 6 is Y. In some aspects, when ⁇ 3 is L; ⁇ 4 is P; ⁇ 5 is F; and ⁇ 6 is L. In some aspects, when ⁇ 3 is Y; ⁇ 4 is V; ⁇ 5 is S; and ⁇ 6 is D. In some aspects, when ⁇ 3 is V; ⁇ 4 is G; ⁇ 5 is S; and ⁇ 6 is S.
  • the antibody comprises a CDR-L2 sequence defined by the consensus sequence ⁇ 1 -A-S- ⁇ 4 -R-A- ⁇ 7 (SEQ ID NOS: 128, 130, 132, 134-138, 143, and 145), where ⁇ 1 is D or G; ⁇ 4 is A, D, N, R, S, T, or Y; and ⁇ 7 is A, N, S, or T.
  • ⁇ 1 when ⁇ 1 is G; ⁇ 4 is A, D, N, R, S, T, or Y; and ⁇ 7 is A, N, or T.
  • ⁇ 1 when ⁇ 1 is D; ⁇ 4 is S or T; and ⁇ 7 is S or T.
  • when ⁇ 4 is S; ⁇ 1 is G or D; and ⁇ 7 is S or T.
  • when ⁇ 4 is N; ⁇ 1 is G or D; and ⁇ 7 is A or T.
  • ⁇ 4 when ⁇ 4 is T; ⁇ 1 is G or D; and ⁇ 7 is T.
  • ⁇ 7 when ⁇ 7 is T; ⁇ 1 is G or D; and ⁇ 4 is A, N, R, S, T, or Y.
  • ⁇ 1 when ⁇ 1 is G; ⁇ 4 is Y; and ⁇ 7 is T. In some aspects, when ⁇ 1 is G; ⁇ 4 is R; and ⁇ 7 is T. In some aspects, when ⁇ 1 is G; ⁇ 4 is T; and ⁇ 7 is T.
  • the antibody comprises a CDR-L1 sequence defined by the consensus sequence ⁇ 1 -A-S-Q- ⁇ 5 -V-S-S- ⁇ 9 - ⁇ 10 -L-A (SEQ ID NOS: 105-112 and 117), where ⁇ 1 is E, G, K, Q, or R; ⁇ 5 is A or S; ⁇ 9 is A, D, N, S, or T; and ⁇ 10 is F or Y.
  • ⁇ 1 when ⁇ 1 is R; ⁇ 5 is Q or S; ⁇ 9 is A, S, or T; and ⁇ 10 is S or Y.
  • ⁇ 1 when ⁇ 1 is G; ⁇ 5 is Q or S; ⁇ 9 is A or D; and ⁇ 10 is F or Y.
  • ⁇ 1 when ⁇ 1 is Q; ⁇ 5 is A or S; ⁇ 9 is N or S; and ⁇ 10 is Y.
  • ⁇ 5 when ⁇ 5 is S; ⁇ 1 is E, G, Q, or R; ⁇ 9 is A, D, S, or T; and ⁇ 10 is F or Y.
  • ⁇ 5 when ⁇ 5 is A; ⁇ 1 is K or Q; ⁇ 9 is N or S; and ⁇ 10 is Y.
  • ⁇ 9 when ⁇ 9 is S; ⁇ 1 is E, K, Q, or R; ⁇ 5 is A or S; and ⁇ 10 is Y.
  • ⁇ 9 when ⁇ 9 is A; ⁇ 1 , is G or R; ⁇ 5 is S; and ⁇ 10 is F or Y.
  • ⁇ 1 when ⁇ 1 is R; ⁇ 5 is S; ⁇ 9 is S; and ⁇ 10 is Y. In some aspects, when ⁇ 1 is G; ⁇ 5 is S; ⁇ 9 is D; and ⁇ 10 is Y. In some aspects, when ⁇ 1 is Q; ⁇ 5 is A; ⁇ 9 is N; and ⁇ 10 is Y. In some aspects, when ⁇ 1 is G; ⁇ 5 is S; ⁇ 9 is A; and ⁇ 10 is F. In some aspects, when ⁇ 1 is R; ⁇ 5 is S; ⁇ 9 is T; and ⁇ 10 is Y. In some aspects, when ⁇ 1 is Q; ⁇ 5 is S; ⁇ 9 is S: and ⁇ 10 is Y.
  • ⁇ 1 when ⁇ 1 is K; ⁇ 5 is A; ⁇ 9 is S; and ⁇ 10 is Y. In some aspects, when ⁇ 1 is E; ⁇ 5 is S; ⁇ 9 is S; and ⁇ 10 is Y. In some aspects, when ⁇ 1 is R; ⁇ 5 is S; ⁇ 9 is A; and ⁇ 10 is Y.
  • the antibody comprises a CDR-L1 sequence defined by the consensus sequence R-A-S-Q-S- ⁇ 6 - ⁇ 7 -S- ⁇ 9 -L- ⁇ 11 (SEQ ID NOS: 119 and 123-124), where ⁇ 6 is I or V; ⁇ 7 is N or S; ⁇ 9 is N, W, or Y; ⁇ 11 is A or N.
  • ⁇ 6 when ⁇ 6 is I, ⁇ 7 is N or S; ⁇ 9 is W or Y; and ⁇ 11 is A or N. In some aspects, when ⁇ 7 is S, ⁇ 6 is I or V; ⁇ 9 is N or Y: and ⁇ 11 is A or N. In some aspects, when ⁇ 11 is A, ⁇ 6 is I or V; ⁇ 7 is N or S; and ⁇ 9 is N or W.
  • ⁇ 6 when ⁇ 6 is I; ⁇ 7 is N; ⁇ 9 is W; and ⁇ 11 is A. In some aspects, when ⁇ 6 is I; ⁇ 7 is S; ⁇ 9 is Y; and ⁇ 11 is N. In some aspects, when ⁇ 6 is V; ⁇ 7 is S; ⁇ 9 is N; and ⁇ 11 is A.
  • the antibody comprises a CDR-L1 sequence defined by the consensus sequence ⁇ 1 - ⁇ 2 -S-Q-S-V-S- ⁇ 8 - ⁇ 9 -Y-L-A (SEQ ID NOS: 113-116), where ⁇ 1 is E or R; ⁇ 2 is A or V; F is A or V; ⁇ 8 is A, D, or S; and ⁇ 10 is A or S.
  • ⁇ 1 is E; ⁇ 2 is A or V; ⁇ 8 is A or S; and ⁇ 9 is A or S.
  • ⁇ 2 is A; ⁇ 1 is E; ⁇ 8 is A or S; and ⁇ 9 is A or S.
  • ⁇ 2 is V; ⁇ 1 is E or R; ⁇ 8 A or D; and ⁇ 9 is A or S.
  • ⁇ 8 is A; ⁇ 1 is E; ⁇ 2 is A or V; and ⁇ 9 is S.
  • ⁇ 9 is S; ⁇ 1 is E; ⁇ 2 is A or V; and ⁇ 8 is A.
  • ⁇ 9 is A; ⁇ 1 is E or R; ⁇ 2 is A or V; and ⁇ 8 D or S.
  • ⁇ 1 when ⁇ 1 is E; ⁇ 2 is A; ⁇ 8 is A; and ⁇ 9 is S. In some aspects, when ⁇ 1 is E; ⁇ 2 is A; ⁇ 8 is S; and ⁇ 9 is A. In some aspects, when ⁇ 1 is R; ⁇ 2 is V; ⁇ 8 is A; and ⁇ 9 is A. In some aspects, when ⁇ 1 is E; ⁇ 2 is V; ⁇ 8 is A; and ⁇ 9 is S.
  • the antibody that specifically binds HLA-G is an antibody comprising a variable region that is encoded by a particular germline, gene, or a variant thereof.
  • the illustrative antibodies provided herein comprise variable regions that are encoded by the heavy chain variable region germline genes V H 3-23, V H 4-39, V H 3-11, and V H 4-0B or variants thereof; and the light chain variable region germline genes VK1-33, VK3-20, VK1-12, and VK1-05 or variants thereof.
  • the CDR sequences provided herein may also be useful when combined with variable regions encoded by other variable region germline genes or variants thereof.
  • the CDR sequences provided herein may be useful when combined with variable regions encoded by variable region germline genes, or variants thereof, that are structurally similar to the variable region germline genes recited above.
  • a CDR-H sequence provided herein may be combined with a variable region encoded by a variable region germline gene selected from the V H 1 or V H 3 family, or a variant thereof.
  • a CDR-L sequence provided herein may be combined with a variable region encoded by a variable region germline gene selected from the V ⁇ 3, V ⁇ 1, V ⁇ 3, and V ⁇ 4 families, or a variant thereof.
  • the affinity of the antibody for HLA-G is less than about 10 ⁇ 5 M, less than about 10 ⁇ 6 M, less than about 10 ⁇ 7 M, less than about 10 ⁇ 8 M, less than about 10 ⁇ 9 M, less than about 10 ⁇ 10 M, less than about 10 ⁇ 11 M, or less than about 10 ⁇ 12 M.
  • the affinity of the antibody is between about 10 ⁇ 7 M and 10 ⁇ 11 M. In some embodiments, the affinity of the antibody is between about 10 ⁇ 7 M and 10 ⁇ 11 M. In some embodiments, the affinity of the antibody is between about 10 ⁇ 7 M and 10 ⁇ 9 M.
  • the affinity of the antibody is between about 10 ⁇ 7 M and 10 ⁇ 8 M. In some embodiments, the affinity of the antibody is between about 10 ⁇ 8 M and 10 ⁇ 11 M. In some embodiments, the affinity of the antibody is between about 10 ⁇ 8 M and 10 ⁇ 11 M. In some embodiments, the affinity of the antibody is between about 10 ⁇ 9 M and 10 ⁇ 11 M. In some embodiments, the affinity of the antibody is between about 10 ⁇ 10 M and 10 ⁇ 11 M.
  • the affinity of the antibody for human HLA-G is between about 1.00 ⁇ 10 ⁇ 8 M and 9.43 ⁇ 10 ⁇ 10 M. In some embodiment, the affinity of the antibody for human HLA-G is about 1.00 ⁇ 10 ⁇ 8 M, about 1.08 ⁇ 10 ⁇ 8 M, about 1.10 ⁇ 10 ⁇ 8 M, about 1.13 ⁇ 10 ⁇ 8 M, about 1.14 ⁇ 10 ⁇ 8 M, about 1.16 ⁇ 10 ⁇ 8 M, about 1.29 ⁇ 10 ⁇ 8 M, about 1.40 ⁇ 10 ⁇ 8 M, about 1.41 ⁇ 10 ⁇ 8 M, about 1.46 ⁇ 10 ⁇ 8 M, about 1.67 ⁇ 10 ⁇ 8 M, about 1.79 ⁇ 10 ⁇ 8 M, about 1.81 ⁇ 10 ⁇ 8 M, about 2.04 ⁇ 10 ⁇ 8 M, about 2.30 ⁇ 10 ⁇ 8 M, about 2.49 ⁇ 10 ⁇ 8 M, about 2.59 ⁇ 10 ⁇ 8 M, about 2.94 ⁇ 10 ⁇ 8 M, about 2.95 ⁇ 10 ⁇ 8 M, about 3.11 ⁇ 10 ⁇ 8 M, about 3.
  • the antibody has a k when associating with human HLA-G of between about 1.41 ⁇ 10 5 M ⁇ 1 ⁇ sec ⁇ 1 and about 1.07 ⁇ 10 6 M ⁇ 1 ⁇ sec ⁇ 1 . In some embodiments the antibody has a k on when associating with human HLA-G of about 1.41 ⁇ 10 5 M ⁇ 1 ⁇ sec ⁇ 1 , about 1.49 ⁇ 10 5 M ⁇ 1 ⁇ sec ⁇ 1 , about 1.66 ⁇ 10 5 M ⁇ 1 ⁇ sec ⁇ 1 , about 2.90 ⁇ 10 5 M ⁇ 1 ⁇ sec ⁇ 1 , about 3.60 ⁇ 10 5 M ⁇ 1 ⁇ sec ⁇ 1 , about 3.74 ⁇ 10 5 M ⁇ 1 ⁇ sec ⁇ 1 , about 3.78 ⁇ 10 5 M ⁇ 1 ⁇ sec ⁇ 1 , about 4.03 ⁇ 10 5 M ⁇ 1 ⁇ sec ⁇ 1 , about 4.30 ⁇ 10 5 M ⁇ 1 ⁇ sec ⁇ 1 , about 4.32 ⁇ 10 5 M ⁇ 1 ⁇
  • the antibody has a k off when associating with human HLA-G of between about 1.06 ⁇ 10 2 sec ⁇ 1 and about 8.55 ⁇ 10 5 sec ⁇ 1 . In some embodiments the antibody has a k off of about 1.06 ⁇ 10 ⁇ 2 sec ⁇ 1 , about 1.13 ⁇ 10 ⁇ 2 sec ⁇ 1 , about 1.87 ⁇ 10 ⁇ 2 sec ⁇ 1 , about 2.13 ⁇ 10 ⁇ 2 sec ⁇ 1 , about 3.62 ⁇ 10 ⁇ 3 sec ⁇ 1 , about 3.66 ⁇ 10 ⁇ 3 sec ⁇ 1 , about 3.75 ⁇ 10 ⁇ 3 sec ⁇ 1 , about 3.78 ⁇ 10 ⁇ 3 sec ⁇ 1 , about 3.83 ⁇ 10 ⁇ 3 sec ⁇ 1 , about 3.96 ⁇ 10 ⁇ 3 sec ⁇ 1 , about 4.17 ⁇ 10 ⁇ 3 sec ⁇ 1 , about 4.27 ⁇ 10 ⁇ 3 sec ⁇ 1 , about 4.29 ⁇ 10 ⁇ 3 sec ⁇ 1 , about 4.41 ⁇ 10 ⁇ 3 sec ⁇ 1 , about 1.
  • the K D , k a , and k d are determined at 25° C. In some embodiments, the K D , k a , and k d are determined by surface plasmon resonance. In some embodiments, the K D , k a , and k d are determined according to the methods described in the examples.
  • the antibody decreases the affinity of HLA-G for its ligand(s). In some aspects, the antibody disrupts the association of HLA-G with beta-2-microglobulin and/or its cognate peptide. In some aspects the antibody prevents HLA-G dimerization or oligomizeration.
  • the antibody inhibits HLA-G function on tumor cells. In some aspects, the antibody inhibits HLA-G function on immune cells. In some embodiments, the antibody blocks HLA-G interaction and/or binding to an ITIM inhibitory receptor. In some embodiments, the antibody blocks HLA-G interaction and/or binding to ILT2. In some embodiments, the antibody blocks HLA-G interaction and/or binding to ILT4. In some embodiments, the antibody blocks HLA-G interaction and/or binding to KIR2DL4.
  • the antibody inhibits immune suppressive function. In some embodiments, the antibody inhibits HLA-G mediated suppression of NK cells. In some embodiments, the antibody inhibits HLA-G mediated suppression of cytotoxic T lymphocytes. In some embodiments, the antibody inhibits HLA-G mediated suppression of B cells. In some embodiments, the antibody inhibits HLA-G mediated suppression of neutrophils. In some embodiments, the antibody inhibits HLA-G mediated suppression of dendritic cells. In some embodiments, the antibody inhibits HLA-G mediated suppression of macrophages. In some embodiments, the antibody inhibits HLA-G mediated suppression of monocytes. In some embodiments, the antibody inhibits HLA-G mediated suppression of NK and/or T cell cytolysis and/or proliferation.
  • the antibody prevents or inhibits HLA-G mediated suppression of phagocytosis. In some embodiments, the antibody mediates HLA-G mediated induction of T regulatory cells. In some embodiments, the antibody prevents or inhibits the generation or expansion of regulatory T cells. In some embodiments, the antibody inhibits tumor growth by antibody-dependent cellular cytotoxicity (ADCC) or phagocytosis (ADCP).
  • ADCC antibody-dependent cellular cytotoxicity
  • ADCP phagocytosis
  • the decrease is about or less than a 10% decrease, about or less than a 20% decrease, about or less than a 30% decrease, about or less than a 40% decrease, about or less than a 50% decrease, about or less than a 60% decrease, about or less than a 70% decrease, about or less than an 80% decrease, about or less than a 90% decrease, or about a complete decrease.
  • the increase is about or greater than a 10% increase, about or greater than a 20% increase, about or greater than a 30% increase, about or greater than a 40% increase, about or greater than a 50% increase, about or greater than a 60% increase, about or greater than a 70% increase, about or greater than an 80% increase, about or greater than a 90% increase, or a complete increase.
  • the antibody binds to an epitope of HLA-G.
  • An epitope often consists of a number of contiguous amino acids such as, for example, without limitation, 5-6 amino acids.
  • the epitope comprises or consists of contiguous or non-contiguous amino acids.
  • the contiguous or non-contiguous amino acids are within a domain of HLA-G.
  • the domain comprises or consists of an alpha three domain.
  • HLA-G has a sequence identical to the amino acid sequence set forth in SEQ ID NO: 342.
  • the epitope has an amino acid sequence that is within the amino acid sequence set forth in SEQ ID NO: 342. In some aspects, the epitope has an amino acid sequence that is 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% identical to a sequence that is within the sequence set forth in SEQ ID NO: SEQ ID NO: 342.
  • the epitope comprises or consists of a contiguous or non-contiguous span of amino acids including residues 195, 197, and/or 198 of the sequence set forth in SEQ ID NO: 342. In some aspects, the epitope comprises a sequence that is identical or corresponds to residues 195, 197, and/or 198 of a sequence that is within the sequence set forth in SEQ ID NO: 342. In some aspects, the epitope has a sequence that has a 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% identity to a sequence that is within the sequence set forth in SEQ ID NO: 342.
  • the epitope has 1, 2, 3, 4, 5, 6, 7, 8, or 9 substitutions from a sequence that is within the sequence set forth in forth in SEQ ID NO: 342. In some aspects, the epitope has 1, 2 or 3 substitutions from residues a sequence that is within the sequence set forth in SEQ ID NO: 342. In some aspects, the antibody makes contact with any of the residues set forth in FIG. 9 .
  • the antibody competes with any of the antibodies set forth herein. Competition could be, for example, without limitation, binding competition, inhibition competition, or any other form of competition. In some aspects, the antibody competes with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 of antibodies 38410, 38418, 38422, 38426, 38381, 38358, 37323, 38373, 38375, 38379, 38389, 33303, or 33357. In some aspects, the antibody competes with any of the antibodies set forth in FIG. 2 or FIG. 3 . In some aspects, the antibody competes with 1, 2, 3, 4, 5, 6, 7, or 8 of 38373, 38375, 38379, 38418, 38422, 38426, 38410 or 38381.
  • the antibody competes with 38358. In some aspects, the antibody competes with 1, 2, 3, 4, 5, 6, 7, 8, or 9 of 38373, 38375, 38379, 38418, 38422, 38426, 38410 or 38381, or 38358. In some aspects, the antibody competes with one or both of 37323 and/or 38389. In some aspects, the antibody competes with one or both of 33303 and/or 33357.
  • an antibody may be altered to increase, decrease or eliminate the extent to which it is glycosylated. Glycosylation of polypeptides is typically either “N-linked” or “O-linked.”
  • N-linked glycosylation refers to the attachment of a carbohydrate moiety to the side chain of an asparagine residue.
  • the tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
  • X is any amino acid except proline
  • O-linked glycosylation refers to the attachment of one of the sugars N-acetylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
  • Addition or deletion of N-linked glycosylation sites to the antibody may be accomplished by altering the amino acid sequence such that one or more of the above-described tripeptide sequences is created or removed.
  • Addition or deletion of O-linked glycosylation sites may be accomplished by addition, deletion, or substitution of one or more serine or threonine residues in or to (as the case may be) the sequence of an antibody.
  • the antibody is glycosylated. In certain embodiments, the antibody is deglycosylated. Carbohydrates may be removed by standard techniques. In certain embodiments, the antibody is aglycosylated, for instance by expression in a system that does not glycosylate.
  • amino acid modifications may be introduced into the Fc region of an antibody provided herein to generate an Fc region variant.
  • the Fc region variant possesses some, but not all, effector functions.
  • Such antibodies may be useful, for example, in applications in which the half-life of the antibody in vivo is important, yet certain effector functions are unnecessary or deleterious.
  • effector functions include complement-dependent cytotoxicity (CDC) and antibody-directed complement-mediated cytotoxicity (ADCC). Numerous substitutions or substitutions or deletions with altered effector function are known in the art.
  • the Fc is modified.
  • a hinge of an IgG1 or IgG4 antibody is modified. Modification of a hinge region stabilizes an antibody and prevents formation of unwanted bispecific antibodies.
  • the modification comprises an L234A, L235A, and/or G237A according to a Kabat numbering scheme or residues number 117, 118, and 120, respectively, wherein residues are numbered according to any of SEQ ID NO: 334.
  • the modification comprises an EU S228P or an S241P according to a Kabat numbering scheme or number 108 according to SEQ ID NO: 335.
  • an IgG Fc is engineered to modulate antibody effector function (See Wang et al., Protein Cell, 2018, January; 9(1): 63-73), which is incorporated by reference herein in its entirety, including any drawings).
  • Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest are provided in U.S. Pat. Nos. 5,500,362 and 5,821,337; Hellstrom et al., Proc. Natl. Acad. Sci. U.S.A., 1986, 83:7059-7063; Hellstrom et al., Proc. Natl. Acad. Sci. U.S.A., 1985, 82:1499-1502; and Bruggemann et al., J. Exp. Med., 1987, 166:1351-1361.
  • Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
  • ADCC activity of the molecule of interest may be assessed in vivo, using an animal model such as that disclosed in Clynes et al. Proc. Natl. Acad. Sci. U.S.A., 1998, 95:652-656.
  • C1q binding assays may also be carried out to confirm that the antibody is unable to bind C1q and hence lacks CDC activity.
  • Examples of C1q binding assays include those described in WO 2006/029879 and WO 2005/100402.
  • Complement activation assays include those described, for example, in Gazzano-Santoro et al., J. Immunol. Methods, 1996, 202:163-171; Cragg et al., Blood, 2003, 101:1045-1052; and Cragg and Glennie, Blood, 2004, 103:2738-2743.
  • FcRn binding and in vivo clearance can also be measured, for example, using the methods described in Petkova et al., Intl. Immunol., 2006, 18:1759-1769.
  • the HLA-G antigen to be used for production of antibodies may be intact HLA-G or a fragment of HLA-G.
  • the intact HLA-G, or fragment of HLA-G may be in the form of an isolated protein or expressed by a cell.
  • Other forms of HLA-G useful for generating antibodies will be apparent to those skilled in the art.
  • Monoclonal antibodies may be obtained, for example, using the hybridoma method first described by Kohler et al., Nature, 1975, 256:495-497, and/or by recombinant DNA methods (see e.g., U.S. Pat. No. 4,816,567). Monoclonal antibodies may also be obtained, for example, using phage or yeast-based libraries. See e.g., U.S. Pat. Nos. 8,258,082 and 8,691,730.
  • lymphocytes that produce or are capable of producing antibodies that will specifically bind to the protein used for immunization.
  • lymphocytes may be immunized in vitro. Lymphocytes are then fused with myeloma cells using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell.
  • a suitable fusing agent such as polyethylene glycol
  • the hybridoma cells are seeded and grown in a suitable culture medium that contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells.
  • a suitable culture medium that contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells.
  • the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient cells.
  • Useful myeloma cells are those that fuse efficiently, support stable high-level production of antibody by the selected antibody-producing cells, and are sensitive media conditions, such as the presence or absence of HAT medium.
  • preferred myeloma cell lines are murine myeloma lines, such as those derived from MOP-21 and MC-11 mouse tumors (available from the Salk Institute Cell Distribution Center, San Diego, Calif.), and SP-2 or X63-Ag8-653 cells (available from the American Type Culture Collection, Rockville, Md.).
  • Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies. See e.g., Kozbor, J. Immunol. 1984, 133:3001.
  • hybridoma cells After the identification of hybridoma cells that produce antibodies of the desired specificity, affinity, and/or biological activity, selected clones may be subcloned by limiting dilution procedures and grown by standard methods. See Goding, supra. Suitable culture media for this purpose include, for example, D-MEM or RPMI-1640 medium. In addition, the hybridoma cells may be grown in vivo as ascites tumors in an animal.
  • DNA encoding the monoclonal antibodies may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the monoclonal antibodies).
  • the hybridoma cells can serve as a useful source of DNA encoding antibodies with the desired properties.
  • the DNA may be placed into expression vectors, which are then transfected into host cells such as bacteria (e.g., E. coli ), yeast (e.g., Saccharomyces or Pichia sp.), COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce antibody, to produce the monoclonal antibodies.
  • Humanized antibodies may be generated by replacing most, or all, of the structural portions of a monoclonal antibody with corresponding human antibody sequences. Consequently, a hybrid molecule is generated in which only the antigen-specific variable, or CDR, is composed of non-human sequence.
  • Methods to obtain humanized antibodies include those described in, for example, Winter and Milstein, Nature, 1991, 349:293-299; Rader et al., Proc. Nat. Acad. Sci. U.S.A., 1998, 95:8910-8915; Steinberger et al., J. Biol. Chem., 2000. 275:36073-36078; Queen et al., Proc. Natl. Acad. Sci. U.S.A., 1989, 86:10029-10033; and U.S. Pat. Nos. 5,585,089, 5,693,761, 5,693,762, and 6,180,370.
  • Human antibodies can be generated by a variety of techniques known in the art, for example by using transgenic animals (e.g., humanized mice). See, e.g., Jakobovits et al., Proc. Natl. Acad. Sci. U.S.A., 1993, 90:2551; Jakobovits et al., Nature, 1993, 362:255-258; Bruggermann et al., Year in Immuno., 1993, 7:33; and U.S. Pat. Nos. 5,591,669, 5,589,369 and 5,545,807. Human antibodies can also be derived from phage-display libraries (see e.g., Hoogenboom et al., J. Mol.
  • Human antibodies may also be generated by in vitro activated B cells (see e.g., U.S. Pat. Nos. 5,567,610 and 5,229,275). Human antibodies may also be derived from yeast-based libraries (see e.g., U.S. Pat. No. 8,691,730).
  • the invention also provides isolated nucleic acids encoding anti-HLA-G antibodies, vectors and host cells comprising the nucleic acids and recombinant techniques for the production of the antibodies.
  • the nucleic acid encoding it may be isolated and inserted into a replicable vector for further cloning (i.e., amplification of the DNA) or expression.
  • the nucleic acid may be produced by homologous recombination, for example as described in U.S. Pat. No. 5,204,244.
  • the vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence, for example as described in U.S. Pat. No. 5,534,615.
  • Suitable host cells include any prokaryotic (e.g., bacterial), lower eukaryotic (e.g., yeast), or higher eukaryotic (e.g., mammalian) cells.
  • Suitable prokaryotes include cubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia ( E. coli ), Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella ( S. typhimurium ), Serratia ( S. marcescans ), Shigella, Bacilli ( B. subtilis and B. licheniformis ), Pseudomonas ( P.
  • prokaryotic e.g., bacterial
  • lower eukaryotic e.g., yeast
  • higher eukaryotic e.g., mammalian cells.
  • Suitable prokaryotes include cubacteria, such as Gram-negative or Gram-positive organism
  • E. coli 294 One useful E. coli cloning host is E. coli 294, although other strains such as E. coli B, E. coli X1776, and E. coli W3110 are suitable.
  • eukaryotic microbes such as filamentous fungi or yeast are also suitable cloning or expression hosts for anti-HLA-G antibody-encoding vectors.
  • Saccharomyces cerevisiae or common baker's yeast, is a commonly used lower eukaryotic host microorganism.
  • Schizosaccharomyces pombe Kluyveromyces ( K. lactis, K. fragilis, K. bulgaricus, K. wickeramii, K. waltii, K. drasophilarum, K. thermotolerans , and K.
  • Useful mammalian host cells include COS-7 cells, HEK293 cells; baby hamster kidney (BHK) cells; Chinese hamster ovary (CHO); mouse sertoli cells; African green monkey kidney cells (VERO-76), and the like.
  • the host cells used to produce the anti-HLA-G antibody of this invention may be cultured in a variety of media.
  • Commercially available media such as, for example, Ham's F10, Minimal Essential Medium (MEM), RPMI-1640, and Dulbecco's Modified Eagle's Medium (DMEM) are suitable for culturing the host cells.
  • MEM Minimal Essential Medium
  • RPMI-1640 RPMI-1640
  • DMEM Dulbecco's Modified Eagle's Medium
  • any of the media described in Ham et al., Meth. Enz., 1979, 58:44; Barnes et al., Anal. Biochem., 1980, 102:255; and U.S. Pat. Nos. 4,767,704, 4,657,866, 4,927,762, 4,560,655, and 5,122,469, or WO 90/03430 and WO 87/00195 may be used.
  • any of these media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics, trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art.
  • growth factors such as insulin, transferrin, or epidermal growth factor
  • salts such as sodium chloride, calcium, magnesium, and phosphate
  • buffers such as HEPES
  • nucleotides such as adenosine and thymidine
  • antibiotics such as adenosine and thymidine
  • trace elements defined as inorganic compounds usually present at final concentrations in the micromolar range
  • the culture conditions such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
  • the antibody can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the antibody is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, is removed, for example, by centrifugation or ultrafiltration.
  • the particulate debris either host cells or lysed fragments
  • the particulate debris is removed, for example, by centrifugation or ultrafiltration.
  • Carter et al. Bio/Technology, 1992, 10:163-167 describes a procedure for isolating antibodies which are secreted to the periplasmic space of E. coli . Briefly, cell paste is thawed in the presence of sodium acetate (pH 3.5), EDTA, and phenylmethylsulfonylfluoride (PMSF) over about 30 minutes. Cell debris can be removed by centrifugation.
  • sodium acetate pH 3.5
  • EDTA EDTA
  • PMSF phenylmethylsulf
  • the antibody is produced in a cell-free system.
  • the cell-free system is an in vitro transcription and translation system as described in Yin et al., mAbs, 2012, 4:217-225, incorporated by reference in its entirety.
  • the cell-free system utilizes a cell-free extract from a eukaryotic cell or from a prokaryotic cell.
  • the prokaryotic cell is E. coli .
  • Cell-free expression of the antibody may be useful, for example, where the antibody accumulates in a cell as an insoluble aggregate, or where yields from periplasmic expression are low.
  • supernatants from such expression systems are generally first concentrated using a commercially available protein concentration filter, for example, an Amicon® or Millipore® Pellcon® ultrafiltration unit.
  • a protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.
  • the antibody composition prepared from the cells can be purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, and affinity chromatography, with affinity chromatography being a particularly useful purification technique.
  • the suitability of protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc domain that is present in the antibody.
  • Protein A can be used to purify antibodies that are based on human ⁇ 1, ⁇ 2, or ⁇ 4 heavy chains (Lindmark et al., J. Immunol. Meth., 1983, 62:1-13).
  • Protein G is useful for all mouse isotypes and for human ⁇ 3 (Guss et al., EMBO J., 1986, 5:1567-1575).
  • the matrix to which the affinity ligand is attached is most often agarose, but other matrices are available.
  • Mechanically stable matrices such as controlled pore glass or poly(styrenedivinyl)benzene allow for faster flow rates and shorter processing times than can be achieved with agarose.
  • the antibody comprises a C H3 domain
  • the BakerBond ABX® resin is useful for purification.
  • the mixture comprising the antibody of interest and contaminants may be subjected to low pH hydrophobic interaction chromatography using an elution buffer at a pH between about 2.5 to about 4.5, generally performed at low salt concentrations (e.g., from about 0 to about 0.25 M salt).
  • Suitable routes of administration include, but are not limited to, the inhalation, intra-arterial, intradermal, intramuscular, intraperitoneal, intravenous, nasal, parenteral, pulmonary, and subcutaneous routes.
  • the pharmaceutical composition may comprise one or more pharmaceutical excipients. Any suitable pharmaceutical excipient may be used, and one of ordinary skill in the art is capable of selecting suitable pharmaceutical excipients. Accordingly, the pharmaceutical excipients provided below are intended to be illustrative, and not limiting. Additional pharmaceutical excipients include, for example, those described in the Handbook of Pharmaceutical Excipients , Rowe et al. (Eds.) 6th Ed. (2009), incorporated by reference in its entirety.
  • the pharmaceutical composition comprises an anti-foaming agent.
  • Any suitable anti-foaming agent may be used.
  • the anti-foaming agent is selected from an alcohol, an ether, an oil, a wax, a silicone, a surfactant, and combinations thereof.
  • the anti-foaming agent is selected from a mineral oil, a vegetable oil, ethylene bis stearamide, a paraffin wax, an ester wax, a fatty alcohol wax, a long chain fatty alcohol, a fatty acid soap, a fatty acid ester, a silicon glycol, a fluorosilicone, a polyethylene glycol-polypropylene glycol copolymer, polydimethylsiloxane-silicon dioxide, ether, octyl alcohol, capryl alcohol, sorbitan trioleate, ethyl alcohol, 2-ethyl-hexanol, dimethicone, oleyl alcohol, simethicone, and combinations thereof.
  • the pharmaceutical composition comprises a cosolvent.
  • cosolvents include ethanol, poly(ethylene) glycol, butylene glycol, dimethylacetamide, glycerin, and propylene glycol.
  • the pharmaceutical composition comprises a buffer.
  • buffers include acetate, borate, carbonate, lactate, malate, phosphate, citrate, hydroxide, diethanolamine, monoethanolamine, glycine, methionine, guar gum, and monosodium glutamate.
  • the pharmaceutical composition comprises a carrier or filler.
  • carriers or fillers include lactose, maltodextrin, mannitol, sorbitol, chitosan, stearic acid, xanthan gum, and guar gum.
  • the pharmaceutical composition comprises a surfactant.
  • surfactants include d-alpha tocopherol, benzalkonium chloride, benzethonium chloride, cetrimide, cetylpyridinium chloride, docusate sodium, glyceryl behenate, glyceryl monooleate, lauric acid, macrogol 15 hydroxystearate, myristyl alcohol, phospholipids, polyoxyethylene alkyl ethers, polyoxyethylene sorbitan fatty acid esters, polyoxyethylene stearates, polyoxylglycerides, sodium lauryl sulfate, sorbitan esters, and vitamin E polyethylene(glycol) succinate.
  • the pharmaceutical composition comprises an anti-caking agent.
  • anti-caking agents include calcium phosphate (tribasic), hydroxymethyl cellulose, hydroxypropyl cellulose, and magnesium oxide.
  • excipients that may be used with the pharmaceutical compositions include, for example, albumin, antioxidants, antibacterial agents, antifungal agents, bioabsorbable polymers, chelating agents, controlled release agents, diluents, dispersing agents, dissolution enhancers, emulsifying agents, gelling agents, ointment bases, penetration enhancers, preservatives, solubilizing agents, solvents, stabilizing agents, and sugars. Specific examples of each of these agents are described, for example, in the Handbook of Pharmaceutical Excipients , Rowe et al. (Eds.) 6th Ed. (2009), The Pharmaceutical Press, incorporated by reference in its entirety.
  • the pharmaceutical composition comprises a solvent.
  • the solvent is saline solution, such as a sterile isotonic saline solution or dextrose solution.
  • the solvent is water for injection.
  • the pharmaceutical compositions are in a particulate form, such as a microparticle or a nanoparticle.
  • Microparticles and nanoparticles may be formed from any suitable material, such as a polymer or a lipid.
  • the microparticles or nanoparticles are micelles, liposomes, or polymersomes.
  • a composition provided herein is a pharmaceutical composition or a single unit dosage form.
  • Pharmaceutical compositions and single unit dosage forms provided herein comprise a prophylactically or therapeutically effective amount of one or more prophylactic or therapeutic antibodies.
  • anhydrous pharmaceutical compositions and dosage forms comprising an antibody, since water can facilitate the degradation of some antibodies.
  • Anhydrous pharmaceutical compositions and dosage forms provided herein can be prepared using anhydrous or low moisture containing ingredients and low moisture or low humidity conditions.
  • Pharmaceutical compositions and dosage forms that comprise lactose and at least one active ingredient that comprises a primary or secondary amine can be anhydrous if substantial contact with moisture and/or humidity during manufacturing, packaging, and/or storage is expected.
  • anhydrous pharmaceutical composition should be prepared and stored such that its anhydrous nature is maintained. Accordingly, anhydrous compositions can be packaged using materials known to prevent exposure to water such that they can be included in suitable formulary kits. Examples of suitable packaging include, but are not limited to, hermetically scaled foils, plastics, unit dose containers (e.g., vials), blister packs, and strip packs.
  • the pharmaceutical composition further comprises one or both of an antibody to an immune inhibitory receptor or ligand and/or an antibody to an immune stimulatory receptor and/or ligand.
  • the pharmaceutical composition further comprises an effective amount of at least one of the following: an anti-ILT2 antibody; an anti-ILT-4 antibody; an anti-ILT4 antibody; an anti-KIR2DL4 antibody; an anti-HLA-E antibody; an anti-NKG2A antibody; an anti-HLA-F antibody; an anti-PD-L1 antibody; an anti-PD-1 antibody; an anti-CTLA4 antibody; an anti-CD38 antibody; an anti-CD73 antibody; an anti-A2A receptor antibody; an anti-A2B receptor antibody; an anti-A2A/A2B dual receptor antibody or a combination thereof; an anti-CD39 antibody; an anti-CD73 antibody; an anti-CD47 antibody; and/or a small molecule inhibitor.
  • the pharmaceutical composition further comprises an anti-Tim-3 antibody: an anti-TIGIT antibody; an anti-Vista antibody; an anti-CD94 antibody; an anti-ILT2 antibody, an anti-ILT4 antibody, an anti-PD-L1 antibody, and/or an anti-CD47 antibody; a small molecule inhibitor; a bi-specific T cell engager, CAR-T therapy, CAR-NK therapy, CAR-Macrophage therapy, engineered cell therapy, and/or adaptive T cell therapy; an oncolytic virus; a chemotherapy; and/or an ADCC capable therapy using effector competent antibodies such as anti-CD19, anti-CD20, anti-EGFR, anti-Her2, anti-SLAMF7, anti-CD52, anti-BCMA, anti-GD2, anti-CD38, and/or anti-CCR4.
  • ADCC capable therapy is enhanced ADCC capable therapy.
  • the effector is enhanced through afucosylation, point mutations, or another method.
  • parenteral dosage forms can be administered to subjects by various routes including, but not limited to, subcutaneous, intravenous (including bolus injection), intramuscular, and intra-arterial. Because their administration typically bypasses subjects' natural defenses against contaminants, parenteral dosage forms are typically, sterile or capable of being sterilized prior to administration to a subject. Examples of parenteral dosage forms include, but are not limited to, solutions ready for injection, dry products ready to be dissolved or suspended in a pharmaceutically acceptable vehicle for injection, suspensions ready for injection, and emulsions.
  • Suitable vehicles that can be used to provide parenteral dosage forms are well known to those skilled in the art. Examples include, but are not limited to: Water for Injection USP; aqueous vehicles such as, but not limited to, Sodium Chloride Injection, Ringer's Injection, Dextrose Injection, Dextrose and Sodium Chloride Injection, and Lactated Ringer's Injection; water miscible vehicles such as, but not limited to, ethyl alcohol, polyethylene glycol, and polypropylene glycol; and non-aqueous vehicles such as, but not limited to, corn oil, cottonseed oil, peanut oil, sesame oil, ethyl oleate, isopropyl myristate, and benzyl benzoate.
  • aqueous vehicles such as, but not limited to, Sodium Chloride Injection, Ringer's Injection, Dextrose Injection, Dextrose and Sodium Chloride Injection, and Lactated Ringer's Injection
  • Excipients that increase the solubility of one or more of the antibodies disclosed herein can also be incorporated into the parenteral dosage forms.
  • the doctor will determine the posology which he considers most appropriate according to a preventive or curative treatment and according to the age, weight, condition and other factors specific to the subject to be treated.
  • the amount of the antibody or composition which will be effective in the prevention or treatment of a disorder or one or more symptoms thereof will vary with the nature and severity of the disease or condition, and the route by which the antibody is administered.
  • the frequency and dosage will also vary according to factors specific for each subject depending on the specific therapy (e.g., therapeutic or prophylactic agents) administered, the severity of the disorder, disease, or condition, the route of administration, as well as age, body, weight, response, and the past medical history of the subject.
  • Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems.
  • exemplary doses of a composition include milligram or microgram amounts of the antibody per kilogram of subject or sample weight (e.g., about 10 micrograms per kilogram to about 50 milligrams per kilogram, about 100 micrograms per kilogram to about 25 milligrams per kilogram, or about 100 microgram per kilogram to about 10 milligrams per kilogram).
  • the dosage of the antibody provided herein, based on weight of the antibody, administered to prevent, treat, manage, or ameliorate a disorder, or one or more symptoms thereof in a subject is 0.1 mg/kg, 1 mg/kg, 2 mg/kg, 3 mg/kg, 4 mg/kg, 5 mg/kg, 6 mg/kg, 10 mg/kg, or 15 mg/kg or more of a subject's body weight.
  • the dosage of the composition or a composition provided herein administered to prevent, treat, manage, or ameliorate a disorder, or one or more symptoms thereof in a subject is 0.1 mg to 200 mg, 0.1 mg to 100 mg, 0.1 mg to 50 mg, 0.1 mg to 25 mg, 0.1 mg to 20 mg, 0.1 mg to 15 mg, 0.1 mg to 10 mg, 0.1 mg to 7.5 mg, 0.1 mg to 5 mg, 0.1 to 2.5 mg, 0.25 mg to 20 mg, 0.25 to 15 mg, 0.25 to 12 mg, 0.25 to 10 mg, 0.25 mg to 7.5 mg, 0.25 mg to 5 mg, 0.25 mg to 2.5 mg, 0.5 mg to 20 mg, 0.5 to 15 mg, 0.5 to 12 mg, 0.5 to 10 mg, 0.5 mg to 7.5 mg, 0.5 mg to 5 mg, 0.5 mg to 2.5 mg, 1 mg to 20 mg, 1 mg to 15 mg, 1 mg to 12 mg, 1 mg to 10 mg, 1 mg to 7.5 mg, 1 mg to 5 mg, or 1 mg to 2.5 mg.
  • the dose can be administered according to a suitable schedule, for example, once, two times, three times, or for times weekly. It may be necessary to use dosages of the antibody outside the ranges disclosed herein in some cases, as will be apparent to those of ordinary skill in the art. Furthermore, it is noted that the clinician or treating physician will know how and when to interrupt, adjust, or terminate therapy in conjunction with subject response.
  • dosage amounts and dose frequency schedules are also encompassed by the herein described dosage amounts and dose frequency schedules.
  • the dosage administered to the subject may be increased to improve the prophylactic or therapeutic effect of the composition or it may be decreased to reduce one or more side effects that a particular subject is experiencing.
  • treatment or prevention can be initiated with one or more loading doses of an antibody or composition provided herein followed by one or more maintenance doses.
  • a dose of an antibody or composition provided herein can be administered to achieve a steady-state concentration of the antibody in blood or serum of the subject.
  • the steady-state concentration can be determined by measurement according to techniques available to those of skill or can be based on the physical characteristics of the subject such as height, weight and age.
  • administration of the same composition may be repeated and the administrations may be separated by at least 1 day, 2 days, 3 days, 5 days, 10 days, 15 days, 30 days, 45 days, 2 months, 75 days, 3 months, or 6 months.
  • administration of the same prophylactic or therapeutic agent may be repeated and the administration may be separated by at least 1 day, 2 days, 3 days, 5 days, 10 days, 15 days, 30 days, 45 days, 2 months, 75 days, 3 months, or 6 months.
  • the antibodies of the invention are administered to a mammal, generally a human, in a pharmaceutically acceptable dosage form such as those known in the art and those discussed above.
  • the antibodies of the invention may be administered to a human intravenously as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intra-cerebrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, or intratumoral routes.
  • the antibodies also are suitably administered by peritumoral, intralesional, or perilesional routes, to exert local as well as systemic therapeutic effects.
  • the intraperitoneal route may be particularly useful, for example, in the treatment of ovarian tumors.
  • the antibodies provided herein may be useful for the treatment of any disease or condition involving HLA-G, such as cancer, autoimmune disease, and infection.
  • any suitable cancer may be treated with the antibodies provided herein.
  • suitable cancers include, for example, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), adrenocortical carcinoma, anal cancer, appendix cancer, astrocytoma, basal cell carcinoma, brain tumor, bile duct cancer, bladder cancer, bone cancer, breast cancer, bronchial tumor, Burkitt Lymphoma, carcinoma of unknown primary origin, cardiac tumor, cervical cancer, chordoma, chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), chronic myeloproliferative neoplasm, colon cancer, colorectal cancer, craniopharyngioma, cutaneous T-cell lymphoma, ductal carcinoma, embryonal tumor, endometrial cancer, ependymoma, esophageal cancer, esthesioneuroblastoma, fibrous histiocytoma, Ewing sar
  • any suitable autoimmune disease may be treated with the antibodies provided herein.
  • suitable autoimmune diseases, or diseases with an autoimmune component include, for example, acute disseminated encephalomyelitis (ADEM), acute necrotizing hemorrhagic leukoencephalitis, Addison's disease, agammaglobulinemia, alopecia areata, amyloidosis, ankylosing spondylitis, anti-GBM/anti-TBM nephritis, antiphospholipid syndrome (APS), autoimmune angioedema, autoimmune aplastic anemia, autoimmune dysautonomia, autoimmune hepatitis, autoimmune hyperlipidemia, autoimmune immunodeficiency, autoimmune inner ear disease (AIED), autoimmune myocarditis, autoimmune oophoritis, autoimmune pancreatitis, autoimmune retinopathy, autoimmune thrombocytopenic purpura (ATP), autoimmune thyroid disease, autoimmune urticarial, axonal &
  • any suitable infection may be treated with the antibodies provided herein.
  • suitable infections include, for example, hepatitis A virus, hepatitis B virus, hepatitis C virus (HCV), human immunodeficiency virus (HIV), and other viral infections.
  • Some embodiments provide for treatment of a subject suffering from cancer, a chronic infection, or from an inflammatory disease, comprising the step of administering to the subject a pharmaceutical composition comprising an effective amount of any of the antibodies set forth herein. Some embodiments provide for treatment of a subject suffering from cancer, a chronic infection, or from an inflammatory disease, comprising the step of administering to the subject a pharmaceutical composition comprising an effective amount of any of the antibodies set forth herein in combination with an effective amount of another antibody set forth herein.
  • the cancer is a hematological cancer.
  • Some embodiments provide a method for modulating immune system function in a subject in need thereof, comprising the step of contacting a population of immune cells of the subject with a pharmaceutical composition comprising an effective amount of the antibody as set forth herein, under conditions such that the immune system is modulated. Some embodiments provide a method for modulating immune system function in a subject in need thereof, comprising the step of contacting a population of immune cells of the subject with an effective amount of any of the antibodies set forth herein in combination with an effective amount of another antibody set forth herein.
  • the antibody comprises a bispecific antibody or a complexing antibody.
  • the bispecific antibody or the complexing antibody is administered in an amount sufficient to achieve 1, 2, 3, 4, 5, 6, 7, or 8 of the following in the subject:
  • the method for modulating immune system function in a subject in need thereof further comprises administering chemotherapy, administering radiation therapy, and/or administering one or more additional therapeutic agents.
  • the one or more additional therapeutic agents comprise one or more immunostimulatory agents.
  • the one or more immunostimulatory agents comprise an antagonist to an inhibitory receptor of an immune cell.
  • the inhibitory receptor is at least one of ILT2, ILT3, ILT4, KIR2DL4, CTLA-4, PD-1, CD39, CD73, PD-L1, PD-L2, LAG-3, TIGIT, B7-H3, B7-H4, Tim3, neuritin, BTLA, CECAM-1, CECAM-5, VISTA, LAIR1, CD160, 2B4, TGF-B, NKG2A, and/or a Killer-cell immunoglobulin-like receptor (KIR).
  • the one or more immunostimulatory agents comprise an agonist of a co-stimulatory receptor of an immune cell.
  • the co-stimulatory receptor comprises one or more of OX40, CD2, CD27, ICAM-1, LFA-1, ICOS (CD278), 4-1BB (CD137), GITR, CD28, CD30, CD40, BAFFR, HVEM, CD7, LIGHT, NKG2C, SLAMF7, NKp30, NKp46, NKp80, CD160, and/or a CD83 ligand.
  • the one or more immunostimulatory agents comprise a cytokine.
  • the cytokine is at least one of IL-1, IL-2, IL-5, IL-7, IL-10, IL-12, IL-15, IL-21, and/or IL-27.
  • the one or more immunostimulatory agents comprise an oncolytic virus.
  • the oncolytic virus comprises one or more of the oncolytic virus is a Herpes simplex virus, a Vesicular stomatitis virus, an adenovirus, a Newcastle disease virus, a vaccinia virus, or a maraba virus.
  • the one or more immunostimulatory agents comprise a chimeric antigen engineered T cell. In some embodiments, immunostimulatory agents comprise a bi- or multi-specific T cell directed antibody. In some embodiments, the one or more immunostimulatory agents comprises or consists of an ADCC competent antibody that may target CD19, CD20, EGFR, Her2, SLAMF7, CD52, BCMA, GD2, CD38, or CCR4. In some embodiments, the ADCC competent antibody is effector enhanced through afucosylation, point mutations, or otherwise.
  • the one or more immunostimulatory agents comprise a bi-specific T cell engager and/or CAR-T therapy, CAR-NK therapy, CAR-macrophage therapy, adoptive T cell therapy.
  • the antibodies provided herein are used in diagnostic applications and/or diagnostic methods.
  • an anti-HLA-G antibody may be useful in assays for HLA-G protein.
  • the antibody can be used to detect the expression of HLA-G in various cells and tissues.
  • the antibody can be used to detect the soluble HLA-G in fluids.
  • the fluids comprise or consist of blood, serum, ascites, and/or other fluids.
  • the assays may be useful, for example, evaluating cancer and autoimmune disease.
  • the diagnostic method comprises or consists of detecting tumor expressed HLA-G. In some embodiments, the diagnostic method comprises or consists of detecting soluble HLA-G. In some embodiments the detection method comprises or consists of detecting HLA-G expression on immune cells.
  • the antibody may be labeled with a detectable moiety. Suitable detectable moieties include, but are not limited to radioisotopes, fluorescent labels, and enzyme-substrate labels.
  • the anti-HLA-G antibody need not be labeled, and the presence thereof can be detected using a labeled antibody which specifically binds to the anti-HLA-G antibody.
  • the antibodies of the invention may be used as affinity purification agents.
  • the antibodies may be immobilized on a solid phase such a resin or filter paper, using methods well known in the art.
  • the immobilized antibody is contacted with a sample containing the HLA-G protein (or fragment thereof) to be purified, and thereafter the support is washed with a suitable solvent that will remove substantially all the material in the sample except the HLA-G protein, which is bound to the immobilized antibody. Finally, the support is washed with another suitable solvent, such as glycine buffer, pH 5.0, that will release the HLA-G protein from the antibody.
  • an anti-HLA-G antibody provided herein is provided in the form of a kit, i.e., a packaged combination of reagents in predetermined amounts with instructions for performing a procedure.
  • the procedure is a diagnostic assay. In other embodiments, the procedure is a therapeutic procedure.
  • the kit further comprises a solvent for the reconstitution of the anti-HLA-G antibody.
  • the anti-HLA-G antibody is provided in the form of a pharmaceutical composition.
  • HLA-G antibodies were selected from a synthetic library of human antibodies presented on the surface of yeast cells in IgG format, as generally described, e.g., in WO2009036379; WO2010105256; WO2012009568; and Xu et al., Protein Eng. Des. Sel., 2013, 26:663-670 (each incorporated by reference in its entirety), and more specifically as provided below.
  • the sequences and characteristics of the antibodies isolated from the recombinant library are provided in Table S.
  • the antigen was biotinylated human HLA-G, decreasing concentrations of antigen were used in each subsequent round of selection.
  • some rounds of selection were employed to reduce the number of non-specific binders utilizing soluble membrane proteins from CHO cells (see WO2014179363 and Xu et al., Protein Eng. Des. Sel., 2013, 26:663-670, each incorporated by reference in its entirety).
  • deselections against recombinant HLA-A/B/C proteins were performed to maintain specific binding to HLA-G. After the final round of sorting, yeast were plated and individual colonies were picked for characterization and for nomination of clones for affinity maturation.
  • Antibody variable domains of interest were synthesized, with codon optimization to maximize transient expression in host cells. The variable regions were cloned into expression vectors containing human immunoglobulin constant domains and their sequence confirmed. Antibody heavy and light chain vector pairings were transfected into Expi293 cells using the Expifectamine system (Invitrogen). Transient cultures were harvested on day 4 and clarified cell culture supernatant IgG titer was estimated using Bio-Layer Interferometry (BLI) using Octet (ForteBio) alongside standards. Antibodies were subsequently purified on a Protein A column and eluted using low pH glycine. Purified antibody samples were then buffer-exchanged or dialyzed into downstream assay-compatible buffers.
  • Antibody purity was assessed by running samples on SDS-PAGE and on an analytical size exclusion chromatography column.
  • Light Chain Shuffling Heavy chain plasmids were extracted from na ⁇ ve outputs (described herein) and transformed into a pre-made na ⁇ ve light chain library with a diversity of 10E+06. Selections were performed as described above with one round of MACS sorting and three rounds of FACS sorting using decreasing amounts of biotinylated HLA-G antigen for respective rounds.
  • CDR-H1 and CDR-H2 Selection The CDR-H3s from clones selected from light chain batch diversification, light chain diversification, and naive discovery efforts were independently recombined into premade libraries with CDR-H1 and CDR-H2 variants of a diversity of >10E+8. Selections were performed using HLA-G antigen. Affinity pressures were applied by using decreasing concentrations of antigen and HLA-G specificity was maintained with deselections against HLA-A/B/C antigens.
  • CDR-H3 Selection After characterization of CDR-H1 and CDR-H2 variants, clones with binding to HLA antigens outside of HLA-G were removed. Chemical liabilities were also removed from the variable regions when applicable. The remaining clones obtained from the CDR-H1 and CDR-H2 selection procedure were subject to additional rounds of affinity maturation via walking dimer mutagenesis of the CDR-H3. Selections were performed using HLA-G as antigen generally as described above, except for employing FACS sorting for all selection rounds.
  • CDR-L1, L2, L3 Selection Clones obtained from the CDR-H1 and CDR-H2 selection procedure were subject to additional rounds of affinity maturation via mutagenesis of the light chain.
  • the CDR-L1 and CDR-L2 diversity was derived from a pre-made library while CDR-L3 diversity was derived from walking monomer mutagenesis. Selections were performed using HLA-G as antigen, starting with one round of MACS followed by three rounds of FACS in the CDR-L1, L2, L3 process described here.
  • Binding kinetics were measured using the Octet Red96 system (Pall ForteBio) at 30° C. in running buffer (1 ⁇ Pall ForteBio Kinetics Buffer diluted into 1 ⁇ PBS pH 7.4).
  • 0.16 ⁇ g % ml of biotinylated recombinant HLA-G/ ⁇ 2m/peptide heterotrimer was loaded onto streptavidin (SA) biosensors to a binding response of approximately 0.25 nm.
  • SA streptavidin
  • the avid K D values ranged from 11.7 nanomolar to sub picomolar with off-rates (k off ) ranging from 0.007 sec ⁇ 1 to the Octet off-rate limit (1.0 ⁇ 10-7 sec ⁇ 1 ).
  • Monovalent K D values ranged from 0.187 nM to 208 nM, but monovalent affinities for clones that had weaker avid affinities were not determined.
  • Epitope binning assays to recombinant HLA-G heterotrimer were determined using the Octet Red96 system (Pall ForteBio) at 30′C in running buffer (1 ⁇ Pall ForteBio Kinetics Buffer diluted into 1 ⁇ PBS pH 7.4). Briefly, 0.16 ⁇ g/ml of biotinylated recombinant HLA-G/ ⁇ 2m/peptide heterotrimer was loaded onto streptavidin (SA) biosensors to a binding response of approximately 0.25 nm. After a short baseline step in running buffer, the biosensor was dipped into 20 ⁇ g/ml of each mAb and continued until the binding response to HLA-G reached saturation. For the competing association step, equimolar concentrations of each mAb to the saturating mAb was used.
  • SA streptavidin
  • Epitope binning was performed in each direction (every mAb was used as both the saturating mAb (association step 1) as well as the competing mAb (association step 2)). Self-blocking sensorgrams are shown in gray. Non-self sensograms are shown in black; black sensorgrams represent the pairwise binning mAb. Sensorgrams from only the second association step were shown in FIG. 2 .
  • FIG. 2A provides biolayer interferometry sensorgrams showing tested antibodies that bind HLA-G can be divided into three distinct chemical bins, with one chemical bin being further divided.
  • Gray sensorgrams indicate self-blocking; black sensorgrams indicate pairwise binning.
  • the y-axis show saturating antibody; the x-axis shows competing antibody.
  • FIG. 2B provides biolayer sensorgrams showing antibodies (Fabs) that bind HLA-G and can be separated into two sub-bins from a broader bin 1.
  • Bin 1a Fabs do not block competing bin 1b Fabs.
  • bin 1b Fabs block bin 1a Fabs.
  • gray sensorograms indicated self-blocking and black sensorograms represent pairwise binning.
  • the y-axis represents the saturating Fab and the x-axis represents the competing Fab.
  • Example 5 Anti-HLA-G Antibodies that Block HLA-G Interaction/Binding to Recombinant ILT2 and ILT4
  • Blocking assays between recombinant HLA-G heterotrimer and recombinant extracellular domain of ILT2 or ILT4 proteins was determined using the Octet Red96 system (Pall ForteBio) at 30° C. in running buffer (1 ⁇ Pall ForteBio Kinetics Buffer diluted into 1 ⁇ PBS pH 7.4). Briefly, 0.16 ⁇ g/ml of biotinylated recombinant HLA-G/2m/peptide heterotrimer was loaded onto streptavidin (SA) biosensors to a binding response of approximately 0.25 nm.
  • SA streptavidin
  • the biosensor was dipped into at least 200 nM of each mAb (up to 0.5 ⁇ M for weakly binding mAbs) and continued until the binding response to HLA-G reached saturation.
  • a second association step immediately followed by dipping into wells containing dimerized ILT2 or ILT4. Dimers were obtained via pre-incubation of the His-tagged ILT2 or ILT4 with anti-His mAb (MAB050, R&D Systems).
  • ILT2/ILT4 binding response to mAb-saturated HLA-G black sensorgrams
  • Sensorgrams from the second association step are shown in FIG. 3 .
  • the provided sensorgrams show antibodies that bind and fully block HLA-G interaction with ILT2 and ILT4, for example, the bin1a and bin1b antibodies 38381 and 38358, respectively.
  • gray sensorgrams indicate ILT2 or ILT4 binding in the absence of antibody; black sensorgrams represent ILT2 or ILT4 binding in the presence of antibody.
  • FIG. 3 also provides biolayer interferometry sensorgrams showing antibodies that bind but do not block HLA-G interaction with ILT2 or ILT4, for example, the bin 3 antibodies such as 33357.
  • Gray sensorgrams indicate ILT2 or ILT4 binding response in the absence of antibody; black sensorgrams indicate ILT2 or ILT4 binding in the presence of antibody.
  • the provided sensorgrams also show antibodies that bind and block HLA-G interaction with ILT2 or ILT4 to an intermediate effect, such as the bin 2 antibody 38389.
  • JEG-3 parentals or HLA-G-knock out (JEG-3 KO) cells were incubated with 100 nM of anti-HLA-G antibodies for 2 hours at 4° C. in wash buffer (Phosphate Buffered Saline (PBS), 2% Fetal bovine serum (FBS) and 2 mM EDTA). Cells were then washed in wash buffer and incubated with an APC conjugated secondary antibody (goat anti-human IgG Kappa) at a 1:500 dilution in wash buffer for 30 minutes at 4° C.
  • wash buffer Phosphate Buffered Saline (PBS), 2% Fetal bovine serum (FBS) and 2 mM EDTA.
  • the results are shown in FIG. 4 .
  • the shaded histogram represents binding of an isotype control to JEG-3 cells at the same concentration.
  • Example 7 Anti-HLA-G Antibodies Abrogate Suppression Mediated Through HLA-G-ILT2 or ILT4 Interaction in NKL Killing Assay
  • NKL (Effector) cells were co-incubated with 721.221 (Target) cells+/ ⁇ HLA-G expression at an E:T ratio of 4:1 overnight at 37° C.
  • 721.221s were pre-incubated with 200 nanomolar (nM) Fab fragments or full-length intact anti-HLA-G antibodies for 60 minutes at 37° C.
  • nM nanomolar
  • 721.221 cells were labelled with 1:1000 CellTrace Violet (CTV) (Invitrogen) in 37° C. PBS.
  • CTV CellTrace Violet
  • Antibody MEM-G/9 is a commercially available antibody (See, Fournel et al., Tissue Antigens 200: 55: 510-518 (1999), which is incorporated by reference in its entirety herein, including any drawings).
  • FIG. 5A (Fab fragments) and FIG. 5B (intact IgG) show the effect on NKL cells that endogenously express ILT2.
  • the percent of dead target cells is shown for each antibody (indicated as a unique clone number in the figure) in addition to control values representing minimum and maximum killing in the presence and absence of HLA-G, respectively.
  • Bin 1 antibodies show the best blockade of all the antibodies tested.
  • FIG. 5C demonstrates the dose response of a specific Bin 1 anti-HLA-G Fab fragment for blockade of HLA-G-mediated suppression of NKL killing through endogenously expressed ILT2.
  • FIG. 5D demonstrates the dose response of a specific Bin 1 anti-HLA-G Fab fragment for blockade of HLA-G-mediated suppression of NKL killing through engineered expression of ILT4 (engineered cell line modified by knocking down ILT2 and retrovirally transduced to express ILT4).
  • Example 8 Fab Fragments of Anti-HLA-G Antibodies Reverse HLA-G Mediated Suppression of Macrophage Phagocytosis, NK Cell Cytotoxicity, and CD8 + T Cell Activity
  • CD14 + enriched cells were differentiated into adherent macrophages by incubating at 37° C., 5% CO 2 for 7 days in complete RPMI (cRPMI) with recombinant human M-CSF. Cells were harvested after 7 days, washed, and resuspended in cRPMI. Cells were plated in a 96-well round bottom plate at 50,000 cells/well in 50 ⁇ l cRPMI and incubated at 37° C., 5% CO 2 , before being combined with the target cells.
  • cRPMI complete RPMI
  • the target cells consisting of either 721.221 parental cells or 721.221-HLA-G, were stained with CTV (1:1000) at 37° C. in PBS, washed and plated in cRPMI at 25,000 cells per well. Cells were subsequently incubated with anti-CD47 antibody with or without anti-HLA-G Fabs for 1 hour at 37° C., 5% CO 2 . The mixture of 721.221 and antibody was then combined with macrophages and incubated for either 2 hours or overnight at 37° C., 5% CO 2 . The final ratio of macrophage to 721.221 target cell was 2:1.
  • macrophages were assayed for the presence of CTV as a readout of phagocytic uptake of CTV + target cells. Live cells were gated on CD11b + /CTV + and reported as a percent of total live macrophages. For the overnight assay, macrophage killing activity was assessed by measuring absolute counts of remaining live CTV + cells per well.
  • FIG. 6A compares results between the two hour and overnight assay formats using an anti-HLA-G antibody (Fab fragment).
  • the overnight assay achieves similar results as the two hour assay that directly measures phagocytosis of target cells.
  • FIG. 6B shows the results of Fab fragments of each anti-HLA-G antibody that were tested in the overnight assay to determine the level of restored phagocytic activity.
  • HLA-G expressing target cells 721.221-HLA-G
  • Fab fragment Bin 1 antibody
  • human primary NK cells Prior to antibody pre-treatment, 721.221 cells were labelled with 1:1000 CellTrace Violet (CTV) (Invitrogen) in 37° C. PBS.
  • CTV CellTrace Violet
  • the results are shown in FIG. 6C .
  • the percent of dead target cells is shown for the Bin 1 antibody (Fab) in addition to control values representing co-cultures with 721.221 target cells with and without HLA-G expression (noted as HLA-G and no HLA-G in figure, respectively).
  • An isotype control Fab (Ctrl Fab) was used as a negative control.
  • FCS data was analyzed using FlowJo version 10 analysis software (FlowJo, LLC). Gates were made to select single cells, live cells, and the cell type of interest.
  • CD8 + T cell populations were defined based on CD8 + ILT2 + or CD8 + ILT2 ⁇ . To determine the percent of cells positive for CD107a, IFN- ⁇ , or TNF- ⁇ , gating was performed on each CD8 + T cell population and determined using fluorescence minus one cells and unstimulated cells.
  • results depicted in FIG. 6D demonstrate that blockade of HLA-G with an anti-HLA-G antibody (representative Bin 1 clone) restored CD107a, IFN- ⁇ , and TNF- ⁇ expression in CD8 + ILT2 + T cells in a dose-dependent manner. There was no effect from HLA-G target cell expression or anti-HLA-G antibody treatment on CD8 + ILT2 ⁇ cells (data not shown).
  • Binding of antibodies to HLA antigens was determined using the LABScreen single antigen class I-combi assay (One Lambda). Antibodies at concentrations greater than 300 nM were incubated with single antigen LABScreen beads in binding buffer (Phosphate Buffered Saline, 10% FBS, 2 mM EDTA) for 45 minutes in the dark at room temperature with gentle shaking. Beads were washed twice with 200 ⁇ L of IX LABScreen wash buffer in a 96-well V-bottom plate by centrifugation at 1500 g and removal of buffer by aspiration.
  • binding buffer Phosphate Buffered Saline, 10% FBS, 2 mM EDTA
  • Antibody 87G is a commercially available antibody and represents a blocking antibody (See, Odum et al., Eur. J. Immunol. 22: 2121-2131 (1991) and Lee et al., Immunity, 591-600 Volume 3, Issue 5 (1995), each of which is incorporated by reference in its entirety herein, including any drawings).
  • Binding of antibodies to physiological levels of native HLA class Ia proteins was assessed by flow cytometry on a collection of twenty-eight B-LCL cell lines (shown in Table X). Cells were obtained from the International Histocompatibility Working Group cell line collection that holds a repository of B-LCL cell lines which have been HLA-typed. The cells were maintained in supplemented RPMI-1640 media containing 15% fetal bovine serum.
  • anti-HLA antibodies were first conjugated to DyLight 650 (Thermo Fisher) by primary amine labeling via the NHS-ester moiety. Unconjugated dye was removed by flowing the antibody preparation through dye removal resin. Conjugation efficiency was between 1 to 3 moles of DyLight 650 per mole of antibody.
  • B-LCL cell lines (ranging from 10,000 to 100,000 cells per well) were incubated with 300 nM of labeled antibodies in cold PBS containing 10% FBS and human Fc block (BD Biosciences). After 2 hours at 4° C., cells were washed twice in cold wash buffer (Phosphate Buffered Saline, 2% FBS, 2 mM EDTA) followed by sample acquisition on a BD FACS Celesta instrument.
  • HLA class I expression To assess overall HLA class I expression, a pan HLA class I antibody, clone W6/32, conjugated to FITC was incubated separately with each individual cell line. All cell lines were strongly positive for class I expression (data not shown). Data was exported as FCS files and analyzed using FlowJo software v10. Gating was performed on live singlet cells using DAPI for live-dead discrimination. Geometric MFI is shown for each B-LCL cell line.
  • Binding levels are provided as geometric MFI. Class I-negative 721.221 cell lines with and without expression of HLA-G were used as controls.
  • 721.221 LCL cells (expressing various point mutants or a domain swap where the primary amino acid sequence encoding the alpha 3 domain was substituted with the analogous sequence from HLA-A*101) were incubated with each antibody (100 nM) in wash buffer (Phosphate Buffered Saline, 2% FBS, 2 mM EDTA) for 60 minutes at 4° C. Cells were then washed with cold wash buffer and incubated with fluorescently labelled secondary antibody at 4° C. for 30 minutes. Numbered antibodies were incubated with 1:500 R-Phycoerythrin labelled goat-anti-human IgG (Jackson ImmunoResearch).
  • FIG. 9A shows the evaluation of HLA-G antibodies binding to various forms of HLA-G after site directed mutagenesis.
  • FIG. 9B provides representative antibody binding histograms for each of the three point mutants (F195S, Y197A, Y197H, E198A).
  • NOD/SCID mice were implanted subcutaneously with 10 million HLA-G expressing 721.221 cells in Matrigel on the right flank.
  • mice were randomized into groups based on tumor volume and dosed intraperitoneally with 300 ⁇ g of either an effector competent anti-HLA-G human IgG1 antibody (hIgG1 WT), the same anti-HLA-G antibody with mutations in the Fe domain to abrogate Fc receptor interactions (hIgG1_AAA), or left untreated.
  • a second dose of antibody was given three days later.
  • Data provided in FIG. 10 represents the percent change in tumor volume six days after initial treatment.
  • Table S provides sequences referred to herein.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Oncology (AREA)
  • Cell Biology (AREA)
  • Urology & Nephrology (AREA)
  • Microbiology (AREA)
  • Epidemiology (AREA)
  • General Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Pathology (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Biotechnology (AREA)
  • Zoology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Virology (AREA)
  • Communicable Diseases (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Neurology (AREA)
  • Rheumatology (AREA)

Abstract

Provided herein are antibodies that selectively bind to HLA-G and compositions comprising the antibodies. Also provided are methods of using the antibodies, such as therapeutic and diagnostic methods.

Description

RELATED APPLICATION
This application claims priority to U.S. provisional application No. 62/737,666, filed Sep. 27, 2018, which is incorporated by reference herein in its entirety.
FIELD
Provided herein are antibodies with binding specificity for HLA-G and compositions comprising the antibodies, including pharmaceutical compositions, diagnostic compositions, and kits. Also provided are methods of using anti-HLA-G antibodies for therapeutic and diagnostic purposes.
BACKGROUND
HLA-G histocompatibility antigen, class I, G, also known as human leukocyte antigen G (HLA-G), is a protein that in humans is encoded by the HLA-G gene. HLA-G belongs to the HLA nonclassical class I heavy chain paralogues. HLA-G is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). There are membrane bound and soluble forms of HLA-G.
HLA-G is normally expressed at the maternal-fetal interface and other immune-privileged sites. HLA-G may play a role in immune tolerance in pregnancy, being expressed in the placenta by extravillous trophoblast cells, while the classical MHC class I genes (HLA-A and HLA-B) are not. As HLA-G was first identified in placenta samples, many studies have evaluated its role in pregnancy disorders, such as preeclampsia and recurrent pregnancy loss. See, Michita, Rafael Tomoyaet al., Human Immunology. 2016, 77 (10): 892-897, which is incorporated by reference herein in its entirety, including any drawings.
HLA-G has been shown to be immune-suppressive. By binding receptors expressed on various myeloid and lymphoid cells. HLA-G may directly inhibit the functions of NK cells, cytotoxic T-lymphocytes, B cells, neutrophils, monocytes, macrophages and dendritic cells. HLA-G also inhibits T and NK cell proliferation and cytolytic activities. HLA-G suppresses phagocytosis and induces the generation or expansion of regulatory T cells.
HLA-G mediates immune function through at least three ITIM-containing inhibitory receptors, ILT2, ILT4, and KIR2DL4. On lymphoid and myeloid cells, for example, HLA-G mediates function through ILT2. On myeloid cells, HLA-G mediates function through ILT4. On decidual NK cells, HLA-G mediates immune function through KIR2DL4 and ILT2.
HLA-G is an immune checkpoint target. HLA-G can directly inhibit immune cell function through receptor binding and/or trogocytosis and impairment of chemotaxis. HLA-G can lend tumor cells a higher invasive and metastatic potential. HLA-G promotes evasion of tumor immune surveillance, and enhances metastasis and the progression of malignancies. During tumor progression HLA-G has other effects, such as, inhibition of immune cell cytolysis, induction of immune cell apoptosis, and/or the generation of regulatory cells through receptor binding and/or trogocytosis.
HLA-G expression is upregulated on a broad spectrum of tumors and is associated with poor prognosis and disease progression. Serum HLA-G levels are elevated in breast, lung, colorectal cancer (CRC), gastric, esophageal, neuroblastoma, cervical, and hematological cancers. HLA-G has also been found to be correlated with clinical parameters in advanced disease, such as, tumor metastasis, poor prognosis, immune escape, and tumor invasiveness.
HLA-G is an attractive target for diseases, such as, for example, cancer.
SUMMARY
Provided herein are antibodies that selectively bind HLA-G. In some embodiments, the antibodies bind human HLA-G. In some embodiments, the antibodies comprise at least one CDR sequence defined by a consensus sequence provided in this disclosure. In some embodiments, the antibodies comprise one or more of an illustrative CDR, VH, or VL sequence provided in this disclosure, or a variant thereof. In some aspects, the variant is a variant with one or more conservative amino acid substitutions.
Also provided are compositions and kits comprising the antibodies. In some embodiments, the compositions are pharmaceutical compositions. Any suitable pharmaceutical composition may be used. In some embodiments, the pharmaceutical composition is a composition for parenteral administration.
This disclosure also provides methods of using the anti-HLA-G antibodies provided herein. In some embodiments, the method is a method of treatment. In some embodiments, the method is an analytical method. In some embodiments, the method is a method of purifying and/or quantifying HLA-G.
In some embodiments, the method is a diagnostic method. In some embodiments, the diagnostic method comprises or consists of detecting tumor expressed HLA-G. In some embodiments, the diagnostic method comprises or consists of detecting soluble HLA-G. In some embodiments, the detection method comprises of consists of detecting HLA-G expression on immune cells.
In some embodiments, the antibodies are used to treat a disease or condition. In some aspects, the disease or condition is selected from a cancer, autoimmune disease, and infection. Some aspects provide for the use of any of the antibodies or pharmaceutical compositions provided herein to treat a disease or condition selected from a cancer, autoimmune disease, and infection.
BRIEF DESCRIPTION OF THE DRAWINGS
FIG. 1 provides a table showing avid and monomeric affinities of anti-HLA-G antibodies to recombinant HLA-G protein.
FIG. 2A and FIG. 2B provide biolayer interferometry sensorgrams showing anti-HLA-G antibodies that bind to HLA-G and can be separated into three biochemical bins based on their ability to cross-block each other when tested for binding in pairwise fashion.
FIG. 3 provide biolayer interferometry sensorgrams showing antibodies that bind and block HLA-G interaction with ILT2 and ILT4 at varying levels of effectiveness.
FIG. 4 shows evaluation of anti-HLA-G antibodies binding to naturally expressed HLA-G found on JEG-3 tumor cells.
FIG. 5A, FIG. 5B, FIG. 5C, and FIG. 5D provide data showing anti-HLA-G Fabs and antibodies that restore NKL killing activity by blocking suppression mediated through interaction of HLA-G with ILT2 or ILT4.
FIG. 6A. FIG. 6B, FIG. 6C, and FIG. 6D provides evaluation of anti-HLA-G antibodies to reverse HLA-G mediated suppression of primary human cells. FIG. 6A and FIG. 6B provide evaluation of phagocytosis in a human macrophage assay. FIG. 6C provides evaluation of primary human NK cell cytotoxic activity. FIG. 6D provides evaluation of primary human CD8+ T cell function.
FIG. 7A and FIG. 7B shows results representing values for binding of anti-HLA-G antibodies to individual recombinant HLA class Ia antigens immobilized on beads.
FIG. 8 shows the evaluation of anti-HLA-G antibodies binding to a panel of 28 HLA-typed B-LCL lines.
FIG. 9A and FIG. 9B show the evaluation of anti-HLA-G antibodies binding to various forms of HLA-G after site-directed mutagenesis.
FIG. 10 provides evidence for tumor growth inhibition by an anti-HLA-G antibody with and Fe effector function in a mouse tumor xenograft tumor model using 721.221 cells expressing HLA-G.
DETAILED DESCRIPTION 1. Definitions
Unless otherwise defined, all terms of art, notations and other scientific terminology used herein are intended to have the meanings commonly understood by those of skill in the art to which this invention pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and/or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a difference over what is generally understood in the art. The techniques and procedures described or referenced herein are generally well understood and commonly employed using conventional methodologies by those skilled in the art, such as, for example, the widely utilized molecular cloning methodologies described in Sambrook et al., Molecular Cloning: A Laboratory Manual 2nd ed. (1989) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. As appropriate, procedures involving the use of commercially available kits and reagents are generally carried out in accordance with manufacturer defined protocols and/or parameters unless otherwise noted.
As used herein, the singular forms “a,” “an,” and “the” include the plural referents unless the context clearly indicates otherwise.
The term “about” indicates and encompasses an indicated value and a range above and below that value. In certain embodiments, the term “about” indicates the designated value±10%, ±5%, or ±1%. In certain embodiments, the term “about” indicates the designated value±one standard deviation of that value.
The term “combinations thereof” includes every possible combination of elements to which the term refers.
The term “immunoglobulin” refers to a class of structurally related proteins generally comprising two pairs of polypeptide chains: one pair of light (L) chains and one pair of heavy (H) chains. In an “intact immunoglobulin,” all four of these chains are interconnected by disulfide bonds. The structure of immunoglobulins has been well characterized. See, e.g., Paul, Fundamental Immunology 7th ed., Ch. 5 (2013) Lippincott Williams & Wilkins, Philadelphia, Pa. Briefly, each heavy chain typically comprises a heavy chain variable region (VH) and a heavy chain constant region (CH). The heavy chain constant region typically comprises three domains, CH1, CH2, and CH3. Each light chain typically comprises a light chain variable region (VL) and a light chain constant region. The light chain constant region typically comprises one domain, abbreviated CL.
The term “antibody” describes a type of immunoglobulin molecule and is used herein in its broadest sense. An antibody specifically includes intact antibodies (e.g., intact immunoglobulins), and antibody fragments and antigen binding proteins. Antibodies comprise at least one antigen-binding domain. One example of an antigen-binding domain is an antigen binding domain formed by a VH-VL dimer. An “HLA-G antibody,” “anti-HLA-G antibody,” “HLA-G Ab,” “HLA-G-specific antibody,” or “anti-HLA-G Ab” is an antibody, as described herein, which binds specifically to the antigen HLA-G.
The VH and VL regions may be further subdivided into regions of hypervariability (“hypervariable regions (HVRs);” also called “complementarity determining regions” (CDRs)) interspersed with regions that are more conserved. The more conserved regions are called framework regions (FRs). Each VH and VL generally comprises three CDRs and four FRs, arranged in the following order (from N-terminus to C-terminus): FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4. The CDRs are involved in antigen binding, and confer antigen specificity and binding affinity to the antibody. See Kabat et al., Sequences of Proteins of Immunological Interest 5th ed. (1991) Public Health Service, National Institutes of Health, Bethesda, Md., incorporated by reference in its entirety.
The light chain from any vertebrate species can be assigned to one of two types, called kappa and lambda, based on the sequence of the constant domain.
The heavy chain from any vertebrate species can be assigned to one of five different classes (or isotypes): IgA, IgD, IgE, IgG, and IgM. These classes are also designated α, δ, ε, γ, and μ, respectively. The IgG and IgA classes are further divided into subclasses on the basis of differences in sequence and function. Humans express the following subclasses: IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2.
The amino acid sequence boundaries of a CDR can be determined by one of skill in the art using any of a number of known numbering schemes, including those described by Kabat et al., supra (“Kabat” numbering scheme); Al-Lazikani et al., 1997, J. Mol. Biol., 273:927-948 (“Chothia” numbering scheme); MacCallum et al., 1996, J. Mol. Biol. 262:732-745 (“Contact” numbering scheme); Lefranc et al., Dev. Comp. Immunol., 2003, 27:55-77 (“IMGT” numbering scheme); and Honegge and Plückthun, J. Mol. Biol., 2001, 309:657-70 (“AHo” numbering scheme), each of which is incorporated by reference in its entirety.
Table 1 provides the positions of CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, and CDR-H3 as identified by the Kabat and Chothia schemes. For CDR-H1, residue numbering is provided using both the Kabat and Chothia numbering schemes.
Unless otherwise specified, the numbering scheme used for identification of a particular CDR herein is the Kabat/Chothia numbering scheme. Where the residues encompassed by these two numbering schemes diverge, the numbering scheme is specified as either Kabat or Chothia.
TABLE 1
Residues in CDRs according to Kabat
and Chothia numbering schemes.
CDR Kabat Chothia
L1 L24-L34 L24-L34
L2 L50-L56 L50-L56
L3 L89-L97 L89-L97
H1 (Kabat Numbering) H31-H35B H26-H32 or H34*
H1 (Chothia Numbering) H31-H35 H26-H32
H2 H50-H65 H52-H56
H3 H95-H102 H95-H102
*The C-terminus of CDR-H1, when numbered using the Kabat numbering convention, varies between H32 and H34, depending on the length of the CDR.
The “EU numbering scheme” is generally used when referring to a residue in an antibody heavy chain constant region (e.g., as reported in Kabat et al., supra). Unless stated otherwise, the EU numbering scheme is used to refer to residues in antibody heavy chain constant regions described herein.
An “antibody fragment” comprises a portion of an intact antibody, such as the antigen binding or variable region of an intact antibody. Antibody fragments include, for example, Fv fragments, Fab fragments, F(ab′)2 fragments, Fab′ fragments, scFv (sFv) fragments, and scFv-Fc fragments.
“Fv” fragments comprise a non-covalently-linked dimer of one heavy chain variable domain and one light chain variable domain.
“Fab” fragments comprise, in addition to the heavy and light chain variable domains, the constant domain of the light chain and the first constant domain (Cm) of the heavy chain. Fab fragments may be generated, for example, by papain digestion of a full-length antibody.
“F(ab′)2” fragments contain two Fab′ fragments joined, near the hinge region, by disulfide bonds. F(ab′)2 fragments may be generated, for example, by pepsin digestion of an intact antibody. The F(ab′) fragments can be dissociated, for example, by treatment with β-mercaptoethanol.
“Single-chain Fv” or “sFv” or “scFv” antibody fragments comprise a VH domain and a VL domain in a single polypeptide chain. The VH and VL are generally linked by a peptide linker. See Plückthun A. (1994). Antibodies from Escherichia coli. In Rosenberg M. & Moore G. P. (Eds.), The Pharmacology of Monoclonal Antibodies vol. 113 (pp. 269-315). Springer-Verlag, New York, incorporated by reference in its entirety. “scFv-Fc” fragments comprise an scFv attached to an Fc domain. For example, an Fc domain may be attached to the C-terminal of the scFv. The Fc domain may follow the VH or VL, depending on the orientation of the variable domains in the scFv (i.e., VH-VL or VL-VH). Any suitable Fc domain known in the art or described herein may be used.
The term “monoclonal antibody” refers to an antibody from a population of substantially homogeneous antibodies. A population of substantially homogeneous antibodies comprises antibodies that are substantially similar and that bind the same epitope(s), except for variants that may normally arise during production of the monoclonal antibody. Such variants are generally present in only minor amounts. A monoclonal antibody is typically obtained by a process that includes the selection of a single antibody from a plurality of antibodies. For example, the selection process can be the selection of a unique clone from a plurality of clones, such as a pool of hybridoma clones, phage clones, yeast clones, bacterial clones, or other recombinant DNA clones. The selected antibody can be further altered, for example, to improve affinity for the target (“affinity maturation”), to humanize the antibody, to improve its production in cell culture, and/or to reduce its immunogenicity in a subject.
The term “chimeric antibody” refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
“Humanized” forms of non-human antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody. A humanized antibody is generally a human immunoglobulin (recipient antibody) in which residues from one or more CDRs are replaced by residues from one or more CDRs of a non-human antibody (donor antibody). The donor antibody can be any suitable non-human antibody, such as a mouse, rat, rabbit, chicken, or non-human primate antibody having a desired specificity, affinity, or biological effect. In some instances, selected framework region residues of the recipient antibody are replaced by the corresponding framework region residues from the donor antibody. Humanized antibodies may also comprise residues that are not found in either the recipient antibody or the donor antibody. Such modifications may be made to further refine antibody function. For further details, see Jones et al., Nature, 1986, 321:522-525; Riechmann et al., Nature, 1988, 332:323-329; and Presta, Curr. Op. Struct. Biol., 1992, 2:593-596, each of which is incorporated by reference in its entirety.
A “human antibody” is one which possesses an amino acid sequence corresponding to that of an antibody produced by a human or a human cell, or derived from a non-human source that utilizes a human antibody repertoire or human antibody-encoding sequences (e.g., obtained from human sources or designed de novo). Human antibodies specifically exclude humanized antibodies.
An “isolated antibody” is one that has been separated and/or recovered from a component of its natural environment. Components of the natural environment may include enzymes, hormones, and other proteinaceous or nonproteinaceous materials. In some embodiments, an isolated antibody is purified to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence, for example by use of a spinning cup sequenator. In some embodiments, an isolated antibody is purified to homogeneity by gel electrophoresis (e.g., SDS-PAGE) under reducing or nonreducing conditions, with detection by Coomassie blue or silver stain. An isolated antibody includes an antibody in situ within recombinant cells, since at least one component of the antibody's natural environment is not present. In some aspects, an isolated antibody is prepared by at least one purification step.
In some embodiments, an isolated antibody is purified to at least 80%, 85%, 90%, 95%, or 99% by weight. In some embodiments, an isolated antibody is provided as a solution comprising at least 85%, 90%, 95%, 98%, 99% to 100% by weight of an antibody, the remainder of the weight comprising the weight of other solutes dissolved in the solvent.
“Affinity” refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity, which reflects a 1:1 interaction between members of a binding pair (e.g., antibody and antigen). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (KD). Affinity can be measured by common methods known in the art, including those described herein. Affinity can be determined, for example, using surface plasmon resonance (SPR) technology, such as a Biacore® instrument, or using bio-layer interferometry technology, such as an Octet® instrument.
With regard to the binding of an antibody to a target molecule, the terms “specific binding,” “specifically binds to,” “specific for,” “selectively binds.” and “selective for” a particular antigen (e.g., a polypeptide target) or an epitope on a particular antigen mean binding that is measurably different from a non-specific or non-selective interaction. Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule. Specific binding can also be determined by competition with a control molecule that is similar to the target, such as an excess of non-labeled target. In that case, specific binding is indicated if the binding of the labeled target to a probe is competitively inhibited by the excess non-labeled target.
The term “kd” (sec−1), as used herein, refers to the dissociation rate constant of a particular antibody-antigen interaction. This value is also referred to as the koff value.
The term “ka” (M−1×sec−1), as used herein, refers to the association rate constant of a particular antibody-antigen interaction. This value is also referred to as the kon value.
The term “KD” (M), as used herein, refers to the dissociation equilibrium constant of a particular antibody-antigen interaction. KD=kd/ka.
The term “KA” (M−1), as used herein, refers to the association equilibrium constant of a particular antibody-antigen interaction. KA=ka/kd.
An “affinity matured” antibody is one with one or more alterations in one or more CDRs or FRs that result in an improvement in the affinity of the antibody for its antigen, compared to a parent antibody which does not possess the alteration(s). In one embodiment, an affinity matured antibody has nanomolar or picomolar affinity for the target antigen. Affinity matured antibodies may be produced using a variety of methods known in the art. For example. Marks et al. (Bio/Technology, 1992, 10:779-783, incorporated by reference in its entirety) describes affinity maturation by VH and VL domain shuffling. Random mutagenesis of CDR and/or framework residues is described by, for example, Barbas et al. (Proc. Nat. Acad. Sci. U.S.A., 1994, 91:3809-3813); Schier et al., Gene, 1995, 169:147-155; Yelton et al., J. Immunol., 1995, 155:1994-2004: Jackson et al., J. Immunol., 1995, 154:3310-33199; and Hawkins et al, J. Mol. Biol., 1992, 226:889-896, each of which is incorporated by reference in its entirety.
When used herein in the context of two or more antibodies, the term “competes with” or “cross-competes with” indicates that the two or more antibodies compete for binding to an antigen (e.g., HLA-G). In one exemplary assay, HLA-G is coated on a plate and allowed to bind a first antibody, after which a second, labeled antibody is added. If the presence of the first antibody reduces binding of the second antibody, then the antibodies compete. The term “competes with” also includes combinations of antibodies where one antibody reduces binding of another antibody, but where no competition is observed when the antibodies are added in the reverse order. However, in some embodiments, the first and second antibodies inhibit binding of each other, regardless of the order in which they are added. In some embodiments, one antibody reduces binding of another antibody to its antigen by at least 50%, at least 60%, at least 70%, at least 80%, or at least 900%.
The term “epitope” means a portion of an antigen capable of specific binding to an antibody. Epitopes frequently consist of surface-accessible amino acid residues and/or sugar side chains and may have specific three-dimensional structural characteristics, as well as specific charge characteristics. Conformational and non-conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents. An epitope may comprise amino acid residues that are directly involved in the binding, and other amino acid residues, which are not directly involved in the binding. The epitope to which an antibody binds can be determined using known techniques for epitope determination such as, for example, testing for antibody binding to HLA-G variants with different point-mutations.
Percent “identity” between a polypeptide sequence and a reference sequence, is defined as the percentage of amino acid residues in the polypeptide sequence that are identical to the amino acid residues in the reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, MEGALIGN (DNASTAR), CLUSTALW, or CLUSTAL OMEGA software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
A “conservative substitution” or a “conservative amino acid substitution,” refers to the substitution of one or more amino acids with one or more chemically or functionally similar amino acids. Conservative substitution tables providing similar amino acids are well known in the art. Polypeptide sequences having such substitutions are known as “conservatively modified variants.” By way of example, the following groups of amino acids are considered conservative substitutions for one another.
Acidic Residues D and E
Basic Residues K, R, and H
Hydrophilic Uncharged Residues S, T, N, and Q
Aliphatic Uncharged Residues G, A, V, L, and I
Non-polar Uncharged Residues C, M, and P
Aromatic Residues F, Y, and W
Alcohol Group-Containing S and T
Residues
Aliphatic Residues I, L, V, and M
Cycloalkenyl-associated Residues F, H, W, and Y
Hydrophobic Residues A, C, F, G, H, I, L, M, V, W, and Y
Negatively Charged Residues D and E
Polar Residues C, D, E, H, K, N, Q, R, S, and T
Positively Charged Residues H, K, and R
Small Residues A, C, D, G, N, P, S, T, and V
Very Small Residues A, G, and S
Residues Involved in Turn A, C, D, E, G, H, K, N, Q, R, S,
Formation P and T
Flexible Residues Q, T, K, S, G, P, D, E, and R
Group 1 A, S, and T
Group 2 D and E
Group 3 N and Q
Group 4 R and K
Group 5 I, L, and M
Group 6 F, Y, and W
Group A A and G
Group B D and E
Group C N and Q
Group D R, K, and H
Group E I, L, M, V
Group F F, Y, and W
Group G S and T
Group H C and M

Additional conservative substitutions may be found, for example, in Creighton, Proteins: Structures and Molecular Properties 2nd ed. (1993) W. H. Freeman & Co., New York, N.Y. An antibody generated by making one or more conservative substitutions of amino acid residues in a parent antibody is referred to as a “conservatively modified variant.”
The term “amino acid” refers to the twenty common naturally occurring amino acids. Naturally occurring amino acids include alanine (Ala; A), arginine (Arg; R), asparagine (Asn; N), aspartic acid (Asp; D), cysteine (Cys; C); glutamic acid (Glu; E), glutamine (Gin; Q), Glycine (Gly; G); histidine (His; H), isoleucine (Ile; I), leucine (Leu; L), lysine (Lys; K), methionine (Met; M), phenylalanine (Phe; F), proline (Pro; P), serine (Ser; S), threonine (Thr, T), tryptophan (Trp; W), tyrosine (Tyr; Y), and valine (Val; V).
“Treating” or “treatment” of any disease or disorder refers, in certain embodiments, to ameliorating a disease or disorder that exists in a subject. In another embodiment, “treating” or “treatment” includes ameliorating at least one physical parameter, which may be indiscernible by the subject. In yet another embodiment, “treating” or “treatment” includes modulating the disease or disorder, either physically (e.g., stabilization of a discernible symptom) or physiologically (e.g., stabilization of a physical parameter) or both. In yet another embodiment, “treating” or “treatment” includes delaying or preventing the onset of the disease or disorder.
As used herein, the term “therapeutically effective amount” or “effective amount” refers to an amount of an antibody or composition that when administered to a subject is effective to treat a disease or disorder.
As used herein, the term “subject” means a mammalian subject. Exemplary subjects include, but are not limited to humans, monkeys, dogs, cats, mice, rats, cows, horses, camels, avians, goats and sheep. In certain embodiments, the subject is a human. In some embodiments, the subject has cancer, an autoimmune disease or condition, and/or an infection that can be treated with an antibody provided herein. In some embodiments, the subject is a human that is suspected to have cancer, an autoimmune disease or condition, and/or an acute infection and chronic infection.
2. Antibodies
Provided herein are antibodies that selectively bind human HLA-G. In some aspects, the antibody selectively binds to the extracellular domain of human HLA-G.
In some embodiments, the antibody has one or more CDRs having particular lengths, in terms of the number of amino acid residues. In some embodiments, the Chothia CDR-H1 of the antibody is 6, 7, 8, or 9 residues in length. In some embodiments, the Kabat CDR-H1 of the antibody is 4, 5, 6, or 7 residues in length. In some embodiments, the Chothia CDR-H2 of the antibody is 5, 6, or 7 residues in length. In some embodiments, the Kabat CDR-H2 of the antibody is 15, 16, 17, or 18 residues in length. In some embodiments, the Kabat/Chothia CDR-H3 of the antibody is 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 residues in length.
In some aspects, the Kabat/Chothia CDR-L1 of the antibody is 9, 10, 11, 12, 13, 14, 15, or 16 residues in length. In some aspects, the Kabat/Chothia CDR-L2 of the antibody is 6, 7, or 8 residues in length. In some aspects, the Kabat/Chothia CDR-L3 of the antibody is 8, 9, 10, 1, or 12 residues in length.
In some embodiments, the antibody comprises a light chain. In some aspects, the light chain is a kappa light chain. In some aspects, the light chain is a lambda light chain.
In some embodiments, the antibody comprises a heavy chain. In some aspects, the heavy chain is an IgA. In some aspects, the heavy chain is an IgD. In some aspects, the heavy chain is an IgE. In some aspects, the heavy chain is an IgG. In some aspects, the heavy chain is an IgM. In some aspects, the heavy chain is an IgG1. In some aspects, the heavy chain is an IgG2. In some aspects, the heavy chain is an IgG3. In some aspects, the heavy chain is an IgG4. In some aspects, the heavy chain is an IgA1. In some aspects, the heavy chain is an IgA2.
In some embodiments, the antibody is an antibody fragment. In some aspects, the antibody fragment is an Fv fragment. In some aspects, the antibody fragment is a Fab fragment. In some aspects, the antibody fragment is a F(ab′)2 fragment. In some aspects, the antibody fragment is a Fab′ fragment. In some aspects, the antibody fragment is an scFv (sFv) fragment. In some aspects, the antibody fragment is an scFv-Fc fragment.
In some embodiments, the antibody is a monoclonal antibody. In some embodiments, the antibody is a polyclonal antibody.
In some embodiments, the antibody is a chimeric antibody. In some embodiments, the antibody is a humanized antibody. In some embodiments, the antibody is a human antibody.
In some embodiments, the antibody is an affinity matured antibody. In some aspects, the antibody is an affinity matured antibody derived from an illustrative sequence provided in this disclosure.
In some embodiments, the antibody blocks HLA-G interaction and/or binding to an ITIM inhibitory receptor. In some embodiments, the antibody blocks HLA-G interaction and/or binding to ILT2. In some embodiments, the antibody blocks HLA-G interaction and/or binding to ILT4. In some embodiments, the antibody blocks HLA-G interaction and/or binding to KIR2DL4. In embodiments, the antibody binds HLA-G but does not block the interaction between HLA-G and ILT2, ILT4, and/or KIRDL4. In some embodiments, the antibody disrupts HLA-G heterodimer and/or prevents dimerization of HLA-G.
In some embodiments, the antibody inhibits immune suppressive function. In some embodiments, the antibody inhibits HLA-G mediated suppression of NK cells. In some embodiments, the antibody inhibits HLA-G mediated suppression of cytotoxic T lymphocytes. In some embodiments, the antibody inhibits HLA-G mediated suppression of B cells. In some embodiments, the antibody inhibits HLA-G mediated suppression of neutrophils. In some embodiments, the antibody inhibits HLA-G mediated suppression of dendritic cells. In some embodiments, the antibody inhibits HLA-G mediated suppression of macrophages. In some embodiments, the antibody inhibits HLA-G mediated suppression of monocytes. In some embodiments, the antibody inhibits HLA-G mediated suppression of NK and/or T cell cytolysis and/or proliferation.
In some embodiments, the antibody prevents or inhibits HLA-G mediated suppression of phagocytosis. In some embodiments, the antibody mediates HLA-G mediated induction of T regulatory cells. In some embodiments, the antibody prevents or inhibits the generation or expansion of regulatory T cells.
The antibodies provided herein may be useful for the treatment of a variety of diseases and conditions, including cancers, autoimmune diseases, and infections. In some embodiments, the antibody inhibits HLA-G function on tumor cells. In some embodiments, the antibody inhibits HLA-G function on immune cells. In some embodiments, the antibody inhibits HLA-G function on myeloid cells. In some embodiments, the antibody inhibits HLA-G function on Tcell subsets. In some embodiments, the antibody inhibits metastasis. In some embodiments, the antibody inhibits angiogenesis.
In some embodiments, the antibody competes or is capable of competing for binding to human HLA-G with another antibody. In some embodiments, the antibody comprises or consists an antibody that is capable of competing for binding to human HLA-G with a reference antibody, wherein the reference antibody binds to an epitope comprising position 195, 197, and/or 198 of SEQ ID NO: 342 on a human HLA-G polypeptide. In some embodiments, the antibody and the reference antibody cross-compete or are capable of cross-competing for binding to human HLA-G with another antibody.
In some embodiments, the antibody binds to an epitope comprising position 195, 197, and/or 198 of SEQ ID NO: 342 on a human HLA-G polypeptide. In some aspects, the epitope comprises or consists of a contiguous or non-contiguous span of amino acids including residues 195, 197, and/or 198 of the sequence set forth in SEQ ID NO: 342. In some aspects, the epitope comprises a sequence that is identical or corresponds to residues 195, 197, and/or 198 of a sequence that is within the sequence set forth in SEQ ID NO: 342. In some aspects, the epitope has a sequence that has a 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% identity to a sequence that is within the sequence set forth in SEQ ID NO: 342. In some aspects, the epitope has 1, 2, 3, 4, 5, 6, 7, 8, or 9 substitutions from a sequence that is within the sequence set forth in forth in SEQ ID NO: 342. In some aspects, the epitope has 1, 2, or 3 substitutions from residues a sequence that is within the sequence set forth in SEQ ID NO: 342. In some aspects, the antibody makes contact with any of the residues set forth in FIG. 9.
2.1. CDR-H3 Sequences
In some embodiments, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 76. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 77. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 78. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 79. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 80. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 81. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 82. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 83. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 84. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 85. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 86. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 87. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 88. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 89. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 90. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 91. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 92. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 93. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 94. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 95. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 96. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 97. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 98. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 99. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 100. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 101.
In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-H3 sequence provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-H3 sequences provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.2. VH Sequences Comprising Illustrative CDRs
In some embodiments, the antibody comprises a VH sequence comprising one or more CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative CDR-H sequences provided in this disclosure, and variants thereof.
2.2.1. VH Sequences Comprising Illustrative Kabat CDRs
In some embodiments, the antibody comprises a VH sequence comprising one or more Kabat CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative Kabat CDR-H sequences provided in this disclosure, and variants thereof.
2.2.1.1. Kabat CDR-H3
In some embodiments, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 76. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 77. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 78. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 79. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 80. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 81. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 82. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 83. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 84. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 85. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 86. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 87. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 88. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 89. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 90. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 91. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 92. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 94. In some aspects, the antibody comprises a VF sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 95. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising consisting of, or consisting essentially of SEQ ID NO: 96. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 97. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 98. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 99. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 100. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 101.
2.2.1.2. Kabat CDR-H2
In some embodiments, the antibody comprises a VH sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 54-71. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 54. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 55. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 56. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 57. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 58. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 59. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 60. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 61. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 62. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 63. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 64. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 65. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 66. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 67. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 68. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 69. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 70. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 71.
2.2.1.3. Kabat CDR-H1
In some embodiments, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 18-34. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 18. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 19. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 20. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 21. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 22. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 23. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 24. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 25. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 26. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 27. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 28. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 29. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 30. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 31. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 32. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 33. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 34.
2.2.1.4. Kabat CDR-H3+Kabat CDR-H2
In some embodiments, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101, and a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 54-71. In some aspects, the Kabat CDR-H3 sequence and the Kabat CDR-H2 sequence are both from a single illustrative VH sequence provided in this disclosure. For example, in some aspects, the Kabat CDR-H3 and Kabat CDR-H2 are both from a single illustrative VH sequence selected from SEQ ID NOS: 170-200.
2.2.1.5. Kabat CDR-H3+Kabat CDR-H1
In some embodiments, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101, and a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 18-34. In some aspects, the Kabat CDR-H3 sequence and the Kabat CDR-H1 sequence are both from a single illustrative VH sequence provided in this disclosure. For example, in some aspects, the Kabat CDR-H3 and Kabat CDR-H1 are both from a single illustrative VH sequence selected from SEQ ID NOS: 170-200.
2.2.1.6. Kabat CDR-H1+Kabat CDR-H2
In some embodiments, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 18-34 and a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 54-71. In some aspects, the Kabat CDR-H1 sequence and the Kabat CDR-H2 sequence are both from a single illustrative VH sequence provided in this disclosure. For example, in some aspects, the Kabat CDR-H1 and Kabat CDR-H2 are both from a single illustrative VH sequence selected from SEQ ID NOS: 170-200.
2.2.1.7. Kabat CDR-H1+Kabat CDR-H2+Kabat CDR-H3
In some embodiments, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 18-34, a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 54-71, and a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101. In some aspects, the Kabat CDR-H1 sequence, Kabat CDR-H2 sequence, and Kabat CDR-H3 sequence are all from a single illustrative VH sequence provided in this disclosure. For example, in some aspects, the Kabat CDR-H1, Kabat CDR-H2, and Kabat CDR-H3 are all from a single illustrative VH sequence selected from SEQ ID NOS: 170-200.
In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 18, a Kabat CDR-H2 sequence comprising SEQ ID NO: 54, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 76. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 19, a Kabat CDR-H2 sequence comprising SEQ ID NO: 55, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 77. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 20, a Kabat CDR-H2 sequence comprising SEQ ID NO: 56, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 78. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 21, a Kabat CDR-H2 sequence comprising SEQ ID NO: 57, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 79. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 22, a Kabat CDR-H2 sequence comprising SEQ ID NO: 58, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 80. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 21, a Kabat CDR-H2 sequence comprising SEQ ID NO: 57, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 76. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 59, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 76. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 60, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 81. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 59, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 82. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 59, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 76. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 59, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 81. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 21, a Kabat CDR-H2 sequence comprising SEQ ID NO: 57, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 83. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 21, a Kabat CDR-H2 sequence comprising SEQ ID NO: 57, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 84. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 24, a Kabat CDR-H2 sequence comprising SEQ ID NO: 61, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 85. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 24, a Kabat CDR-H2 sequence comprising SEQ ID NO: 61, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 86. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 25, a Kabat CDR-H2 sequence comprising SEQ ID NO: 62, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 63, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 88. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 63, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 89. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 25, a Kabat CDR-H2 sequence comprising SEQ ID NO: 63, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 90. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 27, a Kabat CDR-H2 sequence comprising SEQ ID NO: 64, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 90. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 28, a Kabat CDR-H2 sequence comprising SEQ ID NO: 62, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 91. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 29, a Kabat CDR-H2 sequence comprising SEQ ID NO: 64, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 92. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 25, a Kabat CDR-H2 sequence comprising SEQ ID NO: 65, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 93. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 30, a Kabat CDR-H2 sequence comprising SEQ ID NO: 66, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 94. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 31, a Kabat CDR-H2 sequence comprising SEQ ID NO: 67, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 95. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 32, a Kabat CDR-H2 sequence comprising SEQ ID NO: 68, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 96. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 33, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 97. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 34, a Kabat CDR-H2 sequence comprising SEQ ID NO: 70, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 98. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 18, a Kabat CDR-H2 sequence comprising SEQ ID NO: 54, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 99. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 31, a Kabat CDR-H2 sequence comprising SEQ ID NO: 71, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 100. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 24, a Kabat CDR-H2 sequence comprising SEQ ID NO: 61, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 101.
2.2.1.8. Variants of VH Sequences Comprising Illustrative Kabat CDRs
In some embodiments, the VH sequences provided herein comprise a variant of an illustrative Kabat CDR-H3, CDR-H2, and/or CDR-H1 sequence provided in this disclosure.
In some aspects, the Kabat CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative Kabat CDR-H3 sequence provided in this disclosure. In some aspects, the Kabat CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Kabat CDR-H3 sequences provided in this disclosure. In some aspects, the Kabat CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative Kabat CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the Kabat CDR-H2 sequence comprises, consists of, or consists essentially of a variant of an illustrative Kabat CDR-H2 sequence provided in this disclosure. In some aspects, the Kabat CDR-H2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Kabat CDR-H2 sequences provided in this disclosure. In some aspects, the Kabat CDR-H2 sequence comprises, consists of, or consists essentially of any of the illustrative Kabat CDR-H2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the Kabat CDR-H1 sequence comprises, consists of, or consists essentially of a variant of an illustrative Kabat CDR-H1 sequence provided in this disclosure. In some aspects, the Kabat CDR-H1 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Kabat CDR-H1 sequences provided in this disclosure. In some aspects, the Kabat CDR-H1 sequence comprises, consists of, or consists essentially of any of the illustrative Kabat CDR-H1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.2.2. VH Sequences Comprising Illustrative Chothia CDRs
In some embodiments, the antibody comprises a VH sequence comprising one or more Chothia CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative Chothia CDR-H sequences provided in this disclosure, and variants thereof.
2.2.2.1. Chothia CDR-H3
In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 76. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 77. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 78. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 79. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 80. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 81. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 82. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 83. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 84. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 85. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 86. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 87. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 88. In some aspects, the antibody comprises a Vii sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 89. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 90. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 91. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 92. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 93. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 94. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 95. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 96. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 97. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 98. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 99. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 100. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 101.
2.2.2.2. Chothia CDR-H2
In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 38-50. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 38. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 39. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 40. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 41. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 42. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 43. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 44. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 45. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 46. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 47. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 48. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 49. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 50.
2.2.2.3. Chothia CDR-H1
In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 1-14. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 1. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 2. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 3. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 4. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 5. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 6. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 7. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 8. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 9. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 10. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 11. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 12. In some aspects, the antibody comprises a VF sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 13. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 14.
2.2.2.4. Chothia CDR-H3+Chothia CDR-H2
In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101, and a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 38-50. In some aspects, the Chothia CDR-H3 sequence and the Chothia CDR-H2 sequence are both from a single illustrative VH sequence provided in this disclosure. For example, in some aspects, the Chothia CDR-H3 and Chothia CDR-H2 are both from a single illustrative VH sequence selected from SEQ ID NOS: 170-200.
2.2.2.5. Chothia CDR-H3+Chothia CDR-H1
In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101, and a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 1-14. In some aspects, the Chothia CDR-H3 sequence and the Chothia CDR-H1 sequence are both from a single illustrative VH sequence provided in this disclosure. For example, in some aspects, the Chothia CDR-H3 and Chothia CDR-H1 are both from a single illustrative VH sequence selected from SEQ ID NOS: 170-200.
2.2.2.6. Chothia CDR-H1+Chothia CDR-H2
In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 1-14 and a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 38-50. In some aspects, the Chothia CDR-H1 sequence and the Chothia CDR-H2 sequence are both from a single illustrative VH sequence provided in this disclosure. For example, in some aspects, the Chothia CDR-H1 and Chothia CDR-H2 are both from a single illustrative VH sequence selected from SEQ ID NOS: 170-200.
2.2.2.7. Chothia CDR-H1+Chothia CDR-H2+Chothia CDR-H3
In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 1-14, a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 38-50, and a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 76-101. In some aspects, the Chothia CDR-H1 sequence, Chothia CDR-H2 sequence, and Chothia CDR-H3 sequence are all from a single illustrative VH sequence provided in this disclosure. For example, in some aspects, the Chothia CDR-H1, Chothia CDR-H2, and Chothia CDR-H3 are all from a single illustrative VH sequence selected from SEQ ID NOS: 170-200.
In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 1, a Chothia CDR-H2 sequence comprising SEQ ID NO: 38, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 76. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 39, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 77. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 40, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 78. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 79. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 4, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 80. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 76. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 42, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 76. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 43, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 81. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 42, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 82. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 5, a Chothia CDR-H2 sequence comprising SEQ ID NO: 42, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 76. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 42, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 81. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 83. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 84. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 85. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 86. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 7, a Chothia CDR-H2 sequence comprising SEQ ID NO: 45, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 8, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 88. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 8, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 89. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 7, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 90. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 9, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 90. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 45, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 91. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 8, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 92. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 7, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 93. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 10, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 94. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 11, a Chothia CDR-H2 sequence comprising SEQ ID NO: 47, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 95. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 12, a Chothia CDR-H2 sequence comprising SEQ ID NO: 48, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 96. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 13, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 97. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 14, a Chothia CDR-H2 sequence comprising SEQ ID NO: 49, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 98. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 1, a Chothia CDR-H2 sequence comprising SEQ ID NO: 38, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 99. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 11, a Chothia CDR-H2 sequence comprising SEQ ID NO: 50, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 100. In some embodiments, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 101.
2.2.2.8. Variants of VH Sequences Comprising Illustrative Chothia CDRs
In some embodiments, the VH sequences provided herein comprise a variant of an illustrative Chothia CDR-H3, CDR-H2, and/or CDR-H1 sequence provided in this disclosure.
In some aspects, the Chothia CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia CDR-H3 sequence provided in this disclosure. In some aspects, the Chothia CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia CDR-H3 sequences provided in this disclosure. In some aspects, the Chothia CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the Chothia CDR-H2 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia CDR-H2 sequence provided in this disclosure. In some aspects, the Chothia CDR-H2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia CDR-H2 sequences provided in this disclosure. In some aspects, the Chothia CDR-H2 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia CDR-H2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the Chothia CDR-H1 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia CDR-H1 sequence provided in this disclosure. In some aspects, the Chothia CDR-H1 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia CDR-H1 sequences provided in this disclosure. In some aspects, the Chothia CDR-H1 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia CDR-H1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.3. VH Sequences
In some embodiments, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 170-200. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 170. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 171. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 172. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 173. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 174. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 175. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 176. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 177. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 178. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 179. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 180. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 181. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 182. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 183. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 184. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 185. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 186. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 187. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 188. In some aspects, the antibody comprises a VH sequence comprising, consisting of or consisting essentially of SEQ ID NO: 189. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 190. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 191. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 192. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 193. In some aspects, the antibody comprises a VH sequence comprising, consisting of or consisting essentially of SEQ ID NO: 194. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 195. In some aspects, the antibody comprises a Vii sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 196. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 197. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 198. In some aspects, the antibody comprises a VH sequence comprising, consisting of or consisting essentially of SEQ ID NO: 199. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 200.
23.1. Variants of VH Sequences
In some embodiments, the VH sequences provided herein comprise, consist of, or consist essentially of a variant of an illustrative VH sequence provided in this disclosure.
In some aspects, the VH sequence comprises, consists of, or consists essentially of a variant of an illustrative VH sequence provided in this disclosure. In some aspects, the VH sequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identity with any of the illustrative VH sequences provided in this disclosure.
In some embodiments, the VH sequence comprises, consists of, or consists essentially of any of the illustrative VH sequences provided in this disclosure, 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.4. CDR-L3 Sequences
In some embodiments, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 149-166. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 149. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 150. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 151. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 152. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 153. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 154. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 155. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 156. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 157. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 158. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 159. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 160. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 161. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 162. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 163. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 164. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 165. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 166.
In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L3 sequence provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L3 sequences provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.5. VL Sequences Comprising Illustrative CDRs
In some embodiments, the antibody comprises a VL sequence comprising one or more CDR-L sequences comprising, consisting of, or consisting essentially of one or more illustrative CDR-L sequences provided in this disclosure, and variants thereof.
2.5.1. CDR-L3
In some embodiments, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 149-166. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 149. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 150. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 151. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 152. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 153. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 154. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 155. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 156. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 157. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 158. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 159. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 160. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 161. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 162. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 163. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 164. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 165. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 166.
2.5.2. CDR-L2
In some embodiments, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 128-145. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 128. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 129. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 130. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 131. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 132. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 133. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 134. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 135. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 136. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 137. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 138. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 139. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 140. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 141. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 142. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 143. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 144. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 145.
2.5.3. CDR-L1
In some embodiments, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 105-124. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 105. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 106. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 107. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 108. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 109. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 110. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 111. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 112. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 113. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 114. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 115. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 116. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 117. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 18. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 119. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 120. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 121. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 122. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 123. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 124.
2.5.4. CDR-L3+CDR-L2
In some embodiments, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 149-166 and a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 128-145. In some aspects, the CDR-L3 sequence and the CDR-L2 sequence are both from a single illustrative VL sequence provided in this disclosure. For example, in some aspects, the CDR-L3 and CDR-L2 are both from a single illustrative VL sequence selected from SEQ ID NOS: 204-228.
2.5.5. CDR-L3+CDR-L1
In some embodiments, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 149-166 and a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 105-124. In some aspects, the CDR-L3 sequence and the CDR-L1 sequence are both from a single illustrative VL sequence provided in this disclosure. For example, in some aspects, the CDR-L3 and CDR-L1 are both from a single illustrative VL sequence selected from SEQ ID NOS: 204-228.
2.5.6. CDR-L1+CDR-L2
In some embodiments, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 105-124 and a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 128-145. In some aspects, the CDR-L1 sequence and the CDR-L2 sequence are both from a single illustrative VL sequence provided in this disclosure. For example, in some aspects, the CDR-L1 and CDR-L2 are both from a single illustrative VL sequence selected from SEQ ID NOS: 204-228.
2.5.7. CDR-L1+CDR-L2+CDR-L3
In some embodiments, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 105-124, a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 128-145, and a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L1 sequence, CDR-L2 sequence, and CDR-L3 sequence are all from a single illustrative VL sequence provided in this disclosure. For example, in some aspects, the CDR-L1, CDR-L2, and CDR-L3 are all from a single illustrative VL sequence selected from SEQ ID NOS: 204-228.
In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 106, a CDR-L2 sequence comprising SEQ ID NO: 129, and a CDR-L3 sequence SEQ ID NO: 150. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 107, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 151. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 108, a CDR-L2 sequence comprising SEQ ID NO: 130, and a CDR-L3 sequence SEQ ID NO: 151. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 109, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 152. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 107, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence SEQ ID NO: 153. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence SEQ ID NO: 151. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 111, a CDR-L2 sequence comprising SEQ ID NO: 133, and a CDR-L3 sequence SEQ ID NO: 151. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 154. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 112, a CDR-L2 sequence comprising SEQ ID NO: 134, and a CDR-L3 sequence SEQ ID NO: 155. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 113, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 156. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 114, a CDR-L2 sequence comprising SEQ ID NO: 136, and a CDR-L3 sequence SEQ ID NO: 157. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 157. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 116, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 155. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 117, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 155. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 158. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence SEQ ID NO: 155. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 119, a CDR-L2 sequence comprising SEQ ID NO: 139, and a CDR-L3 sequence SEQ ID NO: 159. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 120, a CDR-L2 sequence comprising SEQ ID NO: 140, and a CDR-L3 sequence SEQ ID NO: 160. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 141, and a CDR-L3 sequence SEQ ID NO: 161. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 122, a CDR-L2 sequence comprising SEQ ID NO: 142, and a CDR-L3 sequence SEQ ID NO: 162. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 143, and a CDR-L3 sequence SEQ ID NO: 163. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 143, and a CDR-L3 sequence SEQ ID NO: 164. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 123, a CDR-L2 sequence comprising SEQ ID NO: 144, and a CDR-L3 sequence SEQ ID NO: 165. In some aspects, the antibody comprises a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 124, a CDR-L2 sequence comprising SEQ ID NO: 145, and a CDR-L3 sequence SEQ ID NO: 166.
2.5.8. Variants of VL Sequences Comprising Illustrative CDR-Ls
In some embodiments, the VL sequences provided herein comprise a variant of an illustrative CDR-L3, CDR-L2, and/or CDR-L1 sequence provided in this disclosure.
In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L3 sequence provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L3 sequences provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L2 sequence provided in this disclosure. In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L2 sequences provided in this disclosure. In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the CDR-L1 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L1 sequence provided in this disclosure. In some aspects, the CDR-L sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L sequences provided in this disclosure. In some aspects, the CDR-L1 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.6. VL Sequences
In some embodiments, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 204-228. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 204. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 205. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 206. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 207. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 208. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 209. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 210. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 211. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 212. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 213. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 214. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 215. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 216. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 217. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 218. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 219. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 220. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 221. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 222. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 223. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 224. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 225. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 226. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 227. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 228.
2.6.1. Variants of VL Sequences
In some embodiments, the VL sequences provided herein comprise, consist of, or consist essentially of a variant of an illustrative VL sequence provided in this disclosure.
In some aspects, the VL sequence comprises, consists of, or consists essentially of a variant of an illustrative VL sequence provided in this disclosure. In some aspects, the VL sequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.05% identity with any of the illustrative VL sequences provided in this disclosure.
In some embodiments, the VL sequence comprises, consists of, or consists essentially of any of the illustrative VL sequences provided in this disclosure, 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.7. Pairs
2.7.1. CDR-H3-CDR-L3 Pairs
In some embodiments, the antibody comprises a CDR-H3 sequence and a CDR-L3 sequence. In some aspects, the CDR-H3 sequence is part of a VH and the CDR-L3 sequence is part of a VL.
In some aspects, the CDR-H3 sequence is a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 76-101, and the CDR-L3 sequence is a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 149-166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 76 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 77 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 78 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 79 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 80 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 81 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 82 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 83 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 84 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 85 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 86 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 87 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 88 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 89 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 90 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 91 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 92 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 93 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 94 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 95 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 96 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 97 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 98 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 99 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 100 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
In some aspects, the CDR-H3 sequence is SEQ ID NO: 101 and the CDR-L3 sequence is selected from SEQ ID NOS: 149-166. In some aspects, the CDR-L3 sequence is SEQ ID NO: 149. In some aspects, the CDR-L3 sequence is SEQ ID NO: 150. In some aspects, the CDR-L3 sequence is SEQ ID NO: 151. In some aspects, the CDR-L3 sequence is SEQ ID NO: 152. In some aspects, the CDR-L3 sequence is SEQ ID NO: 153. In some aspects, the CDR-L3 sequence is SEQ ID NO: 154. In some aspects, the CDR-L3 sequence is SEQ ID NO: 155. In some aspects, the CDR-L3 sequence is SEQ ID NO: 156. In some aspects, the CDR-L3 sequence is SEQ ID NO: 157. In some aspects, the CDR-L3 sequence is SEQ ID NO: 158. In some aspects, the CDR-L3 sequence is SEQ ID NO: 159. In some aspects, the CDR-L3 sequence is SEQ ID NO: 160. In some aspects, the CDR-L3 sequence is SEQ ID NO: 161. In some aspects, the CDR-L3 sequence is SEQ ID NO: 162. In some aspects, the CDR-L3 sequence is SEQ ID NO: 163. In some aspects, the CDR-L3 sequence is SEQ ID NO: 164. In some aspects, the CDR-L3 sequence is SEQ ID NO: 165. In some aspects, the CDR-L3 sequence is SEQ ID NO: 166.
2.7.1.1. Variants of CDR-H3-CDR-L3 Pairs
In some embodiments, the CDR-H3-CDR-L3 pairs provided herein comprise a variant of an illustrative CDR-H3 and/or CDR-L1 sequence provided in this disclosure.
In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-H3 sequence provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-H3 sequences provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L3 sequence provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L3 sequences provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.7.2. VH-VL Pairs
In some embodiments, the antibody comprises a VH sequence and a VL sequence.
In some aspects, the VH sequence is a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 170-200 and the VL sequence is a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 204-228.
In some aspects, the VH sequence is SEQ ID NO: 170 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VH sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 171 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 172 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VH sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 173 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 174 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 175 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 176 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 177 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 178 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 179 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 180 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 181 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 182 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VH sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 183 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VF sequence is SEQ ID NO: 184 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 185 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 186 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 187 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 188 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 189 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VH sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 190 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 191 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 192 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VF sequence is SEQ ID NO: 193 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 194 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 195 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL, sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VH sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 196 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 197 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VL sequence is SEQ ID NO: 198 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 199 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VL sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
In some aspects, the VH sequence is SEQ ID NO: 200 and the VL sequence is selected from SEQ ID NOS: 204-228. In some aspects, the VL sequence is SEQ ID NO: 204. In some aspects, the VL sequence is SEQ ID NO: 205. In some aspects, the VL sequence is SEQ ID NO: 206. In some aspects, the VL sequence is SEQ ID NO: 207. In some aspects, the VL sequence is SEQ ID NO: 208. In some aspects, the VL sequence is SEQ ID NO: 209. In some aspects, the VL sequence is SEQ ID NO: 210. In some aspects, the VL sequence is SEQ ID NO: 211. In some aspects, the VL sequence is SEQ ID NO: 212. In some aspects, the VL sequence is SEQ ID NO: 213. In some aspects, the VL sequence is SEQ ID NO: 214. In some aspects, the VL sequence is SEQ ID NO: 215. In some aspects, the VL sequence is SEQ ID NO: 216. In some aspects, the VL sequence is SEQ ID NO: 217. In some aspects, the VL sequence is SEQ ID NO: 218. In some aspects, the VL sequence is SEQ ID NO: 219. In some aspects, the VL sequence is SEQ ID NO: 220. In some aspects, the VL sequence is SEQ ID NO: 221. In some aspects, the VL sequence is SEQ ID NO: 222. In some aspects, the VL sequence is SEQ ID NO: 223. In some aspects, the VH sequence is SEQ ID NO: 224. In some aspects, the VL sequence is SEQ ID NO: 225. In some aspects, the VL sequence is SEQ ID NO: 226. In some aspects, the VL sequence is SEQ ID NO: 227. In some aspects, the VL sequence is SEQ ID NO: 228.
2.7.3. CDR-H1+CDR-H2+CDR-H3+CDR-L11+CDR-L2+CDR-L3
In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 18, a Kabat CDR-H2 sequence comprising SEQ ID NO: 54, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 19, a Kabat CDR-H2 sequence comprising SEQ ID NO: 55, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 77 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 20, a Kabat CDR-H2 sequence comprising SEQ ID NO: 56, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 78 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 21, a Kabat CDR-H2 sequence comprising SEQ ID NO: 57, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 79 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 22, a Kabat CDR-H2 sequence comprising SEQ ID NO: 58, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 80 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 21, a Kabat CDR-H2 sequence comprising SEQ ID NO: 57, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 106, a CDR-L2 sequence comprising SEQ ID NO: 129, and a CDR-L3 sequence SEQ ID NO: 150. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 59, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 107, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 151. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 60, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 81 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 108, a CDR-L2 sequence comprising SEQ ID NO: 130, and a CDR-L3 sequence SEQ ID NO: 151. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 59, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 109, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 152. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 59, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 107, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence SEQ ID NO:153. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 23, a Kabat CDR-H2 sequence comprising SEQ ID NO: 59, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 81 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence SEQ ID NO: 151. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 21, a Kabat CDR-H2 sequence comprising SEQ ID NO: 57, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 83 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 111, a CDR-L2 sequence comprising SEQ ID NO: 133, and a CDR-L3 sequence SEQ ID NO: 151. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 21, a Kabat CDR-H2 sequence comprising SEQ ID NO: 57, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 84 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 24, a Kabat CDR-H2 sequence comprising SEQ ID NO: 61, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 85 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 154. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 24, a Kabat CDR-H2 sequence comprising SEQ ID NO: 61, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 86 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 154. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 25, a Kabat CDR-H2 sequence comprising SEQ ID NO: 62, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 87 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 112, a CDR-L2 sequence comprising SEQ ID NO: 134, and a CDR-L3 sequence SEQ ID NO: 155. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 63, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 88 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 113, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 156. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 26, a Kabat CDR-H2 sequence comprising SEQ ID NO: 63, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 89 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 114, a CDR-L2 sequence comprising SEQ ID NO: 136, and a CDR-L3 sequence SEQ ID NO: 157. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 25, a Kabat CDR-H2 sequence comprising SEQ ID NO: 63, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 90 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 157. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H sequence comprising SEQ ID NO: 27, a Kabat CDR-H2 sequence comprising SEQ ID NO: 64, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 90 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 116, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 155. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 28, a Kabat CDR-H2 sequence comprising SEQ ID NO: 62, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 91 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 117, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 155. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 29, a Kabat CDR-H2 sequence comprising SEQ ID NO: 64, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 92 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 158. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 25, a Kabat CDR-H2 sequence comprising SEQ ID NO: 65, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 93 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence SEQ ID NO: 155. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 30, a Kabat CDR-H2 sequence comprising SEQ ID NO: 66, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 94 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 119, a CDR-L2 sequence comprising SEQ ID NO: 139, and a CDR-L3 sequence SEQ ID NO: 159. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 31, a Kabat CDR-H2 sequence comprising SEQ ID NO: 67, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 95 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 120, a CDR-L2 sequence comprising SEQ ID NO: 140, and a CDR-L3 sequence SEQ ID NO: 160. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 32, a Kabat CDR-H2 sequence comprising SEQ ID NO: 68, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 96 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 141, and a CDR-L3 sequence SEQ ID NO: 161. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 33, a Kabat CDR-H2 sequence comprising SEQ ID NO: 69, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 97 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 122, a CDR-L2 sequence comprising SEQ ID NO: 142, and a CDR-L3 sequence SEQ ID NO: 162. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 34, a Kabat CDR-H2 sequence comprising SEQ ID NO: 70, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 98 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 143, and a CDR-L3 sequence SEQ ID NO: 163. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 18, a Kabat CDR-H2 sequence comprising SEQ ID NO: 54, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 99 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 143, and a CDR-L3 sequence SEQ ID NO: 164. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 31, a Kabat CDR-H2 sequence comprising SEQ ID NO: 71, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 100 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 123, a CDR-L2 sequence comprising SEQ ID NO: 144, and a CDR-L3 sequence SEQ ID NO: 165. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H1 sequence comprising SEQ ID NO: 24, a Kabat CDR-H2 sequence comprising SEQ ID NO: 61, and a Kabat CDR-H3 sequence comprising SEQ ID NO: 101 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 124, a CDR-L2 sequence comprising SEQ ID NO: 145, and a CDR-L3 sequence SEQ ID NO: 166.
In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 1, a Chothia CDR-H2 sequence comprising SEQ ID NO: 38, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 39, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 77 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 40, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 78 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 79 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 4, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 80 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 106, a CDR-L2 sequence comprising SEQ ID NO: 129, and a CDR-L3 sequence SEQ ID NO: 150. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 42, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 107, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 151. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 43, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 81 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 108, a CDR-L2 sequence comprising SEQ ID NO: 130, and a CDR-L3 sequence SEQ ID NO: 151. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 42, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 82 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 109, a CDR-L2 sequence comprising SEQ ID NO: 131, and a CDR-L3 sequence SEQ ID NO: 152. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 5, a Chothia CDR-H2 sequence comprising SEQ ID NO: 42, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 76 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 107, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence SEQ ID NO: 153. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 2, a Chothia CDR-H2 sequence comprising SEQ ID NO: 42, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 81 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 110, a CDR-L2 sequence comprising SEQ ID NO: 132, and a CDR-L3 sequence SEQ ID NO: 151. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 83 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 111, a CDR-L2 sequence comprising SEQ ID NO: 133, and a CDR-L3 sequence SEQ ID NO: 151. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 3, a Chothia CDR-H2 sequence comprising SEQ ID NO: 41, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 84 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 149. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 85 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 154. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 86 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 154. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 7, a Chothia CDR-H2 sequence comprising SEQ ID NO: 45, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 87 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 112, a CDR-L2 sequence comprising SEQ ID NO: 134, and a CDR-L3 sequence SEQ ID NO: 155. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 8, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 88 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 113, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 156. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 8, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 89 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 114, a CDR-L2 sequence comprising SEQ ID NO: 136, and a CDR-L3 sequence SEQ ID NO: 157. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 7, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 90 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 115, a CDR-L2 sequence comprising SEQ ID NO: 135, and a CDR-L3 sequence SEQ ID NO: 157. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 9, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 90 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 116, a CDR-L2 sequence comprising SEQ ID NO: 128, and a CDR-L3 sequence SEQ ID NO: 155. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 45, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 91 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 117, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 155. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 8, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 92 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 137, and a CDR-L3 sequence SEQ ID NO: 158. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 7, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 93 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 118, a CDR-L2 sequence comprising SEQ ID NO: 138, and a CDR-L3 sequence SEQ ID NO: 155. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 10, a Chothia CDR-H2 sequence comprising SEQ ID NO: 46, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 94 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 119, a CDR-L2 sequence comprising SEQ ID NO: 139, and a CDR-L3 sequence SEQ ID NO: 159. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 11, a Chothia CDR-H2 sequence comprising SEQ ID NO: 47, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 95 and a VL sequence comprising a CDR-L sequence comprising SEQ ID NO: 120, a CDR-L2 sequence comprising SEQ ID NO: 140, and a CDR-L3 sequence SEQ ID NO: 160. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 12, a Chothia CDR-H2 sequence comprising SEQ ID NO: 48, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 96 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 121, a CDR-L2 sequence comprising SEQ ID NO: 141, and a CDR-L3 sequence SEQ ID NO: 161. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 13, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 97 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 122, a CDR-L2 sequence comprising SEQ ID NO: 142, and a CDR-L3 sequence SEQ ID NO: 162. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 14, a Chothia CDR-H2 sequence comprising SEQ ID NO: 49, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 98 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 143, and a CDR-L3 sequence SEQ ID NO: 163. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 1, a Chothia CDR-H2 sequence comprising SEQ ID NO: 38, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 99 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 105, a CDR-L2 sequence comprising SEQ ID NO: 143, and a CDR-L3 sequence SEQ ID NO: 164. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 11, a Chothia CDR-H2 sequence comprising SEQ ID NO: 50, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 100 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 123, a CDR-L2 sequence comprising SEQ ID NO: 144, and a CDR-L3 sequence SEQ ID NO: 165. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H1 sequence comprising SEQ ID NO: 6, a Chothia CDR-H2 sequence comprising SEQ ID NO: 44, and a Chothia CDR-H3 sequence comprising SEQ ID NO: 101 and a VL sequence comprising a CDR-L1 sequence comprising SEQ ID NO: 124, a CDR-L2 sequence comprising SEQ ID NO: 145, and a CDR-L3 sequence SEQ ID NO: 166.
2.7.3.1. Variants of VH-VL Pairs
In some embodiments, the VH-VL pairs provided herein comprise a variant of an illustrative VH and/or VL sequence provided in this disclosure.
In some aspects, the VH sequence comprises, consists of, or consists essentially of a variant of an illustrative VH sequence provided in this disclosure. In some aspects, the VH sequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.1% identity with any of the illustrative VH sequences provided in this disclosure.
In some embodiments, the VH sequence comprises, consists of, or consists essentially of any of the illustrative VH sequences provided in this disclosure, 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the VL sequence comprises, consists of, or consists essentially of a variant of an illustrative VL sequence provided in this disclosure. In some aspects, the VL sequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.05% identity with any of the illustrative VL sequences provided in this disclosure.
In some embodiments, the VL sequence comprises, consists of, or consists essentially of any of the illustrative VL sequences provided in this disclosure, 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.7.4 HC+LC
In some aspects, the antibody comprises or consists of one or more heavy chains consisting of an HC sequence and one or more light chains consisting of an LC sequence. In some aspects, the antibody comprises or consists of two identical heavy chains consisting of an HC sequence and two identical light chains consisting of an LC sequence.
In some aspects, the HC sequence is an HC sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 232-262 and the LC sequence is an LC sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 300-330. In some embodiments, the HC sequence is an HC sequence consisting of a sequence selected from SEQ ID NOS: 232-262 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some embodiments, the HC sequence is an HC sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOS: 266-296 and the LC sequence is an LC sequence comprising, consisting of, or consisting essentially of SEQ ID NOS: 300-330. In some embodiments, the HC sequence is an HC sequence consisting of a sequence selected from SEQ ID NOS: 266-296 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 232 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 233 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 234 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 235 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 236 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 237 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 238 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 239 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 240 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 241 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 242 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 243 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 244 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 245 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 246 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 247 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 248 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 249 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 250 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 251 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 252 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 253 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 254 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 255 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 256 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 257 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 258 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 259 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 260 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 261 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 262 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 266 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 267 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 268 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 269 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 270 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 271 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 272 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 273 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 274 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 275 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 276 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 277 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 278 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 279 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 280 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 281 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 282 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 283 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 284 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 285 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 286 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 287 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 288 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 289 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 290 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 291 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 292 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 293 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 294 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 295 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 296 and the LC sequence is an LC sequence consisting of a sequence selected from SEQ ID NOS: 300-330. In some aspects, the LC sequence is SEQ ID NO: 300. In some aspects, the LC sequence is SEQ ID NO: 301. In some aspects, the LC sequence is SEQ ID NO: 302. In some aspects, the LC sequence is SEQ ID NO: 303. In some aspects, the LC sequence is SEQ ID NO: 304. In some aspects, the LC sequence is SEQ ID NO: 305. In some aspects, the LC sequence is SEQ ID NO: 306. In some aspects, the LC sequence is SEQ ID NO: 307. In some aspects, the LC sequence is SEQ ID NO: 308. In some aspects, the LC sequence is SEQ ID NO: 309. In some aspects, the LC sequence is SEQ ID NO: 310. In some aspects, the LC sequence is SEQ ID NO: 311. In some aspects, the LC sequence is SEQ ID NO: 312. In some aspects, the LC sequence is SEQ ID NO: 313. In some aspects, the LC sequence is SEQ ID NO: 314. In some aspects, the LC sequence is SEQ ID NO: 315. In some aspects, the LC sequence is SEQ ID NO: 316. In some aspects, the LC sequence is SEQ ID NO: 317. In some aspects, the LC sequence is SEQ ID NO: 318. In some aspects, the LC sequence is SEQ ID NO: 319. In some aspects, the LC sequence is SEQ ID NO: 320. In some aspects, the LC sequence is SEQ ID NO: 321. In some aspects, the LC sequence is SEQ ID NO: 322. In some aspects, the LC sequence is SEQ ID NO: 323. In some aspects, the LC sequence is SEQ ID NO: 324. In some aspects, the LC sequence is SEQ ID NO: 325. In some aspects, the LC sequence is SEQ ID NO: 326. In some aspects, the LC sequence is SEQ ID NO: 327. In some aspects, the LC sequence is SEQ ID NO: 328. In some aspects, the LC sequence is SEQ ID NO: 329. In some aspects, the LC sequence is SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 232 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 300. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 233 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 301. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 234 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 302. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 235 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 303. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 236 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 304. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 237 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 305. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 238 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 306. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 239 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 307. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 240 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 308. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 241 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 309. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 242 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 310. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 243 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 311. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 244 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 312. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 245 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 313. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 246 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 314. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 247 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 315. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 248 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 316. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 249 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 317. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 250 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 318. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 251 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 319. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 252 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 320. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 253 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 321. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 254 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 322. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 255 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 323. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 256 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 324. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 257 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 325. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 258 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 326. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 259 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 327. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 260 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 328. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 261 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 329. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 262 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 330.
In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 266 and the LC sequence is an LC sequence consisting of a sequence SEQ ID NO: 300. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 267 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 301. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 268 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 302. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 269 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 303. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 270 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 304. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 271 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 305. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 272 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 306. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 273 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 307. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 274 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 308. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 275 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 309. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 276 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 310. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 277 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 311. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 278 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 312. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 279 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 313. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 280 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 314. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 281 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 315. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 282 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 316. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 283 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 317. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 284 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 318. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 285 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 319. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 286 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 320. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 287 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 321. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 288 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 322. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 289 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 323. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 290 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 324. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 291 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 325. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 292 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 326. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 293 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 327. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 294 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 328. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 295 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 329. In some aspects, the HC sequence is an HC sequence consisting of SEQ ID NO: 296 and the LC sequence is an LC sequence consisting of sequence SEQ ID NO: 330.
2.8. Consensus Sequences
In some embodiments, provided herein are anti-HLA-G antibodies comprising one or more sequences defined by consensus sequences. Each consensus sequence is based, at least in part, on one or more alignments of two or more useful anti-HLA-G CDR sequences provided in this disclosure. Based on such alignments, a person of skill in the art would recognize that different amino acid residues may useful in certain positions of the CDRs. Accordingly, each consensus sequence encompasses two or more useful anti-HLA-G CDR sequences.
2.8.1. CDR-H3 Consensus Sequences
In some embodiments, the antibody comprises a CDR-H3 sequence defined by the consensus sequence G-y2-y3-R-A-V-P-F-y9-y10 (SEQ ID NOS: 76-84), where y2 is I, P, Q, T, or V; y3 is A, F, K, or R; y9 is A, D, Q, or V; y10 is D, R, or Y.
In some aspects, when y2 is I; y3 is A or R; y9 is F; and y10 is Y. In some aspects, when y2 is V; y3 is R; y9 is A, D, Q, or V; and y10 is D, R, or Y. In some aspects, when y3 is R; y2 is 1, T, or V; y9 is A, D, or Q; and y10 is D, R, or Y. In some aspects, when y9 is D; y2 is I, P, Q, or V; y3 is A, F, K, or R; and y10 is Y. In some aspects, when y10 is Y; y2 is I, P, R, or V; y3 is A, F, K, or R; and y9 is D. In some aspects, when Yon is D; y2 is V; y3 is R; and y9 is A or V.
In some aspects, when y2 is V; y3 is R: y9 is D; and y10 is Y. In some aspects, when y2 is I; y3 is A; Y is D; and y10 is Y. In some aspects, when y2 is P; y3 is K; y9 is D; and Yon is Y. In some aspects, when y2 is V; y3 is R; y9 is V; and y10 is D. In some aspects, when y2 is V; y3 is R; Y is Q; and y10 is R. In some aspects, when y2 is T; y3 is R; y9 is D; and y10 is Y. In some aspects, when y2 is V; y3 is R; y9 is A; and y10 is D. In some aspects, when y2 is I; y3 is R; y9 is D; and y10 is Y. In some aspects, when y2 is Q; y3 is F; y9 is D; and y10 is Y.
In some embodiments, the antibody comprises a CDR-H3 sequence defined by the consensus sequence G-G-Φ345-Y-S-R-G-P-Φ11-D-V (SEQ ID NOS: 85-93), where Φ3 is E, G, Q, or T; Φ4 is A, H, P, Q. or V; Φ5 is K or T; and Φ11 is F, L, or M.
In some aspects, Φ3 is G; when Φ4 is A or Q; Φ5 is T; and Φ11 is V. In some aspects, Φ3 is T; when Φ4 is H, P, or V; Φ5 is I, T, or Y; and Φ11 is V. In some aspects, Φ4 is H; when Φ3 is T; Φ5 is T; and Φ11 is F, L, or M. In some aspects, Φ4 is V; when Φ3 is E, T, or Q; Φ5 is K or T; and Φ11 is L. In some aspects, Φ5 is T; when Φ3 is E, G. T, or Q; Φ4 is A, H, Q, or V; and Φ11 is F, L, or M. In some aspects, Φ11 is L; when Φ3 is E, G, T, or Q; Φ4 is A, H, P, Q, or V; and Φ5 is I, K, or T.
In some aspects, when Φ3 is T; when Φ4 is H; Φ5 is T; and Φ11 is M. In some aspects, when Φ3 is T; when Φ4 is H; Φ5 is T; and Φ11 is F. In some aspects, when Φ3 is T; when Φ4 is P; Φ5 is I; and Φ11 is L. In some aspects, when Φ3 is G; when Φ4 is Q; Φ5 is T; and Φ11 is L. In some aspects, when Φ3 is G; when Φ4 is A; Φ5 is T; and Φ11 is L. In some aspects, when Φ3 is T; when Φ4 is H; Φ5 is T; and Φ11 is L. In some aspects, when Φ3 is T; when Φ4 is H; Φ5 is T; and Φ11 is L. In some aspects, when Φ3 is T: when Φ4 is V; Φ5 is K; and Φ11 is L. In some aspects, when Φ3 is Q; when Φ4 is V; Φ5 is T; and Φ11 is L. In some aspects, when Φ3 is E; when Φ4 is V; Φ5 is T; and Φ11 is L.
2.8.2. Chothia CDR-H2 Consensus Sequences
In some embodiments, the antibody comprises a Chothia CDR-H2 sequence defined by the consensus sequence Y-ε2-S-ε4-S(SEQ ID NOS: 38 and 44-45), where ε2 is H or Y and ε4 is A or G.
In some aspects, when ε2 is H; ε4 is A or G. In some aspects, when ε4 is G, ε2 is H or Y.
In some aspects, when ε2 is Y; ε4 is G. In some aspects, when ε2 is H; ε4 is G. In some aspects, when ε2 is H; ε4 is A.
In some embodiments, the antibody comprises a Chothia CDR-H2 sequence defined by the consensus sequence α12-S-G-S(SEQ ID NOS: 39, 41-42, and 49), where α1 is A, H, or S; and α2 is S or Y.
In some aspects, when α1, is S; α2 is S or Y.
In some aspects, when α1 is S; α2 is S. In some aspects, when α1 is S; α2 is Y. In some aspects, when α1 is H; α2 is Y. In some aspects, when α1 is A; α2 is Y.
In some embodiments, the antibody comprises a Chothia CDR-H2 sequence defined by the consensus sequence β12-S-G-β56 (SEQ ID NOS: 56-60), where β1 is A or S; β2 is G or S; β5 is 1 or S; and β6 is T or V.
In some aspects, when β1 is S, β2 is G or S; β5 is I or S; and β6 is T or V. In some aspects, when β2 is S, β1 is A or S; β5 is S; and β6 is T or V. In some aspects, when β5 is S, β1 is A or S; β2 is S; and β6 is T or V. In some aspects, when β6 is T, β1 is S; β2 is G or S; and β5 is I or T.
In some aspects, when β1 is A; β2 is S; β5 is S; and β6 is V. In some aspects, when β1 is S; β2 is G; β5 is I; and β6 is T. In some aspects, when β1 is S; β2 is S; β5 is S; and β6 is T.
2.83. Chothia CDR-H1 Consensus Sequences
In some embodiments, the antibody comprises a Chothia CDR-H1 sequence defined by the consensus sequence G-G-S-I-S-S-Ω789 (SEQ ID NOS: 1-4 and 13-14), where Ω7 is S or A; Us is D, S, or N; and Ω9 is T, N, Y, or is absent.
In some aspects, when ω7 is S; Ω8 is D, N. or S; and Ω9 is T. Y, or is absent.
In some aspects, when Ω8 is D; ω7 is S or A; and Ω9 is N, T, or Y.
In some aspects, when Ω8 is T; Ω7 is S; and Ω8 is D or S. In some aspects, when Ω9 is Y; Ω7 is S; and Ω8 is D or S.
In some aspects, when Ω7 is S; Ω8 is D; and Ω9 is Y. In some aspects, when Ω7 is S; Ω8 is S; and Ω9 is T. In some aspects, when Ω7 is S; Ω8 is D; and Ω9 is T. In some aspects, when ω7 is A; Ω8 is D; and Ω9 is N. In some aspects, when Ω7 is S; Ω8 is N; and Ω9 is absent. In some aspects, when Ω7 is S; Ω8 is S; and Ω9 is Y.
In some embodiments, the antibody comprises a Chothia CDR-H1 sequence defined by the consensus sequence G-Y-S-I-ν5-S-G-ν8 (SEQ ID NOS: 6-9), where ν5 is S or L and ν8 is F, H, or Y.
In some aspects, when ν5 is S, ν5 is F, H, or Y.
In some aspects, when ν5 is S, ν8 is F. In some aspects, when ν5 is S, ν8 is H. In some aspects, when ν5 is S. ν8 is Y. In some aspects, when ν5 is L. ν8 is Y.
In some embodiments, the antibody comprises a Chothia CDR-H1 sequence defined by the consensus sequence G-F-T-F-κ567 (SEQ ID NOS: 10-12), where κ5 is D or s; κ6 is D, N, or S; and κ7 is S or Y.
In some aspects, when κ5 is S; κ6 is D or S; and κ7 is S or Y. In some aspects, when κ7 is Y; κ5 is D or S; and κ6 is N or D.
In some aspects, when κ5 is D; κ6 is N; and κ7 is Y. In some aspects, when κ5 is S; κ6 is D; and κ7 is Y. In some aspects, when κ5 is S; κ6 is S; and κ7 is S.
2.8.4. Kabat CDR-H2 Consensus Sequences
In some embodiments, the antibody comprises a Kabat CDR-H2 sequence defined by the consensus sequence β1-I-β34567-T-β9-Y-N-P-S-L-K-S(SEQ ID NOS: 54-65 and 69-70) where β1 is A, E, G, or S; β3 is A, H, S, or Y; β4, is H, S, or Y; β5 is N or S; β2 is A or G; β7 is A, L, or S; and β9 is A, N, L, V, or Y.
In some aspects, when β1 is S; β3 is A, H, S, or Y; β4 is H, S, or Y; β5 is N or S; β6 is A or G; β7 is A, L, or S; and β9 is A, N, L, V, or Y. In some aspects, when β1 is G; β3 is A or Y; β4 is H or Y; β5 is G or S; β6 is A or G; β7 is S; and β9 is A or Y. In some aspects, when β3 is Y; β1 is A, E, G, or S; β4 is H or Y; β5 is S; β6 is A or G; β7 is S; and β9 is A, N, V, or Y. In some aspects, when β3 is S. β1 is S; is S or Y; β5 is N or S; β6 is A or G; β7 is L or S; and β9 is Y. In some aspects, when β3 is H; β1 is S; β4 is H or Y; β5 is S; β6 is G; β7 is A or S; and β9 is L or Y. In some aspects, when β4 is Y; β1 is S or G; β3 is A, H, S, or Y; s is N or S; β6 is A or G; β7 is L or S; and β9 is L or Y. In some aspects, when β4 s H; β1 is A, E, G, S; β3 is H or Y; β5 is S; β6 is A or G; β7 is A or S; and β9 is A, N, Y or V. In some aspects, when β5 is S; β1 is A, E, G, or S; β3 is A, H, S, or Y; β4 is H, S, or Y; β6 is A or G; β7 is A or S; and β9 is A, L, N, Y, or V. In some aspects, when β6 is G; β1 is A, E, G, or S; β3 is A, H, S, or Y; β4 is H, S, or Y; β5 is S; β7 is S; and β9 is A, N, L, V, or Y. In some aspects, when β6 is A; β1 is G or S; β3 is S or Y; β4 is H or Y; β5 is N or S; β7 is L or S; and β9 is A or Y. In some aspects, when β7 is S; β1 is A, E, G, or S; β3 is A, H, S, or Y; β4 is H, S, or Y; β5 is S; β6 is A or G; and β9 is A, L, N, V, or Y. In some aspects, when β9 is Y; β1 is G or S; β3 is A, H, S, or Y; β4 is H, S or Y; β5 is N or S; β6 is A or G; and β7 is A, L, or S. In some aspects, when β9 is A; β1 is G; β3 is Y; β4 is H; β5 is S; β6 is A or G; and β7 is S.
In some aspects, when β1 is S; β3 is Y; β4 is Y; β5 is S; β6 is G; and β7 is S; and β9 is Y. In some aspects, when β1 is S; β3 is S; β4 is S; β5 is S; β6 is G; and β7 is S; and β9 is Y. In some aspects, when β1 is S; β3 is H; β4 is H; β5 is S; β6 is G; and β7 is A; and β9 is Y. In some aspects, when β1 is S; β3 is H; β4 is Y; β5 is S; β6 is G; and β7 is S; and β9 is L. In some aspects, when β1 is S; β3 is H; β4 is Y; β5 is S; β6 is G; and β7 is S; and β9 is Y. In some aspects, when β1 is G; β3 is A; β5 is Y; β5 is S; β6 is G; and β7 is S; and β9 is Y. In some aspects, when β1 is S; β3 is S; β4 is Y; β5 is N; β6 is A; and β7 is L; and β9 is Y. In some aspects, when β1 is S; β3 is Y; β4 is H; β5 is S; β6 is G; and β7 is S; and β9 is Y. In some aspects, when β1 is G; β3 is Y; β4 is H; β5 is S; β6 is A; and β7 is S; and β9 is A. In some aspects, when β1 is G; β3 is Y; β4 is H; β5 is S; β6 is G; and β7 is S; and β9 is Y. In some aspects, when β1 is A; β3 is Y; β4 is H; β5 is S; β6 is G; and β7 is S; and β9 is V. In some aspects, when β1 is G; β3 is Y; β4 is H; β5 is S; β6 is G; and β7 is S: and β9 is A. In some aspects, when β1 is E; β3 is Y; β4 is H; β5 is S; β6 is G; and β7 is S; and β9 is N. In some aspects, when β1 is S; β3 is S; β4 is Y; β5 is S; β6 is G; and β7 is S; and p is Y.
2.8.5. Kabat CDR-H1 Consensus Sequences
In some embodiments, the antibody comprises a Kabat CDR-H1 sequence defined by the consensus sequence S-S-Δ34-Y-W-Δ7 (SEQ ID NOS: 18-21, 23, and 34), where Δ3 is D or S; Δ4 is T or Y; and Δ7 is A, G, or S.
In some aspects, when Δ3 is D; Δ4 is T or Y; and Δ7 is G. In some aspects, when Δ3 is S; Δ4 is T or Y; and Δ7 is A, G, or S. In some aspects, when Δ4 is T; Δ3 is D or S; and Δ7 is A, G, or S. In some aspects, when Δ4 is Y; Δ3 is D or S; and Δ7 is G. In some aspects, when Δ7 is G; Δ3 is D or S; and Δ4 is T or Y.
In some aspects, when Δ3 is D; Δ4 is Y; and Δ7 is G. In some aspects, when Δ3 is S; Δ4 is T; and Δ7 is A. In some aspects, when Δ3 is S; Δ4 is T; and Δ7 is G. In some aspects, when Δ3 is D; Δ4 is T; and Δ7 is G. In some aspects, when Δ3 is S; Δ4 is T; and Δ7 is S. In some aspects, when Δ3 is S; Δ4 is Y; and Δ7 is G.
In some embodiments, the antibody comprises a Kabat CDR-H1 sequence defined by the consensus sequence S-G-θ3-Y-W-θ6 (SEQ ID NOS: 24-29), where θ3 is F, H, or Y; and θ6 is F, G, I, L, or T.
In some aspects, when θ3 is H, θ6 is I or T. In some aspects, when θ3 is Y, θ6 is F, G, or L. In some aspects, when θ6 is T, θ3 is F or H.
In some aspects, when θ3 is Y, θ6 is G. In some aspects, when θ3 is Y, θ6 is F. In some aspects, when θ3 is H, θ6 is I. In some aspects, when θ3 is F, θ6 is T. In some aspects, when θ3 is Y, θ6 is L. In some aspects, when θ3 is H, θ6 is T.
2.8.6. CDR-L3 Consensus Sequences
In some embodiments, the antibody comprises a CDR-L3 sequence defined by the consensus sequence Q-π234-H-S-P-Y-T (SEQ ID NOS: 149-153), where π2 is Q or W; π3 is A, T, or V; and π4 is I or V.
In some aspects, when π2 is Q; π3 is A, T, or V; and π4 is I or V. In some aspects, when π3 is A; π2 is Q or W; and π4 is I or V. In some aspects, when π4 is V; π2 is Q or W; and π3 is A, T, or V.
In some aspects, when π2 is Q; π3 is A; and π4 is V. In some aspects, when π2 is W; A; is A; and π4 is V. In some aspects, when π2 is Q; π3 is V; and π4 is V. In some aspects, when π2 is Q; π3 is T; and π4 is V. In some aspects, when π2 is Q; π3 is A; and π4 is I.
In some embodiments, the antibody comprises a CDR-L3 sequence defined by the consensus sequence Q-Q-λ3-S-λ5-Y-P-P-T (SEQ ID NOS: 154-158), where λ3 is F, H, or V; and λ5 is I, L, or S.
In some aspects, when λ3 is H; λ5 is I, L, or S. In some aspects, when λ5 is H; λ3 is F, H, or V.
In some aspects, when λ3 is H, λ5 is S. In some aspects, when λ3 is H, λ5 is L. In some aspects, when λ3 is F, λ5 is S. In some aspects, when λ3 is V, λ5 is S. In some aspects, when λ3 is H, λ5 is I.
In some embodiments, the antibody comprises a CDR-L3 sequence defined by the consensus sequence Q-Q-ω3456-P-I-T (SEQ ID NOS: 160-161 and 163-164), where ω3 is A, L, V, or Y; ω4 is G, P, V, or Y; ω5 is S, L, or F; and ω6 is D, L, S, or Y.
In some aspects, when ω5 is S; ω3 is V or Y; ω4 is G or V; and ω6 is D or S.
In some aspects, when ω3 is A; ω4 is Y; ω5 is L; and ω6 is Y. In some aspects, when ω3 is L; ω4 is P; ω5 is F; and ω6 is L. In some aspects, when ω3 is Y; ω4 is V; ω5 is S; and ω6 is D. In some aspects, when ω3 is V; ω4 is G; ω5 is S; and ω6 is S.
2.8.7. CDR-L2 Consensus Sequences
In some embodiments, the antibody comprises a CDR-L2 sequence defined by the consensus sequence ψ1-A-S-ψ4-R-A-ψ7 (SEQ ID NOS: 128, 130, 132, 134-138, 143, and 145), where ψ1 is D or G; ψ4 is A, D, N, R, S, T, or Y; and ψ7 is A, N, S, or T.
In some aspects, when ψ1 is G; ψ4 is A, D, N, R, S, T, or Y; and ψ7 is A, N, or T. In some aspects, when ψ1 is D; ψ4 is S or T; and ψ7 is S or T. In some aspects, when ψ4 is S; ψ1 is G or D; and ψ7 is S or T. In some aspects, when ψ4 is N; ψ1 is G or D; and ψ7 is A or T. In some aspects, when ψ4 is T; ψ1 is G or D; and ψ7 is T. In some aspects, when ψ7 is T; ψ1 is G or D; and ψ4 is A, N, R, S, T, or Y.
In some aspects, when ψ1 is G; ψ4 is S; and ψ7 is T. In some aspects, when ψ1 is G; ψ4 is A; and ψ7 is T. In some aspects, when ψ1 is N; ψ4 is S; and ψ7 is A. In some aspects, when ψ1 is G; ψ4 is N; and ψ7 is T. In some aspects, when ψ1 is D; ψ4 is S; and ψ7 is S. In some aspects, when ψ1 is D; ψ4 is S; and ψ7 is T. In some aspects, when ψ1 is G; ψ4 is D; and ψ7 is N. In some aspects, when ψ1 is G; ψ4 is Y; and ψ7 is T. In some aspects, when ψ1 is G; ψ4 is R; and ψ7 is T. In some aspects, when ψ1 is G; ψ4 is T; and ψ7 is T.
2.8.8. CDR-L1 Consensus Sequences
In some embodiments, the antibody comprises a CDR-L1 sequence defined by the consensus sequence ϕ1-A-S-Q-ϕ5-V-S-S-ϕ910-L-A (SEQ ID NOS: 105-112 and 117), where ϕ1 is E, G, K, Q, or R; ϕ5 is A or S; ϕ9 is A, D, N, S, or T; and ϕ10 is F or Y.
In some aspects, when ϕ1 is R; ϕ5 is Q or S; ϕ9 is A, S, or T; and ϕ10 is S or Y. In some aspects, when ϕ1 is G; ϕ5 is Q or S; ϕ9 is A or D; and ϕ10 is F or Y. In some aspects, when ϕ1 is Q; ϕ5 is A or S; ϕ9 is N or S; and ϕ10 is Y. In some aspects, when ϕ5 is S; ϕ1 is E, G, Q, or R; ϕ9 is A, D, S, or T; and ϕ10 is F or Y. In some aspects, when ϕ5 is A; ϕ1 is K or Q; ϕ9 is N or S; and ϕ10 is Y. In some aspects, when ϕ9 is S; ϕ1 is E, K, Q, or R; ϕ5 is A or S; and ϕ10 is Y. In some aspects, when ϕ9 is A; ϕ1, is G or R; ϕ5 is S; and ϕ10 is F or Y. In some aspects, when ϕ10 is Y; ϕ1 is E, G, K, Q, or R; ϕ5 is A or S; and ϕ9 is A, D, N, S, or T.
In some aspects, when ϕ1 is R; ϕ5 is S; ϕ9 is S; and ϕ10 is Y. In some aspects, when ϕ1 is G; ϕ5 is S; ϕ9 is D; and ϕ10 is Y. In some aspects, when ϕ1 is Q; ϕ5 is A; ϕ9 is N; and ϕ10 is Y. In some aspects, when ϕ1 is G; ϕ5 is S; ϕ9 is A; and ϕ10 is F. In some aspects, when ϕ1 is R; ϕ5 is S; ϕ9 is T; and ϕ10 is Y. In some aspects, when ϕ1 is Q; ϕ5 is S; ϕ9 is S: and ϕ10 is Y. In some aspects, when ϕ1 is K; ϕ5 is A; ϕ9 is S; and ϕ10 is Y. In some aspects, when ϕ1 is E; ϕ5 is S; ϕ9 is S; and ϕ10 is Y. In some aspects, when ϕ1 is R; ϕ5 is S; ϕ9 is A; and ϕ10 is Y.
In some embodiments, the antibody comprises a CDR-L1 sequence defined by the consensus sequence R-A-S-Q-S-σ67-S-σ9-L-σ11 (SEQ ID NOS: 119 and 123-124), where σ6 is I or V; σ7 is N or S; σ9 is N, W, or Y; σ11 is A or N.
In some aspects, when σ6 is I, σ7 is N or S; σ9 is W or Y; and σ11 is A or N. In some aspects, when σ7 is S, σ6 is I or V; σ9 is N or Y: and σ11 is A or N. In some aspects, when σ11 is A, σ6 is I or V; σ7 is N or S; and σ9 is N or W.
In some aspects, when σ6 is I; σ7 is N; σ9 is W; and σ11 is A. In some aspects, when σ6 is I; σ7 is S; σ9 is Y; and σ11 is N. In some aspects, when σ6 is V; σ7 is S; σ9 is N; and σ11 is A.
In some embodiments, the antibody comprises a CDR-L1 sequence defined by the consensus sequence Γ12-S-Q-S-V-S-Γ89-Y-L-A (SEQ ID NOS: 113-116), where Γ1 is E or R; Γ2 is A or V; F is A or V; Γ8 is A, D, or S; and Γ10 is A or S.
In some aspects, when Γ1 is E; Γ2 is A or V; Γ8 is A or S; and Γ9 is A or S. In some aspects, when Γ2 is A; Γ1 is E; Γ8 is A or S; and Γ9 is A or S. In some aspects, when Γ2 is V; Γ1 is E or R; Γ8 A or D; and Γ9 is A or S. In some aspects, when Γ8 is A; Γ1 is E; Γ2 is A or V; and Γ9 is S. In some aspects, when Γ9 is S; Γ1 is E; Γ2 is A or V; and Γ8 is A. In some aspects, when Γ9 is A; Γ1 is E or R; Γ2 is A or V; and Γ8 D or S.
In some aspects, when Γ1 is E; Γ2 is A; Γ8 is A; and Γ9 is S. In some aspects, when Γ1 is E; Γ2 is A; Γ8 is S; and Γ9 is A. In some aspects, when Γ1 is R; Γ2 is V; Γ8 is A; and Γ9 is A. In some aspects, when Γ1 is E; Γ2 is V; Γ8 is A; and Γ9 is S.
3. Germine
In some embodiments, the antibody that specifically binds HLA-G is an antibody comprising a variable region that is encoded by a particular germline, gene, or a variant thereof. The illustrative antibodies provided herein comprise variable regions that are encoded by the heavy chain variable region germline genes VH3-23, VH4-39, VH3-11, and VH4-0B or variants thereof; and the light chain variable region germline genes VK1-33, VK3-20, VK1-12, and VK1-05 or variants thereof. One of skill in the art would recognize that the CDR sequences provided herein may also be useful when combined with variable regions encoded by other variable region germline genes or variants thereof. In particular, the CDR sequences provided herein may be useful when combined with variable regions encoded by variable region germline genes, or variants thereof, that are structurally similar to the variable region germline genes recited above. For example, in some embodiments, a CDR-H sequence provided herein may be combined with a variable region encoded by a variable region germline gene selected from the V H1 or V H3 family, or a variant thereof. In some embodiments, a CDR-L sequence provided herein may be combined with a variable region encoded by a variable region germline gene selected from the Vλ3, Vκ1, Vκ3, and Vκ4 families, or a variant thereof.
4. Affinity
In some embodiments, the affinity of the antibody for HLA-G, as indicated by KD, is less than about 10−5 M, less than about 10−6 M, less than about 10−7 M, less than about 10−8 M, less than about 10−9 M, less than about 10−10 M, less than about 10−11 M, or less than about 10−12 M. In some embodiments, the affinity of the antibody is between about 10−7 M and 10−11 M. In some embodiments, the affinity of the antibody is between about 10−7 M and 10−11 M. In some embodiments, the affinity of the antibody is between about 10−7 M and 10−9 M. In some embodiments, the affinity of the antibody is between about 10−7 M and 10−8 M. In some embodiments, the affinity of the antibody is between about 10−8 M and 10−11 M. In some embodiments, the affinity of the antibody is between about 10−8 M and 10−11 M. In some embodiments, the affinity of the antibody is between about 10−9 M and 10−11 M. In some embodiments, the affinity of the antibody is between about 10−10 M and 10−11 M.
In some embodiments, the affinity of the antibody for human HLA-G is between about 1.00×10−8 M and 9.43×10−10 M. In some embodiment, the affinity of the antibody for human HLA-G is about 1.00×10−8 M, about 1.08×10−8 M, about 1.10×10−8 M, about 1.13×10−8 M, about 1.14×10−8 M, about 1.16×10−8 M, about 1.29×10−8 M, about 1.40×10−8 M, about 1.41×10−8 M, about 1.46×10−8 M, about 1.67×10−8 M, about 1.79×10−8 M, about 1.81×10−8 M, about 2.04×10−8 M, about 2.30×10−8 M, about 2.49×10−8 M, about 2.59×10−8 M, about 2.94×10−8 M, about 2.95×10−8 M, about 3.11×10−8 M, about 3.98×10−9 M, about 4.1×10−9 M, about 4.20×10−9 M, about 4.33×10−9 M, about 4.39×10−9 M, about 4.42×10−9 M, about 4.72×10−9 M, about 5.24×10−9 M, about 5.30×10−9 M, about 5.35×10−9 M, about 5.40×10−9 M, about 5.55, 10−9 M, about 5.56×10−9 M, about 5.80×10−9 M, about 5.89×10−9 M, about 5.92×10−9 M, about 5.98×10−9 M, about 5.99×10−9 M, about 6.10×10−9 M, about 6.34×10−9 M, about 6.66×10−9 M, about 6.75×10−9 M, about 7.19×10−9 M, about 7.69×10−9 M, about 7.93×10−9 M, about 8.23×10−9 M, about 8.34×10−9 M, about 8.37×10−9 M, about 8.62×10−9 M, about 8.82×10−9 M, about 9.21×10−9 M, about 9.51×10−9 M, about 1.62×10−10 M, about 1.63×10−10 M, 1.64×10−10 M, about 1.65×10−10 M, about 1.66×10−10 M, about 1.71×10−10 M, about 1.72×10−10 M, about 1.86×10−10 M, about 1.78×10−10 M, about 1.97×10−10 M, about 1.98×10−10 M, about 1.99×10−10 M, about 2.29×10−10 M, about 3.24×10−10M, about 6.47×10−10 M, about 6.96×10−10 M, about 7.84×10−10 M, about 9.41×10−10 M, or about 9.43×10−10 M.
In some embodiments the antibody has a k when associating with human HLA-G of between about 1.41×105 M−1×sec−1 and about 1.07×106 M−1×sec−1. In some embodiments the antibody has a kon when associating with human HLA-G of about 1.41×105 M−1×sec−1, about 1.49×105 M−1×sec−1, about 1.66×105 M−1×sec−1, about 2.90×105 M−1×sec−1, about 3.60×105 M−1×sec−1, about 3.74×105 M−1×sec−1, about 3.78×105 M−1×sec−1, about 4.03×105 M−1×sec−1, about 4.30×105 M−1×sec−1, about 4.32×105 M−1×sec−1, about 4.34×105 M−1×sec−1, about 4.60×105 M−1×sec−1, about 4.64×105 M−1×sec−1, about 4.80×105 M−1×sec−1, about 4.84×105 M−1×sec−1, about 4.87×105 M−1×sec−1, about 4.91×105 M−1×sec−1, about 4.96×105 M−1×sec−1, about 4.97×105 M−1×sec−1, about 4.98×105 M−1×sec−1, about 5.01×105 M−1×sec−1, about 5.14×105 M−1×sec−1, about 5.19×105 M−1×sec−1, about 5.20×105 M−1×sec−1, about 5.26×105 M−1×sec−1, about 5.27×105 M−1×sec−1, about 5.30×105 M−1×sec−1, about 5.61×105 M−1×sec−1, about 5.90×105 M−1×sec−1, about 6.31×105 M−1×sec−1, about 6.32×105 M−1×sec−1, about 6.36×105 M−1×sec−1, about 6.46×105 M−1×sec−1, about 6.53×105 M−1×sec−1, about 6.66×105 M−1×sec−1, about 6.84×105 M−1×sec−1, about 7.20×105 M−1×sec−1, about 7.24×105 M−1×sec−1, about 7.48×105 M−1×sec−1, about 7.36×105 M−1×sec−1, about 7.58×105 M−1×sec−1, about 7.77×105 M−1×sec−1, about 7.92′105 M−1×sec−1, about 7.94×105 M−1×sec−1, about 7.96×105 M−1×sec−1, about 8.03×105 M−1×sec−1, about 8.24×10 M−1×sec−1, about 8.26×105 M−1×sec−1, about 8.55×105 M−1×sec−1, about 8.63×105 M−1×sec−1, about 8.66×105 M−1×sec−1, about 8.74×105 M−1×sec−1, about 8.79×105 M−1×sec−1, about 8.92×105 M−1×sec−1, about 8.96×105 M−1×sec−1, about 9.09×105 M−1×sec−1, about 9.31×105 M−1×sec−1, about 9.35×105 M−1×sec−1, about 9.38×105 M−1×sec−1, about 9.46×105 M−1×sec−1, about 9.54×105 s M−1×sec−1, about 9.73×105 M−1×sec−1, about 9.83×105 M−1×sec−1, about 9.84×105 M−1×sec−1, about 9.91×105 M−1×sec−1, about 1.05×105 M−1×sec−1, or about 1.07×106 M−1×sec−1.
In some embodiments the antibody has a koff when associating with human HLA-G of between about 1.06×102 sec−1 and about 8.55×105 sec−1. In some embodiments the antibody has a koff of about 1.06×10−2 sec−1, about 1.13×10−2 sec−1, about 1.87×10−2 sec−1, about 2.13×10−2 sec−1, about 3.62×10−3 sec−1, about 3.66×10−3 sec−1, about 3.75×10−3 sec−1, about 3.78×10−3 sec−1, about 3.83×10−3 sec−1, about 3.96×10−3 sec−1, about 4.17×10−3 sec−1, about 4.27×10−3 sec−1, about 4.29×10−3 sec−1, about 4.41×10−3 sec−1, about 4.42×10−3 sec−1, about 4.46×10−3 sec−1, about 4.54×10−3 sec−1, about 4.65×10−3 sec−1, about 4.85×10−3 sec−1, about 4.88×10−3 sec−1, about 4.89×10−3 sec−1, about 4.98×10−3 sec−1, about 5.26×10−3 sec−1, about 5.44×10−3 sec−1, about 5.47×10−3 sec−1, about 5.71×10−3 sec−1, about 5.72×10−3 sec−1, about 5.84×10−3 sec−1, about 5.90×10−3 sec−1, about 5.92×10−3 sec−1, about 5.93×10−3 sec−1, about 6.24×10−3 sec−1, about 6.25×10−3 sec−1, about 6.28×10−1 sec−1, about 6.49×10−3 sec−1, about 6.50×10−3 sec−1, about 6.71×10−3 sec−1, about 6.78×10−3 sec−1, about 6.83×10−3 sec−1, about 6.98×10−3 sec−1, about 7.17×10−3 sec−1, about 7.42×10−3 sec−1, about 8.12×10−3 sec−1, about 8.16×10−3 sec−1, about 8.26×10−3 sec−1, about 8.64×10−3 sec−1, about 8.76×10−3 sec−1, about 8.91×10−3 sec−1, about 9.31×10−3 sec−1, about 9.32×10−3 sec−1, about 9.87×10−3 sec−1, about 1.82×10−4 sec−1, about 4.38×10−4 sec−1, about 4.59×10−4 sec−1, about 4.99×10−4 sec−1, about 5.73×10−4 sec−1, about 6.03×10−4 sec−1, or about 8.55×10−5 sec−1.
In some aspects, the KD, ka, and kd are determined at 25° C. In some embodiments, the KD, ka, and kd are determined by surface plasmon resonance. In some embodiments, the KD, ka, and kd are determined according to the methods described in the examples.
5. Inhibition of HLA-G
In some aspects, the antibody decreases the affinity of HLA-G for its ligand(s). In some aspects, the antibody disrupts the association of HLA-G with beta-2-microglobulin and/or its cognate peptide. In some aspects the antibody prevents HLA-G dimerization or oligomizeration.
In some aspects, the antibody inhibits HLA-G function on tumor cells. In some aspects, the antibody inhibits HLA-G function on immune cells. In some embodiments, the antibody blocks HLA-G interaction and/or binding to an ITIM inhibitory receptor. In some embodiments, the antibody blocks HLA-G interaction and/or binding to ILT2. In some embodiments, the antibody blocks HLA-G interaction and/or binding to ILT4. In some embodiments, the antibody blocks HLA-G interaction and/or binding to KIR2DL4.
In some embodiments, the antibody inhibits immune suppressive function. In some embodiments, the antibody inhibits HLA-G mediated suppression of NK cells. In some embodiments, the antibody inhibits HLA-G mediated suppression of cytotoxic T lymphocytes. In some embodiments, the antibody inhibits HLA-G mediated suppression of B cells. In some embodiments, the antibody inhibits HLA-G mediated suppression of neutrophils. In some embodiments, the antibody inhibits HLA-G mediated suppression of dendritic cells. In some embodiments, the antibody inhibits HLA-G mediated suppression of macrophages. In some embodiments, the antibody inhibits HLA-G mediated suppression of monocytes. In some embodiments, the antibody inhibits HLA-G mediated suppression of NK and/or T cell cytolysis and/or proliferation.
In some embodiments, the antibody prevents or inhibits HLA-G mediated suppression of phagocytosis. In some embodiments, the antibody mediates HLA-G mediated induction of T regulatory cells. In some embodiments, the antibody prevents or inhibits the generation or expansion of regulatory T cells. In some embodiments, the antibody inhibits tumor growth by antibody-dependent cellular cytotoxicity (ADCC) or phagocytosis (ADCP).
In some aspects, the decrease is about or less than a 10% decrease, about or less than a 20% decrease, about or less than a 30% decrease, about or less than a 40% decrease, about or less than a 50% decrease, about or less than a 60% decrease, about or less than a 70% decrease, about or less than an 80% decrease, about or less than a 90% decrease, or about a complete decrease. In some aspects, the increase is about or greater than a 10% increase, about or greater than a 20% increase, about or greater than a 30% increase, about or greater than a 40% increase, about or greater than a 50% increase, about or greater than a 60% increase, about or greater than a 70% increase, about or greater than an 80% increase, about or greater than a 90% increase, or a complete increase.
6. HLA-G Assays
In some embodiments, the antibody binds to an epitope of HLA-G. An epitope often consists of a number of contiguous amino acids such as, for example, without limitation, 5-6 amino acids. In some embodiments, the epitope comprises or consists of contiguous or non-contiguous amino acids. In some embodiments, the contiguous or non-contiguous amino acids are within a domain of HLA-G. In some embodiments, the domain comprises or consists of an alpha three domain.
In some aspects, HLA-G has a sequence identical to the amino acid sequence set forth in SEQ ID NO: 342. In some aspects, the epitope has an amino acid sequence that is within the amino acid sequence set forth in SEQ ID NO: 342. In some aspects, the epitope has an amino acid sequence that is 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% identical to a sequence that is within the sequence set forth in SEQ ID NO: SEQ ID NO: 342.
In some aspects, the epitope comprises or consists of a contiguous or non-contiguous span of amino acids including residues 195, 197, and/or 198 of the sequence set forth in SEQ ID NO: 342. In some aspects, the epitope comprises a sequence that is identical or corresponds to residues 195, 197, and/or 198 of a sequence that is within the sequence set forth in SEQ ID NO: 342. In some aspects, the epitope has a sequence that has a 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% identity to a sequence that is within the sequence set forth in SEQ ID NO: 342. In some aspects, the epitope has 1, 2, 3, 4, 5, 6, 7, 8, or 9 substitutions from a sequence that is within the sequence set forth in forth in SEQ ID NO: 342. In some aspects, the epitope has 1, 2 or 3 substitutions from residues a sequence that is within the sequence set forth in SEQ ID NO: 342. In some aspects, the antibody makes contact with any of the residues set forth in FIG. 9.
In some aspects, the antibody competes with any of the antibodies set forth herein. Competition could be, for example, without limitation, binding competition, inhibition competition, or any other form of competition. In some aspects, the antibody competes with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 of antibodies 38410, 38418, 38422, 38426, 38381, 38358, 37323, 38373, 38375, 38379, 38389, 33303, or 33357. In some aspects, the antibody competes with any of the antibodies set forth in FIG. 2 or FIG. 3. In some aspects, the antibody competes with 1, 2, 3, 4, 5, 6, 7, or 8 of 38373, 38375, 38379, 38418, 38422, 38426, 38410 or 38381. In some aspects, the antibody competes with 38358. In some aspects, the antibody competes with 1, 2, 3, 4, 5, 6, 7, 8, or 9 of 38373, 38375, 38379, 38418, 38422, 38426, 38410 or 38381, or 38358. In some aspects, the antibody competes with one or both of 37323 and/or 38389. In some aspects, the antibody competes with one or both of 33303 and/or 33357.
7. Glycosylation Variants
In some embodiments, an antibody may be altered to increase, decrease or eliminate the extent to which it is glycosylated. Glycosylation of polypeptides is typically either “N-linked” or “O-linked.”
“N-linked” glycosylation refers to the attachment of a carbohydrate moiety to the side chain of an asparagine residue. The tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain. Thus, the presence of either of these tripeptide sequences in a polypeptide creates a potential glycosylation site.
“O-linked” glycosylation refers to the attachment of one of the sugars N-acetylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
Addition or deletion of N-linked glycosylation sites to the antibody may be accomplished by altering the amino acid sequence such that one or more of the above-described tripeptide sequences is created or removed. Addition or deletion of O-linked glycosylation sites may be accomplished by addition, deletion, or substitution of one or more serine or threonine residues in or to (as the case may be) the sequence of an antibody.
In certain embodiments, the antibody is glycosylated. In certain embodiments, the antibody is deglycosylated. Carbohydrates may be removed by standard techniques. In certain embodiments, the antibody is aglycosylated, for instance by expression in a system that does not glycosylate.
8. Fc Variants
In some embodiments, amino acid modifications may be introduced into the Fc region of an antibody provided herein to generate an Fc region variant. In some embodiments, the Fc region variant possesses some, but not all, effector functions. Such antibodies may be useful, for example, in applications in which the half-life of the antibody in vivo is important, yet certain effector functions are unnecessary or deleterious. Examples of effector functions include complement-dependent cytotoxicity (CDC) and antibody-directed complement-mediated cytotoxicity (ADCC). Numerous substitutions or substitutions or deletions with altered effector function are known in the art.
In some embodiments, the Fc is modified. In some embodiments, a hinge of an IgG1 or IgG4 antibody is modified. Modification of a hinge region stabilizes an antibody and prevents formation of unwanted bispecific antibodies. In some embodiments, the modification comprises an L234A, L235A, and/or G237A according to a Kabat numbering scheme or residues number 117, 118, and 120, respectively, wherein residues are numbered according to any of SEQ ID NO: 334. In some embodiments, the modification comprises an EU S228P or an S241P according to a Kabat numbering scheme or number 108 according to SEQ ID NO: 335. In some embodiments, an IgG Fc is engineered to modulate antibody effector function (See Wang et al., Protein Cell, 2018, January; 9(1): 63-73), which is incorporated by reference herein in its entirety, including any drawings).
Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest are provided in U.S. Pat. Nos. 5,500,362 and 5,821,337; Hellstrom et al., Proc. Natl. Acad. Sci. U.S.A., 1986, 83:7059-7063; Hellstrom et al., Proc. Natl. Acad. Sci. U.S.A., 1985, 82:1499-1502; and Bruggemann et al., J. Exp. Med., 1987, 166:1351-1361. Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, using an animal model such as that disclosed in Clynes et al. Proc. Natl. Acad. Sci. U.S.A., 1998, 95:652-656.
C1q binding assays may also be carried out to confirm that the antibody is unable to bind C1q and hence lacks CDC activity. Examples of C1q binding assays include those described in WO 2006/029879 and WO 2005/100402.
Complement activation assays include those described, for example, in Gazzano-Santoro et al., J. Immunol. Methods, 1996, 202:163-171; Cragg et al., Blood, 2003, 101:1045-1052; and Cragg and Glennie, Blood, 2004, 103:2738-2743.
FcRn binding and in vivo clearance (half-life determination) can also be measured, for example, using the methods described in Petkova et al., Intl. Immunol., 2006, 18:1759-1769.
9. Preparation of Antibodies
9.1. Antigen Preparation
The HLA-G antigen to be used for production of antibodies may be intact HLA-G or a fragment of HLA-G. The intact HLA-G, or fragment of HLA-G, may be in the form of an isolated protein or expressed by a cell. Other forms of HLA-G useful for generating antibodies will be apparent to those skilled in the art.
9.2. Monoclonal Antibodies
Monoclonal antibodies may be obtained, for example, using the hybridoma method first described by Kohler et al., Nature, 1975, 256:495-497, and/or by recombinant DNA methods (see e.g., U.S. Pat. No. 4,816,567). Monoclonal antibodies may also be obtained, for example, using phage or yeast-based libraries. See e.g., U.S. Pat. Nos. 8,258,082 and 8,691,730.
In the hybridoma method, a mouse or other appropriate host animal is immunized to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the protein used for immunization. Alternatively, lymphocytes may be immunized in vitro. Lymphocytes are then fused with myeloma cells using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell. See Goding J. W., Monoclonal Antibodies: Principles and Practice 3rd ed. (1986) Academic Press, San Diego, Calif.
The hybridoma cells are seeded and grown in a suitable culture medium that contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells. For example, if the parental myeloma cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient cells.
Useful myeloma cells are those that fuse efficiently, support stable high-level production of antibody by the selected antibody-producing cells, and are sensitive media conditions, such as the presence or absence of HAT medium. Among these, preferred myeloma cell lines are murine myeloma lines, such as those derived from MOP-21 and MC-11 mouse tumors (available from the Salk Institute Cell Distribution Center, San Diego, Calif.), and SP-2 or X63-Ag8-653 cells (available from the American Type Culture Collection, Rockville, Md.). Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies. See e.g., Kozbor, J. Immunol. 1984, 133:3001.
After the identification of hybridoma cells that produce antibodies of the desired specificity, affinity, and/or biological activity, selected clones may be subcloned by limiting dilution procedures and grown by standard methods. See Goding, supra. Suitable culture media for this purpose include, for example, D-MEM or RPMI-1640 medium. In addition, the hybridoma cells may be grown in vivo as ascites tumors in an animal.
DNA encoding the monoclonal antibodies may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the monoclonal antibodies). Thus, the hybridoma cells can serve as a useful source of DNA encoding antibodies with the desired properties. Once isolated, the DNA may be placed into expression vectors, which are then transfected into host cells such as bacteria (e.g., E. coli), yeast (e.g., Saccharomyces or Pichia sp.), COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce antibody, to produce the monoclonal antibodies.
9.3. Humanized Antibodies
Humanized antibodies may be generated by replacing most, or all, of the structural portions of a monoclonal antibody with corresponding human antibody sequences. Consequently, a hybrid molecule is generated in which only the antigen-specific variable, or CDR, is composed of non-human sequence. Methods to obtain humanized antibodies include those described in, for example, Winter and Milstein, Nature, 1991, 349:293-299; Rader et al., Proc. Nat. Acad. Sci. U.S.A., 1998, 95:8910-8915; Steinberger et al., J. Biol. Chem., 2000. 275:36073-36078; Queen et al., Proc. Natl. Acad. Sci. U.S.A., 1989, 86:10029-10033; and U.S. Pat. Nos. 5,585,089, 5,693,761, 5,693,762, and 6,180,370.
9.4. Human Antibodies
Human antibodies can be generated by a variety of techniques known in the art, for example by using transgenic animals (e.g., humanized mice). See, e.g., Jakobovits et al., Proc. Natl. Acad. Sci. U.S.A., 1993, 90:2551; Jakobovits et al., Nature, 1993, 362:255-258; Bruggermann et al., Year in Immuno., 1993, 7:33; and U.S. Pat. Nos. 5,591,669, 5,589,369 and 5,545,807. Human antibodies can also be derived from phage-display libraries (see e.g., Hoogenboom et al., J. Mol. Biol., 1991, 227:381-388; Marks et al., J. Mol. Biol., 1991, 222:581-597; and U.S. Pat. Nos. 5,565,332 and 5,573,905). Human antibodies may also be generated by in vitro activated B cells (see e.g., U.S. Pat. Nos. 5,567,610 and 5,229,275). Human antibodies may also be derived from yeast-based libraries (see e.g., U.S. Pat. No. 8,691,730).
10. Vectors, Host Cells, and Recombinant Methods
The invention also provides isolated nucleic acids encoding anti-HLA-G antibodies, vectors and host cells comprising the nucleic acids and recombinant techniques for the production of the antibodies.
For recombinant production of the antibody, the nucleic acid encoding it may be isolated and inserted into a replicable vector for further cloning (i.e., amplification of the DNA) or expression. In some aspects, the nucleic acid may be produced by homologous recombination, for example as described in U.S. Pat. No. 5,204,244.
Many different vectors are known in the art. The vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence, for example as described in U.S. Pat. No. 5,534,615.
Suitable host cells include any prokaryotic (e.g., bacterial), lower eukaryotic (e.g., yeast), or higher eukaryotic (e.g., mammalian) cells. Suitable prokaryotes include cubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia (E. coli), Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella (S. typhimurium), Serratia (S. marcescans), Shigella, Bacilli (B. subtilis and B. licheniformis), Pseudomonas (P. aeruginosa), and Streptomyces. One useful E. coli cloning host is E. coli 294, although other strains such as E. coli B, E. coli X1776, and E. coli W3110 are suitable.
In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are also suitable cloning or expression hosts for anti-HLA-G antibody-encoding vectors. Saccharomyces cerevisiae, or common baker's yeast, is a commonly used lower eukaryotic host microorganism. However, a number of other genera, species, and strains are available and useful, such as Schizosaccharomyces pombe, Kluyveromyces (K. lactis, K. fragilis, K. bulgaricus, K. wickeramii, K. waltii, K. drasophilarum, K. thermotolerans, and K. marxianus), Yarrowia, Pichia pastoris, Candida (C. albicans), Trichoderma reesia, Neuraspora crassa, Schwanniomyces (S. occidentalis), and filamentous fungi such as, for example Penicillium, Tolypocladium, and Aspergillus (A. nidulans and A. niger).
Useful mammalian host cells include COS-7 cells, HEK293 cells; baby hamster kidney (BHK) cells; Chinese hamster ovary (CHO); mouse sertoli cells; African green monkey kidney cells (VERO-76), and the like.
The host cells used to produce the anti-HLA-G antibody of this invention may be cultured in a variety of media. Commercially available media such as, for example, Ham's F10, Minimal Essential Medium (MEM), RPMI-1640, and Dulbecco's Modified Eagle's Medium (DMEM) are suitable for culturing the host cells. In addition, any of the media described in Ham et al., Meth. Enz., 1979, 58:44; Barnes et al., Anal. Biochem., 1980, 102:255; and U.S. Pat. Nos. 4,767,704, 4,657,866, 4,927,762, 4,560,655, and 5,122,469, or WO 90/03430 and WO 87/00195 may be used.
Any of these media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics, trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art.
The culture conditions, such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
When using recombinant techniques, the antibody can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the antibody is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, is removed, for example, by centrifugation or ultrafiltration. For example, Carter et al. (Bio/Technology, 1992, 10:163-167) describes a procedure for isolating antibodies which are secreted to the periplasmic space of E. coli. Briefly, cell paste is thawed in the presence of sodium acetate (pH 3.5), EDTA, and phenylmethylsulfonylfluoride (PMSF) over about 30 minutes. Cell debris can be removed by centrifugation.
In some embodiments, the antibody is produced in a cell-free system. In some aspects, the cell-free system is an in vitro transcription and translation system as described in Yin et al., mAbs, 2012, 4:217-225, incorporated by reference in its entirety. In some aspects, the cell-free system utilizes a cell-free extract from a eukaryotic cell or from a prokaryotic cell. In some aspects, the prokaryotic cell is E. coli. Cell-free expression of the antibody may be useful, for example, where the antibody accumulates in a cell as an insoluble aggregate, or where yields from periplasmic expression are low.
Where the antibody is secreted into the medium, supernatants from such expression systems are generally first concentrated using a commercially available protein concentration filter, for example, an Amicon® or Millipore® Pellcon® ultrafiltration unit. A protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.
The antibody composition prepared from the cells can be purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, and affinity chromatography, with affinity chromatography being a particularly useful purification technique. The suitability of protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc domain that is present in the antibody. Protein A can be used to purify antibodies that are based on human γ1, γ2, or γ4 heavy chains (Lindmark et al., J. Immunol. Meth., 1983, 62:1-13). Protein G is useful for all mouse isotypes and for human γ3 (Guss et al., EMBO J., 1986, 5:1567-1575).
The matrix to which the affinity ligand is attached is most often agarose, but other matrices are available. Mechanically stable matrices such as controlled pore glass or poly(styrenedivinyl)benzene allow for faster flow rates and shorter processing times than can be achieved with agarose. Where the antibody comprises a CH3 domain, the BakerBond ABX® resin is useful for purification.
Other techniques for protein purification, such as fractionation on an ion-exchange column, ethanol precipitation. Reverse Phase HPLC, chromatography on silica, chromatography on heparin Sepharose®, chromatofocusing, SDS-PAGE, and ammonium sulfate precipitation are also available, and can be applied by one of skill in the art.
Following any preliminary purification step(s), the mixture comprising the antibody of interest and contaminants may be subjected to low pH hydrophobic interaction chromatography using an elution buffer at a pH between about 2.5 to about 4.5, generally performed at low salt concentrations (e.g., from about 0 to about 0.25 M salt).
11. Pharmaceutical Compositions and Methods of Administration
Any of the antibodies provided herein can be provided in any appropriate pharmaceutical composition and be administered by any suitable route of administration. Suitable routes of administration include, but are not limited to, the inhalation, intra-arterial, intradermal, intramuscular, intraperitoneal, intravenous, nasal, parenteral, pulmonary, and subcutaneous routes.
The pharmaceutical composition may comprise one or more pharmaceutical excipients. Any suitable pharmaceutical excipient may be used, and one of ordinary skill in the art is capable of selecting suitable pharmaceutical excipients. Accordingly, the pharmaceutical excipients provided below are intended to be illustrative, and not limiting. Additional pharmaceutical excipients include, for example, those described in the Handbook of Pharmaceutical Excipients, Rowe et al. (Eds.) 6th Ed. (2009), incorporated by reference in its entirety.
In some embodiments, the pharmaceutical composition comprises an anti-foaming agent. Any suitable anti-foaming agent may be used. In some aspects, the anti-foaming agent is selected from an alcohol, an ether, an oil, a wax, a silicone, a surfactant, and combinations thereof. In some aspects, the anti-foaming agent is selected from a mineral oil, a vegetable oil, ethylene bis stearamide, a paraffin wax, an ester wax, a fatty alcohol wax, a long chain fatty alcohol, a fatty acid soap, a fatty acid ester, a silicon glycol, a fluorosilicone, a polyethylene glycol-polypropylene glycol copolymer, polydimethylsiloxane-silicon dioxide, ether, octyl alcohol, capryl alcohol, sorbitan trioleate, ethyl alcohol, 2-ethyl-hexanol, dimethicone, oleyl alcohol, simethicone, and combinations thereof.
In some embodiments, the pharmaceutical composition comprises a cosolvent. Illustrative examples of cosolvents include ethanol, poly(ethylene) glycol, butylene glycol, dimethylacetamide, glycerin, and propylene glycol.
In some embodiments, the pharmaceutical composition comprises a buffer. Illustrative examples of buffers include acetate, borate, carbonate, lactate, malate, phosphate, citrate, hydroxide, diethanolamine, monoethanolamine, glycine, methionine, guar gum, and monosodium glutamate.
In some embodiments, the pharmaceutical composition comprises a carrier or filler. Illustrative examples of carriers or fillers include lactose, maltodextrin, mannitol, sorbitol, chitosan, stearic acid, xanthan gum, and guar gum.
In some embodiments, the pharmaceutical composition comprises a surfactant. Illustrative examples of surfactants include d-alpha tocopherol, benzalkonium chloride, benzethonium chloride, cetrimide, cetylpyridinium chloride, docusate sodium, glyceryl behenate, glyceryl monooleate, lauric acid, macrogol 15 hydroxystearate, myristyl alcohol, phospholipids, polyoxyethylene alkyl ethers, polyoxyethylene sorbitan fatty acid esters, polyoxyethylene stearates, polyoxylglycerides, sodium lauryl sulfate, sorbitan esters, and vitamin E polyethylene(glycol) succinate.
In some embodiments, the pharmaceutical composition comprises an anti-caking agent. Illustrative examples of anti-caking agents include calcium phosphate (tribasic), hydroxymethyl cellulose, hydroxypropyl cellulose, and magnesium oxide.
Other excipients that may be used with the pharmaceutical compositions include, for example, albumin, antioxidants, antibacterial agents, antifungal agents, bioabsorbable polymers, chelating agents, controlled release agents, diluents, dispersing agents, dissolution enhancers, emulsifying agents, gelling agents, ointment bases, penetration enhancers, preservatives, solubilizing agents, solvents, stabilizing agents, and sugars. Specific examples of each of these agents are described, for example, in the Handbook of Pharmaceutical Excipients, Rowe et al. (Eds.) 6th Ed. (2009), The Pharmaceutical Press, incorporated by reference in its entirety.
In some embodiments, the pharmaceutical composition comprises a solvent. In some aspects, the solvent is saline solution, such as a sterile isotonic saline solution or dextrose solution. In some aspects, the solvent is water for injection.
In some embodiments, the pharmaceutical compositions are in a particulate form, such as a microparticle or a nanoparticle. Microparticles and nanoparticles may be formed from any suitable material, such as a polymer or a lipid. In some aspects, the microparticles or nanoparticles are micelles, liposomes, or polymersomes. In certain embodiments, a composition provided herein is a pharmaceutical composition or a single unit dosage form. Pharmaceutical compositions and single unit dosage forms provided herein comprise a prophylactically or therapeutically effective amount of one or more prophylactic or therapeutic antibodies.
Further encompassed herein are anhydrous pharmaceutical compositions and dosage forms comprising an antibody, since water can facilitate the degradation of some antibodies.
Anhydrous pharmaceutical compositions and dosage forms provided herein can be prepared using anhydrous or low moisture containing ingredients and low moisture or low humidity conditions. Pharmaceutical compositions and dosage forms that comprise lactose and at least one active ingredient that comprises a primary or secondary amine can be anhydrous if substantial contact with moisture and/or humidity during manufacturing, packaging, and/or storage is expected.
An anhydrous pharmaceutical composition should be prepared and stored such that its anhydrous nature is maintained. Accordingly, anhydrous compositions can be packaged using materials known to prevent exposure to water such that they can be included in suitable formulary kits. Examples of suitable packaging include, but are not limited to, hermetically scaled foils, plastics, unit dose containers (e.g., vials), blister packs, and strip packs.
In some embodiments, the pharmaceutical composition further comprises one or both of an antibody to an immune inhibitory receptor or ligand and/or an antibody to an immune stimulatory receptor and/or ligand. In some embodiments, the pharmaceutical composition further comprises an effective amount of at least one of the following: an anti-ILT2 antibody; an anti-ILT-4 antibody; an anti-ILT4 antibody; an anti-KIR2DL4 antibody; an anti-HLA-E antibody; an anti-NKG2A antibody; an anti-HLA-F antibody; an anti-PD-L1 antibody; an anti-PD-1 antibody; an anti-CTLA4 antibody; an anti-CD38 antibody; an anti-CD73 antibody; an anti-A2A receptor antibody; an anti-A2B receptor antibody; an anti-A2A/A2B dual receptor antibody or a combination thereof; an anti-CD39 antibody; an anti-CD73 antibody; an anti-CD47 antibody; and/or a small molecule inhibitor. In some embodiments, the pharmaceutical composition further comprises an anti-Tim-3 antibody: an anti-TIGIT antibody; an anti-Vista antibody; an anti-CD94 antibody; an anti-ILT2 antibody, an anti-ILT4 antibody, an anti-PD-L1 antibody, and/or an anti-CD47 antibody; a small molecule inhibitor; a bi-specific T cell engager, CAR-T therapy, CAR-NK therapy, CAR-Macrophage therapy, engineered cell therapy, and/or adaptive T cell therapy; an oncolytic virus; a chemotherapy; and/or an ADCC capable therapy using effector competent antibodies such as anti-CD19, anti-CD20, anti-EGFR, anti-Her2, anti-SLAMF7, anti-CD52, anti-BCMA, anti-GD2, anti-CD38, and/or anti-CCR4. In some embodiments, ADCC capable therapy is enhanced ADCC capable therapy. In some embodiments, the effector is enhanced through afucosylation, point mutations, or another method.
11.1. Parenteral Dosage Forms
In certain embodiments, provided are parenteral dosage forms. Parenteral dosage forms can be administered to subjects by various routes including, but not limited to, subcutaneous, intravenous (including bolus injection), intramuscular, and intra-arterial. Because their administration typically bypasses subjects' natural defenses against contaminants, parenteral dosage forms are typically, sterile or capable of being sterilized prior to administration to a subject. Examples of parenteral dosage forms include, but are not limited to, solutions ready for injection, dry products ready to be dissolved or suspended in a pharmaceutically acceptable vehicle for injection, suspensions ready for injection, and emulsions.
Suitable vehicles that can be used to provide parenteral dosage forms are well known to those skilled in the art. Examples include, but are not limited to: Water for Injection USP; aqueous vehicles such as, but not limited to, Sodium Chloride Injection, Ringer's Injection, Dextrose Injection, Dextrose and Sodium Chloride Injection, and Lactated Ringer's Injection; water miscible vehicles such as, but not limited to, ethyl alcohol, polyethylene glycol, and polypropylene glycol; and non-aqueous vehicles such as, but not limited to, corn oil, cottonseed oil, peanut oil, sesame oil, ethyl oleate, isopropyl myristate, and benzyl benzoate.
Excipients that increase the solubility of one or more of the antibodies disclosed herein can also be incorporated into the parenteral dosage forms.
11.2. Dosage and Unit Dosage Forms
In human therapeutics, the doctor will determine the posology which he considers most appropriate according to a preventive or curative treatment and according to the age, weight, condition and other factors specific to the subject to be treated.
The amount of the antibody or composition which will be effective in the prevention or treatment of a disorder or one or more symptoms thereof will vary with the nature and severity of the disease or condition, and the route by which the antibody is administered. The frequency and dosage will also vary according to factors specific for each subject depending on the specific therapy (e.g., therapeutic or prophylactic agents) administered, the severity of the disorder, disease, or condition, the route of administration, as well as age, body, weight, response, and the past medical history of the subject. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems.
In certain embodiments, exemplary doses of a composition include milligram or microgram amounts of the antibody per kilogram of subject or sample weight (e.g., about 10 micrograms per kilogram to about 50 milligrams per kilogram, about 100 micrograms per kilogram to about 25 milligrams per kilogram, or about 100 microgram per kilogram to about 10 milligrams per kilogram). In certain embodiment, the dosage of the antibody provided herein, based on weight of the antibody, administered to prevent, treat, manage, or ameliorate a disorder, or one or more symptoms thereof in a subject is 0.1 mg/kg, 1 mg/kg, 2 mg/kg, 3 mg/kg, 4 mg/kg, 5 mg/kg, 6 mg/kg, 10 mg/kg, or 15 mg/kg or more of a subject's body weight. In another embodiment, the dosage of the composition or a composition provided herein administered to prevent, treat, manage, or ameliorate a disorder, or one or more symptoms thereof in a subject is 0.1 mg to 200 mg, 0.1 mg to 100 mg, 0.1 mg to 50 mg, 0.1 mg to 25 mg, 0.1 mg to 20 mg, 0.1 mg to 15 mg, 0.1 mg to 10 mg, 0.1 mg to 7.5 mg, 0.1 mg to 5 mg, 0.1 to 2.5 mg, 0.25 mg to 20 mg, 0.25 to 15 mg, 0.25 to 12 mg, 0.25 to 10 mg, 0.25 mg to 7.5 mg, 0.25 mg to 5 mg, 0.25 mg to 2.5 mg, 0.5 mg to 20 mg, 0.5 to 15 mg, 0.5 to 12 mg, 0.5 to 10 mg, 0.5 mg to 7.5 mg, 0.5 mg to 5 mg, 0.5 mg to 2.5 mg, 1 mg to 20 mg, 1 mg to 15 mg, 1 mg to 12 mg, 1 mg to 10 mg, 1 mg to 7.5 mg, 1 mg to 5 mg, or 1 mg to 2.5 mg.
The dose can be administered according to a suitable schedule, for example, once, two times, three times, or for times weekly. It may be necessary to use dosages of the antibody outside the ranges disclosed herein in some cases, as will be apparent to those of ordinary skill in the art. Furthermore, it is noted that the clinician or treating physician will know how and when to interrupt, adjust, or terminate therapy in conjunction with subject response.
Different therapeutically effective amounts may be applicable for different diseases and conditions, as will be readily known by those of ordinary skill in the art. Similarly, amounts sufficient to prevent, manage, treat or ameliorate such disorders, but insufficient to cause, or sufficient to reduce, adverse effects associated with the antibodies provided herein are also encompassed by the herein described dosage amounts and dose frequency schedules. Further, when a subject is administered multiple dosages of a composition provided herein, not all of the dosages need be the same. For example, the dosage administered to the subject may be increased to improve the prophylactic or therapeutic effect of the composition or it may be decreased to reduce one or more side effects that a particular subject is experiencing.
In certain embodiments, treatment or prevention can be initiated with one or more loading doses of an antibody or composition provided herein followed by one or more maintenance doses.
In certain embodiments, a dose of an antibody or composition provided herein can be administered to achieve a steady-state concentration of the antibody in blood or serum of the subject. The steady-state concentration can be determined by measurement according to techniques available to those of skill or can be based on the physical characteristics of the subject such as height, weight and age.
In certain embodiments, administration of the same composition may be repeated and the administrations may be separated by at least 1 day, 2 days, 3 days, 5 days, 10 days, 15 days, 30 days, 45 days, 2 months, 75 days, 3 months, or 6 months. In other embodiments, administration of the same prophylactic or therapeutic agent may be repeated and the administration may be separated by at least 1 day, 2 days, 3 days, 5 days, 10 days, 15 days, 30 days, 45 days, 2 months, 75 days, 3 months, or 6 months.
12. Therapeutic Applications
For therapeutic applications, the antibodies of the invention are administered to a mammal, generally a human, in a pharmaceutically acceptable dosage form such as those known in the art and those discussed above. For example, the antibodies of the invention may be administered to a human intravenously as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intra-cerebrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, or intratumoral routes. The antibodies also are suitably administered by peritumoral, intralesional, or perilesional routes, to exert local as well as systemic therapeutic effects. The intraperitoneal route may be particularly useful, for example, in the treatment of ovarian tumors.
The antibodies provided herein may be useful for the treatment of any disease or condition involving HLA-G, such as cancer, autoimmune disease, and infection.
Any suitable cancer may be treated with the antibodies provided herein. Illustrative suitable cancers include, for example, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), adrenocortical carcinoma, anal cancer, appendix cancer, astrocytoma, basal cell carcinoma, brain tumor, bile duct cancer, bladder cancer, bone cancer, breast cancer, bronchial tumor, Burkitt Lymphoma, carcinoma of unknown primary origin, cardiac tumor, cervical cancer, chordoma, chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), chronic myeloproliferative neoplasm, colon cancer, colorectal cancer, craniopharyngioma, cutaneous T-cell lymphoma, ductal carcinoma, embryonal tumor, endometrial cancer, ependymoma, esophageal cancer, esthesioneuroblastoma, fibrous histiocytoma, Ewing sarcoma, eye cancer, germ cell tumor, gallbladder cancer, gastric cancer, gastrointestinal carcinoid tumor, gastrointestinal stromal tumor, gestational trophoblastic disease, glioma, head and neck cancer, hairy cell leukemia, hepatocellular cancer, histiocytosis, Hodgkin lymphoma, hypopharyngeal cancer, intraocular melanoma, islet cell tumor, Kaposi sarcoma, kidney cancer, Langerhans cell histiocytosis, laryngeal cancer, leukemia, lip and oral cavity cancer, liver cancer, lobular carcinoma in situ, lung cancer, lymphoma, macroglobulinemia, malignant fibrous histiocytoma, melanoma, Merkel cell carcinoma, mesothelioma, metastatic squamous neck cancer with occult primary, midline tract carcinoma involving NUT gene, mouth cancer, multiple endocrine neoplasia syndrome, multiple myeloma, mycosis fungoides, myelodysplastic syndrome, myelodysplastic/myeloproliferative neoplasm, nasal cavity and par nasal sinus cancer, nasopharyngeal cancer, neuroblastoma, non-Hodgkin lymphoma, non-small cell lung cancer, oropharyngeal cancer, osteosarcoma, ovarian cancer, pancreatic cancer, papillomatosis, paraganglioma, parathyroid cancer, penile cancer, pharyngeal cancer, pheochromocytomas, pituitary tumor, pleuropulmonary blastoma, primary central nervous system lymphoma, prostate cancer, rectal cancer, renal cell cancer, renal pelvis and ureter cancer, retinoblastoma, rhabdoid tumor, salivary gland cancer, Sezary syndrome, skin cancer, small cell lung cancer, small intestine cancer, soft tissue sarcoma, spinal cord tumor, stomach cancer, T-cell lymphoma, teratoid tumor, testicular cancer, throat cancer, thymoma and thymic carcinoma, thyroid cancer, urethral cancer, uterine cancer, vaginal cancer, vulvar cancer, and Wilms tumor. In some embodiments, the cancer is selected from breast, lung, CRC, gastric, esophageal, neuroblastoma, cervical, and hematological cancers.
Any suitable autoimmune disease may be treated with the antibodies provided herein. Illustrative suitable autoimmune diseases, or diseases with an autoimmune component, include, for example, acute disseminated encephalomyelitis (ADEM), acute necrotizing hemorrhagic leukoencephalitis, Addison's disease, agammaglobulinemia, alopecia areata, amyloidosis, ankylosing spondylitis, anti-GBM/anti-TBM nephritis, antiphospholipid syndrome (APS), autoimmune angioedema, autoimmune aplastic anemia, autoimmune dysautonomia, autoimmune hepatitis, autoimmune hyperlipidemia, autoimmune immunodeficiency, autoimmune inner ear disease (AIED), autoimmune myocarditis, autoimmune oophoritis, autoimmune pancreatitis, autoimmune retinopathy, autoimmune thrombocytopenic purpura (ATP), autoimmune thyroid disease, autoimmune urticarial, axonal & neuronal neuropathies, Balo disease, Behcet's disease, bullous pemphigoid, cardiomyopathy, Castleman disease, Celiac disease, Chagas disease, chronic fatigue syndrome, chronic inflammatory demyelinating polyneuropathy (CIDP), chronic recurrent multifocal ostomyelitis (CRMO), Churg-Strauss syndrome, cicatricial pemphigoid/benign mucosal pemphigoid, Crohn's disease, Cogans syndrome, cold agglutinin disease, colitis, congenital heart block, coxsackie myocarditis, CREST disease, essential mixed cryoglobulincmia, demyelinating neuropathies, dermatitis herpetiformis, dermatomyositis, Devic's disease (neuromyelitis optica), discoid lupus, Dressler's syndrome, endometriosis, eosinophilic esophagitis, eosinophilic fasciitis, erythema nodosum, experimental allergic encephalomyelitis, Evans syndrome, fibromyalgia, fibrosing alveolitis, giant cell arteritis (temporal arteritis), giant cell myocarditis, glomerulonephritis, Goodpasture's syndrome, granulomatosis with polyangiitis (GPA) (formerly called Wegener's Granulomatosis), Graves' disease, Guillain-Barre syndrome, Hashimoto's encephalitis, Hashimoto's thyroiditis, hemolytic anemia, Henoch-Schonlein purpura, herpes gestationis, hypogammaglobulinemia, idiopathic thrombocytopenic purpura (ITP), IgA nephropathy, IgG4-related sclerosing disease, immunoregulatory lipoproteins, inclusion body myositis, inflammatory bowel disease, interstitial cystitis, juvenile arthritis, juvenile diabetes (Type I diabetes), juvenile myositis, Kawasaki syndrome, Lambert-Eaton syndrome, leukocytoclastic vasculitis, lichen planus, lichen sclerosus, ligneous conjunctivitis, linear IgA disease (LAD), lupus (SLE), Lyme disease (chronic), Meníere's disease, microscopic polyangiitis, mixed connective tissue disease (MCTD), Mooren's ulcer, Mucha-Habermann disease, multiple sclerosis, myasthenia gravis, myositis, narcolepsy, neuromyelitis optica (Devic's), neutropenia, ocular cicatricial pemphigoid, optic neuritis, palindromic rheumatism, PANDAS (Pediatric Autoimmune Neuropsychiatric Disorders Associated with Streptococcus), paraneoplastic cerebellar degeneration, paroxysmal nocturnal hemoglobinuria (PNH), Parry Romberg syndrome, Parsonnage-Turner syndrome, pars planitis (peripheral uveitis), pemphigus, peripheral neuropathy, perivenous encephalomyelitis, pernicious anemia, POEMS syndrome, polyarteritis nodosa, type I, II, & III autoimmune polyglandular syndromes, polymyalgia rheumatic, polymyositis, postmyocardial infarction syndrome, postpericardiotomy syndrome, progesterone dermatitis, primary biliary cirrhosis, rimary sclerosing cholangitis, psoriasis, psoriatic arthritis, idiopathic pulmonary fibrosis, pyoderma gangrenosum, pure red cell aplasia, Raynauds phenomenon, reactive arthritis, reflex sympathetic dystrophy, Reiter's syndrome, relapsing polychondritis, restless legs syndrome, retroperitoneal fibrosis, rheumatic fever, rheumatoid arthritis, sarcoidosis, Schmidt syndrome, scleritis, scleroderma, Sjogren's syndrome, sperm & testicular autoimmunity, stiff person syndrome, subacute bacterial endocarditis (SBE), Susac's syndrome, sympathetic ophthalmia, Takayasu's arteritis, temporal arteritis/giant cell arteritis, thrombotic disease, thrombocytopenic purpura (TTP), Tolosa-Hunt syndrome, transverse myelitis, type I diabetes, ulcerative colitis, undifferentiated connective tissue disease (UCTD), uveitis, vasculitis, vesiculobullous dermatosis, vitiligo, and Wegener's granulomatosis (now termed Granulomatosis with Polyangiitis (GPA).
Any suitable infection may be treated with the antibodies provided herein. Illustrative suitable infections include, for example, hepatitis A virus, hepatitis B virus, hepatitis C virus (HCV), human immunodeficiency virus (HIV), and other viral infections.
Some embodiments provide for treatment of a subject suffering from cancer, a chronic infection, or from an inflammatory disease, comprising the step of administering to the subject a pharmaceutical composition comprising an effective amount of any of the antibodies set forth herein. Some embodiments provide for treatment of a subject suffering from cancer, a chronic infection, or from an inflammatory disease, comprising the step of administering to the subject a pharmaceutical composition comprising an effective amount of any of the antibodies set forth herein in combination with an effective amount of another antibody set forth herein. In some embodiments, the cancer is a hematological cancer.
Some embodiments provide a method for modulating immune system function in a subject in need thereof, comprising the step of contacting a population of immune cells of the subject with a pharmaceutical composition comprising an effective amount of the antibody as set forth herein, under conditions such that the immune system is modulated. Some embodiments provide a method for modulating immune system function in a subject in need thereof, comprising the step of contacting a population of immune cells of the subject with an effective amount of any of the antibodies set forth herein in combination with an effective amount of another antibody set forth herein. In some embodiments, the antibody comprises a bispecific antibody or a complexing antibody.
In some embodiments, the bispecific antibody or the complexing antibody is administered in an amount sufficient to achieve 1, 2, 3, 4, 5, 6, 7, or 8 of the following in the subject:
    • a) inhibition of immune suppression;
    • b) reduction of levels of regulatory T cells;
    • c) increase an activity of myeloid cells;
    • d) increase in activity of cytotoxic T lymphocytes, NK cells, B cells, neutrophils, monocytes, macrophages, and/or dendritic cells;
    • e) increase in phagocytic activity;
    • f) inhibition of metastasis;
    • g) inhibition of tumor growth; and/or
    • h) induction of tumor regression.
      In some embodiments, the bispecific antibody binds HLA-G and HLA-E.
In some embodiments, the method for modulating immune system function in a subject in need thereof further comprises administering chemotherapy, administering radiation therapy, and/or administering one or more additional therapeutic agents. In some embodiments, the one or more additional therapeutic agents comprise one or more immunostimulatory agents. In some embodiments, the one or more immunostimulatory agents comprise an antagonist to an inhibitory receptor of an immune cell. In some embodiments, the inhibitory receptor is at least one of ILT2, ILT3, ILT4, KIR2DL4, CTLA-4, PD-1, CD39, CD73, PD-L1, PD-L2, LAG-3, TIGIT, B7-H3, B7-H4, Tim3, neuritin, BTLA, CECAM-1, CECAM-5, VISTA, LAIR1, CD160, 2B4, TGF-B, NKG2A, and/or a Killer-cell immunoglobulin-like receptor (KIR).
In some embodiments, the one or more immunostimulatory agents comprise an agonist of a co-stimulatory receptor of an immune cell. In some embodiments, the co-stimulatory receptor comprises one or more of OX40, CD2, CD27, ICAM-1, LFA-1, ICOS (CD278), 4-1BB (CD137), GITR, CD28, CD30, CD40, BAFFR, HVEM, CD7, LIGHT, NKG2C, SLAMF7, NKp30, NKp46, NKp80, CD160, and/or a CD83 ligand.
In some embodiments, the one or more immunostimulatory agents comprise a cytokine. In some embodiments, the cytokine is at least one of IL-1, IL-2, IL-5, IL-7, IL-10, IL-12, IL-15, IL-21, and/or IL-27. In some embodiments, the one or more immunostimulatory agents comprise an oncolytic virus. In some embodiments, the oncolytic virus comprises one or more of the oncolytic virus is a Herpes simplex virus, a Vesicular stomatitis virus, an adenovirus, a Newcastle disease virus, a vaccinia virus, or a maraba virus. In some embodiments, the one or more immunostimulatory agents comprise a chimeric antigen engineered T cell. In some embodiments, immunostimulatory agents comprise a bi- or multi-specific T cell directed antibody. In some embodiments, the one or more immunostimulatory agents comprises or consists of an ADCC competent antibody that may target CD19, CD20, EGFR, Her2, SLAMF7, CD52, BCMA, GD2, CD38, or CCR4. In some embodiments, the ADCC competent antibody is effector enhanced through afucosylation, point mutations, or otherwise.
In some embodiments, the one or more immunostimulatory agents comprise a bi-specific T cell engager and/or CAR-T therapy, CAR-NK therapy, CAR-macrophage therapy, adoptive T cell therapy.
13. Diagnostic Applications and Diagnostic Methods
In some embodiments, the antibodies provided herein are used in diagnostic applications and/or diagnostic methods. For example, an anti-HLA-G antibody may be useful in assays for HLA-G protein. In some aspects, the antibody can be used to detect the expression of HLA-G in various cells and tissues. In some embodiments, the antibody can be used to detect the soluble HLA-G in fluids. In some embodiments, the fluids comprise or consist of blood, serum, ascites, and/or other fluids. The assays may be useful, for example, evaluating cancer and autoimmune disease.
In some embodiments, the diagnostic method comprises or consists of detecting tumor expressed HLA-G. In some embodiments, the diagnostic method comprises or consists of detecting soluble HLA-G. In some embodiments the detection method comprises or consists of detecting HLA-G expression on immune cells.
In some diagnostic applications, the antibody may be labeled with a detectable moiety. Suitable detectable moieties include, but are not limited to radioisotopes, fluorescent labels, and enzyme-substrate labels. In another embodiment of the invention, the anti-HLA-G antibody need not be labeled, and the presence thereof can be detected using a labeled antibody which specifically binds to the anti-HLA-G antibody.
14. Affinity Purification Reagents
The antibodies of the invention may be used as affinity purification agents. In this process, the antibodies may be immobilized on a solid phase such a resin or filter paper, using methods well known in the art. The immobilized antibody is contacted with a sample containing the HLA-G protein (or fragment thereof) to be purified, and thereafter the support is washed with a suitable solvent that will remove substantially all the material in the sample except the HLA-G protein, which is bound to the immobilized antibody. Finally, the support is washed with another suitable solvent, such as glycine buffer, pH 5.0, that will release the HLA-G protein from the antibody.
15. Kits
In some embodiments, an anti-HLA-G antibody provided herein is provided in the form of a kit, i.e., a packaged combination of reagents in predetermined amounts with instructions for performing a procedure. In some embodiments, the procedure is a diagnostic assay. In other embodiments, the procedure is a therapeutic procedure.
In some embodiments, the kit further comprises a solvent for the reconstitution of the anti-HLA-G antibody. In some embodiments, the anti-HLA-G antibody is provided in the form of a pharmaceutical composition.
EXAMPLES Example 1: Selection of HLA-G Antibodies
HLA-G antibodies were selected from a synthetic library of human antibodies presented on the surface of yeast cells in IgG format, as generally described, e.g., in WO2009036379; WO2010105256; WO2012009568; and Xu et al., Protein Eng. Des. Sel., 2013, 26:663-670 (each incorporated by reference in its entirety), and more specifically as provided below. The sequences and characteristics of the antibodies isolated from the recombinant library are provided in Table S.
Eight naïve human synthetic yeast libraries each of ˜10E+09 diversity were propagated as described in WO2009036379; WO2010105256; WO2012009568; and Xu et al., Protein Eng. Des. Sel., 2013, 26:663-670; each incorporated by reference in its entirety. For the first two rounds of selection, a magnetic bead sorting technique utilizing the Miltenyi MACS® system was performed, as described in Siegel et al., J. Immunol. Meth., 2004, 286:141-153. The following rounds of selection were performed using flow cytometry-based sorting. For all rounds of selection, the antigen was biotinylated human HLA-G, decreasing concentrations of antigen were used in each subsequent round of selection. In addition to selection on antigen, some rounds of selection were employed to reduce the number of non-specific binders utilizing soluble membrane proteins from CHO cells (see WO2014179363 and Xu et al., Protein Eng. Des. Sel., 2013, 26:663-670, each incorporated by reference in its entirety). In addition to the CHO cell proteins, deselections against recombinant HLA-A/B/C proteins were performed to maintain specific binding to HLA-G. After the final round of sorting, yeast were plated and individual colonies were picked for characterization and for nomination of clones for affinity maturation.
Antibody variable domains of interest were synthesized, with codon optimization to maximize transient expression in host cells. The variable regions were cloned into expression vectors containing human immunoglobulin constant domains and their sequence confirmed. Antibody heavy and light chain vector pairings were transfected into Expi293 cells using the Expifectamine system (Invitrogen). Transient cultures were harvested on day 4 and clarified cell culture supernatant IgG titer was estimated using Bio-Layer Interferometry (BLI) using Octet (ForteBio) alongside standards. Antibodies were subsequently purified on a Protein A column and eluted using low pH glycine. Purified antibody samples were then buffer-exchanged or dialyzed into downstream assay-compatible buffers.
Antibody purity was assessed by running samples on SDS-PAGE and on an analytical size exclusion chromatography column.
Light Chain Shuffling: Heavy chain plasmids were extracted from naïve outputs (described herein) and transformed into a pre-made naïve light chain library with a diversity of 10E+06. Selections were performed as described above with one round of MACS sorting and three rounds of FACS sorting using decreasing amounts of biotinylated HLA-G antigen for respective rounds.
Example 2: Affinity Maturation
Optimization of nave clones was carried out utilizing four maturation strategies; diversification of CDR-H1 and CDR-H2; diversification of CDR-H3; diversification of CDR-L1, L2 and L3; shuffling of diversified heavy and light chains.
CDR-H1 and CDR-H2 Selection: The CDR-H3s from clones selected from light chain batch diversification, light chain diversification, and naive discovery efforts were independently recombined into premade libraries with CDR-H1 and CDR-H2 variants of a diversity of >10E+8. Selections were performed using HLA-G antigen. Affinity pressures were applied by using decreasing concentrations of antigen and HLA-G specificity was maintained with deselections against HLA-A/B/C antigens.
CDR-H3 Selection: After characterization of CDR-H1 and CDR-H2 variants, clones with binding to HLA antigens outside of HLA-G were removed. Chemical liabilities were also removed from the variable regions when applicable. The remaining clones obtained from the CDR-H1 and CDR-H2 selection procedure were subject to additional rounds of affinity maturation via walking dimer mutagenesis of the CDR-H3. Selections were performed using HLA-G as antigen generally as described above, except for employing FACS sorting for all selection rounds.
CDR-L1, L2, L3 Selection: Clones obtained from the CDR-H1 and CDR-H2 selection procedure were subject to additional rounds of affinity maturation via mutagenesis of the light chain. The CDR-L1 and CDR-L2 diversity was derived from a pre-made library while CDR-L3 diversity was derived from walking monomer mutagenesis. Selections were performed using HLA-G as antigen, starting with one round of MACS followed by three rounds of FACS in the CDR-L1, L2, L3 process described here.
Diversified Heavy Chain and Light Chain Shuffling: Outputs from CDR-H3 diversification and CDR-L1, L2, L3 diversification described above were recombined and selections were performed using HLA-G as antigen generally as described above, except for employing FACS sorting for all selection rounds.
Example 3: Binding Affinity of Anti-HLA-G Antibodies to Recombinant HLA-G
Binding kinetics were measured using the Octet Red96 system (Pall ForteBio) at 30° C. in running buffer (1× Pall ForteBio Kinetics Buffer diluted into 1×PBS pH 7.4). In brief, 0.16 μg % ml of biotinylated recombinant HLA-G/β2m/peptide heterotrimer was loaded onto streptavidin (SA) biosensors to a binding response of approximately 0.25 nm. After a short baseline step in running buffer, the biosensors were exposed to varying concentrations (1.5, 3.0, or 30 nM) of full-length anti-HLA-G mAbs for the association step. Dissociation of the complex was monitored upon dipping the sensors to running buffer once again for up to 30 min. Data was processed using ForteBio Octet DataAnalysis software (version 10) with background subtraction of biosensors without HLA-G. A 1:1 Langmuir binding model was fit to each sensorgram to obtain association and dissociation rates via local-full or local-partial fitting. KD was calculated from the ratio of kd to ka. Monovalent affinities were obtain using identical methods but Fabs were used instead of IgGs.
FIG. 1 provides a table showing avid and monovalent affinities of anti-HLA-G antibodies to recombinant HLA-G protein. Data shown in FIG. 1 had R2>0.98. ND=not determined using Fabs. The avid KD values ranged from 11.7 nanomolar to sub picomolar with off-rates (koff) ranging from 0.007 sec−1 to the Octet off-rate limit (1.0×10-7 sec−1). Monovalent KD values ranged from 0.187 nM to 208 nM, but monovalent affinities for clones that had weaker avid affinities were not determined.
Example 4: Antibodies that Bind to HLA-G and Bin Separately from Other Antibodies
Epitope binning assays to recombinant HLA-G heterotrimer were determined using the Octet Red96 system (Pall ForteBio) at 30′C in running buffer (1× Pall ForteBio Kinetics Buffer diluted into 1×PBS pH 7.4). Briefly, 0.16 μg/ml of biotinylated recombinant HLA-G/β2m/peptide heterotrimer was loaded onto streptavidin (SA) biosensors to a binding response of approximately 0.25 nm. After a short baseline step in running buffer, the biosensor was dipped into 20 μg/ml of each mAb and continued until the binding response to HLA-G reached saturation. For the competing association step, equimolar concentrations of each mAb to the saturating mAb was used.
Epitope binning was performed in each direction (every mAb was used as both the saturating mAb (association step 1) as well as the competing mAb (association step 2)). Self-blocking sensorgrams are shown in gray. Non-self sensograms are shown in black; black sensorgrams represent the pairwise binning mAb. Sensorgrams from only the second association step were shown in FIG. 2.
FIG. 2A provides biolayer interferometry sensorgrams showing tested antibodies that bind HLA-G can be divided into three distinct chemical bins, with one chemical bin being further divided. Gray sensorgrams indicate self-blocking; black sensorgrams indicate pairwise binning. The y-axis show saturating antibody; the x-axis shows competing antibody.
FIG. 2B provides biolayer sensorgrams showing antibodies (Fabs) that bind HLA-G and can be separated into two sub-bins from a broader bin 1. Bin 1a Fabs do not block competing bin 1b Fabs. However, bin 1b Fabs block bin 1a Fabs. As described above, gray sensorograms indicated self-blocking and black sensorograms represent pairwise binning. The y-axis represents the saturating Fab and the x-axis represents the competing Fab.
Example 5: Anti-HLA-G Antibodies that Block HLA-G Interaction/Binding to Recombinant ILT2 and ILT4
Blocking assays between recombinant HLA-G heterotrimer and recombinant extracellular domain of ILT2 or ILT4 proteins was determined using the Octet Red96 system (Pall ForteBio) at 30° C. in running buffer (1× Pall ForteBio Kinetics Buffer diluted into 1× PBS pH 7.4). Briefly, 0.16 μg/ml of biotinylated recombinant HLA-G/2m/peptide heterotrimer was loaded onto streptavidin (SA) biosensors to a binding response of approximately 0.25 nm. After a short baseline step in running buffer, the biosensor was dipped into at least 200 nM of each mAb (up to 0.5 μM for weakly binding mAbs) and continued until the binding response to HLA-G reached saturation. A second association step immediately followed by dipping into wells containing dimerized ILT2 or ILT4. Dimers were obtained via pre-incubation of the His-tagged ILT2 or ILT4 with anti-His mAb (MAB050, R&D Systems). ILT2/ILT4 binding response to mAb-saturated HLA-G (black sensorgrams) was compared to HLA-G in the absence of anti-HLA-G mAb (gray sensorgrams).
Sensorgrams from the second association step are shown in FIG. 3. The provided sensorgrams show antibodies that bind and fully block HLA-G interaction with ILT2 and ILT4, for example, the bin1a and bin1b antibodies 38381 and 38358, respectively. As indicated, gray sensorgrams indicate ILT2 or ILT4 binding in the absence of antibody; black sensorgrams represent ILT2 or ILT4 binding in the presence of antibody.
FIG. 3 also provides biolayer interferometry sensorgrams showing antibodies that bind but do not block HLA-G interaction with ILT2 or ILT4, for example, the bin 3 antibodies such as 33357. Gray sensorgrams indicate ILT2 or ILT4 binding response in the absence of antibody; black sensorgrams indicate ILT2 or ILT4 binding in the presence of antibody.
The provided sensorgrams also show antibodies that bind and block HLA-G interaction with ILT2 or ILT4 to an intermediate effect, such as the bin 2 antibody 38389.
Example 6: Anti-HLA-G Antibodies Bind to HLA-G Naturally Expressed on JEG-3 Cells
JEG-3 parentals or HLA-G-knock out (JEG-3 KO) cells were incubated with 100 nM of anti-HLA-G antibodies for 2 hours at 4° C. in wash buffer (Phosphate Buffered Saline (PBS), 2% Fetal bovine serum (FBS) and 2 mM EDTA). Cells were then washed in wash buffer and incubated with an APC conjugated secondary antibody (goat anti-human IgG Kappa) at a 1:500 dilution in wash buffer for 30 minutes at 4° C. Cells were subsequently washed and resuspended in 1% paraformaldehyde/wash buffer followed by sample acquisition using a BD Fortessa X-20 flow cytometer (Becton Dickinson). Sample data was exported as FCS files and analyzed using FlowJo software v10 (Tree Star, Inc.).
The results are shown in FIG. 4. The shaded histogram represents binding of an isotype control to JEG-3 cells at the same concentration.
Example 7: Anti-HLA-G Antibodies Abrogate Suppression Mediated Through HLA-G-ILT2 or ILT4 Interaction in NKL Killing Assay
Inhibition of NKL cytotoxicity via the ILT2-HLA-G interaction or ILT4-HLA-G interaction is abrogated by anti-HLA-G antibodies. NKL (Effector) cells were co-incubated with 721.221 (Target) cells+/−HLA-G expression at an E:T ratio of 4:1 overnight at 37° C. 721.221s were pre-incubated with 200 nanomolar (nM) Fab fragments or full-length intact anti-HLA-G antibodies for 60 minutes at 37° C. Prior to antibody pre-treatment, 721.221 cells were labelled with 1:1000 CellTrace Violet (CTV) (Invitrogen) in 37° C. PBS.
After overnight co-incubation, cells were washed once in 4° C. wash buffer (Phosphate Buffeed Saline, 2% FBS, 2 mM EDTA) and then stained with 1:2000 Fixable Viability Dye eFluor™ 780 (Invitrogen) 30 minutes at 4° C. Cells were washed again in 4° C. wash buffer resuspended in wash buffer and analyzed for percent dead 721.221 cells by flow cytometry analysis on a BD Celesta flow cytometer. Percent of dead 721.221 cells was determined by gating on CTV positive cells, then dividing the Fixable Viability Dye positive portion of these cells by the total CTV count.
Antibody MEM-G/9 is a commercially available antibody (See, Fournel et al., Tissue Antigens 200: 55: 510-518 (1999), which is incorporated by reference in its entirety herein, including any drawings).
FIG. 5A (Fab fragments) and FIG. 5B (intact IgG) show the effect on NKL cells that endogenously express ILT2. The percent of dead target cells is shown for each antibody (indicated as a unique clone number in the figure) in addition to control values representing minimum and maximum killing in the presence and absence of HLA-G, respectively. As can be seen from FIG. 5, Bin 1 antibodies show the best blockade of all the antibodies tested.
FIG. 5C demonstrates the dose response of a specific Bin 1 anti-HLA-G Fab fragment for blockade of HLA-G-mediated suppression of NKL killing through endogenously expressed ILT2.
FIG. 5D demonstrates the dose response of a specific Bin 1 anti-HLA-G Fab fragment for blockade of HLA-G-mediated suppression of NKL killing through engineered expression of ILT4 (engineered cell line modified by knocking down ILT2 and retrovirally transduced to express ILT4).
Example 8: Fab Fragments of Anti-HLA-G Antibodies Reverse HLA-G Mediated Suppression of Macrophage Phagocytosis, NK Cell Cytotoxicity, and CD8+ T Cell Activity
CD14+ enriched cells were differentiated into adherent macrophages by incubating at 37° C., 5% CO2 for 7 days in complete RPMI (cRPMI) with recombinant human M-CSF. Cells were harvested after 7 days, washed, and resuspended in cRPMI. Cells were plated in a 96-well round bottom plate at 50,000 cells/well in 50 μl cRPMI and incubated at 37° C., 5% CO2, before being combined with the target cells.
The target cells, consisting of either 721.221 parental cells or 721.221-HLA-G, were stained with CTV (1:1000) at 37° C. in PBS, washed and plated in cRPMI at 25,000 cells per well. Cells were subsequently incubated with anti-CD47 antibody with or without anti-HLA-G Fabs for 1 hour at 37° C., 5% CO2. The mixture of 721.221 and antibody was then combined with macrophages and incubated for either 2 hours or overnight at 37° C., 5% CO2. The final ratio of macrophage to 721.221 target cell was 2:1. After either the 2 hour or overnight incubation, cells were blocked with wash buffer/BD Fc Block™/2% mouse serum for 20 minutes and then stained with anti-CD11b and live/dead discrimination dye for 20 minutes. Cells were then washed, resuspended in wash buffer and analyzed on the BD Fortessa flow cytometer. Sample data was exported as FCS files and analyzed using FlowJo software v10.
In the 2-hour format assay, macrophages were assayed for the presence of CTV as a readout of phagocytic uptake of CTV+ target cells. Live cells were gated on CD11b+/CTV+ and reported as a percent of total live macrophages. For the overnight assay, macrophage killing activity was assessed by measuring absolute counts of remaining live CTV+ cells per well.
FIG. 6A compares results between the two hour and overnight assay formats using an anti-HLA-G antibody (Fab fragment). The overnight assay achieves similar results as the two hour assay that directly measures phagocytosis of target cells. FIG. 6B shows the results of Fab fragments of each anti-HLA-G antibody that were tested in the overnight assay to determine the level of restored phagocytic activity.
To demonstrate inhibition of primary human NK cell cytotoxicity is abrogated by an anti-HLA-G antibody, HLA-G expressing target cells (721.221-HLA-G) were pre-incubated with a representative Bin 1 antibody (Fab fragment) and then co-cultured with human primary NK (Effector) cells from 3 separate donors at an E:T ratio of 4:1 overnight at 37° C. Prior to antibody pre-treatment, 721.221 cells were labelled with 1:1000 CellTrace Violet (CTV) (Invitrogen) in 37° C. PBS.
After overnight co-incubation, cells were washed once in 4° C. wash buffer (Phosphate Buffered Saline, 2% FBS, 2 mM EDTA) and then stained with 1:2000 Fixable Viability Dye eFluor 780 (Invitrogen) for 30 minutes at 4° C. Cells were washed, resuspended in wash buffer, and analyzed for percent dead 721.221 cells by flow cytometry analysis on a BD Celesta flow cytometer. Percent of dead 721.221 cells was determined by gating on CTV positive cells, then dividing the Fixable Viability Dye positive portion of these cells by the total CTV count.
The results are shown in FIG. 6C. The percent of dead target cells is shown for the Bin 1 antibody (Fab) in addition to control values representing co-cultures with 721.221 target cells with and without HLA-G expression (noted as HLA-G and no HLA-G in figure, respectively). An isotype control Fab (Ctrl Fab) was used as a negative control.
To demonstrate an anti-HLA-G antibody reverses HLA-G mediated suppression of cytotoxic primary CD8+ T cell function, human CD8+ T cells treated with CD3/CD28 activator (ImmunoCult™, Stem Cell Technologies) for 1 hour were mixed with antibody pre-treated 721.221 cells (with and without expression of HLA-G) and co-cultured overnight at 37° C. After overnight co-incubation, Monensin Solution (ThermoFisher) and eFluor 450-CD107a (ThermoFisher) were added; the final amount of each reagent was 0.5 μg/mL antibody and 2 μM Monensin. The assay was incubated for 4 hours.
After the incubation, cells were washed and stained over several steps which included the following: (1) live/dead cell staining using Fixable Viability Dye eFluor 780 (ThermoFisher); (2) Fc blocking with staining buffer (Phosphate Buffered Saline, 2% FBS, 2 mM EDTA) containing 6% normal mouse serum and 5 μL Human TruStain FcX™ per sample (Biolegend) for 15 minutes at 4° C.; (3) CD8 and ILT2 staining with Alexa Fluor 700-CD8 (Biolegend, Clone SKI) and PE-CD85j/ILT2 (Biolegend, Clone HP-F1, ThermoFisher); Fixation and permeabilization using fix/perm reagent (ThermoFisher); (5) Intracellular staining with Brilliant Violet 711-IFN-γ (Biolegend, Clone 4S.B3) and APC-TNF-α (Biolegend, Clone MAb11) diluted in Permeabilization Buffer (ThermoFisher) for 20 minutes at 4° C. After the staining steps, cells were washed, centrifuged, and resuspended in staining buffer followed by sample acquisition on a BD Fortessa X-20 flow cytometer using the high throughput sampler.
FCS data was analyzed using FlowJo version 10 analysis software (FlowJo, LLC). Gates were made to select single cells, live cells, and the cell type of interest. CD8+ T cell populations were defined based on CD8+ILT2+ or CD8+ILT2. To determine the percent of cells positive for CD107a, IFN-γ, or TNF-α, gating was performed on each CD8+ T cell population and determined using fluorescence minus one cells and unstimulated cells.
Results depicted in FIG. 6D demonstrate that blockade of HLA-G with an anti-HLA-G antibody (representative Bin 1 clone) restored CD107a, IFN-γ, and TNF-α expression in CD8+ ILT2+ T cells in a dose-dependent manner. There was no effect from HLA-G target cell expression or anti-HLA-G antibody treatment on CD8+ILT2 cells (data not shown).
Example 9: Anti-HLA-G Antibodies that are Selective Binders to HLA-G and do not Bind to Classical HLA Class I Antigens
Binding of antibodies to HLA antigens (97 different antigens spanning HLA-A, -B, and -C haplotypes) was determined using the LABScreen single antigen class I-combi assay (One Lambda). Antibodies at concentrations greater than 300 nM were incubated with single antigen LABScreen beads in binding buffer (Phosphate Buffered Saline, 10% FBS, 2 mM EDTA) for 45 minutes in the dark at room temperature with gentle shaking. Beads were washed twice with 200 μL of IX LABScreen wash buffer in a 96-well V-bottom plate by centrifugation at 1500 g and removal of buffer by aspiration. Beads were then incubated with a PE-conjugated secondary antibody (polyclonal goat anti-human or anti-mouse in 1× wash buffer) for 30 minutes at room temperature in dark with gentle shaking. After incubation, beads were washed twice, resuspended in 90 μL of wash buffer, and then transferred to a 96-well flat bottom plate. Acquisition was performed on a Luminex 100 instrument and data output as a CSV file. Results for each single HLA antigen bead group were tabulated from median fluorescent intensity values.
Antibody 87G is a commercially available antibody and represents a blocking antibody (See, Odum et al., Eur. J. Immunol. 22: 2121-2131 (1991) and Lee et al., Immunity, 591-600 Volume 3, Issue 5 (1995), each of which is incorporated by reference in its entirety herein, including any drawings).
The results are shown in FIG. 7. Binding values (median fluorescent signal) to each single HLA antigen are shown for each anti-HLA-G antibody.
Example 10: Anti-HLA-G Antibodies that do not Bind to Classical HLA Class Antigens Expressed at Physiological Levels on B-LCL Cells
Binding of antibodies to physiological levels of native HLA class Ia proteins was assessed by flow cytometry on a collection of twenty-eight B-LCL cell lines (shown in Table X). Cells were obtained from the International Histocompatibility Working Group cell line collection that holds a repository of B-LCL cell lines which have been HLA-typed. The cells were maintained in supplemented RPMI-1640 media containing 15% fetal bovine serum.
For antibody binding, anti-HLA antibodies were first conjugated to DyLight 650 (Thermo Fisher) by primary amine labeling via the NHS-ester moiety. Unconjugated dye was removed by flowing the antibody preparation through dye removal resin. Conjugation efficiency was between 1 to 3 moles of DyLight 650 per mole of antibody. B-LCL cell lines (ranging from 10,000 to 100,000 cells per well) were incubated with 300 nM of labeled antibodies in cold PBS containing 10% FBS and human Fc block (BD Biosciences). After 2 hours at 4° C., cells were washed twice in cold wash buffer (Phosphate Buffered Saline, 2% FBS, 2 mM EDTA) followed by sample acquisition on a BD FACS Celesta instrument. To assess overall HLA class I expression, a pan HLA class I antibody, clone W6/32, conjugated to FITC was incubated separately with each individual cell line. All cell lines were strongly positive for class I expression (data not shown). Data was exported as FCS files and analyzed using FlowJo software v10. Gating was performed on live singlet cells using DAPI for live-dead discrimination. Geometric MFI is shown for each B-LCL cell line.
TABLE X
Ethnic/Population Workshop
IHW ID Alternate ID Sex Group Involvement HLA A* HLA B* HLA Cw*
IHW09367 LCK Asian 13 0203 1102 4601 380201 0702 1202
IHW09458 FH70EY M 13 3002 6802 0801 5301 0401 07
IHW09383 FH9 M Other 13 2402 3303 4801 44032 0801 0701
IHW09397 DUG150 Unknown 13 02 680101 5802 4501 0602 1601
IHW09057 TEM M Jewish 10, 12 6601 3801 1203
IHW09010 AMAI M Algerian 10, 12 6802 5301 0401
IHW09436 FH48 M Caucasian 13 2402 0201 4427 070201 070201 0704
IHW01167 1413-1090 M Caucasian CEPH 680102 0201 0801 4402 0701 0501
IHW01075 1344-8354 F Caucasian CEPH 2402 0301 4001 5101 030401 0102
IHW01185 1416-1337 M Caucasian CEPH 0205 2501 4901 4402 0701 0501
IHW09431 FH43 M American Black 13 3001 3301 5301 8101 04 08
IHW01124 1362-8563 M Caucasian CEPH 0201 2902 3501 4403 0401 1601
IHW01133 1362-8572 F Caucasian CEPH 2902 2601 4403 4402 1601 0501
IHW01092 1346-8603 M Caucasian CEPH 0201 1101 0702 3501 0702 0401
IHW09371 ISH4 Asian 13 0218 1101 1501 4601 0102 040101
IHW09433 FH45 M Asian 13 1101 02 3802 4101 0702 17
IHW09380 FH6 M Hispanic 13 2402 2901 2702 0705 1505 020202
IHW09411 FH29 F Hispanic 13 0201 2902 1516 440301 1402 1601
IHW09401 TER-259 USA White/ 13 3201 6802 0801 44020101 0102 07
American Indian
IHW09398 FH18 F American Black 13 3601 7401 5301 5703 0401 0701
IHW09382 FH8 F Am. Black 13 110101 3402 8201 270502 0302 0102
IHW01026 1332-8257 F Caucasian CEPH 0301 3001 3501 0702 0401 0702
IHW09409 FH27 M Native American 13 310102 3401 350101 380201 0401 0702
IHW09452 FH64 Unknown 13 02 3201 44 1801 05 07
IHW01028 1332-8259 F Caucasian CEPH 0301 0301 3501 2705 0401 020202
IHW01061 1341-8465 F Caucasian CEPH 0201 680102 0702 0702 0702 0702
IHW01099 1347-8434 M Caucasian CEPH 2501 0101 0801 1501 0701 0602
IHW01136 1362-8575 M Caucasian CEPH 0101 1101 0702 5101 0702 1502
The results are shown in FIG. 8. Binding levels are provided as geometric MFI. Class I-negative 721.221 cell lines with and without expression of HLA-G were used as controls.
Example 11: Critical HLA-G Amino Acid Determinants Required for HLA-G Antibody Binding
721.221 LCL cells transiently expressing various point mutants of HLA-G were established using the Neon® Transfection System (ThermoFisher Scientific). Cells were transfected with 1 μg of plasmid per point mutanin the 10 μL reaction format. Cells were cultured for 72 hours prior to staining with anti-HLA-G antibodies.
721.221 LCL cells (expressing various point mutants or a domain swap where the primary amino acid sequence encoding the alpha 3 domain was substituted with the analogous sequence from HLA-A*101) were incubated with each antibody (100 nM) in wash buffer (Phosphate Buffered Saline, 2% FBS, 2 mM EDTA) for 60 minutes at 4° C. Cells were then washed with cold wash buffer and incubated with fluorescently labelled secondary antibody at 4° C. for 30 minutes. Numbered antibodies were incubated with 1:500 R-Phycoerythrin labelled goat-anti-human IgG (Jackson ImmunoResearch). W6/32 was incubated with 1:500 Alexa Fluor 488 goat-anti-mouse IgG (Jackson ImmunoResearch). MEMG/9 (Invitrogen) was pre-conjugated with Allophycocyanin. After incubation with secondary antibody, cells were washed and resuspended in cold wash buffer prior to analysis by flow cytometry on a BD Celesta instrument. Sample data was exported as FCS files and analyzed using FlowJo software v10. As shown in FIG. 9, mutation of residues 195, 197, and/or 198 results in loss of binding by bin 1 anti-HLA-G antibodies, revealing those residues are critical, though unlikely to be the only determinants for bin 1 antibody binding. Intriguingly, the biochemical bin defined by Octet as bin 1a (FIG. 2B) can be further distinguished based on either sensitivity to mutation at residue 197 (for example, 38379) or mutation at residue 198 (for example, 38410)
FIG. 9A shows the evaluation of HLA-G antibodies binding to various forms of HLA-G after site directed mutagenesis. FIG. 9B provides representative antibody binding histograms for each of the three point mutants (F195S, Y197A, Y197H, E198A).
Example 12: Tumor Growth Inhibition for an Ant-HLA-G Antibody with and without Effector Function in a Mouse Xenograft Model Using 721.221 Cells Expressing HLA-G
NOD/SCID mice were implanted subcutaneously with 10 million HLA-G expressing 721.221 cells in Matrigel on the right flank. On day 29 post-implantation, mice were randomized into groups based on tumor volume and dosed intraperitoneally with 300 μg of either an effector competent anti-HLA-G human IgG1 antibody (hIgG1 WT), the same anti-HLA-G antibody with mutations in the Fe domain to abrogate Fc receptor interactions (hIgG1_AAA), or left untreated. A second dose of antibody was given three days later. Data provided in FIG. 10 represents the percent change in tumor volume six days after initial treatment. These results demonstrate that an anti-HLA-G antibody can inhibit the growth of tumors expressing HLA-G by engaging Fc receptor dependent effector mechanisms, which may include antibody-dependent cellular cytotoxicity (ADCC) or phagocytosis (ADCP).
Example S: Sequences
Table S provides sequences referred to herein.
TABLE S
Sequences.
SEQ
ID Re- Scheme/
NO: gion Clone Sequence
  1 CDR- Chothia GGSISSSDY
H1
  2 CDR- Chothia GGSISSSST
H1
  3 CDR- Chothia GGSISSSDT
H1
  4 CDR- Chothia GGSISSADN
H1
  5 CDR- Chothia GGSVSSSST
H1
  6 CDR- Chothia GYSTSSGY
H1
  7 CDR- Chothia GYSILSGY
H1
  8 CDR- Chothia GYSISSGH
H1
  9 CDR- Chothia GYSISSGF
H1
 10 CDR- Chothia GFTFDNY
H1
 11 CDR- Chothia GFTFSDY
H1
 12 CDR- Chothia GFTFSSS
H1
 13 CDR- Chothia GGSISSSN
H1
 14 CDR- Chothia GGSISSSSY
H1
 15
 16
 17
 18 CDR- Kabat SSDYYWG
H1
 19 CDR- Kabat SSSTYWA
H1
 20 CDR- Kabat SSSTYWG
H1
 21 CDR- Kabat SSDTYWG
H1
 22 CDR- Kabat SADNYWG
H1
 23 CDR- Kabat SSSTYWS
H1
 24 CDR- Kabat SGYYWG
H1
 25 CDR- Kabat SGYYWF
H1
 26 CDR- Kabat SGHYWI
H1
 27 CDR- Kabat SGFYWT
H1
 28 CDR- Kabat SGYYWL
H1
 29 CDR- Kabat SGHYWT
H1
 30 CDR- Kabat NYAMH
H1
 31 CDR- Kabat DYYMS
H1
 32 CDR- Kabat SSAMA
H1
 33 CDR- Kabat SSNWWS
H1
 34 CDR- Kabat SSSYYWG
H1
 35
 36
 37
 38 CDR- Chothia YYSGS
H2
 39 CDR- Chothia SSSGS
H2
 40 CDR- Chothia HHSGA
H2
 41 CDR- Chothia HYSGS
H2
 42 CDR- Chothia AYSGS
H2
 43 CDR- Chothia SYNAL
H2
 44 CDR- Chothia YHSGS
H2
 45 CDR- Chothia YHSAS
H2
 46 CDR- Chothia SARAGI
H2
 47 CDR- Chothia ASSGSV
H2
 48 CDR- Chothia SGSGIT
H2
 49 CDR- Chothia SYSGS
H2
 50 CDR- Chothia SSSGST
H2
 51
 52
 53
 54 CDR- Kabat SIYYSGSTYYNPSLKS
H2
 55 CDR- Kabat SISSSGSTYYNPSLKS
H2
 56 CDR- Kabat SIHHSGATYYNPSLKS
H2
 57 CDR- Kabat SIHYSGSTLYNPSLKS
H2
 58 CDR- Kabat SIHYSGSTYYNPSLKS
H2
 59 CDR- Kabat GIAYSGSTYYNPSLKS
H2
 60 CDR- Kabat SISYNALTYYNPSLKS
H2
 61 CDR- Kabat SIYHSGSTYYNPSLKS
H2
 62 CDR- Kabat GIYHSASTAYMPSLKS
H2
 63 CDR- Kabat GIYHSGSTYYNPSLKS
H2
 64 CDR- Kabat AIYHSGSTVYNPSLKS
H2
 65 CDR- Kabat GIYHSGSTAYNPSLKS
H2
 66 CDR- Kabat AISARAGITYYADSVKG
H2
 67 CDR- Kabat YIASSGSVIYYADSVKG
H2
 68 CDR- Kabat TISGSGITTWYADSVKG
H2
 69 CDR- Kabat EIYHSGSTNYNPSLKS
H2
 70 CDR- Kabat SISYSGSTYYNPSLKS
H2
 71 CDR- Kabat YISSSGSTIYYADSVKG
H2
 72
 73
 74
 75
 76 CDR- GVRRAVPFDY
H3
 77 CDR- GIARAVPFDY
H3
 78 CDR- GPKRAVPFDY
H3
 79 CDR- GVRRAVPFVD
H3
 80 CDR- GVRRAVPFQR
H3
 81 CDR- GTRRAVPFDY
H3
 82 CDR- GVRRAVPFAD
H3
 83 CDR- GIRRAMPFDY
H3
 84 CDR- GQFRAVPFDY
H3
 85 CDR- GGTHTYSRGPMDV
H3
 86 CDR- GGTHTYSRGPFDV
H3
 87 CDR- GGTPIYSRGPLDV
H3
 88 CDR- GGGQTYSRGPLDV
H3
 89 CDR- GGGATYSRGPLDV
H3
 90 CDR- GGTHTYSRGPLDV
H3
 91 CDR- GGTVKYSRGPLDV
H3
 92 CDR- GGQVTYSRGPLDV
H3
 93 CDR- GGEVTYSRGPLDV
H3
 94 CDR- RIGYSYGTAPPFDV
H3
 95 CDR- HGTPRAFDI
H3
 96 CDR- GSRHLNAFNR
H3
 97 CDR- GVYHYDPYGMDV
H3
 98 CDR- TELGKMHFDY
H3
 99 CDR- GSPRYMQD
H3
100 CDR- HSSLGTHNWFDP
H3
101 CDR- EGALSYSWLAAFDI
H3
102
103
104
105 CDR- RASQSVSSSYLA
L1
106 CDR- GASQSVSSDYLA
L1
107 CDR- QASQAVSSNYLA
L1
108 CDR- GASQSVSSAFLA
L1
109 CDR- RASQSVSSTYLA
L1
110 CDR- QASQSVSSSYLA
L1
111 CDR- KASQAVSSSYLA
L1
112 CDR- EASQSVSSSYLA
L1
113 CDR- EASQSVSASYLA
L1
114 CDR- EASQSVSSAYLA
L1
115 CDR- RVSQSVSDAYLA
L1
116 CDR- EVSQSVSASYLA
L1
117 CDR- RASQSVSSAYLA
L1
118 CDR- RASNAVSSSYLA
L1
119 CDR- RASQSINSWLA
L1
120 CDR- AASQGISSDLA
L1
121 CDR- RASQDISTYLN
L1
122 CDR- RSSQSLLHSNGYNYLD
L1
123 CDR- RASQSISSYLN
L1
124 CDR- RASQSVSSNLA
L1
125
126
127
128 CDR- GASSRT
L2
129 CDR- GAYSLAT
L2
130 CDR- GASARAT
L2
131 CDR- GASSREA
L2
132 CDR- GASNRAA
L2
133 CDR- GASSRQD
L2
134 CDR- GASNRAT
L2
135 CDR- DASSRAS
L2
136 CDR- DASTRAT
L2
137 CDR- GASDRAN
L2
138 CDR- GASYRAT
L2
139 CDR- DASSLES
L2
140 CDR- SASSTQS
L2
141 CDR- DAFNLET
L2
142 CDR- LGSNRAS
L2
143 CDR- GASRRAT
L2
144 CDR- AASSLQS
L2
145 CDR- GASTRAT
L2
146
147
148
149 CDR- QQAVHSPYT
L3
150 CDR- QWAVHSPYT
L3
151 CDR- QQVVHSPYT
L3
152 CDR- QQTVHSPYT
L3
153 CDR- QQAIHSPYT
L3
154 CDR- QQHSSYPPT
L3
155 CDR- QQHSLYPPT
L3
156 CDR- QQFSSYPPT
L3
157 CDR- QQVSSYPPT
L3
158 CDR- QQHSIYPPT
L3
159 CDR- QQYDSHIT
L3
160 CDR- QQAYLYPIT
L3
161 CDR- QQLPFLPIT
L3
162 CDR- MQALGGPWT
L3
163 CDR- QQYVSDPIT
L3
164 CDR- QQVGSSPIT
L3
165 CDR- QQSHLVPRT
L3
166 CDR- QQANHHPPFT
L3
167
168
169
170 VH QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD
YYWGWIRQPPGKGLEWIGSIYYSGSTYYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAVPFDYWGQGTLVTVSS
171 VH QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
TYWAWIRQPPGKGLEWIGSISSSGSTYYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GIARAVPFDYWGQGTLVTVSS
172 VH QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
TYWGWIRQSPGKGLEWIGSIHHSGATYYNPSLK
SRVTISVDTSKNQFSLKTSSVTAADTAVYYCAR
GPKRAVPFDYWGQGTLVTVSS
173 VH QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD
TYWGWIRQPPGKGLEWIGSIHYSGSTLYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAVPFVDWGQGTLVTVSS
174 VH QLQLQESGPGLVKPSETLSLTCTVSGGSISSAD
NYWGWIRQPPGKGLEWIGSIHYSGSTYYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAVPFQRWGQGTLVTVSS
175 VH QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD
TYWGWIRQPPGKGPEWIGSIHYSGSTLYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAVPFDYWGQGTLVTVSS
176 VH QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAVPFDYWGQGTLVTVSS
177 VH QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
TYWSWIRQPPGKGLEWIGSISYNALTYYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GTRRAVPFDTWGQGTLVTVSS
178 VH QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAVPFADWGQGTLVTVSS
179 VH QLQLQESGPGLVKPSETLSLTCTVSGGSVSSSS
TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAVPFDYWGQGTLVTVSS
180 VH QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GTRRAVPFDYWGQGTLVTVSS
181 VH QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD
TYWGWIRQPPGKGLEWIGSIHYSGSTLYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GIRRAVPFDYWGQGTLVTVSS
182 VH QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD
TYWGWIRQPPGKGLEWIGSIHYSGSTLYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GQFRAVPFDYWGQGTLVTVSS
183 VH QVQLQESGPGLVKPSETLSLTCAVSGYSISSGY
YWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKS
RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GTHTYSRGPMDVWGQGTTVTVSS
184 VH QLQLQESGPRLVKPSETLSLTCAVSGYSISSGY
YWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKS
RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GTHTYSRGPFDVWGQGTTVTVSS
185 VH LVQLQESGPGLVKPSETLSLTCAVSGYSILSGY
YWFWIRQPPGKGLEWIGGIYHSASTAYNPSLKS
RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GTPIYSRGPLDVWGQGTTVTVSS
186 VH QVQLQESGPGLVKPSETLSLTCAVSGYSISSGH
YWIWIRQPPGKGLEWIGGIYHSGSTYYNPSLKS
RVTISVDTSKDQFSLKLSSVTAADTAVYYCARG
GGQTYSRGPLDVWGQGTTVTVSS
187 VH QVQLQESGPGLVKPPETLSLTCAVSGYSISSGH
YWIWIRQPPGKGLEWIGGIYHSGSTYYNPSLKS
RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GGATYSRGPLDVWGQGTTVTVSS
188 VH QVQLQESGPGLVKPSETLSLTCAVSGYSILSGY
YWFWIRQPPGKGLEWIGGIYHSGSTYYNPSLKS
RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GTHTYSRGPLDVWGQGTTVTVSS
189 VH QVQLQESGPGLVKPSETLSLTCAVSGYSISSGF
YWTWIRQPPGKGLEWIGAIYHSGSTVYNPSLKS
RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GTHTYSRGPLDVWGQGTTVTVSS
190 VH QVQLQESGPGLVKPSETLSLTCAVSGYSISSGY
YWLWIRQPPGKGLEWIGGIYHSASTAYNPSLKS
RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GTVKYSRGPLDVWGQGTTVTVSS
191 VH QVQLQESGPGLVKPSETLSLTCAVSGYSISSGH
YWTWIRQPPGKGLEWIGAIYHSGSTVYNPSLKS
RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GQVTYSRGPLDVWGQGTTVTVSS
192 VH QVQLQESGPGLVKPSETLSLTCAVSGYSILSGY
YWFWIRQPPGKGLEWIGGIYHSGSTAYNPSLKS
RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GEVTYSRGPLDVWGQGTTVTVSS
193 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFDNYA
MHWVRQAPGKGLEWVSAISARAGITYYADSVKG
RFTISRDNSKNTLYLQMNSLRAEDTAVYYCARR
IGYSYGTAPPFDVWGQGTTVTVSS
194 VH QVQLVESGGGLVQPGGSLRLSCAASGFTFSDYY
MSWIRQAPGKGLEWVSYIASSGSVIYYADSVKG
RFTISRDNAKNSLYLQMNSLRAEDTAVYYCARH
GTPRAFDIWGQGTTVTVSS
195 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSSA
MAWVRQAPGKGLEWVSTISGSGITTWYADSVKG
RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKG
SRHLNAFNRWGQGTTVTVSS
196 VH QVQLQESGPGLVKPSGTLSLTCAVSGGSISSSN
WWSWVRQPPGKGLEWIGEIYHSGSTNYNPSLKS
RVTISVDKSKNQFSLKLSSVTAADTAVYYCARG
VYHYDPYGMDVWGQGTTVTVSS
197 VH QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
YYWGWIRQPPGKGLEWIGSISYSGSTYYNPSLK
SRVTISVDTSRNQFSLKLSSVTAADTAVYYCAR
TELGKMHFDYWGQGTLVTVSS
198 VH QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD
YYWGWIRQPPGKGLEWIGSIYYSGSTYYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GSPRYMQDWGQGTLVTVSS
199 VH QVQLVESGSGLVKPGGSLRLSCAASGFTFSDYY
MSWIRQAPGKGLEWVSYISSSGSTIYYADSVKG
RFTISRDNAKNSLYLQMNSLRAEDTAVYYCARH
SSLGTHNWFDPWGQGTLVTVSS
200 VH QVQLQESGPGLVKPSETLSLTCAVSGYSISSGY
YWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKS
RVTISVDTSKNQFSLKLSSVTAADTAVYYCARE
GALSYSWLAAFDIWGQGTMVTVSS
201
202
203
204 VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY
LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQAVHSPYTF
GGGTKVEIK
205 VL EIVLTQSPGTLSLSPGERATLSCGASQSVSSDY
LAWYQQKPGQAPRLLIYGAYSLATGIPDRFSGS
GSGTDFTLTISRLRPEDFAVYYCQWAVHSPYTF
GGGTKVEIK
206 VL EIVLTQSPGTLSLSPGERATLSCQASQAVSSNY
LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQVVHSPYTF
GGGTKVEIK
207 VL EIVLTQSPGTLSLSPGERATLSCGASQSVSSAF
LAWYQQKPGQAPRLLIYGASARATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQVVHSPYTF
GGGTKVEIK
208 VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSTY
LAWYQQKPGQAPRLLIYGASSREAGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQTVHSPYTF
GGGTKVEIK
209 VL EIVLTQSPGTLSLSPGERATLSCQASQAVSSNY
LAWYQQKPGQAPRLLIYGASNRAAGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQAIHSPYTF
GGGTKVEIK
210 VL EIVLTQSPGTLSLSPGERATLSCQASQSVSSSY
LAWYQQKPGQAPRLLIYGASNRAAGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQVVHSPYTF
GGGTKVEIK
211 VL EIVLTQSPGTLSLSPGERATLSCKASQAVSSSY
LAWYQQKPGQAPRLLIYGASSRQDGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQVVHSPYTF
GGGTKVEIK
212 VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY
LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQHSSYPPTF
GGGTKVEIK
213 VL EIVLTQSPGTLSLSPGERATLSCEASQSVSSSY
LAWYQQKPGQAPRLLIYGASNRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQHSLYPPTF
GGGTKVEIK
214 VL EIVLTQSPGTLSLSPGFRATLSCEASQSVSASY
LAWYQQKPGQAPRLLIYDASSRASGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQFSSYPPTF
GGGTKVEIK
215 VL EIVLTQSPGTLSLSPGERATLSCEASQSVSSAY
LAWYQQKPGQAPRLLIYDASTRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQVSSYPPTF
GGGTKVEIK
216 VL EIVLTQSPGTLSLSPGERAALSCRVSQSVSDAY
LAWYQQKPGQAPRLLIYDASSRASGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQVSSYPPTF
GGGTKVEIK
217 VL EIVLTQSPGTLSLSPGERATLSCEVSQSVSASY
LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQHSLYPPTF
GGGTKVEIK
218 VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSAY
LAWYQQKPGQAPRLLIYGASDRANGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQHSLYPPTF
GGGTKVEIK
219 VL EIVLTQSPGTLSLSPGERATLSCRASNAVSSSY
LAWYQQKPGQAPRLLIYGASDRANGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQHSIYPPTF
GGGTKVEIK
220 VL EIVLTQSPGTLSLSPGERATLSCRASNAVSSSY
LAWYQQKPGQAPRLLIYGASYRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQHSLYPPTF
GGGTKVEIK
221 VL DIQMTQSPSTLSASVGDRVTITCRASQSINSWL
AWYQQKPGKAPKLLISDASSLESGVPSRFSGSG
SGTEFTLTISSLQPDDFATYYCQQYDSHITFGG
GTKVEIK
222 VL DIQMTQSPSSVSASVGDRVTITCAASQGISSDL
AWYQQKPGKAPKLLIYSASSTQSGVPSRFSGSG
SGTDFTLTISSLQPEDFATYYCQQAYLYPITFG
GGTKVEIK
223 VL GVQMTQSPSSLSASVGDRVTITCRASQDISTYL
NWYQQKPGKAPKLLIYDAFNLETGVPSRFSGSG
SGTDFTFTISSLQPEDIATYYCQQLPFLPITFG
GGTKVEIK
224 VL DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSN
GYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDR
FSGSGSGTDFTLKISRVEAEDVGVYYCMQALGG
PWTFGGGTKVEIK
225 VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY
LAWYQQKPGQAPRLLIYGASRRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQYVSDPITF
GGGTKVEIK
226 VL EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY
LAWYQQKPGQAPRLLIYGASRRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQVGSSPITF
GGGTKVEIK
227 VL DIQMTQSPSSLSASVGDRVTITCRASQSISSYL
NWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSG
SGTDFTLTISSLQPEDFATYYCQQSHLVPRTFG
GGTKVEIK
228 VL EIVMTQSPATLSVSPGERATLSCRASQSVSSNL
AWYQQKPGQAPRLLIYGASTRATGIPARFSGSG
SGTEFTLTISSLQSEDFAVYYCQQANHHPPFTF
GGGTKVEIK
229
230
231
232 IGG1 33343 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD
AAA  YYWGWIRQPPGKGLEWIGSIYYSGSTYYNPSLK
HC SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAWPFDYWGQGTLVTVSSASTKGPSVFPLA
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP
CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC
VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA
LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT
TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
VMHEALHNHYTQKSLSLSPGK
233 IGG1  37268 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
AAA  TYWAWIRQPPGKGLEWIGSISSSGSTYYNPSLK
HC SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GIARAVPFDYWGQGTLVTVSSASTKGPSVFPLA
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP
CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC
VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA
LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT
TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
VMHEALHNHYTQKSLSLSPGK
234 IGG1  37269 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
AAA  TYWGWIRQSPGKGLEWIGSIHHSGATYYNPSLK
HC SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GPKRAVPFDYWGQGTLVTVSSASTKGPSVFPLA
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP
CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC
VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA
LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT
TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
VMHEALHNHYTQKSLSLSPGK
235 IGG1  37271 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD
AAA  TYWGWIRQPPGKGLEWIGSIHYSGSTLYNPSLK
HC SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAVPFVDWGQGTLVTVSSASTKGPSVFPLA
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP
CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC
VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA
LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT
TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
VMHEALHNHYTQKSLSLSPGK
236 IGG1  37272 QLQLQESGPGLVKPSETLSLTCTVSGGSISSAD
AAA  NYWGWIRQPPGKGLEWIGSIHYSGSTYYNPSLK
HC SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAVPFQRWGQGTLVTVSSASTKGPSVFPLA
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP
CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC
VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA
LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT
TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
VMHEALHNHYTQKSLSLSPGK
237 IGG1  37277 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD
AAA  TYWGWIRQPPGKGPEWIGSIHYSGSTLYNPSLK
HC SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP
CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC
VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA
LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT
TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
VMHEALHNHYTQKSLSLSPGK
238 IGG1  38373 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
AAA  TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK
HC SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP
CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC
VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA
LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT
TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
VMHEALHNHYTQKSLSLSPGK
239 IGG1  38375 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
AAA  TYWSWIRQPPGKGLEWIGSISYNALTYYNPSLK
HC SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GTRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP
CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC
VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA
LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT
TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
VMHEALHNHYTQKSLSLSPGK
240 IGG1 38379 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
AAA  TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK
HC SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAVPFADWGQGTLVTVSSASTKGPSVFPLA
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP
CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC
VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA
LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT
TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
VMHEALHNHYTQKSLSLSPGK
241 IGG1 38381 QLQLQESGPGLVKPSETLSLTCTVSGGSVSSSS
AAA  TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK
HC SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP
CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC
VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA
LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT
TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
VMHEALHNHYTQKSLSLSPGK
242 IGG1  38383 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
AAA  TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK
HC SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GTRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP
CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC
VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA
LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT
TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
VMHEALHNHYTQKSLSLSPGK
243 IGG1 38386 QLQLQESCPGLVKPSETLSLTCTVSGGSISSSD
AAA  TYWGWIRQPPGKGLEWIGSIHYSGSTLYNPSLK
HC SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GIRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP
CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC
VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA
LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT
TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
VMHEALHNHYTQKSLSLSPGK
244 IGG1  37273 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD
AAA  TYWGWIRQPPGKGLEWIGSIHYSGSTLYNPSLK
HC SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GQFRAVPFDYWGQGTLVTVSSASTKGPSVFPLA
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP
CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC
VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA
LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT
TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
VMHEALHNHYTQKSLSLSPGK
245 IGG1 33361 QVQLQESGPGLVKPSETLSLTCAVSGYSISSGY
AAA  YWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKS
HC RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GTHTYSRGPMDVWGQGTTVTVSSASTKGPSVFP
LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC
PPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR
EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN
KALPAPIEKTISKAKGQPREPQVYTLPPSREEM
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
CSVMHEALHNHYTQKSLSLSPGK
246 IGG1  35624 QLQLQESGPRLVKPSETLSLTCAVSGYSISSGY
AAA  YWGWIRQPPCKGLEWIGSIYHSGSTYYNPSLKS
HC RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GTHTYSRGPFDVWGQGTTVTVSSASTKGPSVFP
LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC
PPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR
EEQYNSTYRVVSVLTVLHQLWLNGKEYKCKVSN
KALPAPIEKTISKAKGQPREPQVYTLPPSREEM
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
CSVMHEALHNHYTQKSLSLSPGK
247 IGG1 38410 LVQLQESGPGLVKPSETLSLTCAVSGYSILSGY
AAA  YWFWIRQPPGKGLEWIGGIYHSASTAYNPSLKS
HC RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GTPIYSRGPLDVWGQGTTVTVSSASTKGPSVFP
LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC
PPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR
EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN
KALPAPIEKTISKAKGQPREPQVYTLPPSREEM
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
CSVMHEALHNHYTQKSLSLSPGK
248 IGG1 38418 QVQLQESGPGLVKPSETLSLTCAVSGYSISSGH
AAA  YWIWIRQPPGKGLEWIGGIYHSGSTYYNPSLKS
HC RVTISVDTSKDQFSLKLSSVTAADTAVYYCARG
GGQTYSRGPLDVWGQGTTVTVSSASTKGPSVFP
LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC
PPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR
EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN
KALPAPIEKTISKAKGQPREPQVYTLPPSREEM
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
CSVMHEALHNHYTQKSLSLSPGK
249 IGG1 38420 QVQLQESGPGLVKPPETLSLTCAVSGYSISSGH
AAA  YWIWIRQPPGKGLEWIGGIYHSGSTYYNPSLKS
HC RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GGATYSRGPLDVWGQGTTVTVSSASTKGPSVFP
LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC
PPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR
EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN
KALPAPIEKTISKAKGQPREPQVYTLPPSREEM
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
CSVMHEALHNHYTQKSLSLSPGK
250 IGG1 38421 QVQLQESGPGLVKPSETLSLTCAVSGYSILSGY
AAA  YWFWIRQPPGKGLEWIGGIYHSGSTYYNPSLKS
HC RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GTHTYSRGPLDVWGQGTTVTVSSASTKGPSVFP
LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC
PPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR
EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN
KALPAPIEKTISKAKGQPREPQVYTLPPSREEM
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
CSVMHEALHNHYTQKSLSLSPGK
251 IGG1 38422 QVQLQESGPGLVKPSETLSLTCAVSGYSISSGF
AAA  YWTWIRQPPGKGLEWIGAIYHSGSTVYNPSLKS
HC RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GTHTYSRGPLDVWGQGTTVTVSSASTKGPSVFP
LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC
PPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHEDPEVKFNWYVDCWEVHNAKTKPR
EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN
KALPAPIEKTISKAKGQPREPQVYTLPPSREEM
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
CSVMHEALHNHYTQKSLSLSPGK
252 IGG1 38424 QVQLQESGPGLVKPSETLSLTCAVSGYSISSGY
AAA  YWLWIRQPPGKGLEWIGGIYHSASTAYNPSLKS
HC RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GTVKYSRGPLDVWGQGTTVTVSSASTKGPSVFP
LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC
PPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR
EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN
KALPAPIEKTISKAKGQPREPQVYTLPPSREEM
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
CSVMHEALHNHYTQKSLSLSPGK
253 IGG1 38425 QVQLQESGPGLVKPSETLSLTCAVSGYSISSGH
AAA  YWTWIRQPPGKGLEWIGAIYHSGSTVYNPSLKS
HC RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GQVTYSRGPLDVWGQGTTVTVSSASTKGPSVFP
LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC
PPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR
EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN
KALPAPIEKTISKAKGQPREPQVYTLPPSREEM
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
CSVMHEALHNHYTQKSLSLSPGK
254 IGG1 38426 QVQLQESGPGIVKPSETLSLTCAVSGYSILSGY
AAA  YWFWIRQPPGKGLEWIGGIYHSGSTAYNPSLKS
HC RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GEVTYSRGPLDVWGQGTTVTVSSASTKGPSVFP
LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTC
PPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHFDPEVKFNWYVDGVEVHNAKTKPR
EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN
KALPAPIEKTISKAKGQPREPQVYTLPPSREEM
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
CSVMHEALHNHYTQKSLSLSPGK
255 IGG1 37323 EVQLLESGGGLVQPGGSLRLSCAASGFTFDNYA
AAA  MHWVRQAPGKGLEWVSAISARAGITYYADSVKG
HC RFTISRDNSKNTLYLQMNSLRAEDTAVYYCARR
IGYSYGTAPPFDVWGQGTTVTVSSASTKGPSVF
PLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN
SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS
LGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT
CPPCPAPEAAGAPSVFLFPPKPKDTLMISRTPE
VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
NKALPAPIEKTISKAKGQPREPQVYTLPPSREE
MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN
YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVF
SCSVMHEALHNHYTQKSLSLSPGK
256 IGG1 38389 QVQLVESGGGLVQPGGSLRLSCAASGFTFSDYY
AAA  MSWIRQAPGKGLEWVSYIASSGSVIYYADSVKG
HC RFTISRDNAKNSLYLQMNSLRAEDTAVYYCARH
GTPRAFDIWGQGTTVTVSSASTKGPSVFPLAPS
SKSTSGGTAALGCLVKDYFPEPVTVSWNSGALT
SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCP
APEAAGAPSVFLFPPKPKDTLMISRTPEVTCVV
VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQ
VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP
PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM
HEALHNHYTQKSLSLSPGK
257 IGG1 38358 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSSA
AAA  MAWVRQAPGKGLEWVSTISGSGITTWYADSVKG
HC RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKG
SRHLNAFNRWGQGTTVTVSSASTKGPSVFPLAP
SSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL
TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
TYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPC
PAPEAAGAPSVFLFPPKPKDTLMISRTPEVTCV
VVDVSHEDPENKFNWYVDGVEVHNAKTKPREEQ
YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKAL
PAPIEKTISKAKGQPREPQVYTLPPSREEMTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT
PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV
MHEALHNHYTQKSLSLSPGK
258 IGG1 33303 QVQLQESHPGLVKPSGTLSLTCAVSGGSISSSN
AAA  WWSWVRQPPGKGLEWIGEIYHSGSTNYNPSLKS
HC RVTISVDKSKNQFSLKLSSVTAADTAVYYCARG
VYHYDPYGMDVWGQGTTVTVSSASTKGPSVFPL
APSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG
ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG
TQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP
PCPAPEAAGAPSVFLFPPKPKDTLMISRTPEVT
CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE
EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK
ALPAPIEKTISKAKGQPREPQVYTLPPSREEMT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK
TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC
SVMMEALHNHYTQKSLSLSPGK
259 IGG1 33342 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
AAA  YYWGWIRQPPGKGLEWIGSISYSGSTYYNPSLK
HC SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
TELGKMHFDYWGQGTLVTVSSASTKGPSVFPLA
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPP
CPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTC
VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA
LPAPIEKTISKAKGQPREPQVYTLPPSREEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT
TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
VMHEALHNHYTQKSLSLSPGK
260 IGG1 33299 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD
AAA  YYWGWIRQPPGKGLEWIGSIYYSGSTYYNPSLK
HC SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GSPRYMQDWGQGTLVTVSSASTKGPSVFPLAPS
SKSTSGGTAALGCLVKDYFPEPVTVSWNSGALT
SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCP
APEAAGAPSVFLFPPKPKDTLMISRTPEVTCVV
VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQ
VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP
PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM
HEALHNHYTQKSLSLSPGK
261 IGG1 33351 QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYY
AAA  MSWIRQAPGKGLEWVSYISSSGSTIYYADSVKG
HC RFTISRDNAKNSLYLQMNSLRAEDTAVYYCARH
SSLGTHNWFDPWGQGTLVTVSSASTKGPSVFPL
APSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG
ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG
TQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP
PCPAPEAAGAPSVFLFPPKPKDTLMISRTPEVT
CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE
EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK
ALPAPIEKTISKAKGQPREPQVYTLPPSREEMT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK
TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC
SVMHEALHNHYTQKSLSLSPGK
262 IGG1 33357 QVQLQESGPGLVKPSETLSLTCAVSGYSISSGY
AAA  YWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKS
HC RVTISVDTSKNQFSLKLSSVTAADTAVYYCARE
GALSYSWLAAFDIWGQGTMVTVSSASTKGPSVF
PLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN
SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS
LGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT
CPPCPAPEAAGAPSVFLFPPKPKDTLMISRTPE
VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
NKALPAPIEKTISKAKGQPREPQVYTLPPSREE
MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN
YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVF
SCSVMHEALHNHYTQKSLSLSPGK
263
264
265
266 IGG4 33343 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD
HC YYWGWIRQPPGKGLEWIGSIYYSGSTYYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA
PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV
DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS
SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV
SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH
EALHNHYTQKSLSLSPGK
267 IGG4  37268 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
HC TYWAWIRQPPGKGLEWIGSISSSGSTYYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GIARAVPFDYWGQGTLVTVSSASTKGPSVFPLA
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA
PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV
DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS
SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV
SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH
EALHNHYTQKSLSLSPGK
268 IGG4  37269 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
HC TYWGWIRQSPGKGLEWIGSIHHSGATYYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GPKRAVPFDYWGQGTLVTVSSASTKGPSVFPLA
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA
PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV
DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS
SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV
SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH
EALHNHYTQKSLSLSPGK
269 IGG4  37271 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD
HC TYWGWIRQPPGRGLEWIGSIHYSGSTLYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAVPFVDWGQGTLVTVSSASTKGPSVFPLA
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA
PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV
DVSQEDPEVQFNWTVDGVEVHNAKTKPREEQFN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS
SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV
SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQRGNVFSCSVMH
EALHNHYTQKSLSLSPGK
270 IGG4  37272 QLQLQESGPGLVKPSETLSLTCTVSGGSISSAD
HC NYWGWIRQPPGKGLEWIGSIHYSGSTYYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAVPFQRWGQGTLVTVSSASTKGPSVFPLA
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA
PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV
DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS
SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV
SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH
EALHNHYTQKSLSLSPGK
271 IGG4  37277 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD
HC TYWGWIRQPPGKGPEWIGSIHYSGSTLYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA
PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV
DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS
SIEKTISKAKOQPREPQVYTLPPSQEEMTKNQV
SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH
EALHNHYTQKSLSLSPGK
272 IGG4  38373 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
HC TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA
PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV
DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS
SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV
SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH
EALHNHYTQKSLSLSPGK
273 IGG4  38375 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
HC TYWSWIRQPPGKGLEWIGSISYNALTYYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GTRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA
PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV
DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS
SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV
SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH
EALHNHYTQKSLSLSPGK
274 IGG4  38379 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
HC TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAVPFADWGQGTLVTVSSASTKGPSVFPLA
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA
PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV
DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS
SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV
SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH
EALHNHYTQKSLSLSPGK
275 IGG4  38381 QLQLQESGPGLVKPSETLSLTCTVSGGSVSSSS
HC TYWSWIRQPPGKGLEWIGGIAYSGSTYYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GVRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA
PEFLGGPSVDLFPPKPKDTLMISRTPEVTCVVV
DVSQEDPWCQFNWYVDGVWVHNAKTKPREEQFN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS
SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV
SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH
EALHNHYTQKSLSLSPGK
276 IGG4  38383 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
HC TYWSWIRQPPGRGLEWIGGIAYSGSTYYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GTRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA
PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV
DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS
SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV
SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH
EALHNHYTQKSLSLSPGK
277 IGG4  38386 QLQLQRSGPGLVKPSETLSLTCTVSGGSISSSD
HC TYWGWIRQPPGKGLEWIGSIHYSGSTLYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GIRRAVPFDYWGQGTLVTVSSASTKGPSVFPLA
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA
PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV
DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS
SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV
SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH
EALHNHYTQKSLSLSPGK
278 IGG4  37273 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD
HC TYWGWIRQPPGKGLEWIGSIHYSGSTLYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GQFRAVPFDYWGQGTLVTVSSASTKGPSVFPLA
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA
PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV
DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS
SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV
SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH
EALHNHYTQKSLSLSPGK
279 IGG4  33361 QVQLQESGPGLVKPSETLSLTCAVSGYSISSGY
HC YWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKS
RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GTHTYSRGPMDVWGQGTTVTVSSASTKGPSVFP
LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC
PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV
VVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ
FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL
PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT
PPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV
MHEALHNHYTQKSLSLSPGK
280 IGG4  35624 QLQLQESGPRLVKPSETLSLTCAVSGYSISSGY
HC YWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKS
RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GTHTYSRGPFDVWGQGTTVTVSSASTKGPSVFP
LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC
PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV
VVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ
FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL
PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT
PPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV
MHEALHNHYTQKSLSLSPGK
281 IGG4  38410 LVQLQESGPGLVKPSETLSLTCAVSGYSILSGY
HC YWFWIRQPPGKGLEWIGGIYHSASTAYNPSLKS
RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GTPIYSRGPLDVWGQGTTVTVSSASTKGPSVFP
LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC
PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV
VVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ
FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL
PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT
PPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV
MHEALHNHYTQKSLSLSPGK
282 IGG4  38418 QVQLQESGPGLVKPSETLSLTCAVSGYSISSGH
HC YWIWIRQPPCKGLEWIGGIYHSGSTYYNPSLKS
RVTISVDTSKDQFSLKLSSVTAADTAVYYCARG
GGQTYSRGPLDVWGQGTTVTVSSASTKGPSVFP
LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC
PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV
VVDVSQEDPEVQFNWTVDGVEVHNAKTKPREEQ
FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL
PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT
PPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV
MHEALHNHYTQKSLSLSPGK
283 IGG4  38420 QVQLQESGPGLVKPPETLSLTCAVSGYSISSGH
HC YWIWIRQPPGKGLEWIGGIYHSGSTYYNPSLKS
RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GGATYSRGPLDVWGQGTTVTVSSASTKGPSVFP
LAPCSRSTSESTAALGCLVKDYFPFPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC
PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV
VVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ
FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL
PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT
PPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV
MHEALHNHYTQKSLSLSPGK
284 IGG4  38421 QVQLQESGPGLVKPSETLSLTCAVSGYSILSGY
HC YWFWIRQPPGKGLEWIGGIYHSGSTYYNPSLKS
RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GTHTYSRGPLDVWGQGTTVTVSSASTKGPSVFP
LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC
PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV
VVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ
FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL
PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT
PPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV
MHEALHNHYTQKSLSLSPGK
285 IGG4  38422 QVQLQESGPGLVKPSETLSLTCAVSGYSISSGF
HC YWTWIRQPPGKGLEWIGAIYHSGSTVYNPSLKS
RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GTHTYSRGPLDVWGQGTTVTVSSASTKGPSVFP
LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC
PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV
VVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ
FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL
PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT
PPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV
MHEALHNHYTQKSLSLSPGK
286 IGG4  38424 QVQLQESGPGLVKPSETLSLTCAVSGYSISSGY
HC YWLWIRQPPGKGLEWIGGIYHSASTAYNPSLKS
RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GTVKYSRGPLDVWGQGTTVTVSSASTKGPSVFP
LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC
PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV
VVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ
FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL
PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN
QVSLTCLVKGFYPSDIAVEWESNSQPENNYKTT
PPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV
MHEALHNHYTQKSLSLSPGK
287 IGG4  38425 QVQLQESGPGLVKPSETLSLTCAVSGYSISSGH
HC YWTWIRQPPGKGLEWIGAIYHSGSTVYNPSLKS
RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GQVTYSRGPLDVWGQGTTVTVSSASTKGPSVFP
LAPCSRSTSESTAALGCLVKDYFPEPVTVSWNS
GALTSGIHTFPAVLQSSGLYSLSSVVTVPSSSL
GTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC
PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV
VVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ
FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL
PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT
PPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV
MHEALHNHYTQKSLSLSPGK
288 IGG4 38426 QVQLQESGPGLVKPSETLSLTCAVSGYSILSGY
HC YWFWIRQPPGKGLEWIGGIYHSGSTAYNPSLKS
RVTISVDTSKNQFSLKLSSVTAADTAVYYCARG
GEVTYSRGPLDVWGQGTTVTVSSASTKGPSVFP
LAPCSRSTSFSTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC
PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCV
VVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ
FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL
PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT
PPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV
MHEALHNHYTQKSLSLSPGK
289 IGG4  37323 EVQLLESGGGLVQPGGSLRLSCAASGFTFDNYA
HC MHWVRQAPGKCLEWVSAISARAGITYYADSVKG
RFTISRDNSKNTLYLQMNSLRAEDTAVYYCARR
IGYSYGTAPPFDVWGQGTTVTVSSASTKGPSVF
PLAPCSRSTSESTAALGCLVKDYFPEPVTVSWN
SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS
LGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPP
CPAPEFLGGPSVFLPPPKPKDTLMISRTPEVTC
VVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREE
QFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKG
LPSSIEKTISKAKGQPREPQVYTLPPSQEEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT
TPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCS
VMHEALHNHYTQKSLSLSPGK
290 IGG4  38389 QVQLVESGGGLVQPGGSLRLSCAASGFTFSDYY
HC MSWIRQAPGKGLEWVSYIASSGSVIYYADSVKG
RFTISRDNAKNSLYLQNMSLRAEDTAVYYCARH
GTPRAFDIWGQGTTVTVSSASTKGPSVFPLAPC
SRSTSESTAALGCLVKDYFPEPVTVSWNSGALT
SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKT
YTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPE
FLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
SQEDPEVQFNWYVDGVEVHNAKTKPREEQFNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSI
EKTISKAKGQPREPQVYTLPPSQEEMTKNQVSL
TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL
DSDGSFFLYSRLTVDKSRWQESNVFSCSVMHEA
LHNHYTQKSLSLSPGK
291 IGG4  38358 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSSA
HC MAWVRQAPGKGLEWVSTISGSCITTWYADSVKG
RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKG
SRHLNAFNRWGQGTTVTVSSASTKGPSVFPLAP
CSRSTSESTAALGCLVKDYFPEPVTVSWNSGAL
TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTK
TYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAP
EFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD
VSQEDPEVQFNWYVDGVEVHHAKTKPREEQFNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSS
IEKTISKAKGQPREPQVYTLPPSQEEMTKNQVS
LTCLVKCFYPSDIAVEWESNGQPENNYKTTPPV
LDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHE
ALHNHYTQKSLSLSPGK
292 IGG4  33303 QVQLQESGPGLVKPSGTLSLTCAVSGGSISSSN
HC WWSWVRQPPGKGLEWIGEIYHSGSTNYNPSLKS
RVTISVDKSKNQFSLKLSSVTAADTAVYYCARG
VYHYDPYGMDVWGQGTTVTVSSASTKGPSVFPL
APCSRSTSESTAALOCLVKDVFPEPVTVSWNSG
ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG
TKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP
APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV
VDVSQEDPEVQFNWYVDSVEVHNAKTKPREEQF
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP
SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ
VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP
PVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVM
HEALHNHYTQKSLSLSPGK
293 IGG4  33342 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSS
HC YYWGWIRQPPGKGLEWIGSISYSGSTYYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
TELGKMHFDYWGQGTLVTVSSASTKGPSVFPLA
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
KTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPA
PEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVV
DVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS
SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQV
SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH
EALHNHYTQKSLSLSPGK
294 IGG4  33329 QLQLQESGPGLVKPSETLSLTCTVSGGSISSSD
HC YYWGWIRQPPGKGLEWIGSIYYSGSTYYNPSLK
SRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR
GSPRYMQDWGQGTLVTVSSASTKGPSVFPLAPC
SRSTSESTAALGCLVKDYFPEPVTVSWNSGALT
SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKT
YTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPE
FLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
SQEDPEVQFNWYVDGVEVHNAKTKPREEQFNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSI
EKTISKAKGQPREPQVYTLPPSQEEMTKNQVSL
TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL
DSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEA
LHNHYTQKSLSLSPGK
295 IGG4 33351 QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYY
HC MSWIRQAPGKGLEWVSYISSSGSTIYYADSVKG
RFTISRDNAKNSLYLQMNSLRAEDTAVYYCARH
SSLGTHNWFDPWGQGTLVTVSSASTKGPSVFPL
APCSRSTSESTAALGCLVKDYFPEPVTVSWNSG
ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG
TKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP
APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV
VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP
SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQ
VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP
PVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVM
HEALHNHYTQKSLSLSPGK
296 IGG4  33357 QVQLQESGPGLVKPSETLSLTCAVSGYSISSGY
HC YWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKS
RVTISVDTSKNQFSLKLSSVTAADTAVYYCARE
GALSYSWLAAFDIWGQGTMVTVSSASTKGPSVF
PLAPCSRSTSESTAALGCLVKDYFPEPVTVSWN
SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS
LGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPP
CPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTC
VVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREE
QFNSTYRVVSVDTVLHQDWLNGKEYKCKVSNKG
LPSSIEKTISKAKGQPREPQVYTLPPSQEEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT
TPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCS
VMHEALHNHYTQKSLSLSPGK
297
298
299
300 LC 33343 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY
LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQAVHSPYTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLKNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
301 LC 37268 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY
LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQAVHSPYTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKEKVYACEVT
HQGLSSPVTKSFNRCEC
302 LC 37269 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY
LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQAVHSPYTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
303 LC 37271 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY
LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQAVHSPYTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
304 LC 37272 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY
LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQAVHSPYTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
305 LC 37277 EIVLTQSPGTLSLSPGFRATLSCGASQSVSSDY
LAWYQQKPGQAPRLLIYGAYSLATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQWAVHSPYTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
306 LC 38373 EIVLTQSPGTLSLSPGERATLSCQASQAVSSNY
LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQVVHSPYTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
307 LC 38375 EIVLTQSPGTLSLSPGERATLSCGASQSVSSAF
LAWYQQKPGQAPRLLIYGASARATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQVVHSPYTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
308 LC 38379 EIVLTQSPGTLSLSPGERATLSCRASQSVSSTY
LAWYQQKPGQAPRLLIYGASSREAGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQTVHSPYTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
309 LC 38381 EIVLTQSPGTLSLSPGERATLSCQASQAVSSNY
LAWYQQKPGQAPRLLIYGASNRAAGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQAIHSPYTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
310 LC 38383 EIVLTQSPGTLSLSPGERATLSCQASQSVSSSY
LAWYQQKPGQAPRLLIYGASNRAAGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQVVHSPYTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
311 LC 38386 EIVLTQSPGTLSLSPGERATLSCKASQAVSSSY
LAWYQQKPGQAPRLLIYGASSRQDGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYGQQVVHSPYTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
312 LC 37273 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY
LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQAVHSPYTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
313 LC 33361 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY
LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQHSSYPPTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
314 LC 35624 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY
LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS
GSGTDFTLTISPLEPEDFAVYYCQQHSSYPPTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
315 LC 38410 EIVLTQSPGTLSLSPGERATLSCEASQSVSSSY
LAWYQQKPGQAPRLLIYGASNPATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQHSLYPPTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
316 LC 38418 EIVLTQSPGTLSLSPGERATLSCEASQSVSASY
LAWYQQKPGQAPRLLIYDASSRASGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQFSSYPPTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
317 LC 38420 EIVLTQSPGTLSLSPGERATLSCEASQSVSSAY
LAWYQQKPGQAPRLLIYDASTRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQVSSYPPTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
318 LC 38421 EIVLTQSPGTLSLSPGERAALSCRVSQSVSDAY
LAWYQQKPGQAPRLLIYDASSRASGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQVSSYPPTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
319 LC 38422 EIVLTQSPGTLSLSPGERATLSCEVSQSVSASY
LAWYQQKPGQAPRLLIYGASSRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQHSLYPPTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
320 LC 38424 EIVLTQSPGTLSLSPGERATLSCRASQSVSSAY
LAWYQQKPGQAPRLLIYGASDRANGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQHSLYPPTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
321 LC 38425 EIVLTQSPGTLSLSPGERATLSCRASNAVSSSY
LAWYQQKPGQAPRLLIYGASDRANGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQHSIYPPTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
322 LC 38426 EIVLTQSPGTLSLSPGERATLSCRASNAVSSSY
LAWYQQKPGQAPRLLIYGASYRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQHSLYPPTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
323 LC 37323 DIQMTQSPSTLSASVGDRVTITCRASQSINSWL
AWYQQKPGKAPKLLISDASSLESGVPSRFSGSG
SGTEFTLTISSLQPDDFATYYCQQYDSHITFGG
GTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVV
CLLNNFYPREAKVQWKVDNALQSGNSQESVTEQ
DSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQ
GLSSPVTKSFNRGEC
324 LC 38389 DIQMTQSPSSVSASVGDRVTITCAASQGISSDL
AWYQQKPGKAPKLLIYSASSTQSGVPSRFSGSG
SGTDFTLTISSLQPEDFATYYCQQAYLYPITFG
GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV
VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE
QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH
QGLSSPVTKSFNRGEC
325 LC 38358 GVQMTQSPSSLSASVGDRVTITCRASQDISTYL
NWYQQKPGKAPKLLIYDAFNLETGVPSRFSGSG
SGTDFTFTISSLQPEDIATYYCQQLPFLPITFG
GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV
VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE
QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH
QGLSSPVTKSFNRGEC
326 LC 33303 DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSN
GYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDR
FSGSGSGTDFTLKISRVEAEDVGVYYCMQALGG
PWTFGGSTKVEIKRTVAAPSVFIFPPSDEQLKS
GTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYA
CEVTHQGLSSPVTKSFNRGEC
327 LC 33342 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY
LAWYQQKPGQAPRLLIYGASRRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQYVSDPITF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
328 LC 33299 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSY
LAWYQQKPGQAPRLLIYGASRRATGIPDRFSGS
GSGTDFTLTISRLEPEDFAVYYCQQVGSSPITF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
329 LC 33351 DIQMTQSPSSLSASVGDRVTITCRASQSISSYL
NWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSG
SGTDFTLTISSLQPEDFATYYCQQSHLVPRTFG
GGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV
VCLLNNFYPREAKVQWKVDNALQSGNSQESVTE
QDSKDSTYSLSSTLTLSKADYEKHKVYACFVTH
QGLSSPVTKSFNRGEC
330 LC 33357 EIVMTQSPATLSVSPGERATLSCRASQSVSSNL
AWYQQKPGQAPRLLIYGASTRATGIPARFSGSG
SGTEFTLTISSLQSEDFAVYYCQQANHHPPFTF
GGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQSGNSQESVT
EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGEC
331
332
333
334 Fc  ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF
for  PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS
IGG1 SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
PKSCDKTHTCPPCPAPEAAGAPSVFLFPPKPKD
TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV
EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN
GKEYKCKVSNKALPAPIEKTISKAKGQPREPQV
YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEW
ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK
SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
335 Fc   ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYF
re- PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS
gion SVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVE
for SKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLM
IGG4 ISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVH
NAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKE
YKCKVSNKGLPSSIEKTISKAKGQPREPQVYTL
PPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESN
GQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRW
QEGNVFSCSVMHEALHNHYTQKSLSLSPGK
336 Kappa  RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFY
re- PREAKVQWKVDNALQSGNSQESVTEQDSKDSTY
gion  SLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT
for KSFNRGEC
LC
337 hHLA-G1 MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFS
AAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSAC
PRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDR
MNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGR
LLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQ
ISKRKCEAANVAEQRRAYLEGTCVEWLHRYLEN
GKEMLQRADPPKTHVTHHPVFDYEATLRCWALG
FYPAEIILTWQRDGEDQTQDVELVETRPAGDGT
FQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLR
WKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAV
LWRKKSSD
338 hHLA-G5 MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFS
AAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSAC
PRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDR
MNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGR
LLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQ
ISKRKCEAANVAEQRRAYLEGTCVEWLHRYLEN
GKEMLQRADPPKTHVTHHPVFDYEATLRCWALG
FYPAEIILTWQRDGEDQTQDVELVETRPAGDGT
FQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLR
WSKEGDGGIMSVRESRSLSEDL
339 Cyno  MAVMAPRTLLLVLSGVLALTQPRAGSHSMRYFY
HLA-AG TAVSRPGRGQPRFIAVGYVDDTQFVRFDSDAES
PRMEPRAPWVEQEGPEYWDRETQNMKTATQTYQ
ANLRTLLRYYNQSEAGSHTFQKMYGCDLGPDGR
LLRGYEQFAYDGRDYIILNEDLRSWTAADMAAQ
NTQRKWEAAGAAEQHRTYLEGECLEWLRRYLEN
GKETLQRADPPKTNVTHHPVSDYEATLRCWALG
FYPAEITLTWQRDGEEQTEDTELVETRPTGDGT
FQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLR
WEPSSQSTILIVGIIAGLVLLGTVVTGAVVAAV
MWRRKS
340 Rhesus  MAVMAPRTLLLVLSGVLALTQTRAGSHSMRYFY
HLA-AG TSMSRPGRGQPRFIAVGYVDDTQFVRFDSDAES
PRMEPRAPWVEQEGPEYWDRETQNMKTATQTYR
ENLRTLLRYYNQSEAGSHTIQKMYGCDLHPFGR
LLRGYEQFAYDGRDYIALNEDLRSWTAADMAAQ
FTQRKWEAAGAAEQHRTYLEGECLEWLRRYLEN
GKETLQRADPPKTNVTHHPVSDYEATLRCWALG
FYPAEITLTWQRDGEEQTEDTETVETRPTGDGT
FQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLR
WEPSSQSTILIVGIIAGLVLLGTVVTGAVVAAV
MWRRKSSDR
341 hHLA- MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFS
G ECD  AAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSAC
with PRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDR
signal MNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGR
peptide LLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQ
ISKRKCEAANVAEQRRAYLEGTCVEWLHRYLEN
GKEMLQRADPPKTHVTHHPVFDYEATLRCWALG
FYPAEIILTWQRDGEDQTQDVELVETRPAGDGT
FQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLR
W
342 hHLA- GSHSMRYFSPAVSRPGRGEPRFIAMGYVDDTQF
G ECD  VRFDSDSACPRMEPRAPWVEQEGPEYWEEETRN
without TKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMI
signal GCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRS
peptide WTAADTAAQISKRKCEAANVAEQRRAYLEGTCV
EWLHRYLENGKEMLQRADPPKTHVTHHPVFDYE
ATLRCWALGFYPAEIILTWQRDGEDQTQDVELV
ETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHE
GLPEPLMLRW
EQUIVALENTS
The disclosure set forth above may encompass multiple distinct inventions with independent utility. Although each of these inventions has been disclosed in its preferred form(s), the specific embodiments thereof as disclosed and illustrated herein are not to be considered in a limiting sense, because numerous variations are possible. The subject matter of the inventions includes all novel and nonobvious combinations and subcombinations of the various elements, features, functions, and/or properties disclosed herein. The following claims particularly point out certain combinations and subcombinations regarded as novel and nonobvious. Inventions embodied in other combinations and subcombinations of features, functions, elements, and/or properties may be claimed in this application, in applications claiming priority from this application, or in related applications. Such claims, whether directed to a different invention or to the same invention, and whether broader, narrower, equal, or different in scope in comparison to the original claims, also are regarded as included within the subject matter of the inventions of the present disclosure.

Claims (10)

What is claimed is:
1. An antibody that specifically binds to human HLA-G (hHLA-G), comprising a heavy chain variable region (VH) and a light chain variable region (VL), wherein
a) the VH comprises:
i) a VH-complementarity determining region (CDR) 1 comprising the amino acid sequence set forth in SEQ ID NO: 7; a VHCDR2 comprising the amino acid sequence set forth in SEQ ID NO: 44; and a VHCDR3 comprising the amino acid sequence set forth in SEQ ID NO: 93, wherein the CDRs are according to Chothia; or
ii) a VHCDR1 comprising the amino acid sequence set forth in SEQ ID NO: 25; a VHCDR2 comprising the amino acid sequence set forth in SEQ ID NO: 65; and a VHCDR3 comprising the amino acid sequence set forth in SEQ ID NO: 93, wherein the CDRs are according to Kabat; and
b) the VL comprises:
i) a VLCDR1 comprising the amino acid sequence set forth in SEQ ID NO: 118; a VLCDR2 comprising the amino acid sequence set forth in SEQ ID NO: 138; and a VLCDR3 comprising the amino acid sequence set forth in SEQ ID NO: 155, wherein the CDRs are according to Chothia and Kabat.
2. The antibody of claim 1, comprising a VH sequence that is at least 85% identical to the amino acid sequence set forth in SEQ ID NO: 192 and a VL sequence that is at least 85% identical to the amino acid sequence set forth in SEQ ID NO: 220.
3. The antibody of claim 1, comprising a VH sequence that is at least 95% identical to the amino acid sequence set forth in SEQ ID NO: 192 and a VL sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 220.
4. The antibody of claim 1, wherein the antibody comprises a heavy chain of SEQ ID NO: 254 and a light chain of SEQ ID NO: 322.
5. The antibody of claim 1, wherein the antibody comprises a heavy chain of SEQ ID NO: 288 and a light chain of SEQ ID NO: 322.
6. The antibody of claim 1, wherein the antibody is a monoclonal antibody.
7. A pharmaceutical composition comprising the antibody of claim 1 and a pharmaceutically acceptable carrier or excipient.
8. The pharmaceutical composition of claim 7, further comprising an effective amount of at least one of the following:
a) an anti-ILT2 antibody;
b) an anti-ILT4 antibody;
c) an anti-KIR2DL4 antibody;
d) an anti-HLA-E antibody;
e) an anti-NKG2A antibody
f) an anti-HLA-F antibody
g) an anti-PD-L1 antibody;
h) an anti-PD-1 antibody;
i) an anti-CD38 antibody;
j) an anti-CD39 antibody;
k) an anti-CD73 antibody;
l) an anti-A2A receptor antibody;
m) an anti-A2B receptor antibody;
n) an anti-A2A/A2B dual receptor antibody or a combination thereof;
o) an anti-CD47 antibody;
p) an anti-CTLA-4 antibody;
q) an anti-TIM-3 antibody;
r) an anti-TIGIT antibody;
s) an anti-VISTA antibody;
t) an anti-CD94 antibody;
u) a small molecule inhibitor;
v) an oncolytic virus;
w) a chemotherapy; and/or
x) ADCC capable therapies using effector competent antibodies selected from the group consisting of anti-CD19, anti-CD20, anti-EGFR, anti-Her2, anti-SLAMF7, anti-CD52, anti-BCMA, anti-GD2, and anti-CCR4.
9. The pharmaceutical composition of claim 8, further comprising one or both of
a) an antibody to an immune inhibitory receptor or ligand and/or
b) an antibody to an immune stimulatory receptor or ligand.
10. A kit comprising the antibody of claim 1.
US16/584,421 2018-09-27 2019-09-26 Anti-HLA-G antibodies, compositions comprising anti-HLA-G antibodies and methods of using anti-HLA-G antibodies Active 2040-01-20 US11208487B2 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
US16/584,421 US11208487B2 (en) 2018-09-27 2019-09-26 Anti-HLA-G antibodies, compositions comprising anti-HLA-G antibodies and methods of using anti-HLA-G antibodies
US17/530,072 US12264199B2 (en) 2018-09-27 2021-11-18 Anti-HLA-G antibodies, compositions comprising anti-HLA-G antibodies and methods of using anti-HLA-G antibodies
US19/065,819 US20250353913A1 (en) 2018-09-27 2025-02-27 Anti-hla-g antibodies, compositions comprising anti-hla-g antibodies and methods of using anti-hla-g antibodies

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201862737666P 2018-09-27 2018-09-27
US16/584,421 US11208487B2 (en) 2018-09-27 2019-09-26 Anti-HLA-G antibodies, compositions comprising anti-HLA-G antibodies and methods of using anti-HLA-G antibodies

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US17/530,072 Continuation US12264199B2 (en) 2018-09-27 2021-11-18 Anti-HLA-G antibodies, compositions comprising anti-HLA-G antibodies and methods of using anti-HLA-G antibodies
US17/530,072 Division US12264199B2 (en) 2018-09-27 2021-11-18 Anti-HLA-G antibodies, compositions comprising anti-HLA-G antibodies and methods of using anti-HLA-G antibodies
US19/065,819 Continuation US20250353913A1 (en) 2018-09-27 2025-02-27 Anti-hla-g antibodies, compositions comprising anti-hla-g antibodies and methods of using anti-hla-g antibodies

Publications (2)

Publication Number Publication Date
US20200102390A1 US20200102390A1 (en) 2020-04-02
US11208487B2 true US11208487B2 (en) 2021-12-28

Family

ID=68296637

Family Applications (4)

Application Number Title Priority Date Filing Date
US16/584,421 Active 2040-01-20 US11208487B2 (en) 2018-09-27 2019-09-26 Anti-HLA-G antibodies, compositions comprising anti-HLA-G antibodies and methods of using anti-HLA-G antibodies
US17/280,755 Abandoned US20210340259A1 (en) 2018-09-27 2019-09-26 Anti-hla-g antibodies, compositions comprising anti-hla-g antibodies and methods of using anti-hla-g antibodies
US17/530,072 Active 2041-07-26 US12264199B2 (en) 2018-09-27 2021-11-18 Anti-HLA-G antibodies, compositions comprising anti-HLA-G antibodies and methods of using anti-HLA-G antibodies
US19/065,819 Pending US20250353913A1 (en) 2018-09-27 2025-02-27 Anti-hla-g antibodies, compositions comprising anti-hla-g antibodies and methods of using anti-hla-g antibodies

Family Applications After (3)

Application Number Title Priority Date Filing Date
US17/280,755 Abandoned US20210340259A1 (en) 2018-09-27 2019-09-26 Anti-hla-g antibodies, compositions comprising anti-hla-g antibodies and methods of using anti-hla-g antibodies
US17/530,072 Active 2041-07-26 US12264199B2 (en) 2018-09-27 2021-11-18 Anti-HLA-G antibodies, compositions comprising anti-HLA-G antibodies and methods of using anti-HLA-G antibodies
US19/065,819 Pending US20250353913A1 (en) 2018-09-27 2025-02-27 Anti-hla-g antibodies, compositions comprising anti-hla-g antibodies and methods of using anti-hla-g antibodies

Country Status (27)

Country Link
US (4) US11208487B2 (en)
EP (1) EP3856780A1 (en)
JP (2) JP7588068B2 (en)
KR (1) KR102867868B1 (en)
CN (2) CN113166243B (en)
AR (2) AR116526A1 (en)
AU (1) AU2019346598B2 (en)
BR (1) BR112021005868A2 (en)
CA (1) CA3114407A1 (en)
CL (2) CL2021000761A1 (en)
CO (1) CO2021004719A2 (en)
CR (1) CR20210197A (en)
DO (1) DOP2021000049A (en)
EA (1) EA202190609A1 (en)
EC (1) ECSP21026339A (en)
IL (1) IL281778A (en)
MX (1) MX2021003555A (en)
MY (1) MY204959A (en)
NZ (1) NZ774376A (en)
PE (1) PE20211767A1 (en)
PH (1) PH12021550690A1 (en)
SG (1) SG11202103104RA (en)
TW (2) TW202438522A (en)
UA (1) UA129052C2 (en)
UY (1) UY38391A (en)
WO (1) WO2020069133A1 (en)
ZA (2) ZA202102034B (en)

Families Citing this family (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA3104530A1 (en) 2018-07-09 2020-01-16 Five Prime Therapeutics, Inc. Antibodies binding to ilt4
BR112022011235A2 (en) 2019-12-09 2022-12-13 Twist Bioscience Corp LIBRARIES OF NUCLEIC ACID VARIANTS TO ADENOSINE RECEPTORS
PH12022553387A1 (en) * 2020-06-11 2024-03-25 Tizona Therapeutics Bispecific immune cell engagers with binding specificity for hla-g and another antigen
KR20230147617A (en) * 2021-01-21 2023-10-23 트위스트 바이오사이언스 코포레이션 Methods and compositions related to adenosine receptors
US11795227B2 (en) * 2021-03-24 2023-10-24 Shine-On Biomedical Co., Ltd. Immunomodulation and anti-tumor-related nanobody and nucleic acid encoding sequence thereof, and uses of the same
US12012454B2 (en) * 2021-03-24 2024-06-18 China Medical University Hospital Anti-tumor antigen nanobody and nucleic acid encoding sequence thereof, and uses of the same
GB202111905D0 (en) 2021-08-19 2021-10-06 UCB Biopharma SRL Antibodies
CN115925930B (en) * 2021-11-04 2025-10-31 台州恩泽医疗中心(集团) Monoclonal antibody for resisting HLA-G1, HLA-G4 and HLA-G5 isomer molecules and application thereof
US20250297013A1 (en) * 2022-03-25 2025-09-25 Hk Inno.N Corporation Hla-g-specific antibody and use thereof
CN115819583B (en) * 2022-03-31 2026-03-03 台州恩泽医疗中心(集团) Monoclonal antibody of anti-HLA-G molecule and application thereof
TW202346367A (en) * 2022-04-08 2023-12-01 美商提聖納醫療公司 Combination therapy involving anti-hla-g antibodies and anti-egfr antibodies, anti-pd1 or anti-pd-l1 antibodies, and/or anti-cd47 antibodies
CN119768507A (en) * 2022-06-24 2025-04-04 怡诺安有限公司 Immune cells expressing immune checkpoint regulators and uses thereof
CN117448412A (en) * 2022-07-26 2024-01-26 中山大学孙逸仙纪念医院 CD158d molecules, neutralizing antibodies, and applications
WO2024108568A1 (en) * 2022-11-25 2024-05-30 深圳先进技术研究院 Anti-human leukocyte antigen-g nanobody, and preparation method therefor and use thereof
CN119569891B (en) * 2023-09-06 2025-09-05 上海恩凯细胞技术有限公司 Application of chimeric antigen receptors targeting non-classical HLA molecules for cancer therapy
GB202319122D0 (en) * 2023-12-14 2024-01-31 Kbio Holdings Ltd Antibody
WO2025165879A1 (en) 2024-01-29 2025-08-07 Tizona Therapeutics, Inc. Methods of using anti-hla-g antibodies
WO2025245256A1 (en) 2024-05-22 2025-11-27 Tizona Therapeutics, Inc. Combination therapy involving anti-hla-g antibodies and anti- egfr antibodies or anti-pd-1 antibodies

Citations (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1996031604A1 (en) 1995-04-07 1996-10-10 The Regents Of The University Of California Antibodies for the detection of hla-g
WO1999042128A1 (en) 1998-02-20 1999-08-26 Commissariat A L'energie Atomique Method for selecting tumours expressing hla-g, sensitive to anticancer treatment and uses
WO2002022784A2 (en) 2000-09-15 2002-03-21 University Of Kansas Medical Center Expression, preparation, uses, and sequence of recombinantly-derived soluble hla-g
CN1718588A (en) 2004-10-26 2006-01-11 四川新创生物科技有限公司 Monoclone antibody for anti HLA-G and hybrid tumour cell secreting same, cancer dignosis method, diagnosis reagent box and its application
US20070020703A1 (en) 2003-06-30 2007-01-25 Commissariat A L'energie Atomique Use of compositions comprising a soluble form of hla-g in the treatment of blood diseases
US20070259403A1 (en) 2003-11-04 2007-11-08 The Animal Engineering Research Institute Hla-E Chimeric Molecule
WO2010150235A1 (en) 2009-06-25 2010-12-29 Commissariat A L'energie Atomique Et Aux Energies Alternatives Multimeric polypeptides of hla-g including alpha1-alpha3 monomers and pharmaceutical uses thereof
CN101967191A (en) 2009-07-28 2011-02-09 广州天美生物技术有限公司 Preparation method of HLA-G (Human Leukocyte Antigen G) antibody and application of HLA-G antibody in medicine
WO2013106586A2 (en) 2012-01-11 2013-07-18 The Terasaki Family Foundation Anti-hla class-ib antibodies mimic immunoreactivity and immunomodulatory functions of intravenous immunoglobulin (ivig) useful as therapeutic ivig mimetics and methods of their use
EP2730588A1 (en) 2012-11-12 2014-05-14 Intelectys Antibodies and fragments thereof raised against the alpha-3 domain of HLA-G protein, methods and means for their preparation, and uses thereof
WO2016160622A2 (en) 2015-03-27 2016-10-06 University Of Southern California Hla-g as a novel target for car t-cell immunotherapy
US20170226223A1 (en) 2015-05-15 2017-08-10 City Of Hope Chimeric antigen receptor compositions
WO2017207775A1 (en) 2016-06-03 2017-12-07 Invectys Anti hla-g specific antibodies
WO2018091580A1 (en) 2016-11-18 2018-05-24 F. Hoffmann-La Roche Ag Anti-hla-g antibodies and use thereof
WO2019202040A1 (en) 2018-04-18 2019-10-24 F. Hoffmann-La Roche Ag Anti-hla-g antibodies and use thereof
WO2020043899A1 (en) 2018-08-31 2020-03-05 Invectys Chimeric antigen receptors against multiple hla-g isoforms

Family Cites Families (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4560655A (en) 1982-12-16 1985-12-24 Immunex Corporation Serum-free cell culture medium and process for making same
US4657866A (en) 1982-12-21 1987-04-14 Sudhir Kumar Serum-free, synthetic, completely chemically defined tissue culture media
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4767704A (en) 1983-10-07 1988-08-30 Columbia University In The City Of New York Protein-free culture medium
GB8516415D0 (en) 1985-06-28 1985-07-31 Celltech Ltd Culture of animal cells
US4927762A (en) 1986-04-01 1990-05-22 Cell Enterprises, Inc. Cell culture medium with antioxidant
US5567610A (en) 1986-09-04 1996-10-22 Bioinvent International Ab Method of producing human monoclonal antibodies and kit therefor
IL85035A0 (en) 1987-01-08 1988-06-30 Int Genetic Eng Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same
US5204244A (en) 1987-10-27 1993-04-20 Oncogen Production of chimeric antibodies by homologous recombination
DE68925971T2 (en) 1988-09-23 1996-09-05 Cetus Oncology Corp CELL GROWING MEDIUM FOR INCREASED CELL GROWTH, FOR INCREASING LONGEVITY AND EXPRESSION OF PRODUCTS
GB8823869D0 (en) 1988-10-12 1988-11-16 Medical Res Council Production of antibodies
US5175384A (en) 1988-12-05 1992-12-29 Genpharm International Transgenic mice depleted in mature t-cells and methods for making transgenic mice
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5229275A (en) 1990-04-26 1993-07-20 Akzo N.V. In-vitro method for producing antigen-specific human monoclonal antibodies
US5122469A (en) 1990-10-03 1992-06-16 Genentech, Inc. Method for culturing Chinese hamster ovary cells to improve production of recombinant proteins
EP0940468A1 (en) 1991-06-14 1999-09-08 Genentech, Inc. Humanized antibody variable domain
ES2136092T3 (en) 1991-09-23 1999-11-16 Medical Res Council PROCEDURES FOR THE PRODUCTION OF HUMANIZED ANTIBODIES.
JP3571337B2 (en) 1992-02-11 2004-09-29 セル ジェネシス,インコーポレーテッド Homozygous gene conjugation by gene targeting
US5573905A (en) 1992-03-30 1996-11-12 The Scripps Research Institute Encoded combinatorial chemical libraries
US5534615A (en) 1994-04-25 1996-07-09 Genentech, Inc. Cardiac hypertrophy factor and uses therefor
DK1360288T3 (en) 2000-12-18 2011-06-14 Dyax Corp Focused libraries of genetic packages
CN1942483B (en) 2004-04-13 2012-09-26 弗·哈夫曼-拉罗切有限公司 Anti-P-selectin antibodies
TWI309240B (en) 2004-09-17 2009-05-01 Hoffmann La Roche Anti-ox40l antibodies
JP5933894B2 (en) 2007-09-14 2016-06-15 アディマブ, エルエルシー Rationally designed synthetic antibody libraries and their use
US8877688B2 (en) 2007-09-14 2014-11-04 Adimab, Llc Rationally designed, synthetic antibody libraries and uses therefor
KR102810907B1 (en) 2010-07-16 2025-05-21 아디맵 엘엘씨 Abtibody libraries
US20140323315A1 (en) 2013-04-29 2014-10-30 Adimab, Llc Polyspecificity reagents, methods for their preparation and use

Patent Citations (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1996031604A1 (en) 1995-04-07 1996-10-10 The Regents Of The University Of California Antibodies for the detection of hla-g
WO1999042128A1 (en) 1998-02-20 1999-08-26 Commissariat A L'energie Atomique Method for selecting tumours expressing hla-g, sensitive to anticancer treatment and uses
WO2002022784A2 (en) 2000-09-15 2002-03-21 University Of Kansas Medical Center Expression, preparation, uses, and sequence of recombinantly-derived soluble hla-g
US20070020703A1 (en) 2003-06-30 2007-01-25 Commissariat A L'energie Atomique Use of compositions comprising a soluble form of hla-g in the treatment of blood diseases
US20070259403A1 (en) 2003-11-04 2007-11-08 The Animal Engineering Research Institute Hla-E Chimeric Molecule
CN1718588A (en) 2004-10-26 2006-01-11 四川新创生物科技有限公司 Monoclone antibody for anti HLA-G and hybrid tumour cell secreting same, cancer dignosis method, diagnosis reagent box and its application
WO2010150235A1 (en) 2009-06-25 2010-12-29 Commissariat A L'energie Atomique Et Aux Energies Alternatives Multimeric polypeptides of hla-g including alpha1-alpha3 monomers and pharmaceutical uses thereof
WO2010150233A2 (en) 2009-06-25 2010-12-29 Commissariat A L'energie Atomique Et Aux Energies Alternatives Multimeric polypeptides of hla-g including at least two alpha3 domains and pharmaceutical uses thereof
CN101967191A (en) 2009-07-28 2011-02-09 广州天美生物技术有限公司 Preparation method of HLA-G (Human Leukocyte Antigen G) antibody and application of HLA-G antibody in medicine
WO2013106586A2 (en) 2012-01-11 2013-07-18 The Terasaki Family Foundation Anti-hla class-ib antibodies mimic immunoreactivity and immunomodulatory functions of intravenous immunoglobulin (ivig) useful as therapeutic ivig mimetics and methods of their use
EP2730588A1 (en) 2012-11-12 2014-05-14 Intelectys Antibodies and fragments thereof raised against the alpha-3 domain of HLA-G protein, methods and means for their preparation, and uses thereof
WO2014072534A1 (en) 2012-11-12 2014-05-15 Intelectys Antibodies and fragments thereof raised against the alpha-3 domain of hla-g protein, methods and means for their preparation, and uses thereof.
WO2016160622A2 (en) 2015-03-27 2016-10-06 University Of Southern California Hla-g as a novel target for car t-cell immunotherapy
US20170226223A1 (en) 2015-05-15 2017-08-10 City Of Hope Chimeric antigen receptor compositions
WO2017207775A1 (en) 2016-06-03 2017-12-07 Invectys Anti hla-g specific antibodies
WO2018091580A1 (en) 2016-11-18 2018-05-24 F. Hoffmann-La Roche Ag Anti-hla-g antibodies and use thereof
WO2019202040A1 (en) 2018-04-18 2019-10-24 F. Hoffmann-La Roche Ag Anti-hla-g antibodies and use thereof
WO2020043899A1 (en) 2018-08-31 2020-03-05 Invectys Chimeric antigen receptors against multiple hla-g isoforms

Non-Patent Citations (89)

* Cited by examiner, † Cited by third party
Title
Ab7759 Data Sheet, ABcam, UK.
Agaugue, S., et al., Role of HLA-G in tumor escape through expansion of myeloid-derived suppressor cells and cytokinic balance in favor of Th2 versus TM/TM1. Blood, 2011.117(26): p. 7021-7031.
Agaugue, Sophie et al., "A human major histocompatibility complex class I gene that encodes a protein with shortened cytoplasmic segment." Immunobiology, 2011.
Aifen Lin et al: "Human Leukocyte Antigen-G (HLA-G) Expression in Cancers: Roles in Immune Evasion, Metastasis and Target for Therapy", Molecular Medicine, vol. 21, No. 1, Jan. 1, 2015 (Jan. 1, 2015), p. 1, XP055365402, Washington, DC; US ISSN: 1076-1551, DOI: 10.2119/molmed.2015.00083 the whole document, in particular p. 788, middle column-p. 789, left-hand column, first paragraph; figure 3.
AIFEN LIN, WEI-HUA YAN: "Human Leukocyte Antigen-G (HLA-G) Expression in Cancers: Roles in Immune Evasion, Metastasis and Target for Therapy", MOLECULAR MEDICINE, FEINSTEIN INSTITUTE FOR MEDICAL RESEARCH, WASHINGTON , DC, vol. 21, no. 1, Washington , DC , pages 1, XP055365402, ISSN: 1076-1551, DOI: 10.2119/molmed.2015.00083
Alignment of the amino acid sequence of the 3 domain of HLA-G with antigenic determinant C.
Angal et al., "A single amino acid substitution abolishes the heterogeneity of chimeric mouse/human (IgG4) antibody" Molecular Immunology, Jan. 1993;30(1); 105-8 (cited in Annex 4).
ANNEX 1—MEM-G/04 Specificity and Blocking Activity.
Annex 2—Characterization of 01G Antibody.
Annex 3—Alpha 3 Domain Immunization of Mice and Rabbits and Characterization of Obtained Sera and Monoclonal Antibodies.
Annex 4—1537 Specificity and Blocking Activity.
Annex 5—Hydrophobicity Profile of Alpha 3 Domain of HLA-G in Comparison to Other HLA-I.
Apps R, et al., A critical look at HLA-G. Trends Immunol. Jul. 2008;29(7):313-21.
Barnstable et al., "Production of monoclonal antibodies to group A erythrocytes, HLA and other human cell surface antigens-new tools for genetic analysis" Cell, May 1978; 14)1);9-20 (cited in Annex 1 and Annex 2).
Bensussan, A et al., "Detection of membrane-bound HLA-G translated products with a specific monoclonal antibdy" PNAS, vol. 92, 1995, p. 10292-10296.
Boyson, J et al., "Disulfide bond-mediated dimerization of HLA-G on the cell surface" PNAS, vol. 99, No. 25, 2002 16180-16185 (2002).
Carosella et al. Beyond the increasing complexity of the immunomodulatory HLA-G molecule. Blood (2008) 111(10): 4862-4870 (a). HLA-G isoforms structures.
Carosella et al. HLA-G: from biology to clinical benefits Trends in Immunology vol. 29 No. 3 (126:132) 2008 (b).
Chaplin, David D., "Overview of the immune response" J Allergy Clin. Immunol, Feb. 2010; 125(2 Suppl 2): S3-23.
Chua et al. Chapter 40 Production of Monoclonal Antibody by DNA Immunization with Electroporation S. Li (ed.), Electroporation Protocols: Preclinical and Clinical Gene Medicine. Methods in Molecular Biology, vol. 423. 2008.
Clements, C.S. et al., "Crystal structure of HLA-G: A nonclassical MHC class I molecule expressed at the fetal-maternal interface" PNAS, vol. 102, No. 9, Mar. 1, 2005 pp. 3360-3365.
Contini et al., Soluble HLA-A, -B, -C and -G molecules induce apoptosis in T and NK CD8+ cells and inhibit cytotoxic T Cell activity through CD8 litigation; Eur J. Immunol. 33(2003), 125-134.
Desai, S, et al. Structural Relatedness of Distinct Determinants Recognized by Monoclonal Antibody TP25.99 on B2-Microglobulin-Associated and B2-Microglobulin-Free HLA Class I Heavy Chains, The Journal of Immunology, 2000, 165: 3275-3283.
Desai, Smruti A. et al., "Chains-Microglobulin-Free HLA Class I Heavy-Microglobulin Associated and b2Antibody TP25.99 on b2 Determinants Recognized by Monoclonal Structural" The Journal of Immunology, 2000.
Diaz-Lagares, A et al., "Nitric oxide produces HLA-G nitration and induces metalloprotease-dependent shedding creating a tolerogenic milieu" Immunology, vol. 126, No. 3, 2008, 436-445.
Donadi, E et al., "Implications of the polymorphism of HLA-G on its fuction, regulation, evolution and disease association" Cellular and Molecular Life Sciences, vol. 68, 2011, pp. 369-395.
Excerpt from "DNA Vaccines: Methods and Protocols" (2000) pp. 37-38.
Excerpt of p. 735 from Janeway's Immunobiology, p. 735, eds. Murphy et al., 7th ed., 2008.
Experimental data: 15E7 Blocking HLA-G6/ILT4 Interaction.
Fioretti, Daniela et al., "DNA vaccines: developing new strategies against cancer" Journal of Biomedicine and Biotechnology, 2010;2010:174378.
Fournel S, et al., Comparative reactivity of different HLA-G monoclonal antibodies to soluble HLA-G molecules. Tissue Antigens. Jun. 2000;55(6):510-8.
Furukawa et al., Evaluation of the Reactivity and Receptor Competition of HLA-G Isoforms toward Available Antibodies: Implications of Structural Characteristics of HLA-G Isoforms (2019) Int. J. Mol. Sci. 20: 5947.
Gauster, M., et al.; Monoclonal antibody HC10 does not bind HLA-G; Rheumatology 46, 892-893 (2007).
Geraghty, D.E., et al., A human major histocompatibility complex class I gene that encodes a protein with shortened cytoplasmic segment. Proc. Natl. Acad. Sci. USA, 1987. 84(1): p. 9145-9149.
Gonen-Gross, et al., "Complexes of HLA-G Protein on the Cell Surface Are Important for Leukocyte Ig-Like Receptor-1 Function" The Journal of Immunology, vol. 171, 2003, pp. 1343-1351.
HC10 Data Sheet, Mouse anti Human HLA Class I Heavy Chain (Restricted expression), Nordic-MUbio, pp. 1-3.
Ishitani, Akiko et al., "Protein expression and peptide binding suggest unique and interacting functional roles for HLA-E, F, and G in maternal-placental immune recognition" The Journal of Immunology, Aug. 1, 2003; 171(3):1376-1384.
Kobayashi, Y et al., "Establishment of a Choriocarcinoma Model from Immortalized Normal Extravillous Trophoblast Dells Transduced with HRASV12" The Ameican Journal of Pathology, vol. 179, No. 3, Sep. 3, 2011, 1471-1482 (2011).
Kutzler, Michele A. et al., "DNA vaccines: ready for prime time?" Nature Reviews Genetics, Oct. 2008;9(10);174378.
Laddy, et al., "From Plasmids to Protection: A Review of DNA Vaccines Against Infectious Diseases" International Reviews of Immunology, 25:99-123, 2006.
Le Discorde, Magali et al., "HLA-G*0105N null allele encodes functional HLA-G isoforms." Biology of Reproduction, vol. 73(2), Aug. 2005, pp. 280-288.
Le Gal, et al., HLA-G-mediated inhibition of antigen-specific cytotoxid T Lymphocytes, International Immunology, vol. 11, No. 8, pp. 1351-1356.
Le Rond S, et al., Alloreactive CD4+ and CDS+ T cells express the immunotolerant HLA-G molecule in mixed ymphocyte reactions: in vivo implications in transplanted patients. Eur J Immunol. Mar. 2004;34(3) :649-660.
Lee N, et al., The membrane-bound and soluble forms of HLA-G bind identical sets of endogenous peptides but differ with respect to TAP association. Immunity. Nov. 1995;3(5):591-600.
Li Hua et al.: "Increasing the safety and efficacy of chimeric antigen receptor T Cell therapy", Protein & Cell, Springer Asia, Beijing, CN, vol. 8, No. 8, Apr. 22, 2017 (Apr. 22, 2017).
Liang et al., HLA-G inhibits the functions of murine dendritic cells via the PIR-B immune inhibitory receptor, Eur. J. Immunol. 32 (2002), 2418-2426 2002.
Lin, A et al., "HLA-G expression in Human ovarian carcinoma counteracts NK cell function" Annals of Oncology, vol. 18, 2007, pp. 1804-1809.
Loke, Y et al., "Evaluation of trophoblast HLA-G antigen with a specific monoclonal antibody" Tissue Antigens, vol. 50, 1997, pp. 135-146.
Loumagne, Laure, et al., "Alloreactive CD4+ and CDS+ T cells express the immunotolerant HLA-G molecule in mixed lymphocyte reactions: in vivo implications in transplanted patients.in vivo evidence that secretion of HLA-G by immunogenic tumor cells allows their evasion from immunosurveillance", International Journal of Cancer, 135, 2107-2117(2014).
Loustau et al., HLA-G Neo-Expression on Tumors, Frontiers in Immunology 11(2020), Article 1685 Aug. 14, 2020.
Mansfield, A et al., "Regional immunity in melanoma: immunosuppressive changes precede nodal metastasis" Modern Pathol, vol. 24, 2011 particular relevance: pp. 487-494 487-494 (2011 ).
Markel, G et al., "Preclinical Evaluation of Adoptive Cell Therapy for Patients with Metastatic Renal Cell Carcinoma" Anticancer Research, vol. 29, 2009, pp. 145-154.
Matsushita et al., Differential but Competitive Binding of Nogo Protein and class 1 Major Histocompatibility Complex (MHCI) to the PIR-B Ectodomain Provides an Inhibition of Cells, J. Biol. Chem. 286(29), 25739 25747 Feb. 6, 2011.
McMaster M, et al., HLA-G isoforms produced by placental cytotrophoblasts and found in amniotic fluid are due to unusual glycosylation. J Immunol. Jun. 15, 1998;160(12) :5922-5928.
MEM-G/04 datasheets (GeneTex).
Menier, Catherine et al., "Characterization of Monoclonal Antibodies Recognizing HLA-G or HLA-E: New Tools to Analyze the Expression of Nonclassical HLA Class I Molecules" Human Immunology, vol. 64, 2003, pp. 315-326.
Molek and Bratkovic, Epitope Mapping of Mono- and Polyclonal Antibodies by Screening Phage-displayed Random Peptide Libraries, Acta Chim Slov.63 (2016), 914-919.
Morales et al., Placental Cell Expression of HLA-G2 Isoforms is Limited to the Invasive Trophoblast Phenotype, (2003) J. Immunol. 171 (11): 6215-6224.
Naji A, et al., Soluble HLA-G and HLA-G1 expressing antigen-presenting cells inhibit Tcell alloproliferation through IL T- 2/IL T-4/Faslmediated pathways. Hum Immunol. Apr. 2007;68( 4) :233-9.
Nencioni et al., "Anticancer vaccination strategies" Annals of Oncology, 2004; 15 Suppl 4:iv153-60.
Opposition of European Patent No. 2917229 (Application No. 13791794.4) filed by F. Hoffman-La Roche AG.
Opposition of European Patent No. 2917229 (Application No. 13791794.4) filed by James Poole Limited.
Opposition of European Patent No. 2917229 (Application No. 13791794.4) filed by Regimbeau.
Opposition of European Patent No. 2917229 (Application No. 13791794.4) filed by Venner Shipley.
Parish, D et al., "Immunogenicity of Low-Dose Intradermal Recombinant DNA Hepatitis B Vaccine" Southern Medical Journal, vol. 84, No. 4, 1991, pp. 426-430.
Patentee (Invectys) Response to Opposition of European Patent No. 2917229 (Application No. 13791794.4).
Paul et al., HLA-G, -E, -F Preworkshop: Tools and Protocols for Analysis of non-Classical Class I Genes Transxription and Protein Expression, (2000) Human Immunology 61 (11):1177-1195.
Paul, P et al., "HLA-G expression in Melanoma: A way for tumor cells to escape from immunosurveillance" PNAS, vol. 95, No. 8, 1998, pp. 4510-4515.
Paul, Pascale, et al., HLA-G expression in melanoma: A way for tumor cells to escape from immunosurveillance, Proc. Natl. Acad. Sci. USA vol. 95, pp. 4510-4515, Apr. 1998.
Paul, Pascale, et al., HLA-G, -E, -F Preworkshop: Tools and Protocols for Analysis of Non-Classical Class I Genes Transcription and Protein Expression, Human Immunology 61, 1177-1195 (2000).
Pelanda et al., "Central B-cell tolerance: where selection begins" Cold Spring Harb Perspect Bio, Apr. 1, 2012:4(4):a007146.
Pirrone et al., Applications of Hydrogen/Deuterium Exchange MS from 2012 to 2014, (2015) Analytical Chemistry 87: 99-118.
Pule et al., "A chimeric T cell antigen receptor that augments cytokine release and supports clonal expansion of primary human T cells" Moleculalr Therapy: The Journal of the American Society of Gene Therapy, Academic Press; Nature Publishing Group, US, vol. 12, No. 5, Nov. 1, 2005 (Nov. 1, 2005).
Riteau, B. et al., HLA-G2, -G3, and -G4 Isoforms Expressed as Nonmature Cell Surface Glycoproteins Inhibit NK and Antigen-Specific CTL Cytolysis Journal of Immunology, 2001; 166:5018-5026.
Rouas-Freiss, N et al., "Expression of tolerogenic HLA-G molecules in cancer prevents antitumor responses" Seminars in Cancer Biology, vol. 17, 2007, 413-421 (2007).
Saade, Fadi et al., "Technologies for enhanced efficacy of DNA vaccines" Expert Rev. Vaccines, 11(2). 189-209 Feb. 2012.
Seitz, C et al., "The monoclonal antibody HCA2 recognises a broadly shared epitope on selected classical as well as several nn-classical HLA class I molecules" Molecular Immunology, vol. 35, 1998, pp. 819-827.
Shiroishi, M et al., "Efficient Leukocyte Ig-like Receptor Signaling and Crystal Structure of Disulfide-linked HLA-G Dimer" The Journal of Biological Chemistry, vol. 281, 2006, p. 10439-10447.
Shiroishi, M, et al., Human Inhibitory receptors Ig-like transcript 2 (ILT2) and ILT4 compete with CDS for MHC class I binding and bind preferentially to HLA-G, PNAS, Jul. 22, 2003, vol. 100(15): 8856-8861.
Shiroishi, Mitsunori, et al.; Structural basis for recognition of the nonclassical MHC molecule HLA-G by the leukocyte lg-like receptor B2 (LILRB2/LIR2/ILT4/CD85d); 16412-16417, PNAS, Oct. 31, 2006, vol. 103, No. 44.
Tanabe et al. Structural and Functional Analysis of Monomorphic Determinants Recognized by Monoclonal Antibodies Reacting with the HLA Class I Domain (1992) Journal of Immunology 148 (10): 3202-3209.
Tran, Tri Minh, et al., The epitope recognized by pan-HLA class l-reactive monoclonal antibody W6/32 and its relationship to unusual stability of the HLA-B27 /˜2-microglobulin complex.
Van Lierop MJ, et al., Detection of HLA-G by a specific sandwich ELISA using monoclonal antibodies G233 and 56B. Mal Hum Reprod 2002 Aua;B(S):776-784.
Vergati et al., Strategies for Cancer Vaccine Development, J. Biomed. Biotechnol. 2010.
Xing Y, Hogquist KA. T-cell tolerance: central and peripheral. Cold Spring Harb Perspect Biol. Jun. 1, 2012 ;4(6): a006957.
Yari, F et al., "Production and Characterization of Monoclonal Antibodies with Specificity for Human HLA-G Isoforms" Hybridoma and Hybridomics, vol. 22, No. 5, 2003 particular relevance: pp. 301-306.
Ye et al., Human Leukocyte antigen G expression: as a significant prognostic indicator for patients with colorectal cancer (2007) Modem Pathology 20 (3):375-383.
Zhang, X. et al., "Methotrexate-Loaded PLGA Nanobubbles for Ultrasound Imaging and Synergistic Targeted Therapy of Residual Tumor During HIFU Ablation," Biomaterials (2014) vol. 35, pp. 5148-5161.
Zoller and Christ, Prophylactic Tumor Vaccination: Comparison of Effector Mechanisms Initiated by Protein Versus DNA Vaccination, J. Immunol. 166 (2001 ), 3440-3450 2001.

Also Published As

Publication number Publication date
JP2024177227A (en) 2024-12-19
TW202035456A (en) 2020-10-01
JP7588068B2 (en) 2024-11-21
MX2021003555A (en) 2021-05-27
CO2021004719A2 (en) 2021-05-31
US20220135689A1 (en) 2022-05-05
BR112021005868A2 (en) 2021-10-19
KR102867868B1 (en) 2025-10-13
CN113166243A (en) 2021-07-23
NZ774376A (en) 2025-11-28
AU2019346598B2 (en) 2026-02-26
ZA202201874B (en) 2025-05-28
PH12021550690A1 (en) 2022-02-28
DOP2021000049A (en) 2021-10-31
CL2023002048A1 (en) 2023-12-22
AR130233A2 (en) 2024-11-20
IL281778A (en) 2021-05-31
CR20210197A (en) 2021-06-03
AU2019346598A1 (en) 2021-04-29
WO2020069133A1 (en) 2020-04-02
KR20210098956A (en) 2021-08-11
SG11202103104RA (en) 2021-04-29
ECSP21026339A (en) 2021-07-30
PE20211767A1 (en) 2021-09-07
UY38391A (en) 2020-04-30
CL2021000761A1 (en) 2021-09-10
US20200102390A1 (en) 2020-04-02
ZA202102034B (en) 2022-09-28
EP3856780A1 (en) 2021-08-04
JP2022502052A (en) 2022-01-11
MY204959A (en) 2024-09-25
UA129052C2 (en) 2025-01-01
US12264199B2 (en) 2025-04-01
CA3114407A1 (en) 2020-04-02
TWI828767B (en) 2024-01-11
AR116526A1 (en) 2021-05-19
US20250353913A1 (en) 2025-11-20
US20210340259A1 (en) 2021-11-04
CN115057932A (en) 2022-09-16
EA202190609A1 (en) 2021-08-17
TW202438522A (en) 2024-10-01
CN113166243B (en) 2023-03-24

Similar Documents

Publication Publication Date Title
US12264199B2 (en) Anti-HLA-G antibodies, compositions comprising anti-HLA-G antibodies and methods of using anti-HLA-G antibodies
US20250026850A1 (en) Anti-cd39 antibodies, compositions comprising anti-cd39 antibodies and methods of using anti-cd39 antibodies
US20210107981A1 (en) Anti-pd-1 antibodies, compositions comprising anti-pd-1 antibodies and methods of using anti-pd-1 antibodies
JP7335164B2 (en) ANTI-TIGIT ANTIGEN-BINDING PROTEIN AND METHOD OF USE THEREOF
RU2810326C2 (en) Antibodies against hla-g, compositions containing antibodies against hla-g, and methods of use of antibodies against hla-g
WO2025054320A1 (en) Anti-ackr4 antibodies, compositions and uses thereof
EA045983B1 (en) ANTI-HLA-G ANTIBODIES, COMPOSITIONS CONTAINING ANTI-HLA-G ANTIBODIES, AND METHODS OF USE OF ANTI-HLA-G ANTIBODIES

Legal Events

Date Code Title Description
FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY

FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO SMALL (ORIGINAL EVENT CODE: SMAL); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY

AS Assignment

Owner name: TIZONA THERAPEUTICS, CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:BEERS, COURTNEY;CORBIN, JOHN;HODGES, DOUG;AND OTHERS;REEL/FRAME:050910/0145

Effective date: 20191031

Owner name: ADIMAB, LLC, NEW HAMPSHIRE

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:WARFIELD, JOSEPH ROBERT;WIDBOOM, PAUL FREDRICK;REEL/FRAME:050910/0567

Effective date: 20191104

AS Assignment

Owner name: TIZONA THERAPEUTICS, CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:ADIMAB, LLC;REEL/FRAME:050952/0059

Effective date: 20191107

AS Assignment

Owner name: TIZONA THERAPEUTICS, CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:ADIMAB, LLC;REEL/FRAME:051326/0371

Effective date: 20191107

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS

FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY

STPP Information on status: patent application and granting procedure in general

Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED

STCF Information on status: patent grant

Free format text: PATENTED CASE

MAFP Maintenance fee payment

Free format text: PAYMENT OF MAINTENANCE FEE, 4TH YEAR, LARGE ENTITY (ORIGINAL EVENT CODE: M1551); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY

Year of fee payment: 4