US10976324B2 - Synergistic combination of biomarkers for detecting and assessing hepatic fibrosis - Google Patents
Synergistic combination of biomarkers for detecting and assessing hepatic fibrosis Download PDFInfo
- Publication number
- US10976324B2 US10976324B2 US15/320,862 US201515320862A US10976324B2 US 10976324 B2 US10976324 B2 US 10976324B2 US 201515320862 A US201515320862 A US 201515320862A US 10976324 B2 US10976324 B2 US 10976324B2
- Authority
- US
- United States
- Prior art keywords
- cxcl10
- patient
- fibrosis
- protein
- stage
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active, expires
Links
- 206010019668 Hepatic fibrosis Diseases 0.000 title abstract description 183
- 239000000090 biomarker Substances 0.000 title abstract description 169
- 239000011885 synergistic combination Substances 0.000 title 1
- 101000858088 Homo sapiens C-X-C motif chemokine 10 Proteins 0.000 claims abstract description 433
- 102100025248 C-X-C motif chemokine 10 Human genes 0.000 claims abstract description 432
- 229920002674 hyaluronan Polymers 0.000 claims abstract description 391
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 claims abstract description 388
- 229960003160 hyaluronic acid Drugs 0.000 claims abstract description 388
- 208000006454 hepatitis Diseases 0.000 claims abstract description 58
- 241000700605 Viruses Species 0.000 claims abstract description 48
- 231100000283 hepatitis Toxicity 0.000 claims abstract description 47
- 239000003446 ligand Substances 0.000 claims description 127
- 239000003550 marker Substances 0.000 claims description 122
- 238000001514 detection method Methods 0.000 claims description 105
- 108090000623 proteins and genes Proteins 0.000 claims description 71
- 102000004169 proteins and genes Human genes 0.000 claims description 70
- 239000013060 biological fluid Substances 0.000 claims description 68
- 238000004519 manufacturing process Methods 0.000 claims description 32
- 239000000203 mixture Substances 0.000 claims description 22
- 239000007787 solid Substances 0.000 claims description 14
- 239000011521 glass Substances 0.000 claims description 9
- 239000010703 silicon Substances 0.000 claims description 6
- 229910052710 silicon Inorganic materials 0.000 claims description 6
- 239000012528 membrane Substances 0.000 claims description 5
- 238000002360 preparation method Methods 0.000 claims description 4
- 239000011324 bead Substances 0.000 claims description 3
- 108020004707 nucleic acids Proteins 0.000 claims description 2
- 102000039446 nucleic acids Human genes 0.000 claims description 2
- 150000007523 nucleic acids Chemical class 0.000 claims description 2
- 206010016654 Fibrosis Diseases 0.000 abstract description 196
- 230000004761 fibrosis Effects 0.000 abstract description 178
- 238000000034 method Methods 0.000 abstract description 144
- 206010008909 Chronic Hepatitis Diseases 0.000 abstract description 11
- 230000006870 function Effects 0.000 description 213
- 238000011002 quantification Methods 0.000 description 133
- 230000035945 sensitivity Effects 0.000 description 116
- 238000012360 testing method Methods 0.000 description 103
- 230000003612 virological effect Effects 0.000 description 93
- 239000000523 sample Substances 0.000 description 85
- 238000007477 logistic regression Methods 0.000 description 81
- 241000711549 Hepacivirus C Species 0.000 description 73
- 230000000295 complement effect Effects 0.000 description 67
- 210000002966 serum Anatomy 0.000 description 61
- 235000018102 proteins Nutrition 0.000 description 58
- 210000004185 liver Anatomy 0.000 description 56
- 238000004422 calculation algorithm Methods 0.000 description 42
- 238000012886 linear function Methods 0.000 description 39
- 230000008569 process Effects 0.000 description 35
- 238000013145 classification model Methods 0.000 description 31
- 238000011282 treatment Methods 0.000 description 31
- 238000005070 sampling Methods 0.000 description 27
- 238000009826 distribution Methods 0.000 description 26
- 238000003066 decision tree Methods 0.000 description 25
- 101710107035 Gamma-glutamyltranspeptidase Proteins 0.000 description 22
- 101710173228 Glutathione hydrolase proenzyme Proteins 0.000 description 22
- 102000006640 gamma-Glutamyltransferase Human genes 0.000 description 22
- BPYKTIZUTYGOLE-IFADSCNNSA-N Bilirubin Chemical compound N1C(=O)C(C)=C(C=C)\C1=C\C1=C(C)C(CCC(O)=O)=C(CC2=C(C(C)=C(\C=C/3C(=C(C=C)C(=O)N\3)C)N2)CCC(O)=O)N1 BPYKTIZUTYGOLE-IFADSCNNSA-N 0.000 description 20
- 208000037262 Hepatitis delta Diseases 0.000 description 19
- 241000724709 Hepatitis delta virus Species 0.000 description 19
- 238000004458 analytical method Methods 0.000 description 19
- 230000002195 synergetic effect Effects 0.000 description 18
- MXBCYQUALCBQIJ-RYVPXURESA-N (8s,9s,10r,13s,14s,17r)-13-ethyl-17-ethynyl-11-methylidene-1,2,3,6,7,8,9,10,12,14,15,16-dodecahydrocyclopenta[a]phenanthren-17-ol;(8r,9s,13s,14s,17r)-17-ethynyl-13-methyl-7,8,9,11,12,14,15,16-octahydro-6h-cyclopenta[a]phenanthrene-3,17-diol Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@](CC4)(O)C#C)[C@@H]4[C@@H]3CCC2=C1.C1CC[C@@H]2[C@H]3C(=C)C[C@](CC)([C@](CC4)(O)C#C)[C@@H]4[C@@H]3CCC2=C1 MXBCYQUALCBQIJ-RYVPXURESA-N 0.000 description 17
- 208000019425 cirrhosis of liver Diseases 0.000 description 17
- 102100036475 Alanine aminotransferase 1 Human genes 0.000 description 16
- 108010082126 Alanine transaminase Proteins 0.000 description 16
- 230000007882 cirrhosis Effects 0.000 description 16
- 238000007620 mathematical function Methods 0.000 description 16
- 238000005259 measurement Methods 0.000 description 16
- PXFBZOLANLWPMH-UHFFFAOYSA-N 16-Epiaffinine Natural products C1C(C2=CC=CC=C2N2)=C2C(=O)CC2C(=CC)CN(C)C1C2CO PXFBZOLANLWPMH-UHFFFAOYSA-N 0.000 description 15
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 15
- 210000004369 blood Anatomy 0.000 description 15
- 239000008280 blood Substances 0.000 description 15
- 102000004625 Aspartate Aminotransferases Human genes 0.000 description 14
- 108010003415 Aspartate Aminotransferases Proteins 0.000 description 14
- 101000669513 Homo sapiens Metalloproteinase inhibitor 1 Proteins 0.000 description 14
- 102100039364 Metalloproteinase inhibitor 1 Human genes 0.000 description 14
- -1 ICAMI Proteins 0.000 description 12
- 102000000380 Matrix Metalloproteinase 1 Human genes 0.000 description 12
- 108010016113 Matrix Metalloproteinase 1 Proteins 0.000 description 12
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 12
- 238000000338 in vitro Methods 0.000 description 12
- 108010059886 Apolipoprotein A-I Proteins 0.000 description 11
- 102000005666 Apolipoprotein A-I Human genes 0.000 description 11
- 238000010801 machine learning Methods 0.000 description 11
- 239000008194 pharmaceutical composition Substances 0.000 description 11
- 229940024606 amino acid Drugs 0.000 description 10
- 235000001014 amino acid Nutrition 0.000 description 10
- 150000001413 amino acids Chemical class 0.000 description 10
- 230000002440 hepatic effect Effects 0.000 description 10
- 239000000047 product Substances 0.000 description 10
- 102100026802 72 kDa type IV collagenase Human genes 0.000 description 9
- 108010048036 Angiopoietin-2 Proteins 0.000 description 9
- 102100034608 Angiopoietin-2 Human genes 0.000 description 9
- 102000019034 Chemokines Human genes 0.000 description 9
- 108010012236 Chemokines Proteins 0.000 description 9
- 101000627872 Homo sapiens 72 kDa type IV collagenase Proteins 0.000 description 9
- 101000990902 Homo sapiens Matrix metalloproteinase-9 Proteins 0.000 description 9
- 108010050904 Interferons Proteins 0.000 description 9
- 102000014150 Interferons Human genes 0.000 description 9
- 102100037795 Interleukin-6 receptor subunit beta Human genes 0.000 description 9
- 101710152369 Interleukin-6 receptor subunit beta Proteins 0.000 description 9
- 102100030412 Matrix metalloproteinase-9 Human genes 0.000 description 9
- 102000004264 Osteopontin Human genes 0.000 description 9
- 108010081689 Osteopontin Proteins 0.000 description 9
- 102100023087 Protein S100-A4 Human genes 0.000 description 9
- 108010085149 S100 Calcium-Binding Protein A4 Proteins 0.000 description 9
- 108010065472 Vimentin Proteins 0.000 description 9
- 102000013127 Vimentin Human genes 0.000 description 9
- 238000004590 computer program Methods 0.000 description 9
- 229940079322 interferon Drugs 0.000 description 9
- 208000019423 liver disease Diseases 0.000 description 9
- 238000007637 random forest analysis Methods 0.000 description 9
- 239000000243 solution Substances 0.000 description 9
- 210000005048 vimentin Anatomy 0.000 description 9
- 102100033601 Collagen alpha-1(I) chain Human genes 0.000 description 8
- 102100027995 Collagenase 3 Human genes 0.000 description 8
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 8
- 101000577887 Homo sapiens Collagenase 3 Proteins 0.000 description 8
- 102000013462 Interleukin-12 Human genes 0.000 description 8
- 108010065805 Interleukin-12 Proteins 0.000 description 8
- 102100038246 Retinol-binding protein 4 Human genes 0.000 description 8
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 8
- 102100023543 Vascular cell adhesion protein 1 Human genes 0.000 description 8
- 239000012634 fragment Substances 0.000 description 8
- 102100025279 C-X-C motif chemokine 11 Human genes 0.000 description 7
- 102100036153 C-X-C motif chemokine 6 Human genes 0.000 description 7
- 102100036170 C-X-C motif chemokine 9 Human genes 0.000 description 7
- 101710090667 Collagen alpha-1(I) chain Proteins 0.000 description 7
- 102100024458 Cyclin-dependent kinase inhibitor 2A Human genes 0.000 description 7
- 102100034221 Growth-regulated alpha protein Human genes 0.000 description 7
- 101000858060 Homo sapiens C-X-C motif chemokine 11 Proteins 0.000 description 7
- 101000947177 Homo sapiens C-X-C motif chemokine 6 Proteins 0.000 description 7
- 101000947172 Homo sapiens C-X-C motif chemokine 9 Proteins 0.000 description 7
- 101001069921 Homo sapiens Growth-regulated alpha protein Proteins 0.000 description 7
- 102000000588 Interleukin-2 Human genes 0.000 description 7
- 108010002350 Interleukin-2 Proteins 0.000 description 7
- 102000004388 Interleukin-4 Human genes 0.000 description 7
- 108090000978 Interleukin-4 Proteins 0.000 description 7
- 230000008901 benefit Effects 0.000 description 7
- 238000002091 elastography Methods 0.000 description 7
- 230000003902 lesion Effects 0.000 description 7
- 238000010606 normalization Methods 0.000 description 7
- 239000003755 preservative agent Substances 0.000 description 7
- 230000002335 preservative effect Effects 0.000 description 7
- 238000000746 purification Methods 0.000 description 7
- 238000007619 statistical method Methods 0.000 description 7
- 230000001052 transient effect Effects 0.000 description 7
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 6
- 102100033715 Apolipoprotein A-I Human genes 0.000 description 6
- 108010066813 Chitinase-3-Like Protein 1 Proteins 0.000 description 6
- 102100038196 Chitinase-3-like protein 1 Human genes 0.000 description 6
- 101000733802 Homo sapiens Apolipoprotein A-I Proteins 0.000 description 6
- IWUCXVSUMQZMFG-AFCXAGJDSA-N Ribavirin Chemical compound N1=C(C(=O)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 IWUCXVSUMQZMFG-AFCXAGJDSA-N 0.000 description 6
- 108010079351 Tumor Suppressor Protein p14ARF Proteins 0.000 description 6
- 238000013473 artificial intelligence Methods 0.000 description 6
- 238000013528 artificial neural network Methods 0.000 description 6
- 239000007853 buffer solution Substances 0.000 description 6
- 235000012000 cholesterol Nutrition 0.000 description 6
- 238000007635 classification algorithm Methods 0.000 description 6
- 239000003112 inhibitor Substances 0.000 description 6
- 239000007788 liquid Substances 0.000 description 6
- 210000001519 tissue Anatomy 0.000 description 6
- 241000282412 Homo Species 0.000 description 5
- 102000004318 Matrilysin Human genes 0.000 description 5
- 108090000855 Matrilysin Proteins 0.000 description 5
- 239000012472 biological sample Substances 0.000 description 5
- 238000001574 biopsy Methods 0.000 description 5
- 239000003153 chemical reaction reagent Substances 0.000 description 5
- 238000013537 high throughput screening Methods 0.000 description 5
- 239000002953 phosphate buffered saline Substances 0.000 description 5
- 108090000765 processed proteins & peptides Proteins 0.000 description 5
- 238000002560 therapeutic procedure Methods 0.000 description 5
- 238000010200 validation analysis Methods 0.000 description 5
- 102000005741 Metalloproteases Human genes 0.000 description 4
- 108010006035 Metalloproteases Proteins 0.000 description 4
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 4
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 4
- XUIMIQQOPSSXEZ-UHFFFAOYSA-N Silicon Chemical compound [Si] XUIMIQQOPSSXEZ-UHFFFAOYSA-N 0.000 description 4
- 239000000556 agonist Substances 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 201000010099 disease Diseases 0.000 description 4
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 4
- 150000004676 glycans Chemical class 0.000 description 4
- 238000003384 imaging method Methods 0.000 description 4
- 208000015181 infectious disease Diseases 0.000 description 4
- 239000004615 ingredient Substances 0.000 description 4
- 150000002632 lipids Chemical class 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 229920001282 polysaccharide Polymers 0.000 description 4
- 239000005017 polysaccharide Substances 0.000 description 4
- 229960000329 ribavirin Drugs 0.000 description 4
- HZCAHMRRMINHDJ-DBRKOABJSA-N ribavirin Natural products O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1N=CN=C1 HZCAHMRRMINHDJ-DBRKOABJSA-N 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- 238000003756 stirring Methods 0.000 description 4
- 102100036601 Aggrecan core protein Human genes 0.000 description 3
- 108010067219 Aggrecans Proteins 0.000 description 3
- 108010088751 Albumins Proteins 0.000 description 3
- 102000009027 Albumins Human genes 0.000 description 3
- 102100033312 Alpha-2-macroglobulin Human genes 0.000 description 3
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 3
- 101710098275 C-X-C motif chemokine 10 Proteins 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- 208000005176 Hepatitis C Diseases 0.000 description 3
- 101001014213 Homo sapiens Morphogenetic neuropeptide Proteins 0.000 description 3
- 108090000144 Human Proteins Proteins 0.000 description 3
- 102000003839 Human Proteins Human genes 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 239000004793 Polystyrene Substances 0.000 description 3
- 108010015078 Pregnancy-Associated alpha 2-Macroglobulins Proteins 0.000 description 3
- 239000005557 antagonist Substances 0.000 description 3
- 229960002685 biotin Drugs 0.000 description 3
- 235000020958 biotin Nutrition 0.000 description 3
- 239000011616 biotin Substances 0.000 description 3
- 230000000903 blocking effect Effects 0.000 description 3
- 229940098773 bovine serum albumin Drugs 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 210000004027 cell Anatomy 0.000 description 3
- 238000003776 cleavage reaction Methods 0.000 description 3
- 239000003814 drug Substances 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 238000000605 extraction Methods 0.000 description 3
- 239000012530 fluid Substances 0.000 description 3
- 102000046438 human CXCL10 Human genes 0.000 description 3
- KIUKXJAPPMFGSW-MNSSHETKSA-N hyaluronan Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)C1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H](C(O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-MNSSHETKSA-N 0.000 description 3
- 229940099552 hyaluronan Drugs 0.000 description 3
- 210000005228 liver tissue Anatomy 0.000 description 3
- 238000002493 microarray Methods 0.000 description 3
- 229920002223 polystyrene Polymers 0.000 description 3
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 3
- 102000004196 processed proteins & peptides Human genes 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 230000007017 scission Effects 0.000 description 3
- 230000028327 secretion Effects 0.000 description 3
- 230000009466 transformation Effects 0.000 description 3
- 238000000844 transformation Methods 0.000 description 3
- BQCIDUSAKPWEOX-UHFFFAOYSA-N 1,1-Difluoroethene Chemical compound FC(F)=C BQCIDUSAKPWEOX-UHFFFAOYSA-N 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- 240000003291 Armoracia rusticana Species 0.000 description 2
- 235000011330 Armoracia rusticana Nutrition 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- 101710151400 Chitinase 3 Proteins 0.000 description 2
- 108090000266 Cyclin-dependent kinases Proteins 0.000 description 2
- 102000003903 Cyclin-dependent kinases Human genes 0.000 description 2
- 101710107426 Endochitinase 3 Proteins 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 2
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 2
- 102000014702 Haptoglobin Human genes 0.000 description 2
- 108050005077 Haptoglobin Proteins 0.000 description 2
- 102000003693 Hedgehog Proteins Human genes 0.000 description 2
- 108090000031 Hedgehog Proteins Proteins 0.000 description 2
- 241000711557 Hepacivirus Species 0.000 description 2
- 206010019799 Hepatitis viral Diseases 0.000 description 2
- 102100021374 Hepatocyte nuclear factor 3-gamma Human genes 0.000 description 2
- 101000818741 Homo sapiens Hepatocyte nuclear factor 3-gamma Proteins 0.000 description 2
- 241000725303 Human immunodeficiency virus Species 0.000 description 2
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 2
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 2
- UQSXHKLRYXJYBZ-UHFFFAOYSA-N Iron oxide Chemical compound [Fe]=O UQSXHKLRYXJYBZ-UHFFFAOYSA-N 0.000 description 2
- 206010028980 Neoplasm Diseases 0.000 description 2
- 239000000020 Nitrocellulose Substances 0.000 description 2
- 239000004743 Polypropylene Substances 0.000 description 2
- 238000012952 Resampling Methods 0.000 description 2
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N Sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 2
- 238000008050 Total Bilirubin Reagent Methods 0.000 description 2
- 239000007983 Tris buffer Substances 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- 238000009534 blood test Methods 0.000 description 2
- 238000004364 calculation method Methods 0.000 description 2
- 238000007865 diluting Methods 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 210000002744 extracellular matrix Anatomy 0.000 description 2
- 239000000706 filtrate Substances 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 208000002672 hepatitis B Diseases 0.000 description 2
- 208000010710 hepatitis C virus infection Diseases 0.000 description 2
- 210000004408 hybridoma Anatomy 0.000 description 2
- 238000002649 immunization Methods 0.000 description 2
- 230000003053 immunization Effects 0.000 description 2
- 238000004020 luminiscence type Methods 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 239000002207 metabolite Substances 0.000 description 2
- 210000002569 neuron Anatomy 0.000 description 2
- 229920001220 nitrocellulos Polymers 0.000 description 2
- 208000008338 non-alcoholic fatty liver disease Diseases 0.000 description 2
- 206010053219 non-alcoholic steatohepatitis Diseases 0.000 description 2
- 238000010239 partial least squares discriminant analysis Methods 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 229920001155 polypropylene Polymers 0.000 description 2
- 229920000136 polysorbate Polymers 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 238000009097 single-agent therapy Methods 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 238000004448 titration Methods 0.000 description 2
- 239000013026 undiluted sample Substances 0.000 description 2
- 201000001862 viral hepatitis Diseases 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- WNWNYJSOBYTXFA-BZIARYSWSA-N (2s,3s,4s,5r,6r)-6-[(2r,3r,4r,5r)-2-amino-4,5,6-trihydroxy-1-oxohexan-3-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound OC[C@@H](O)[C@@H](O)[C@@H]([C@H](C=O)N)O[C@@H]1O[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@H]1O WNWNYJSOBYTXFA-BZIARYSWSA-N 0.000 description 1
- ORILYTVJVMAKLC-UHFFFAOYSA-N Adamantane Natural products C1C(C2)CC3CC1CC2C3 ORILYTVJVMAKLC-UHFFFAOYSA-N 0.000 description 1
- 206010001488 Aggression Diseases 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 108091023037 Aptamer Proteins 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 208000008439 Biliary Liver Cirrhosis Diseases 0.000 description 1
- 206010004659 Biliary cirrhosis Diseases 0.000 description 1
- 102000004506 Blood Proteins Human genes 0.000 description 1
- 108010017384 Blood Proteins Proteins 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 1
- GAIWTPWLGYKINJ-PPCQKOCDSA-N CO[C@@H]1C(C(=O)O)O[C@@H](O[C@@H]2C(NC(C)=O)[C@@H](C)OC(CO)[C@H]2O)C(O)[C@H]1O Chemical compound CO[C@@H]1C(C(=O)O)O[C@@H](O[C@@H]2C(NC(C)=O)[C@@H](C)OC(CO)[C@H]2O)C(O)[C@H]1O GAIWTPWLGYKINJ-PPCQKOCDSA-N 0.000 description 1
- 101150077124 CXCL10 gene Proteins 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 108010067225 Cell Adhesion Molecules Proteins 0.000 description 1
- 102000016289 Cell Adhesion Molecules Human genes 0.000 description 1
- 206010008609 Cholangitis sclerosing Diseases 0.000 description 1
- 208000000419 Chronic Hepatitis B Diseases 0.000 description 1
- 208000010471 Chronic Hepatitis D Diseases 0.000 description 1
- 208000006154 Chronic hepatitis C Diseases 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 238000008157 ELISA kit Methods 0.000 description 1
- 208000004930 Fatty Liver Diseases 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 208000018565 Hemochromatosis Diseases 0.000 description 1
- 241000700721 Hepatitis B virus Species 0.000 description 1
- 206010019728 Hepatitis alcoholic Diseases 0.000 description 1
- 101001035951 Homo sapiens Hyaluronan-binding protein 2 Proteins 0.000 description 1
- 101000990912 Homo sapiens Matrilysin Proteins 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 102100039238 Hyaluronan-binding protein 2 Human genes 0.000 description 1
- 102100040018 Interferon alpha-2 Human genes 0.000 description 1
- 108010079944 Interferon-alpha2b Proteins 0.000 description 1
- 206010065973 Iron Overload Diseases 0.000 description 1
- 102100030417 Matrilysin Human genes 0.000 description 1
- 208000001145 Metabolic Syndrome Diseases 0.000 description 1
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 1
- 208000008589 Obesity Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 101710137011 Retinol-binding protein 4 Proteins 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 108010000134 Vascular Cell Adhesion Molecule-1 Proteins 0.000 description 1
- 201000000690 abdominal obesity-metabolic syndrome Diseases 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 230000003044 adaptive effect Effects 0.000 description 1
- 230000016571 aggressive behavior Effects 0.000 description 1
- 208000002353 alcoholic hepatitis Diseases 0.000 description 1
- 238000013103 analytical ultracentrifugation Methods 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 239000003443 antiviral agent Substances 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000027455 binding Effects 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 210000000845 cartilage Anatomy 0.000 description 1
- 229910052729 chemical element Inorganic materials 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 210000003040 circulating cell Anatomy 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 239000013066 combination product Substances 0.000 description 1
- 229940127555 combination product Drugs 0.000 description 1
- 238000004891 communication Methods 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 239000004020 conductor Substances 0.000 description 1
- 229940055354 copegus Drugs 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 235000020247 cow milk Nutrition 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 238000007418 data mining Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 238000009434 installation Methods 0.000 description 1
- 229940117681 interleukin-12 Drugs 0.000 description 1
- 229940028885 interleukin-4 Drugs 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 210000002510 keratinocyte Anatomy 0.000 description 1
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 1
- 238000012417 linear regression Methods 0.000 description 1
- HWYHZTIRURJOHG-UHFFFAOYSA-N luminol Chemical compound O=C1NNC(=O)C2=C1C(N)=CC=C2 HWYHZTIRURJOHG-UHFFFAOYSA-N 0.000 description 1
- 239000000696 magnetic material Substances 0.000 description 1
- 208000030159 metabolic disease Diseases 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000003041 necroinflammatory effect Effects 0.000 description 1
- 235000020824 obesity Nutrition 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 238000003909 pattern recognition Methods 0.000 description 1
- 229940002988 pegasys Drugs 0.000 description 1
- 108010092853 peginterferon alfa-2a Proteins 0.000 description 1
- 108010092851 peginterferon alfa-2b Proteins 0.000 description 1
- 229940106366 pegintron Drugs 0.000 description 1
- 150000002978 peroxides Chemical class 0.000 description 1
- 210000002381 plasma Anatomy 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 231100000572 poisoning Toxicity 0.000 description 1
- 230000000607 poisoning effect Effects 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 229940053146 rebetol Drugs 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 208000010157 sclerosing cholangitis Diseases 0.000 description 1
- 239000004065 semiconductor Substances 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 238000012706 support-vector machine Methods 0.000 description 1
- 231100000167 toxic agent Toxicity 0.000 description 1
- 239000003440 toxic substance Substances 0.000 description 1
- 238000012549 training Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
Images
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
-
- G—PHYSICS
- G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
- G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
- G16B40/00—ICT specially adapted for biostatistics; ICT specially adapted for bioinformatics-related machine learning or data mining, e.g. knowledge discovery or pattern finding
-
- G—PHYSICS
- G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
- G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
- G16B40/00—ICT specially adapted for biostatistics; ICT specially adapted for bioinformatics-related machine learning or data mining, e.g. knowledge discovery or pattern finding
- G16B40/20—Supervised data analysis
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/08—Hepato-biliairy disorders other than hepatitis
- G01N2800/085—Liver diseases, e.g. portal hypertension, fibrosis, cirrhosis, bilirubin
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/56—Staging of a disease; Further complications associated with the disease
Definitions
- the application relates to hepatic fibroses, especially to hepatic fibroses that may appear in a patient infected with one or more hepatitis viruses and/or who is suffering from hepatitis, specifically chronic hepatitis.
- the application provides methods and means for determining the stage (or degree) of the hepatic fibrosis of such a patient. More particularly, the methods and means of the application allow to determine, whether or not the stage (or degree) of the hepatic fibrosis of this patient has passed beyond the stage of mild fibrosis.
- the methods and means of the invention employ a combination of biomarkers, such as, in particular, the protein CXCL10 and hyaluronic acid (HA).
- biomarkers such as, in particular, the protein CXCL10 and hyaluronic acid (HA).
- hepatic fibrosis results, in particular, from excessive accumulation of molecular compounds of the altered extracellular matrix in the hepatic parenchy-ma.
- the stage of damage of the liver tissue, especially the nature and extent of hepatic tissue lesions, is evaluated by a score of hepatic fibrosis, especially by the F Metavir score system, which comprises 5 stages from F0 to F4 (cf. Table 25 below).
- the determination of the score of hepatic fibrosis is essential to the physician since it is a prognostic score.
- this determination is the basis that allows the physician to make a decision of administrating or not administrating a treatment in view of treating these lesions, or at least in view of alleviating their effects. It is also on this basis that the physician decides to initiate a treatment. In particular, if the Metavir fibrosis score is at most F1 (mild fibrosis), the physician generally decides that no treatment should be administered, whereas, if the Metavir fibrosis score is at least F2, it is recommendable to administer a treatment, regardless of the necroinflammatory activity.
- possible treatments bring about major side effects for the patient (treatments including interferon), or their cost is very high (novel antiviral agents).
- the biomarker HA is employed in the clinical tests ELFTM (U.S. Pat. No. 7,141,380 B2), HEPASCORETM (Adams et al. 2005; US 2007/0225919 ⁇ 1), FIBROSPECTTM (U.S. Pat. No. 6,986,995 B2), FIBROMETERTM (U.S. Pat. No. 8,489,335 B2), and SHASTATM (Kelleher et al. 2005).
- ELFTM U.S. Pat. No. 7,141,380 B2
- HEPASCORETM Adams et al. 2005; US 2007/0225919 ⁇ 1
- FIBROSPECTTM U.S. Pat. No. 6,986,995 B2
- FIBROMETERTM U.S. Pat. No. 8,489,335 B2
- SHASTATM Kerelleher et al. 2005.
- the protein CXCL10 is essentially known as a biomarker of the response to anti-HCV therapy using interferon, and has scarcely been described in the context of hepatic fibrosis.
- HA has the capacity of inducing the expression of the protein CXCL10.
- an increase in HA induces an increase of CXCL10.
- the concentrations of the two molecules develop into the same direction (an increase of the concentration of HA results in an increase of the concentration of CXCL10).
- a synergistic effect is obtained that goes beyond that of a simple juxtaposition of the two molecules as biomarkers.
- the application relates to methods and means allowing to determine the stage (or degree) of hepatic fibrosis of a patient, especially to determine whether or not the stage (or degree) of hepatic fibrosis of said patient has passed beyond the stage of mild fibrosis.
- the inventors have identified particular biomarkers for this purpose, such as CXCL10 (ligand 10 of chemokine (motif CXC)) and HA (hyaluronic acid or hyaluronan).
- CXCL10 ligand 10 of chemokine (motif CXC)
- HA hyaluronic acid or hyaluronan
- the inventors have identified particular combinations of biomarkers that, like the combination of CXCL10 with HA, lead to a synergistic effect.
- the inventors demonstrate that the performances of the combination of CXCL10 with HA are particularly robust (AUC performances and/or correct classification rate and/or sensitivity and/or NPV and/or specificity and/or PPV): cf. Example 9 below.
- the detection of HA and CXCL10 is effected as a multiplex detection: cf. Example 10 below.
- the means of the invention comprise, in particular:
- FIG. 1 presents the distribution of the protein CXCL10 serum concentration according to the hepatic fibrosis score determined by hepatic biopsy (PBH) (Metavir score F1 or F2) for a population of 118 patients (cf. Example 1 below).
- PBH hepatic biopsy
- FIG. 2 presents the distribution of the hyaluronic acid (HA) serum concentration according to the hepatic fibrosis score determined by PBH (score F1 or F2) for a population of 118 patients (cf. Example 1 below).
- HA hyaluronic acid
- FIG. 3 presents a classification model or algorithm allowing to determine the stage of hepatic fibrosis without recurring to PBH (Metavir hepatic fibrosis score ⁇ F2 or ⁇ F2).
- This model or algorithm has been developed by modification of the algorithm described by Castera et al. (Castera et al. 2010 and Castera et al. 2014).
- this modified model or algorithm comprises a second analysis level for the treatment (without PBH) of those samples that give incongruent results on the first analysis level (cf. Example 3 below).
- FIG. 4 presents the distribution of the protein CXCL10 serum concentration according to the degree of hepatic fibrosis (Metavir score ⁇ F2 or ⁇ F2) for a population of 310 patients (cf. Example 3 below).
- FIG. 5 presents the distribution of the hyaluronic acid (HA) serum concentration according to the degree of hepatic fibrosis (Metavir score ⁇ F2 or F2) for a population of 310 patients [cf. Example 3 below].
- HA hyaluronic acid
- FIG. 6 presents a classification model or algorithm allowing to accurately determine the stage of hepatic fibrosis without recurring to PBH (Metavir hepatic fibrosis score F0-F1 or F2-F3 or F4).
- This model or algorithm has been developed by modification of the algorithm described by Boursier et al.
- this modified model or algorithm comprises a second analysis level for the treatment (without PBH) of those samples that give incongruent results on the first analysis level (cf. Example 6 below).
- FIG. 7 presents the distribution of the protein CXCL10 serum concentration according to the degree of hepatic fibrosis (Metavir score F0-F1 or F2-F3 or F4) for a population of 310 patients (cf. Example 6 below).
- FIG. 8 presents the distribution of the hyaluronic acid (HA) serum concentration according to the degree of hepatic fibrosis (Metavir score F0-F1 or F2-F3 or F4) for a population of 310 patients (cf. Example 6 below).
- HA hyaluronic acid
- FIGS. 9, 10 and 11 each present a classification model or algorithm comprising the combination of marker HA and marker CXCL10 for the classification of patients as a function of their stage of hepatic fibrosis (Metavir hepatic fibrosis score F0-F1 or F2-F3).
- This model or algorithm can further comprise a preliminary step allowing to classify the patients according to whether their Metavir hepatic fibrosis score is below F4, or equal to F4, for example, by measuring the stiffness of the liver, for example, by FIBROSCANTM.
- FIG. 9 combination of HA and CXCL10.
- FIGS. 10 and 11 combination of HA, CXCL10 and one or more other additional markers.
- FIG. 10 combination of HA, CXCL10 and one or more other additional markers [clinical or anatomical marker(s) and/or virological marker(s)], in this case: body mass index (BMI), age at the sampling date (Age), viral load at the sampling date (VL).
- BMI body mass index
- Age age at the sampling date
- VL viral load at the sampling date
- FIG. 11 combination of HA, CXCL10 and the measurement of liver stiffness, measured, for example, by FIBROSCANTM (FS).
- FS FIBROSCANTM
- FIG. 12 presents a classification model or algorithm that is not based on a linear function: this model or algorithm is based on a CART (Classification And Regression Tree) classification model and comprises the combination of marker HA and marker CXCL10 (cf. Example 7 below).
- CART Classification And Regression Tree
- FIGS. 13A to 16B illustrate the performances of the combination HA+CXCL10 by means of the method known under the name of Bootstrap (cf. Example 3 below; 1000 subpopulations of the same size randomly chosen from a population of 310 patients; draws with replacement).
- FIGS. 13A and 13B present the values of the differences of AUC and precision that have been measured between, on the one hand, the mROC discriminating rule with “fix coefficients” (or “coef fix”) and, on the other hand, the mROC discriminating rule with “optimized coefficients” (or “coef optim”) in the form of histograms.
- the mROC discriminating rule employed the combination of HA+CXCL10.
- FIGS. 13A and 13B present the values of the differences of AUC and precision that have been measured for the mROC discriminating rule with “fix coefficients” (“coef fix”) between, on the one hand, the combination of HA+CXCL10 and, on the other hand, the HA marker alone in the form of histograms.
- fix coefficients (“coef fix”) [abscissa: 0.84; 0.86; 0.88; 0.90; 0.92; 0.94; 0.96]; cf. Example 9 below.
- FIGS. 16A and 16B compare the performances of the mROC function obtained on the population of 118 patients of Example 1 (markers HA+CXCL10; function Z1; cf. Table 2 below) with those of the function mROC obtained on the population of 310 patients of Example 3 (markers HA+CXCL10; function Z4; cf. Table 7 below), when both are applied to the population of 118 patients; cf. Example 9 below.
- FIG. 16B ordinate, sensitivity; abscissa, specificity; curves of Z1 and Z4 (the two curves merge).
- the application relates to a process for determining, especially for determining with a high probability, the stage (or degree) of hepatic fibrosis in a patient infected with one or more hepatitis viruses and/or who is suffering from hepatitis, specifically chronic hepatitis.
- the hepatitis virus of viruses can be, for example, one or more hepatitis C viruses and/or hepatitis B viruses and/or hepatitis D viruses, especially hepatitis C viruses.
- Said hepatitis C virus may be of any genotype.
- the genotype of said hepatitis C virus may be genotype 1, 2, 3, 4, 5, 6 or 7, especially genotype 1 or 4.
- Said patient is a mammal, especially a human.
- the process of the application employs the quantification of different markers, which can all be measured or determined in an essentially non-invasive way (the degree of invasive intervention with the body of the patient does not go beyond a simple sampling of biological fluid).
- the process of the application can be performed in vitro.
- the process of the application is a process for determining, especially for determining with a high probability, whether or not the stage (or degree) of hepatic fibrosis of said patient has passed beyond the stage of mild fibrosis.
- Said “stage (or degree) of hepatic fibrosis that has not passed beyond the stage of mild fibrosis” means a stage that is equal to or lower than that of mild fibrosis.
- Said “stage (or degree) of hepatic fibrosis that has passed beyond the stage of mild fibrosis” means a stage that is higher than that of mild fibrosis.
- the different stages of hepatic fibrosis are as follows (in the order from a weak degree to a stronger degree):
- Said stage of mild fibrosis is that of a portal fibrosis without septum.
- the liver of this patient is thus either free of fibrosis (absence of fibrosis), or suffering from a portal fibrosis without septum.
- the liver of this patient is thus suffering from a portal fibrosis with septums, or from a septal fibrosis without cirrhosis, or from a cirrhosis.
- Metavir score system There are various systems of hepatic fibrosis scores. The most common is the Metavir score system.
- Stage of fibrosis Metavir fibrosis score Absence of fibrosis F0 Portal fibrosis without septum
- Stage of fibrosis with septums F1 Portal fibrosis with septums
- F2 Septal fibrosis without cirrhosis
- F3 Cirrhosis
- Said stage of mild fibrosis is thus a degree of hepatic fibrosis that has a score of F1 according to the Metavir scores system.
- a score of hepatic fibrosis indicating that the liver of said patient has not passed beyond the stage of mild fibrosis is a score of at most F1, i.e., a score of F0 or F1, according to the Metavir scores system.
- a score of hepatic fibrosis indicating that the liver of said patient has passed beyond the stage of mild fibrosis is a score of at least F2, i.e., a score of F2, F3 or F4, according to the Metavir scores system.
- Said stage of mild fibrosis is thus a degree of hepatic fibrosis that has a score of F1/F2 according to Ishak's scores system.
- a score of hepatic fibrosis indicating that the liver of said patient has not passed beyond the stage of mild fibrosis is a score of at most F2, i.e., a score of F0, F1 or F2, according to Ishak's scores system.
- a score of hepatic fibrosis indicating that the liver of said patient has passed beyond the stage of mild fibrosis is a score of at least F3, i.e., a score of F3, F4, F5 or F6, according to Ishak's scores system.
- Determining whether or not the stage (or degree) of the hepatic fibrosis of a patient infected with one or more hepatitis viruses and/or who is suffering from hepatitis, specifically chronic hepatitis, has passed beyond the stage of mild fibrosis is particularly essential to the physician.
- the process of the application can be used not only in the diagnostic of hepatic fibrosis or of the stage of hepatic fibrosis, but also in the treatment of a liver disease, especially to determine the moment when a treatment must be administered to the patient.
- the process of the invention can thus be a process for the therapy of a patient, comprising administering an antihepatitis and/or anti-HCV and/or anti-hepatic fibrosis treatment only when it has been determined, using the means of the application, that the patient has passed beyond the stage of mild fibrosis, or else a process for the therapy of a patient, comprising adjusting an antihepatitis and/or anti-HCV and/or anti-hepatic fibrosis treatment as a function of the response of the hepatic tissue of the patient, as determined using the means of the application.
- said treatment can be a treatment aiming at blocking or slowing down the progression of hepatic fibrosis by eliminating the virus (especially in the case of hepatitis C) and/or by blocking the replication of the virus (especially in the case of hepatitis B).
- the process of the application is applicable to whatever stage of hepatic fibrosis of the patient: this stage can be one from an absence of hepatic fibrosis to one of cirrhosis.
- the hepatic fibrosis score of said patient can be F0, F1, F2, F3 or F4, especially F0, F1, F2 or F3, especially F0, F1 or F2, especially F1, F2 or F3, especially F1 or F2, according to the Metavir fibrosis scores system.
- Said patient can be a patient in which the stiffness of the liver has been measured beforehand, especially by a non-invasive method, such as transient elastography (for example, by FIBROSCANTM).
- a non-invasive method such as transient elastography (for example, by FIBROSCANTM).
- the process of the application employs the quantification, especially the detection and quantification, of biological markers (or variables).
- the biological markers (or biomarkers) selected for performing the process include several different circulating molecules. They may further include zero, one or more additional markers that are not circulating molecules.
- circulating molecules is understood to have its usual meaning in the field.
- the circulating molecules are molecules that are present in the blood of a mammal, especially of a human, in acellular form: they are contained neither in a circulating cell nor in a tissue cell.
- the molecules circulating in the blood are also circulating in the plasma.
- the molecules circulating in the blood are also circulating in the serum.
- the circulating molecules can be, for example, proteins, glycoproteins, enzymes, polysaccharides, lipids, glycerides, hormones.
- the circulating molecules can be, for example, molecules or metabolites produced by the cells of the organism of said patient.
- the circulating molecules can be, for example, molecules (or metabolites) produced by the cells of the organism of said patient, but not produced by a virus, especially a hepatitis virus.
- the formed elements of the blood, such as the platelets, as well as the viruses, such as the hepatitis virus, are circulating, but are not molecules. Thus, they are not part of the circulating molecules within the meaning of the invention.
- these circulating molecules are human circulating molecules.
- Examples of circulating molecules include, in particular:
- a biological sample In order to quantify, especially to detect and quantify, one or more of the circulating molecules, a biological sample, especially a sample of a biological fluid, must be or must have been taken from the patient.
- the circulating molecules selected for performing the process comprise (or consist of) at least two different circulating molecules.
- the selected circulating molecules comprise (or consist of) at least hyaluronic acid (HA) and the protein CXCL10 (CXCL10).
- Hyaluronic acid HA
- CXCL10 protein CXCL10
- HA is a polymer of hyalobiuronic acid; its structural formula is as follows:
- CXCL10 is the ligand 10 to chemokine (motif CXC) [C-X-C motif chemokine 10], also known under the designation of C7; IFI10; INP10; IP-10; SCYB10; crg-2; gIP-10 or mob-1. Its human sequence is described in data bases under the accession number NM_001565.
- the precursor form of the protein CXCL10 (human) is a protein constituted of 98 amino acids of the following sequence:
- the signal peptide of the precursor form of CXCL10 is a peptide constituted of 21 amino acids that is identical with fragment 1 ⁇ 21 of the sequence of SEQ ID NO: 1 or 2, namely:
- the agonist form of CXCL10 is a protein of 77 amino acids of the following sequence:
- the antagonist form of CXCL10 is a protein of 75 amino acids whose sequence is that of the agonist form truncated by 2 N-terminal amino acids.
- the antagonist form of CXCL10 has thus the following sequence:
- the form CXCL10 which results from cleavage after secretion, is a protein of 73 amino acids, whose sequence is that of the agonist form truncated by 4 C-terminal amino acids.
- the form CXCL10, which results from cleavage after secretion, has thus the following sequence:
- the circulating forms of protein CXCL10 thus comprise the proteins of SEQ ID NO: 4 to NO: 9, especially:
- the quantification, especially the detection and quantification, of CXCL10 includes the quantification, or detection and quantification, of at least one, especially more than one, especially all the circulating forms of protein CXCL10.
- the quantification, especially the detection and quantification, of CXCL10 includes the quantification, or detection and quantification, of at least one, especially more than one, especially all the circulating forms of the proteins of SEQ ID NOS: 4 to 9.
- the circulating molecules selected for performing the process can be constituted of protein CXCL10 and HA.
- CXCL10 and HA are the only two circulating molecules that are selected or used as biological markers.
- one or more other (different) circulating proteins may be selected in addition to HA and CXCL10.
- these other selected circulating molecules do not comprise alpha-2 macroglobulin (A2M).
- A2M alpha-2 macroglobulin
- the protein A2M is present in high amounts in the blood of human patients. Therefore, it is not possible, or at least very difficult in routine, to measure the concentration of A2M in multiplex detection with those of HA and of protein CXCL10.
- these other selected circulating molecules do not comprise “granulocyte-macrophage colony-stimulating factor” (GMCSF).
- GMCSF granulocyte-macrophage colony-stimulating factor
- these other selected circulating molecules do not comprise interleukin 12 (IL 12).
- these other selected circulating molecules do not comprise interleukin 2 (IL 2).
- IL 2 interleukin 2
- these other selected circulating molecules do not comprise matrix metallopeptidase 13 (MMP13).
- these other selected circulating molecules do not comprise alanine aminotransferase (ALT).
- these other selected circulating molecules do not comprise gamma glutamyl transpeptidase (GGT).
- these other selected circulating molecules do not comprise the protein “intercellular adhesion molecule” (ICAM1).
- ICM1 intercellular adhesion molecule
- these other selected circulating molecules do not comprise interleukin 4 (IL 4).
- these other selected circulating molecules do not comprise ligand 6 to chemokine motif CXC (CXCL9).
- these other selected circulating molecules do not comprise the protein “vascular cell adhesion molecule 1” (VCAM1).
- VCAM1 vascular cell adhesion molecule 1
- these other selected circulating molecules do not comprise “retinol binding protein 4” (RBP4).
- these other selected circulating molecules do not comprise inhibitor 1 of metalloproteinase (TIMP1).
- these other selected circulating molecules do not comprise vimentin (VIM).
- these other selected circulating molecules do not comprise secreted phosphoprotein 1 (SPP1).
- these other selected circulating molecules do not comprise aspartate aminotransferase (AST).
- these other selected circulating molecules do not comprise apolipoprotein A1 (ApoA1).
- these other selected circulating molecules do not comprise interleukin-6 signal transducer (IL6ST).
- IL6ST interleukin-6 signal transducer
- these other selected circulating molecules do not comprise the inhibitor of cyclin-dependent kinase 2A (p14ARF).
- these other selected circulating molecules do not comprise matrix metallopeptidase 9 (MMP9).
- these other selected circulating molecules do not comprise angiopoietin 2 (ANGPT2).
- these other selected circulating molecules do not comprise ligand 11 to chemokine motif CXC (CXCL11).
- these other selected circulating molecules do not comprise matrix metallopeptidase 2 (MMP2).
- MMP2 matrix metallopeptidase 2
- these other selected circulating molecules do not comprise matrix metallopeptidase 7 (MMP1).
- MMP1 matrix metallopeptidase 7
- these other selected circulating molecules do not comprise S100 calcium binding protein A4 (S100A4).
- these other selected circulating molecules do not comprise inhibitor 1 of metalloproteinase (TIMP1).
- these other selected circulating molecules do not comprise protein 1 of the chitinase-3 type (CHI3L1).
- these other selected circulating molecules do not comprise the alpha-1(I) chain of collagen (COL1A1).
- these other selected circulating molecules do not comprise chemokine 1 of the growth-controlling protein alpha motif CXC (CXCL1).
- these other selected circulating molecules do not comprise ligand 6 to chemokine motif CXC (CXCL6).
- these other selected circulating molecules do not comprise the protein “Indian hedgehog” (IHH).
- these other selected circulating molecules do not comprise the interferon-stimulated transcription factor 3G (IRF9).
- these other selected circulating molecules do not comprise matrix metalloproteinase 1 (MMP1).
- MMP1 matrix metalloproteinase 1
- these other selected circulating molecules do not comprise any of proteins GMCSF, IL-12, IL-2 and MMP13.
- these other selected circulating molecules do not comprise any of proteins A2M, GMCSF, IL-12, IL-2 and MMP13.
- these other selected circulating molecules do not comprise any of proteins ALT, GGT, ICAMI, IL-4, CXCL9, VCAM1 and RBP4.
- these other selected circulating molecules do not comprise any of proteins A2M, ALT, GGT, ICAMI, IL4, CXCL9, VCAM1 and RBP4.
- these other selected circulating molecules do not comprise any of proteins A2M, TIMP1, VIM and SPP1.
- these other selected circulating molecules do not comprise any of proteins A2M, AST, ApoA1, IL6ST, p14ARF, MMP9, ANGPT2, CXCL11, MMP2, MMP7, S100A4, TIMP1, CHI3L1, COL1A1, CXCL1, CXCL6, IHH, IRF9 and MMP1.
- these other selected circulating molecules do not comprise any of proteins A2M, GMCSF, IL-12, IL-2, MMP13, ALT, GGT, ICAMI, IL4, CXCL9, VCAM1, RBP4, TIMP1, VIM, SPP1, AST, ApoA1, IL6ST, p14ARF, MMP9, ANGPT2, CXCL11, MMP2, MMP7, S100A4, TIMP1, CH13L1, COL1A1, CXCL1, CXCL6, IHH, IRF9 and MMP1.
- the total number of (different) circulating molecules are selected in numbers of six, five, four, three or two, especially in numbers of five, four, three or two, especially in numbers of four, three or two, especially in numbers of three or two, especially in numbers of two.
- the selected biological markers can further comprise zero, one or more additional marker(s) that are not circulating molecules, in particular, that are not human circulating molecules.
- additional marker(s) means those of the selected biological markers that are not one of the circulating molecules, in particular, that are not one of the human circulating molecules.
- the selected biological markers can comprise, in addition to said circulating molecules (and especially in addition to HA and CXCL10), one or more additional markers selected from:
- the additional markers are selected from:
- the clinical or anatomical characteristics are advantageously characteristics the measurement of which does not require detection or quantification in a sample of biological fluid of said patient, and more generally the measurement of which can be performed without taking a biological sample from said patient.
- the age, body mass index (BMI), sex and liver stiffness are clinical or anatomical characteristics (or markers) that can be quantified by extracorporeal measurement without taking a sample of biological fluid, and more generally without taking a biological sample from said patient (the stiffness of the liver can be measured by transient elastography, especially by FIBROSCANTM, and more generally without any invasive intervention.
- Examples of clinical or anatomical characteristics of said patient include, in particular, the age of said patient, the BMI of said patient, the sex of said patient, and the stiffness of the liver of said patient (FS), more particularly the age of said patient, the BMI of said patient, and the stiffness of the liver of said patient (FS).
- the marker “age of said patient” includes, in particular:
- the marker “BMI of said patient” includes, in particular:
- examples of clinical or anatomical characteristics of said patient include, more particularly:
- the total number of (different) clinical or anatomical markers selected as additional markers is zero, one, two or three, more particularly zero, one or two, more particularly zero or one, for example, zero, for example, one, for example, two, for example, one, two or three, for example, one or two.
- the selected clinical or anatomical markers are one, two or three (different) markers, more particularly one or two (different) markers, for example, one marker, for example, two different markers, selected from:
- the virological characteristics (or markers) of said patient are characteristics that require detection or quantification in a sample of biological fluid of said patient.
- this sample of biological fluid is the same, or at least of the same nature, as that employed to detect or quantify said circulating molecules (such as CXCL10 and HA).
- virological characteristics of said patient include, in particular:
- the marker “nature of the virus(es) contained in the blood of said patient” includes, in particular, the nature of the hepatitis virus(es) contained in the blood of said patient: for example, HCV and/or HBV and/or HDV, more particularly HCV and/or HBV, more particularly HCV.
- the marker “viral load of said patient” includes, in particular, the viral load of said patient in hepatitis virus, for example, their viral load in HCV and/or HBV and/or HDV, more particularly in HCV and/or HBV, more particularly in HCV.
- the marker “genotype(s) of said hepatitis virus(es) with which said patient is infected” includes, in particular, the genotype(s) of said hepatitis virus(es) with which said patient is infected, for example, genotypes 1 and/or 2 and/or 3 and/or 4 and/or 5 and/or 6 and/or 7.
- virological characteristics of said patient include, more particularly, the viral load of said patient in hepatitis virus, more particularly the viral load of said patient in HCV and/or HBV and/or HDV, more particularly in HCV and/or HBV, more particularly in HCV.
- the total number of (different) virological markers selected as additional markers is zero, one or two, more particularly zero or one, more particularly one or two, more particularly one, more particularly zero.
- no virological marker is selected, or else only one virological marker is selected and is the viral load of said patient (more particularly their viral load in hepatitis virus, more particularly the viral load of said patient in HCV and/or HBV and/or HDV, more particularly in HCV and/or HBV, more particularly in HCV).
- the total number of different additional markers selected in addition to said circulating molecules is zero, one, two, three, four, five, or more than five.
- the total number of different additional markers as described above is zero, one, two, three, four or five, more particularly zero, one, two, three or four, more particularly zero, one, two or three, more particularly zero, one or two, more particularly zero or one, more particularly zero, more particularly one, two, three, four or five, or more than five, more particularly one, two, three, four or five, more particularly one, two, three or four, more particularly one, two or three, more particularly one or two, more particularly one, more particularly two, more particularly three, more particularly four, more particularly five.
- said additional markers can comprise (or consist of), for example:
- said additional markers can comprise (or consist of), for example:
- the selected biological markers can comprise (or consist of):
- the total number of different additional markers selected as above is more particularly zero, one, two, three, four or five, more particularly zero, one, two, three or four, more particularly zero, one, two or three, more particularly zero, one or two, more particularly zero or one, more particularly zero, more particularly one, two, three, four, five, or more than five, more particularly one, two, three, four or five, more particularly one, two, three or four, more particularly one, two or three, more particularly one or two, more particularly one, more particularly two, more particularly three, more particularly four, more particularly five.
- the selected biological markers can comprise (or consist of):
- the total number of different additional markers selected as above is more particularly zero, one, two, three, four or five, more particularly zero, one, two, three or four, more particularly zero, one, two or three, more particularly zero, one or two, more particularly zero or one, more particularly zero, more particularly one, two, three, four, five, or more than five, more particularly one, two, three, four or five, more particularly one, two, three or four, more particularly one, two or three, more particularly one or two, more particularly one, more particularly two, more particularly three, more particularly four, more particularly five.
- the selected biological markers can comprise (or consist of):
- the total number of different additional markers selected as above is more particularly zero, one, two or three, more particularly one, two or three, more particularly two or three, more particularly zero, one or two, more particularly zero or one, more particularly zero, more particularly one, two or three, more particularly one or two, more particularly one, more particularly two, more particularly three, more particularly four.
- the selected biological markers can comprise (or consist of) HA and CXCL10.
- the selected biological markers can comprise (or consist of) HA, CXCL10, and the age of said patient (more particularly the age of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done).
- the selected biological markers can comprise (or consist of) HA, CXCL10, and the BMI of said patient (more particularly the BMI of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done).
- the selected biological markers can comprise (or consist of) HA, CXCL10, and the stiffness of the liver of said patient (FS).
- the selected biological markers can comprise (or consist of) HA, CXCL10, and the viral load of said patient (VL), more particularly the viral load of said patient in hepatitis virus, for example, their viral load in HCV and/or HBV and/or HDV, more particularly in HCV and/or HBV, more particularly in HCV.
- VL viral load of said patient
- the selected biological markers can comprise (or consist of):
- the selected biological markers can comprise (or consist of):
- the selected biological markers can comprise (or consist of):
- the selected biological markers can comprise (or consist of):
- the selected biological markers can comprise (or consist of):
- biomarkers are more particularly as follows:
- the selected circulating molecules (comprising at least HA and CXCL10) are quantified, more particularly detected and quantified, in a sample of biological fluid of said patient.
- the values of quantification of the circulating molecules are values of concentration or proportion, more particularly values of concentration. They may be expressed in mg/mL, ⁇ g/mL, ng/mL or pg/mL.
- the value of quantification of HA is a value of concentration expressed in ng/mL.
- the value of quantification of CXCL10 is a value of concentration expressed in pg/mL.
- values of concentration or proportion may be those measured in said sample of biological fluid or in an extract of filtrate of this sample.
- the values of quantification may be those measured in the filtrate of purification of said biological sample.
- the collected sample of biological fluid is blood and if serum is prepared from this blood, the values of quantification may be those measured in the serum.
- said step of quantification may, in particular, comprise in vitro detection of each of the circulating molecules selected as biological markers, such as HA and CXCL10.
- the detection of each of the circulating molecules selected as biological markers, more particularly HA and CXCL10 is done in multiplex detection (simultaneous detection in one and the same sample of biological fluid); cf. Example 10 below.
- Certain markers of the prior art, such as A2M have a very high serum concentration: their quantification thus cannot be done in multiplex detection with markers whose serum concentration is much lower, such as HA and CXCL10.
- the combinations of biomarkers described in the application on the other hand allow for multiplex performance.
- a ligand specific of this circulating molecule can be used.
- This ligand can directly bear a detection marker (such as a chemiluminescent marker or fluorophor).
- This ligand can be used as a capture ligand and/or detection ligand.
- This ligand can, for example, be an organic molecule or complex, or an inorganic molecule or complex.
- this ligand may be a protein (more particularly an antibody, more particularly a monoclonal antibody or a polyclonal antibody), a polysaccharide, a lipid, or a complex of protein(s) and/or polysaccharide(s) and/or lipid(s).
- an antibody or antibodies can be used as ligands.
- This antibody (or these antibodies) can bind specifically to one, more or all the circulating forms of CXCL10.
- an antibody polyclonal or monoclonal may be employed that binds specifically to one, more or all the proteins of SEQ ID NOS: 4 to 9, more particularly to all the proteins of SEQ ID NOS: 4 to 9 [for example, monoclonal mouse anti-human CXCL10 antibody, commercially available from R&D SYSTEMS, Inc. (614 McKinley Place NE; Minneapolis, Minn. 55413; USA), under the catalogue reference MAB266 (clone 33036, class IgG1)].
- the biological markers further comprise one or more additional markers that are not circulating molecules, more particularly that are not human circulating molecules (cf. above), this or these additional markers are also quantified.
- the value of quantification of this marker can be determined (or determined in advance) by collecting the value of the age of said patient [for example, a value expressed in number of years (whole number or with decimals)].
- the value of quantification of this marker can be determined (or determined in advance) by measuring in vitro the value of the load or concentration of hepatitis virus (more particularly of HCV and/or HCV and/or HDV, more particularly HCV) in a sample of biological fluid obtained in advance from said patient (human), more particularly by measuring in vitro the value of the quantity of hepatitis virus in a sample of biological fluid obtained in advance from said patient (human) and determining the value of this viral load or concentration.
- the value of this load of hepatitis virus can, for example, be expressed in copies/mL, or in IU/mL, or as a multiple of one of these units, such as 10 3 copies/mL.
- this or of each of these additional markers is advantageously the value of said marker at the date when said biological fluid was collected for in vitro measuring the concentrations of each of said (human) circulating molecules, more particularly at the date when said biological fluid was collected for in vitro measuring the concentrations of HA and of the protein CXCL10.
- the values of quantification of the selected biological markers are compared to their values, or to the distribution of their values, in the predefined reference cohorts according to the stage of hepatic fibrosis, in order to classify said patient into the one of these reference cohorts to which they most probably belong.
- Said reference cohorts include or are:
- Classification into the first cohort determines or indicates that the stage of hepatic fibrosis of said patient does not pass beyond the stage of portal fibrosis without septum.
- the individuals of said reference cohorts are individuals of the same species as said patient [for example, humans of said patient is human], and are infected with one or more hepatitis viruses that belong to different genotypes.
- the individuals of said reference cohorts are humans infected with HCV, and the HCV strains of these individuals belong to at least two different genotypes, more particularly at least three, more particularly at least four, more particularly at least five, more particularly at least six, more particularly at least seven, different genotypes.
- the individuals of said reference cohorts are humans infected with HCV, and the HCV strains of these individuals belong to at least four different genotypes including the genotypes 1, 2, 3 and 4.
- the individuals of said reference cohorts are humans infected with HCV, and the HCV strains of these individuals belong to at least five different genotypes including the genotypes 1, 2, 3, 4 and 5.
- the individuals of said reference cohorts are humans infected with HCV, and the HCV strains of these individuals belong to at least six different genotypes including the genotypes 1, 2, 3, 4, 5 and 6.
- the individuals of said first reference cohort include at least individuals whose stage of hepatic fibrosis is that of a fibrosis without septum (score F1 according to the Metavir fibrosis scores system).
- the individuals of said first reference cohort can thus be comprised of individuals whose stage of hepatic fibrosis is that of a portal fibrosis without septum [score F1 according to the Metavir fibrosis scores system].
- the individuals of said first reference cohort can thus be comprised of individuals whose stage of hepatic fibrosis is that of a portal fibrosis without septum and of individuals infected with one or more hepatitis viruses and/or who are suffering from hepatitis (specifically chronic hepatitis), but who do not have hepatic fibrosis [scores F0 and F1 according to the Metavir fibrosis scores system].
- the individuals of said second reference cohort include at least individuals whose stage of hepatic fibrosis is that of a portal fibrosis with septum(s) (score F2 according to the Metavir fibrosis scores system).
- the individuals of said second reference cohort can be comprised of individuals whose stage of hepatic fibrosis is that of a portal fibrosis with septum [score F2 according to the Metavir fibrosis scores system].
- the individuals of said second reference cohort can be comprised of individuals whose stage of hepatic fibrosis is that of a portal fibrosis with septums and of individuals whose stage of hepatic fibrosis is that of a septal fibrosis without cirrhosis [scores F2 and F3 according to the Metavir fibrosis scores system].
- the individuals of said second reference cohort can be comprised of individuals whose stage of hepatic fibrosis is that of a portal fibrosis with septums, of individuals whose stage of hepatic fibrosis is that of a septal fibrosis without cirrhosis, and of individuals whose stage of hepatic fibrosis is that of a cirrhosis [scores F2, F3 and F4 according to the Metavir fibrosis scores system].
- the total number of individuals who form said first reference cohort and said second reference cohort may be at least 100, more particularly at least 200, advantageously at least 300.
- Each of these two cohorts is comprised of a plurality of individuals and represents 30% to 70% of the overall population of the individuals (the total of the individuals of said first reference cohort and said second reference cohort being 100%).
- the number of individuals constituting said first reference cohort and said second reference cohort make a total of 100
- said first reference cohort is comprised of 30 individuals
- said second reference cohort is comprised of 70 individuals.
- each of these two cohorts is comprised of a plurality of individuals and represents 40% to 60% of the overall population of the individuals, more particularly 40% to 55%, more particularly 45% to 55%, more particularly 45% to 50% of the overall population of the individuals (the total of the individuals of said first reference cohort and said second reference cohort being 100%).
- the number of individuals constituting said first reference cohort and said second reference cohort make a total of more than 300
- said first reference cohort is comprised of a number of individuals representing 40% to 60% of this overall population of more than 300 individuals
- said second reference cohort is thus comprised of a number of individuals representing the complementary percentage to make a total of 100%).
- a process of the application is thus a process (in vitro) for determining (more particularly for determining with a high probability) whether the stage of hepatic fibrosis of a (human) patient infected with one or more hepatitis viruses and/or who is suffering from hepatitis, specifically chronic hepatitis, has not passed beyond the stage of mild fibrosis, or whether they have on the contrary passed beyond this stage, said stage of mild fibrosis being that of a portal fibrosis without septum (according to the Metavir fibrosis scores system, the stage of a portal fibrosis without septum is a score F1), said process comprising the following steps:
- a process of the application is a process (in vitro) for determining (more particularly for determining with a high probability) whether the stage of hepatic fibrosis of a (human) patient infected with one or more hepatitis viruses and/or who is suffering from hepatitis, specifically chronic hepatitis, has not passed beyond the stage of mild fibrosis, or whether they have on the contrary passed beyond this stage, said stage of mild fibrosis being that of a portal fibrosis without septum (according to the Metavir fibrosis scores system, the stage of a portal fibrosis without septum is a score F1), said process comprising the following steps:
- step i)b) there are more particularly selected zero, one, two or three additional markers selected from the list of markers consisting of the age, body mass index (BMI), viral load (VL) and stiffness of the liver (FS) from this list (cf. “Optional additional markers” above).
- no additional marker is selected, or the additional marker stiffness of the liver, or the additional markers age and BMI, or the additional markers age, BMI and viral load are selected.
- the different biological markers selected in step i) may, for example, comprise or consist of:
- Said step of comparing the values of quantification of the biological markers to their values, or to the distribution of their values, in the predefined reference cohorts according to the stage (or degree) of hepatic fibrosis, in order to classify said patient into the one of these reference cohorts to which they most probably belong, can be realized by any means that the skilled person considers appropriate.
- this comparison can be done by classification, more particularly by combining the determined (or measured) values obtained for said patient in a classification model, more particularly in a multivariate classification model.
- Such a classification model compares (in a combined manner) the determined values obtained for said patient to their values, or to the distribution of their values, in the predefined reference cohorts according to the stage of hepatic fibrosis, in order to classify said patient into the one of these reference cohorts to which they most probably belong, for example, by attributing to them an output value indicating the hepatic fibrosis score of said patient.
- Such a classification model can be created, especially created in advance, by making a comparison between the cohorts of the determined values obtained for said reference cohorts, or the distribution of these determined values.
- such a classification model can be created, especially created in advance, by measuring or collecting the values of quantification of the biological markers in reference cohorts predefined according to their score of hepatic fibrosis, and by analyzing these determined values, or the distribution thereof, by a statistical method for creating a classification model, more particularly a multivariate classification model, which induces or determines a score of hepatic fibrosis from said values of quantification.
- a classification model can, for example, be created (in advance) by:
- said classification model can be created (in advance) as follows:
- ⁇ for a population of individuals of the same species as said patient, infected with the same hepatitis virus(es) as said patient, determining the stage (or degree or score) of hepatic fibrosis of each of said individuals of the population, and classifying them into subpopulations according to their stage (or degree or score) of hepatic fibrosis, thus constituting the reference cohorts created according to their stage (or degree or score) of hepatic fibrosis, said reference cohorts including or being:
- Said step of comparison can be realized by classifying the values of quantification obtained for said patient in a classification model, more particularly, a multivariate classification model, in order to assign to said patient a score (Z) indicating whether or not the stage (or degree) of the hepatic fibrosis of said patient has passed beyond the stage of mild fibrosis.
- a classification model more particularly, a multivariate classification model
- Said classification model can be a model that, from a combination of the values of quantification of said biological markers, induces a score value (Z) from the combination of the values of quantification of said selected biological markers.
- said step of comparison can be realized by applying a predetermined discriminating classification rule to the values of quantification obtained for said patient, in order to classify said patient into the one of said reference cohorts to which they most probably belong (more particularly, in order to classify said patient into said first reference cohort or into said second reference cohort).
- This discriminating rule can be a rule that compares the values of quantification obtained for the selected biological markers to one or more threshold values predetermined by classification, in order to classify said patient into the one of said reference cohorts to which they most probably belong (i.e., in order to classify said patient into said first reference cohort or into said second reference cohort).
- a model can be created by a mathematical function, a non-parametric technique, a procedure of heuristic classification, or else an approach of probabilistic prediction.
- a typical example of classification based on the quantification of biological markers consists in the discrimination of “healthy” versus “sick” patients.
- characteristic values can for example represent values of protein concentrations and/or of clinical and/or anatomical data and/or of virological data.
- Each sample x i is associated to a discrete value y i , representing the clinical status of individual i.
- y i 0 if the patient i has a score of hepatic fibrosis F1
- y i 1 if the patient i has a score of hepatic fibrosis F2.
- a model offers a discriminating rule (for example, a mathematical function, an algorithm or procedure), which uses the information available from x i for predicting y j in each sample observed. The objective is to use this model in order to predict the clinical status of patient p, namely y p , from available biological and/or clinical values, namely x p .
- mROC linear or non-linear mathematical function
- Each classification model that the skilled person considers appropriate may be used or employed.
- said discriminating classification rule can be, for example:
- the multivariate ROC method is a generalization of the ROC (receiver operating characteristics) method (cf. Reiser and Faraggi 1997; Su and Liu 1993, Shapiro, 1999). It calculates the area under the ROC curve (AUC) relative to a linear combination of biomarkers and/or of transformations of biomarkers (in the case of a normalization) under the assumption of a multivariate normal distribution.
- the mROC method was described, in particular, in Kramar et al. 1999 and Kramar et al. 2001.
- the software mROC version 1.0 commercially available from the developers (A. Kramar, A. Fortune, D. Farragi and B. Reiser), for example, can be used to create an mROC model.
- BMQ biomarker
- BMQ i the value of quantification of one of the selected biomarkers (i going from 1 to n) or the value of the Box-Cox transformed form of this value of quantification
- BMQ t the Box-Cox transformed form of the value of quantification of BMQ
- a, b, . . . and w being the parameters of the mROC function.
- the logistic regression (LR) using an affine function or LOGIT function is a model of binomial regression (Berkson 1944; Berkson 1951).
- the family of artificial intelligence or machine learning methods is a family of algorithms that, instead of proceeding to an explicit generalization, compare the examples of a new problem with the examples considered while learning that have been stored in the memory. These algorithms directly create hypotheses from learnt examples themselves.
- a CART model is a decision tree. An example thereof is presented in FIG. 12 .
- the value of quantification of each of the biomarkers (BMQ i ) is compared to a series of threshold values (parameters h, i and j in FIG. 12 ), which allows to classify the tested sample by following the decision tree (in FIG. 12 : score ⁇ F2, or score F2).
- KNN k-nearest neighbors
- WKNN weighted k-nearest neighbors
- the class (or clinical status) of x is determined as a function of the majority class among the k nearest neighbors of the observation x.
- Libraries of specific KKNN functions are available, for example, in the software R (http://www.R-project.org/). The software R was initially developed by John Chambers and the Bell laboratories (cf. Chambers 2008). The current version of this software suite is the version 2.11.1.
- the source code is freely available under the regulations of the General Public License “Free Software Foundation's GNU” on the website http://www.R-project.org/. This software can be used to create a WKNN model.
- a random forest is constituted of a set of simple forecast trees, each being capable of producing a response when presented a subset of predictors (Breiman 2001; Liaw and Wiener 2002).
- the calculations are realized with the software R.
- This software can be used to create RF models.
- a neural network is constituted of a directed weighted graph whose nodes symbolize the neurons.
- the network is built from examples of each class (for example, F2 versus F1) and is then used to determine to which class a new element belongs; cf. Intrator and Intrator 1993, Riedmiller and Braun 1993, Riedmiller 1994, Anastasiadis et. al. 2005; cf. http://cran.r-project.org/web/packages/neuralnet/index.html.
- the software freely available on http://www.r-project.org/(version 1.3 of Neuralnet, written by Stefan Fritsch and Frauke Guenther, following the work by Marc Suling), for example, can be used to build a network of neurons.
- the comparison of values of quantification of the selected biomarkers to their values, or to the distribution of their values, in reference cohorts predefined according to the stage of hepatic fibrosis for classifying said patient into the one of these reference cohorts to which they most probably belong can thus be realized, in particular, by following a method and/or by using an algorithm or a software:
- said comparison can thus be realized, in particular, by following a method and/or by using an algorithm or a software:
- Each of these algorithms, software or methods allows to build a classification model from values of quantification of each of said reference cohorts, and to combine the values of quantification obtained on said patient in this model to induce therefrom the classification or score of hepatic fibrosis of said patient.
- the classification model employed is a multivariate classification model using a mathematical function, such as mROC, or logistic regression (more particularly logistic regression using a LOGIT affine function).
- the classification model employs a machine learning or artificial intelligence model, such as CART.
- the means of the application more particularly the selection of the biological markers of the application, allow to achieve very good performances of classification of said patient.
- said comparison of the values of quantification of said patient to their values, or to the distribution of their values, in said reference cohorts is performed by classifying said patient into the one of these reference cohorts to which they most probably belong, with a particularly high sensitivity (Se) and/or negative predictive value (NPV) and/or specificity (Spe) and/or positive predictive value (PPV) and/or area under the ROC curve (AUC) and/or correct classification rate (CCR).
- Se particularly high sensitivity
- NPV negative predictive value
- Spe specificity
- PPV positive predictive value
- AUC area under the ROC curve
- CCR correct classification rate
- sensitivity Se
- specificity Spe
- positive predictive value PV
- negative predictive value NPV
- AUC area under the ROC curve
- CCR correct classification rate
- PPV thus represents the probability that the tested subject has actually passed beyond said stage of mild fibrosis (Metavir hepatic fibrosis score of at least F2), knowing that the means of the application indicate that they have passed beyond said stage of mild fibrosis (Metavir hepatic fibrosis score of at least F2) [positive result of the test].
- NPV thus represents the probability that the tested subject actually has not passed beyond said stage of mild fibrosis (Metavir hepatic fibrosis score of at most F1), knowing that the means of the application indicate that they have not passed beyond said stage of mild fibrosis (Metavir hepatic fibrosis score of at least F2) [negative result of the test].
- the correct classification rate is the percentage of correctly classified patients.
- the area under the ROC curve is the area under the ROC curve (AUC) relative to a linear combination of biomarkers and/or of transformations of biomarkers (in the case of a normalization) under the assumption of a multivariate normal distribution.
- Said comparison of values of quantification of said patient to their values, or to the distribution of their values, in said reference cohorts can be done by following a classification model as described above.
- said comparison can be done according to an mROC function, a LOGIT function or a CART tree, especially a Z 1 to Z 13 mROC function, a LOGIT 1 to LOGIT 4 function, a CART 1 to CART 4 tree, as described below.
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a sensitivity (Se) of at least 70%, at least 75%, at least 76%, at least 77%, at least 78%, at least 80%, at least 82% or at least 83%.
- a sensitivity of at least 70%, at least 75%, at least 76%, at least 77%, at least 78%, at least 80%, at least 82% or at least 83%.
- said comparison can be done (for example by mROC, logistic regression or CART tree) by classifying said patient with a sensitivity (Se) of at least 76%, at least 77%, at least 78%, at least 80%, at least 82% or at least 83%.
- a sensitivity Se
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a negative predictive value (NPV) of at least 70%, at least 75%, at least 76%, at least 77%, at least 78%, at least 80%, at least 81%, at least 82% or at least 83%.
- NPV negative predictive value
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a negative predictive value (NPV) of at least 75%, at least 76%, at least 77%, at least 78%, at least 80%, at least 81%, at least 82% or at least 83%.
- NPV negative predictive value
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a specificity of at least 59%, at least 70%, at least 71%, at least 80%, at least 85%, at least 86%, at least 87%, at least 89%, at least 90% or at least 91%.
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a specificity of at least 85%, at least 86%, at least 87%, at least 89%, at least 90% or at least 91%.
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a positive predictive value (PPV) of at least 54%, at least 61%, at least 62%, at least 85%, at least 86%, at least 87%, at least 88%, at least 90% or at least 91%.
- PSV positive predictive value
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a positive predictive value (PPV) of at least 85%, at least 86%, at least 87%, at least 88%, at least 90% or at least 91%.
- PSV positive predictive value
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a sensitivity (Se) of at least 76% (as described above) and/or with a negative predictive value (NPV) of at least 75% (as described above).
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a sensitivity (Se) of at least 76% (as described above) and/or with a specificity (Spe) of at least 59% (as described above).
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a sensitivity (Se) of at least 76% (as described above) and/or with a specificity (Spe) of at least 85% (as described above).
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a sensitivity (Se) of at least 76% (as described above) and/or with a PPV of at least 54% (as described above).
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a sensitivity (Se) of at least 76% (as described above) and/or with a PPV of at least 85% (as described above).
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a specificity (Spe) of at least 54% (as described above) and/or with a PPV of at least 54% (as described above).
- a specificity Spe
- a PPV PPV
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a specificity (Spe) of at least 54% (as described above) and/or with a PPV of at least 85% (as described above).
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a specificity (Spe) of at least 85% (as described above) and/or with a PPV of at least 54% (as described above).
- a specificity Spe
- PPV PPV
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a specificity (Spe) of at least 85% (as described above) and/or with a PPV of at least 85% (as described above).
- a specificity Spe
- PPV PPV
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a specificity (Spe) of at least 54% (as described above) and/or with an NPV of at least 75% (as described above).
- Spe specificity
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a specificity (Spe) of at least 85% (as described above) and/or with an NPV of at least 75% (as described above).
- a specificity Spe
- NPV neurotrophic factor
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with an NPV of at least 75% (as described above) and/or with a PPV of at least 54% (as described above).
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a sensitivity (Se) of at least 76% (as described above) and with an NPV of at least 75% (as described above), as well as with:
- said comparison can be done (for example by mROC or logistic regression) by classifying said patient with an area under the ROC curve (AUC) of at least 0.700, at least 0.704, at least 0.720, at least 0.729, at least 0.730, at least 0.731, at least 0.840, at least 0.844, at least 0.860, at least 0.865, at least 0.868, at least 0.880, at least 0.882, at least 0.890, at least 0.895, at least 0.898, at least 0.899, at least 0.0900, at least 0.910, at least 0.920, at least 0.921, at least 0.930, at least 0.931, or at least 0.933.
- AUC area under the ROC curve
- the combination of the two only markers HA and CXCL10 is sufficient to achieve an AUC of at least 0.700, more particularly at least 0.704, more particularly at least 0.865 (cf. the Examples below).
- said comparison can be done, for example by mROC or logistic regression, by classifying said patient with an AUC of at least 0.800, more particularly at least 0.865, at least 0.868, at least 0.880, at least 0.882, at least 0.890, at least 0.895 or at least 0.898.
- said comparison can be done (for example by mROC, logistic regression or CART tree) by classifying said patient with a correct classification rate (CCR) of at least 60%, at least 66%, at least 70%, at least 72%, at least 73%, at least 75%, at least 77%, at least 80%, at least 81%, at least 82%, at least 83%, at least 85%, at least 86%, at least 88% or at least 89%.
- CCR classification rate
- said comparison can be done (for example by mROC, logistic regression or CART tree) by classifying said patient with a correct classification rate (CCR) of at least 80%, at least 81%, at least 82%, at least 83%, at least 85%, at least 86%, at least 88% or at least 89%.
- CCR classification rate
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a correct classification rate of at least 80% and/or with an AUC of at least 0.704.
- said comparison is done (for example by mROC, logistic regression or CART tree) by classifying said patient with a correct classification rate of at least 70% and/or with an AUC of at least 0.800, more particularly with a correct classification rate of at least 80% and/or with an AUC of at least 0.800.
- said comparison can be done (for example by mROC, logistic regression or CART tree) with at least one of the two performances 1/ and 2/ below:
- said comparison can be done (for example by mROC, logistic regression or CART tree) with at least one of the two performances 1/ and 2/ below:
- a discriminating rule of the application (whether mROC, CART, LR or other, cf. below), more particularly an mROC function responding to the formula of the function Z 10 , Z 11 , Z 12 or Z 13 (cf. below), has a rate of unclassified patients of 0%.
- a discriminating rule of the application (whether mROC, CART, LR or other), more particularly an mROC function responding to the formula of the function Z 10 , Z 11 , Z 12 or Z 13 , has at least one of its performances of AUC, correct classification rate, sensitivity, NPV, specificity and PPV that is superior:
- the inventors demonstrate in fact that the combination of the marker CXCL10 with the marker HA leads to a synergistic effect, i.e., performances that go beyond a simple juxtaposition of their respective individual performances (AUC performances and/or correct classification rate and/or sensitivity and/or NPV and/or specificity and/or PPV).
- AUC performances and/or correct classification rate and/or sensitivity and/or NPV and/or specificity and/or PPV are presented in the Examples below, in particular:
- the inventors demonstrate that the synergistic effect observed with the combination of CXCL10 and HA does not depend on the fact that an mROC function is employed for the classification of the patient; cf. the Examples below, especially:
- a mathematical function can be employed to perform said step of comparison of the values of quantification of the biological markers of said patient to their values, or to the distribution of their values, in reference cohorts predefined according to the stage (or degree) of hepatic fibrosis for classifying said patient into the one of these reference cohorts to which they most probably belong.
- the comparison is then effected by combining the values of quantification of each of the selected biological markers in this mathematical function.
- This mathematical function can assign a score (Z) to said patient, which is then compared to a threshold value ( ⁇ or cut-off) predetermined by multivariate classification, for classifying said patient into the one of these reference cohorts to which they most probably belong (more particularly, for classifying said patient into said first reference cohort or into said second reference cohort).
- Said mathematical function can be, for example, a linear function, such as an mROC function, or a non-linear function, for example, an affine function, such as a function of logistic regression using a LOGIT affine function.
- Example 8 Example 8
- the mROC functions of the application like the function Z 13 above as well as the functions Z 12 to Z 1 described below, exhibit the performances described above (performances of AUC and/or correct classification rate and/or sensitivity and/or NPV and/or specificity and/or PPV).
- the inventors further demonstrate that the performances of the combination of CXCL10 with HA are particularly robust (performances of AUC and/or correct classification rate and/or sensitivity and/or NPV and/or specificity and/or PPV), because the parameters of the mROC function are selected in the indicated ranges of values: cf. Example 9 below.
- Example 8 below.
- the threshold value of each of the mROC functions of the application may for example be from ⁇ 7 to 25, more particularly from 3 to 25, more particularly from 10 to 25.
- An mROC function of the application may for example have a correct classification rate of at least 66% and/or a value of area under the ROC curve (AUC) of at least 0.704, more particularly a correct classification rate of at least 72% and/or a value of area under the ROC curve (AUC) of at least 0.729, more particularly a correct classification rate of at least 80% and a value of AUC of at least 0.865, more particularly a correct classification rate of at least 80% and/or a value of area under the ROC curve (AUC) of at least 0.898.
- AUC area under the ROC curve
- An mROC function of the application may for example have a sensitivity of at least 70% and/or an NPV of at least 70%, more particularly a sensitivity of at least 75% and/or an NPV of at least 75%, more particularly a sensitivity of at least 76% and/or an NPV of at least 75%.
- An mROC function of the application may for example have a specificity of at least 59% and/or a PPV of at least 54%, more particularly a specificity of at least 70% and/or a PPV of at least 61%, more particularly a specificity of at least 85% and/or a PPV of at least 85%, more particularly a specificity of at least 86% and/or a PPV of at least 86%.
- the threshold value of Z 10 may be, for example, from ⁇ 7 to 25, more particularly from 3 to 25, more particularly from 10 to 25, more particularly from 11.68 to 23.71.
- a function Z 10 may for example have a correct classification rate of at least 66% and/or a value of AUC of at least 0.704, more particularly a correct classification rate of at least 72% and a value of AUC of at least 0.729, more particularly a correct classification rate of at least 80% and a value of AUC of at least 0.865, more particularly a correct classification rate of at least 80% and a value of AUC of at least 0.898, more particularly a correct classification rate of at least 83% and a value of AUC of at least 0.868 (cf. Examples 3, 5 and 8 below).
- a function Z 10 may for example have a sensitivity of at least 70% and/or an NPV of at least 70%, particularly a sensitivity of at least 75% and/or an NPV of at least 75%, more particularly a sensitivity of at least 76% and/or an NPV of at least 75%, more particularly a sensitivity of at least 78% and/or an NPV of at least 77% (cf. Examples 1, 3, 5 and 6 below).
- a function Z 10 may for example have a specificity of at least 59% and/or a PPV of at least 54%, more particularly a specificity of at least 70% and/or a PPV of at least 61%, more particularly a specificity of at least 85% and/or a PPV of at least 85%, more particularly a specificity of at least 86% and/or a PPV of at least 86%, more particularly a specificity of at least 90% and/or a PPV of at least 90% (cf. Examples 1, 3, 5 and 6 below).
- the threshold value of Z 4 may be, for example, from ⁇ 7 to 25, more particularly from 3 to 25, more particularly from 10 to 25, more particularly 15.170.
- a function Z 4 may for example have a correct classification rate of at least 66% and/or a value of AUC of at least 0.704, more particularly a correct classification rate of at least 72% and a value of AUC of at least 0.729, more particularly a correct classification rate of at least 80% and a value of AUC of at least 0.865, more particularly a correct classification rate of at least 80% and a value of AUC of at least 0.882, more particularly a correct classification rate of at least 83% and a value of AUC of at least 0.898 (cf. Examples 3, 5 and 8 below).
- a function Z 4 may for example have a sensitivity of at least 70% and/or an NPV of at least 70%, particularly a sensitivity of at least 75% and/or an NPV of at least 75%, more particularly a sensitivity of at least 76% and/or an NPV of at least 75%, more particularly a sensitivity of at least 78% and/or an NPV of at least 77% (cf. Examples 3 and 5 below).
- a function Z 4 may for example have a specificity of at least 59% and/or a PPV of at least 54%, more particularly a specificity of at least 70% and/or a PPV of at least 61%, more particularly a specificity of at least 85% and/or a PPV of at least 85%, more particularly a specificity of at least 86% and/or a PPV of at least 86%, more particularly a specificity of at least 90% and/or a PPV of at least 90% (cf. Examples 3 and 5 below).
- the threshold value of Z 1 may be, for example, from ⁇ 7 to 25, more particularly from 3 to 25, more particularly from 3 to 5, more particularly 3.382.
- the function Z 1 may for example have a correct classification rate of at least 66% and/or an AUC of at least 0.704 (cf. Example 1 below).
- the function Z 1 may for example have a sensitivity of at least 78% and/or an NPV of at least 81% (cf. Example 1 below).
- the function Z 1 may for example have a specificity of at least 59% and/or a PPV of at least 54% (cf. Example 1 below).
- the threshold value of Z 7 may be, for example, from ⁇ 7 to 25, more particularly from 3 to 25, more particularly from 10 to 25, more particularly 13.5.
- a function Z 7 may for example have a correct classification rate of at least 66% and/or a value of AUC of at least 0.704, more particularly a correct classification rate of at least 72% and a value of AUC of at least 0.729, more particularly a correct classification rate of at least 80% and a value of AUC of at least 0.865, more particularly a correct classification rate of at least 82% and a value of AUC of at least 0.865 (cf. Example 6 below).
- a function Z 7 may for example have a sensitivity of at least 70% and/or an NPV of at least 70%, particularly a sensitivity of at least 75% and/or an NPV of at least 75%, more particularly a sensitivity of at least 76% and/or an NPV of at least 75%, more particularly a sensitivity of at least 78% and/or an NPV of at least 77%.
- a function Z 7 may for example have a specificity of at least 59% and/or a PPV of at least 54%, more particularly a specificity of at least 70% and/or a PPV of at least 61%, more particularly a specificity of at least 85% and/or a PPV of at least 85%, more particularly a specificity of at least 86% and/or a PPV of at least 86%, more particularly a specificity of at least 90% and/or a PPV of at least 90%.
- the threshold value of Z 11 may be, for example, from ⁇ 7 to 25, more particularly from ⁇ 7 to 17.
- a function Z 11 may for example have a correct classification rate of at least 66% and/or a value of AUC of at least 0.704, more particularly a correct classification rate of at least 72% and a value of AUC of at least 0.729, more particularly a correct classification rate of at least 80% and a value of AUC of at least 0.865, more particularly a correct classification rate of at least 80% and a value of AUC of at least 0.882, more particularly a correct classification rate of at least 83% and a value of AUC of at least 0.899 (cf. Examples 1, 3, 6, 7 and 8 below).
- a function Z 11 may for example have a sensitivity of at least 70% and/or an NPV of at least 70%, particularly a sensitivity of at least 75% and/or an NPV of at least 75%, more particularly a sensitivity of at least 76% and/or an NPV of at least 75%, more particularly a sensitivity of at least 80% and/or an NPV of at least 78% (cf. Examples 1, 3, 6 and 7 below).
- a function Z 11 may for example have a specificity of at least 59% and/or a PPV of at least 54%, more particularly a specificity of at least 70% and/or a PPV of at least 61%, more particularly a specificity of at least 85% and/or a PPV of at least 85%, more particularly a specificity of at least 86% and/or a PPV of at least 86%, more particularly a specificity of at least 87% and/or a PPV of at least 88% (cf. Examples 1, 3, 6 and 7 below).
- the threshold value of Z 3 may be, for example, from ⁇ 7 to 25, more particularly from ⁇ 7 to 17, more particularly ⁇ 5.730.
- the function Z 3 may for example have a correct classification rate of at least 66% and/or an AUC of at least 0.704, more particularly a correct classification rate of at least 72% and a value of AUC of at least 0.729, more particularly a correct classification rate of at least 73% and an AUC of at least 0.731, more particularly a correct classification rate of at least 80% and a value of AUC of at least 0.868 (cf. Examples 1 and 8 below).
- the function Z 3 may for example have a sensitivity of at least 70% and/or an NPV of at least 70%, particularly a sensitivity of at least 75% and/or an NPV of at least 75%, more particularly a sensitivity of at least 76% and/or an NPV of at least 75%, more particularly a sensitivity of at least 76% and/or an NPV of at least 83% (cf. Example 1 below).
- the function Z 3 may for example have a specificity of at least 59% and/or a PPV of at least 54%, more particularly a specificity of at least 70% and/or a PPV of at least 61%, more particularly a specificity of at least 71% and/or a PPV of at least 62% (cf. Example 1 below).
- the threshold value of Z 5 may be, for example, from ⁇ 7 to 25, more particularly from ⁇ 7 to 17, more particularly 16.543.
- a function Z 5 may for example have a correct classification rate of at least 66% and/or a value of AUC of at least 0.704, more particularly a correct classification rate of at least 72% and a value of AUC of at least 0.729, more particularly a correct classification rate of at least 80% and a value of AUC of at least 0.865, more particularly a correct classification rate of at least 80% and a value of AUC of at least 0.868, more particularly a correct classification rate of at least 80% and a value of AUC of at least 0.882, more particularly a correct classification rate of at least 83% and a value of AUC of at least 0.899 (cf. Examples 1, 3, 7 and 8 below).
- a function Z 5 may for example have a sensitivity of at least 70% and/or an NPV of at least 70%, particularly a sensitivity of at least 75% and/or an NPV of at least 75%, more particularly a sensitivity of at least 76% and/or an NPV of at least 75%, more particularly a sensitivity of at least 80% and/or an NPV of at least 78% (cf. Examples 1, 3 and 7 below).
- a function Z 5 may for example have a specificity of at least 59% and/or a PPV of at least 54%, more particularly a specificity of at least 70% and/or a PPV of at least 61%, more particularly a specificity of at least 85% and/or a PPV of at least 85%, more particularly a specificity of at least 86% and/or a PPV of at least 86%, more particularly a specificity of at least 87% and/or a PPV of at least 88% (cf. Examples 1, 3 and 7 below).
- the threshold value of Z 8 may be, for example, from ⁇ 7 to 25, more particularly from ⁇ 7 to 17, more particularly 14.7.
- a function Z 8 may for example have a correct classification rate of at least 66% and/or a value of AUC of at least 0.704, more particularly a correct classification rate of at least 72% and a value of AUC of at least 0.729, more particularly a correct classification rate of at least 80% and a value of AUC of at least 0.865, more particularly a correct classification rate of at least 80% and a value of AUC of at least 0.868, more particularly a correct classification rate of at least 82% and a value of AUC of at least 0.868 (cf. Examples 6 and 8 below).
- a function Z 8 may for example have a sensitivity of at least 70% and/or an NPV of at least 70%, particularly a sensitivity of at least 75% and/or an NPV of at least 75%, more particularly a sensitivity of at least 76% and/or an NPV of at least 75%, more particularly a sensitivity of at least 80% and/or an NPV of at least 78%.
- a function Z 8 may for example have a specificity of at least 59% and/or a PPV of at least 54%, more particularly a specificity of at least 70% and/or a PPV of at least 61%, more particularly a specificity of at least 85% and/or a PPV of at least 85%, more particularly a specificity of at least 86% and/or a PPV of at least 86%, more particularly a specificity of at least 87% and/or a PPV of at least 88%.
- the threshold value of Z 2 may be, for example, from ⁇ 7 to 25, more particularly from ⁇ 7 to 17, more particularly 14.7.
- a function Z 2 may for example have a correct classification rate of at least 66% and/or a value of AUC of at least 0.704, more particularly a correct classification rate of at least 72% and a value of AUC of at least 0.729 (cf. Example 1 below).
- a function Z 2 may for example have a sensitivity of at least 70% and/or an NPV of at least 70%, particularly a sensitivity of at least 75% and/or an NPV of at least 75%, more particularly a sensitivity of at least 76% and/or an NPV of at least 75%, more particularly a sensitivity of at least 76% and/or an NPV of at least 82% (cf. Example 1 below).
- a function Z 2 may for example have a specificity of at least 59% and/or a PPV of at least 54%, more particularly a specificity of at least 70% and/or a PPV of at least 61% (cf. Example 1 below).
- the threshold value of Z 6 may be, for example, from ⁇ 7 to 25, more particularly from ⁇ 7 to 17, more particularly 14.7.
- a function Z 6 may for example have a correct classification rate of at least 66% and/or a value of AUC of at least 0.704, more particularly a correct classification rate of at least 72% and a value of AUC of at least 0.729, more particularly a correct classification rate of at least 80% and a value of AUC of at least 0.865, more particularly a correct classification rate of at least 80% and a value of AUC of at least 0.868, more particularly a correct classification rate of at least 86% and a value of AUC of at least 0.931 (cf. Example 5 below).
- a function Z 6 may for example have a sensitivity of at least 70% and/or an NPV of at least 70%, particularly a sensitivity of at least 75% and/or an NPV of at least 75%, more particularly a sensitivity of at least 76% and/or an NPV of at least 75%, more particularly a sensitivity of at least 83% and/or an NPV of at least 81% (cf. Example 5 below).
- a function Z 6 may for example have a specificity of at least 59% and/or a PPV of at least 54%, more particularly a specificity of at least 70% and/or a PPV of at least 61%, more particularly a specificity of at least 85% and/or a PPV of at least 85%, more particularly a specificity of at least 86% and/or a PPV of at least 86%, more particularly a specificity of at least 89% and/or a PPV of at least 90% (cf. Example 5 below).
- the threshold value of Z 9 may be, for example, from ⁇ 7 to 25, more particularly from ⁇ 7 to 17, more particularly 14.7.
- a function Z 9 may for example have a correct classification rate of at least 66% and/or a value of AUC of at least 0.704, more particularly a correct classification rate of at least 72% and a value of AUC of at least 0.729, more particularly a correct classification rate of at least 80% and a value of AUC of at least 0.865, more particularly a correct classification rate of at least 85% and a value of AUC of at least 0.868 (cf. Example 6 below).
- a function Z 9 may for example have a sensitivity of at least 70% and/or an NPV of at least 70%, particularly a sensitivity of at least 75% and/or an NPV of at least 75%, more particularly a sensitivity of at least 76% and/or an NPV of at least 75% (cf. Example 6 below).
- a function Z 9 may for example have a specificity of at least 59% and/or a PPV of at least 54%, more particularly a specificity of at least 70% and/or a PPV of at least 61%, more particularly a specificity of at least 85% and/or a PPV of at least 85%, more particularly a specificity of at least 86% and/or a PPV of at least 86% (cf. Example 6 below).
- LOGIT Intercept+ k (CXCL10)+ l (AH), [function LOGIT 1 ] with ⁇ 5 ⁇ Intercept ⁇ 1 0.001 ⁇ k ⁇ 0.010 0.010 ⁇ l ⁇ 0.050.
- LOGIT 3 Intercept+ k (CXCL10)+ l (HA), [function LOGIT 3 ] with ⁇ 3.57 ⁇ Intercept ⁇ 2.67 0.003 ⁇ k ⁇ 0.007; and 0.02 ⁇ l ⁇ 0.04 (cf. Example 7, Table 19);
- the threshold value of each of the LOGIT functions of the application may be, for example, 0.5.
- a function of logistic regression of the application may for example have a correct classification rate of at least 66% and/or a value of area under the ROC curve (AUC) of at least 0.704, more particularly a correct classification rate of at least 72% and/or a value of area under the ROC curve (AUC) of at least 0.729, more particularly a correct classification rate of at least 80% and a value of AUC of at least 0.865, more particularly a correct classification rate of at least 80% and/or a value of area under the ROC curve (AUC) of at least 0.882.
- AUC area under the ROC curve
- a function of logistic regression of the application may for example further have a sensitivity of at least 70% and/or an NPV of at least 70%, particularly a sensitivity of at least 75% and/or an NPV of at least 75%, more particularly a sensitivity of at least 76% and/or an NPV of at least 75%.
- a function of logistic regression of the application may for example have a specificity of at least 59% and/or a PPV of at least 54%, more particularly a specificity of at least 70% and/or a PPV of at least 61%, more particularly a specificity of at least 85% and/or a PPV of at least 85%, more particularly a specificity of at least 86% and/or a PPV of at least 86%.
- machine learning can be employed to compare the values of quantification of the biomarkers to their values, or to the distribution of their values, in the predefined reference cohorts according to the stage of hepatic fibrosis, in order to classify said patient into the one of these reference cohorts to which they most probably belong.
- Said machine learning can be learning by a decision tree, more particularly by a CART decision tree.
- the values of quantification obtained for said patient are each compared to a threshold value belonging to, or characteristic of, the marker of that value, by following a decision tree, more particularly a CART decision tree.
- This decision tree (more particularly this CART decision tree), more particularly said threshold values of this tree, can be determined [in advance] by machine learning, more particularly by establishing a decision tree (more particularly by establishing a CART tree), from the values of quantification, or from the distribution of the values of quantification, of said reference cohorts, more particularly of said first and second reference cohorts.
- a decision tree, more particularly a CART decision tree can thus be defined by a series of threshold values ordered according to a decision tree.
- a decision tree using the markers HA and CXCL10 can be defined by three threshold values:
- Such a CART tree is shown in FIG. 12 .
- said machine learning can be a CART decision tree that includes a threshold of decision h for the marker HA and thresholds of decision i and j for the marker CXCL10, said thresholds h, i and j being as follows:
- the threshold of the marker CXCL10 is j, and:
- the CART tree is that of FIG. 12 with:
- the CART tree is that of FIG. 12 with:
- the CART tree is that of FIG. 12 with:
- the CART tree is that of FIG. 12 with:
- a CART tree of the application may for example have a correct classification rate of at least 66%, more particularly at least 72%, more particularly at least 80%, more particularly at least 83%, more particularly at least 84%, more particularly at least 85%.
- a CART tree of the application may for example have a sensitivity of at least 70% and/or an NPV of at least 70%, particularly a sensitivity of at least 75% and/or an NPV of at least 75%, more particularly a sensitivity of at least 76% and/or an NPV of at least 75%, more particularly a sensitivity of at least 77% and/or an NPV of at least 77%, more particularly a sensitivity of at least 78% and/or an NPV of at least 78%, more particularly a sensitivity of at least 82% and/or an NPV of at least 80%.
- a CART tree of the application may for example have a specificity of at least 59% and/or a PPV of at least 54%, more particularly a specificity of at least 70% and/or a PPV of at least 61%, more particularly a specificity of at least 85% and/or a PPV of at least 85%, more particularly a specificity of at least 86% and/or a PPV of at least 86%, more particularly a specificity of at least 89% and/or a PPV of at least 90%, more particularly a specificity of at least 91% and/or a PPV of at least 91%.
- said comparison can be done by combining machine learning and mathematical function, for example, by combining a decision tree and a linear or non-linear function.
- this comparison can be done:
- the process starts with a step of measuring the stiffness of the liver of said patient, for example, using FIBROSCANTM.
- This step allows, for example, to determine whether or not the liver of said patient is affected by cirrhosis (Metavir stage F4). If it is not affected by cirrhosis, i.e., if the stage of the hepatic fibrosis of said patient is lower than a Metavir score F4, a sample of biological fluid can be analyzed to quantify the biological markers selected as described above, more particularly for at least CXCL10 and HA, to determine further the stage of hepatic fibrosis (Metavir score F0 or F1, or else Metavir score F2 or F3). If the liver of said subject is affected by cirrhosis (detected by measuring the stiffness of the liver), the performance of an analysis of a sample of biological fluid seems superfluous and is thus not necessary.
- the application relates to products, reagents or ligands for the detection and/or quantification of the selected biomarkers, more particularly to reagents or ligands that bind specifically to circulating molecules selected as biomarkers as described above, as well as to articles of manufacture, compositions, pharmaceutical compositions, kits, tubes, solid supports comprising such reagents or ligands, as well as to computing systems (especially computer program and computing device product), which are especially suitable for the application of the methods or products of the application.
- computing systems especially computer program and computing device product
- the application relates to a ligand that binds specifically to a biomarker that is a circulating molecule as described above, for example, a ligand that binds specifically to HA, or a ligand that binds specifically to CXCL10 (more particularly to the human protein CXCL10). More particularly, this ligand binds specifically to the circulating form of this molecule, or if there are several thereof, to at least one, to several, or to all circulating forms of this molecule.
- this ligand allows not only to specifically detect the selected biomarker, but also to quantify it.
- this ligand may be a protein, polypeptide, peptide, for example an antibody (monoclonal or polyclonal), an antibody fragment, a recombinant protein, an aptamer, a polysaccharide, a lipid, or a combination of such products, more particularly a protein, an antibody (monoclonal or polyclonal), an antibody fragment or a recombinant protein.
- Such antibodies can be, for example, IgG, IgM, IgE, IgA, IgD, or any other subclass of these immunoglobins
- the antibodies employed in the invention can be fragments of antibodies or artificial derivatives of such fragments, as long as such fragments or derivatives show said property of specific binding.
- Such fragments can be, for example, the fragments Fab, F(ab′)2, Fv, Fab/c, scFv (single chain Fragment variable).
- ligands include antibodies that bind specifically to CXCL10, such as:
- each of these antibodies can be employed as a capture ligand and/or as a detection ligand.
- ligands include proteins that bind specifically to HA, such as the recombinant human protein aggrecan G1-IGD-G2 commercially available from the company R&D SYSTEMS, Inc. (614 McKinley Place NE; Minneapolis, Minn. 55413; USA), under the catalogue reference 1220-PG-025, or the protein HABP (HA binding protein; a protein derived from bovine cartilage) commercially available from UNITED STATES BIOLOGICAL (4 Technology Way, Salem, Mass. 01970, USA) under the catalogue reference H7980-30.
- this recombinant protein can be employed as a capture ligand and/or as a detection ligand.
- Each of said ligands can further include at least one marker for their detection, more particularly at least one marker for detection that is not naturally present in the structure of the ligand, for example, at least one moiety selected from fluorophores (for example ATTOTM 550, ATTOTM 663; ATTO-TEC GmbH, Siegen, Germany), chromophores, enzymes (for example, horseradish peroxydase, alkaline phosphatase), radioactive elements, isotopes of chemical elements.
- fluorophores for example ATTOTM 550, ATTOTM 663; ATTO-TEC GmbH, Siegen, Germany
- chromophores for example, enzymes (for example, horseradish peroxydase, alkaline phosphatase), radioactive elements, isotopes of chemical elements.
- the application also relates to a set or association of at least two ligands, namely a first ligand that binds specifically to one of the selected circulating molecules, and a second ligand that binds specifically to another one of the selected circulating molecules, for example, the set or association of a ligand specific for HA and a ligand specific for CXCL10.
- Each of said first and second ligands may or may not bear a marker for its detection.
- Said first and second ligands may each bear a marker for its detection. They may each bear the same marker, or else bear different markers.
- Said ligands may be in admixture, or else in distinct forms or in forms physically separated from one another, for example, in a combined preparation for simultaneous use, separately or at different times.
- the set or association contains no ligand that would bind to a circulating protein not included in the circulating molecules selected as biomarkers as described above. More particularly, according to this embodiment, the set or association contains no ligand that would bind to a circulating protein other than HA or CXCL10.
- the set or association contains no ligand that would bind to A2M, GMCSF, IL-12, IL-2, MMP13, ALT, GGT, ICAM1, IL-4, CXCL9, VCAM1, RBP4, TIMP1, VIM, SPP1, AST, ApoA1, IL6ST, p14ARF, MMP9, ANGPT2, CXCL11, MMP2, MMP1, S100A4, TIMP1, CHI3L1, COL1A1, CXCL1, CXCL6, IHH, IRF9 or MMP1.
- This set or association may further comprise means for the detection and/or measurement of the viral load in hepatitis virus (for example, HCV and/or HBV and/or HDV).
- means for the detection and/or measurement of the viral load in hepatitis virus for example, HCV and/or HBV and/or HDV.
- the application also relates to an article of manufacture, composition, pharmaceutical composition, kit that each comprise at least one ligand or at least one set or association of ligands of the application.
- the application relates to an article of manufacture, composition, pharmaceutical composition, kit that are each suitable for the multiplex detection of circulating molecules, i.e., molecules contained in acellular form in a (sample of) biological fluid, such as CXCL10 and HA (cf. “Circulating molecules” above).
- circulating molecules i.e., molecules contained in acellular form in a biological fluid, such as CXCL10 and HA (cf. “Circulating molecules” above).
- the application relates to an article of manufacture, composition, pharmaceutical composition, kit that each comprise these first and second ligands as a combination product (or in a combined form, or as a combined preparation), especially for simultaneous, separated or temporally distributed use, more particularly for simultaneous use in time.
- the article of manufacture, composition, pharmaceutical composition or kit contains no ligand that would bind to a circulating protein not included in the circulating molecules selected as biomarkers as described above. More particularly, according to this embodiment, the article of manufacture, composition, pharmaceutical composition or kit contains no ligand that would bind to a circulating protein other than HA or CXCL10.
- the article of manufacture, composition, pharmaceutical composition or kit contains no ligand that would bind to A2M, GMCSF, IL-12, IL-2, MMP13, ALT, GGT, ICAM1, IL-4, CXCL9, VCAM1, RBP4, TIMP1, VIM, SPP1, AST, ApoA1, IL6ST, p14 ARF, MMP9, ANGPT2, CXCL11, MMP2, MMP7, S100A4, TIMP1, CHI3L1, COL1A1, CXCL1, CXCL6, IHH, IRF9 or MMP1.
- the application relates to an article of manufacture suitable for the multiplex detection of molecules contained in acellular form in a (sample of) biological fluid, and comprising a solid support to which the ligands of said molecules are attached.
- Said article of manufacture may be, for example:
- microplates for high throughput screening can be used (cf. Example 10).
- the wells of these microplates have the capability of adsorbing biomolecules, more particularly proteins. They generally have an excellent thermal and chemical stability as well as excellent optical properties. They are generally made of polystyrene and/or polypropylene.
- Each microplate contains a plurality of wells, generally 96 wells. These microplates are devised to receive rows of droplets of said first and second ligands whose volume is lower than 100 nL per droplet (generally 50 nL per droplet). A spotter robot can be used to deposit these rows of droplets.
- Said first and second ligands can be attached, immobilized or grafted on the article of manufacture, or covalently bonded thereto.
- the article of manufacture may be, for example, in the form of an article of manufacture suitable for the multiplex detection of molecules contained in acellular form in a (sample of) biological fluid having a volume lower than or equal to 500 ⁇ L (more particularly lower than or equal to 400 ⁇ L, more particularly lower than or equal to 100 ⁇ L), wherein said solid support comprises a plurality of liquid sample reception zones, said zones being fluidly independent of each other, each being suitable for the reception of a single liquid sample per zone, wherein the maximum volume of liquid sample that each zone can receive does not exceed 500 ⁇ L (more particularly lower than or equal to 400 ⁇ L, more particularly lower than or equal to 100 ⁇ L), and wherein at least one of said liquid sample reception zones comprises both said first ligand and said second ligand (more particularly, said first protein and said second protein).
- Said liquid sample reception zones can, for example, be wells of a plate or microplate for titration and/or high throughput screening, the reception wells of spots on a silicon chip, cylindrical portions of a glass capillary, a membrane, a glass slide, a tube.
- said first ligand and said second ligand (more particularly, said first protein and said second protein) can be attached (or immobilized, or grafted, or covalently bonded) to said solid support in a configuration according to which only one liquid sample with a volume lower than or equal to 500 ⁇ L (more particularly lower than or equal to 400 ⁇ L, more particularly lower than or equal to 100 ⁇ L) can contact both said first protein and said second protein.
- said first ligand (more particularly, said first protein) can be attached (or immobilized, or grafted, or covalently bonded) to said solid support in a first attachment site
- said second ligand (more particularly, said second protein) can be attached (or immobilized, or grafted, or covalently bonded) to said solid support in a second attachment site, wherein said first attachment site is in fluid communication with said second attachment site.
- Each of these first and second ligands can be used as a capture ligand (for example, in the case of detection in sandwich configuration additionally using detection ligands that bear at least one detection marker; cf. composition below, cf. Example 10).
- the ligands of circulating molecules that are contained in an article of manufacture comprise no ligand that would bind to A2M, GMCSF, IL-12, IL-2, MMP13, ALT, GGT, ICAM1, IL-4, CXCL9, VCAM1, RBP4, TIMP1, VIM, SPP1, AST, ApoA1, IL6ST, p14ARF, MMP9, ANGPT2, CXCL11, MMP2, MMP1, S100A4, TIMP1, CHI3L1, COL1A1, CXCL1, CXCL6, IHH, IRF9 or MMP1.
- the ligands of circulating molecules that are contained in an article of manufacture consist of:
- an article of manufacture further comprises instructions (for example, a sheet of instructions) for quantifying the molecules to which the ligands specifically bind, for example, for quantifying CXCL10 and HA, more particularly instructions (for example, a sheet of instructions) for quantifying these molecules and determine a stage or score of hepatic fibrosis from the values of quantification obtained.
- instructions for example, a sheet of instructions for quantifying the molecules to which the ligands specifically bind, for example, for quantifying CXCL10 and HA, more particularly instructions (for example, a sheet of instructions) for quantifying these molecules and determine a stage or score of hepatic fibrosis from the values of quantification obtained.
- Said article of manufacture may further comprise one or more of the following elements:
- the application also relates to a composition suitable for the multiplex detection of molecules, more particularly for the multiplex detection of molecules contained in acellular form in a fluid (such as the molecules CXCL10 and HA), comprising in admixture:
- Said first detection marker can be the same or different from said second detection marker.
- the first ligand and the second ligand are each specific for a different circulating molecule (circulating molecule selected as a biomarker as described above).
- said first ligand is a ligand (for example, a protein) that binds specifically to HA
- said second ligand is a ligand (for example, a protein, more particularly an antibody) that binds specifically to (human) CXCL10, more particularly a ligand (for example, a protein, more particularly an antibody) that binds specifically to one, at least one, several or all circulating forms of the (human) protein CXCL10.
- first and second ligands may, for example, be used as detection ligands (for example, in the case of detection in sandwich configuration with capture ligands; cf. Article of manufacture above; cf. Example 10).
- the application also relates to a kit comprising:
- Said ligands that bind to molecules contained in acellular form in a biological fluid consist of:
- Said first detection marker can be the same or different from said second detection marker.
- the first ligand and the second ligand are each specific for a different circulating molecule (circulating molecule selected as a biomarker as described above).
- said first ligand is a ligand (for example, a protein) that binds specifically to HA
- said second ligand is a ligand (for example, a protein, more particularly an antibody) that binds specifically to (human) CXCL10, more particularly a ligand (for example, a protein, more particularly an antibody) that binds specifically to one, at least one, several or all circulating forms of the (human) protein CXCL10.
- first and second ligands may, for example, be used as detection ligands (for example, in the case of detection in sandwich configuration with capture ligands; cf. Article of manufacture above; cf. Example 10).
- the kit may further comprise an article of manufacture as described above.
- the application also relates to said ligand, set or association of ligands, article of manufacture, composition, pharmaceutical composition, kit for use in a process for detecting or diagnosing a liver disease involving tissue lesions of the liver, more particularly hepatic fibrosis, more particularly for determining the score of hepatic fibrosis of a patient, more particularly hepatic fibrosis, more particularly for determining whether or not the score of hepatic fibrosis of a patient has passed beyond that of a mild fibrosis, more particularly for determining whether the hepatic fibrosis of a patient has a Metavir fibrosis score of at most F1, or else of at least F2.
- the application also relates to said ligand, set or association of ligands, article of manufacture, composition, pharmaceutical composition, kit for use in a process for the treatment of a liver disease involving tissue lesions of the liver, more particularly hepatic fibrosis.
- Such use may comprise, in particular:
- This process may further comprise that the treatment is not administered if, or as long as, this score does not pass beyond that of a mild fibrosis.
- This treatment may be, for example:
- the duration of the treatment may be, for example, at least 24 weeks, for example, 24 weeks for a liver disease of HCV of genotype 2 or 3, or 48 week for a liver disease of HCV of genotype 1, 4 or 5, or for a patient who has not responded to the treatment by the end of 24 weeks.
- the application also relates to a medicament or medicamental association for the treatment of a liver disease involving damage of the liver tissue, more particularly hepatic fibrosis (such as standard interferon or pegylated interferon in a monotherapy, or in a pluritherapy involving one or more other active ingredients, especially ribavirin), for being used in the treatment process of the invention.
- hepatic fibrosis such as standard interferon or pegylated interferon in a monotherapy, or in a pluritherapy involving one or more other active ingredients, especially ribavirin
- liver disease has its normal meaning, i.e., a damaged liver, more particularly a damage of the liver tissue, more particularly lesions of the liver, especially hepatic fibrosis.
- the application relates more particularly to chronic liver diseases (chronic aggressions of the liver of 6 months or more).
- liver fibrosis Different diseases cause and/or lead to lesions of the liver, such as hepatic fibrosis.
- hepatic fibrosis there may be mentioned:
- the application is more particularly suitable for viral hepatitis, especially viral hepatitis C (HCV) and/or virus B (HBV) and/or virus D (HDV), especially viral hepatitis of at least HCV (and optionally HBV and/or HDV).
- HCV viral hepatitis C
- HBV virus B
- HDV virus D
- the application also relates to a computer program product intended for being stored in a memory of a processing unit, or on an immobile data carrier intended for cooperating with a reader of said processing unit.
- the computer program product comprises instructions for performing a process or using a product of the application, especially for performing a statistical analysis suitable for performing a process of the invention [especially suitable for the (multivariate) statistical analysis of the selected biomarkers], and/or for the constriction of a (multivariate) classification model suitable for performing a process or using a product of the invention.
- the application also relates to a computer installation, computer device, computer, comprising a processing unit in the memory of which there are stored or registered:
- Example 1 Determination and Application of HA+CXCL10 Combinations to a Population of Patients Whose Degree of Fibrosis is Determined by Hepatic Biopsy Puncture (PBH)
- HCV hepatitis C virus
- hepatic fibrosis score of these patients was determined by hepatic biopsy puncture (PBH). This population consisted of 118 patients, among whom 73 showed a fibrosis score F1, and 45 showed a fibrosis score F2 (score determined by PBH according to the Metavir F scores system, two independent readings by an approved pathologist). The studies performed were approved by the local ethics committee in accordance with the Helsinki declaration. All the patients gave their written informed consent.
- the serum concentrations of the protein CXCL10 and of hyaluronic acid (HA) were measured in the serum of these patients using commercially available ELISA kits (sandwich in solid phase).
- the kit employed was the kit QUANTIKINE® HUMAN CXCL10/IP-10 ELISA, commercially available from R&D Systems, Inc. (614 McKinley Place NE, Minneapolis, Minn. 55413, USA), under the catalogue reference DIP100.
- kits for the serum concentration of hyaluronic acid (HA), the kit employed was the kit HYALURONAN QUANTIKINE® ELISA, commercially available from R&D Systems, Inc. (614 McKinley Place NE, Minneapolis, Minn. 55413, USA), under the catalogue reference DHYALO.
- HYALURONAN QUANTIKINE® ELISA commercially available from R&D Systems, Inc. (614 McKinley Place NE, Minneapolis, Minn. 55413, USA), under the catalogue reference DHYALO.
- FIG. 1 and FIG. 2 The distribution of the concentrations of molecules CXCL10 and HA according to the hepatic fibrosis score is presented in FIG. 1 and FIG. 2 , respectively.
- the values of serum concentrations of CXCL10 and HA were combined by the mROC method, in order to establish a discriminating rule allowing to discriminate the patients showing a significant fibrosis (Metavir hepatic fibrosis score ⁇ F2) from those showing a non-significant fibrosis (Metavir hepatic fibrosis score ⁇ F2).
- the values of serum concentrations of CXCL10 and HA were also combined by the mROC method with clinical parameters, such as the body mass index (BMI), the age at the sampling date (Age), and the viral load of the patient at the sampling date (VL), in order to establish a discriminating rule allowing to discriminate the patients showing a significant fibrosis (Metavir hepatic fibrosis score ⁇ F2) from those showing a non-significant fibrosis (Metavir hepatic fibrosis score ⁇ F2).
- BMI body mass index
- Age age at the sampling date
- VL viral load of the patient at the sampling date
- the mROC method is the multivariate receiver operating characteristics method as described, in particular, by Kramar et al. 1999 and Kramar et al. 2001.
- HA serum concentration of hyaluronic acid, expressed in ng/mL
- CXCL10 serum concentration of protein CXCL10, expressed in pg/mL
- Age age of the patient at the sampling date
- BMI body mass index of the patient at the sampling date (mass/height 2 )
- VL viral load of the patient at the sampling date, expressed in 10 3 copies per mL
- AUC of 0.704 for the combination HA+CXCL10 without other markers [AUC of 0.729 for HA+CXCL10+BMI+Age, and AUC of 0.731 for HA+CXCL10+BMI+Age+VL], versus
- NPV of 81% for the combination HA+CXCL10 without other markers [sensitivity of 82% or 83% for the combination HA+CXCL10+BMI+Age or HA+CXCL10+BMI+Age+VL], versus
- HA HA with CXCL10
- additional markers clinical or anatomical marker(s) and/or virological marker(s)
- Example 2 Comparison with Non-Invasive Tests Available to the Public (Same Population of Patients as in Example 1)
- Example 1 The 118 patients of Example 1 were tested for comparison with tests of measuring the stage of hepatic fibrosis that are additionally available to the public (tests that are commercially available or described in scientific articles).
- test HEPASCORETM the test HEPASCORETM
- test FIBROTESTTM the test APRI
- test FORNS the test FORNS
- test HEPASCORETM is commercialized by QUEST DIAGNOSTICS (3 Giralda Farms, Madison, N.J. 07940, USA), and is described in Adams et al. 2005.
- test FIBROTESTTM is commercialized by BIOPREDICTIVE (40, rue du Bac, 75007 Paris, France), and is described in Imbert-Bismut et al. 2001.
- test APRI is described in Wai et al. 2003.
- test FORNS is described in Forns et al. 2002.
- the test SHASTA is described in Kelleher et al. 2005.
- test FIBROTESTTM The one of these tests that is most often used currently is the test FIBROTESTTM.
- A2M concentration of alpha 2 macroglobulin
- GGT concentration of gamma glutamyl transpeptidase
- APOA1 concentration of apolipoprotein A1
- Hapto concentration of haptoglobin
- Bilirubin concentration of total bilirubin
- Age age at the date of sampling
- Sex sex of the patient (female or male)
- Table 5 further shows a comparison of these results with those obtained with the combination of the biomarkers HA+CXCL10 (combinations HA+CXCL10 of Example 2 above) for the same population of patients.
- HA HA with CXCL10 allows to achieve diagnostic performances at least comparable with, if not better than, the tests currently available to the public, especially in terms of global rate of correct classification, rate of correct classification, sensitivity and NPV.
- the combination of HA with CXCL10 (optionally combined with one or more additional markers (clinical or anatomical marker(s) and/or virological marker(s))) has, in particular:
- the combination of HA with CXCL10 (optionally combined with one or more additional markers (clinical or anatomical marker(s) and/or virological marker(s))) has, in particular, the advantage of requiring the determination of only two biomarkers (HA and CXCL10), while for the test HEPASCORETM, four biomarkers must be determined (A2M, GGT, Bilirubin and HA). It is also observed that the combination of HA with CXCL10 (optionally combined with one or more additional markers (clinical or anatomical marker(s) and/or virological marker(s))) shows an improved sensitivity performance over the test HEPASCORETM.
- HA with CXCL10 shows diagnostic performances at least as satisfactory as those of the two tests that are currently most often used, namely HEPASCORETM and FIBROTESTTM, while it is much more simple to perform (and thus quicker, less expensive, and safer).
- Example 3 Determination and Application of HA+CXCL10 Combinations to a Population of Patients Independent of that of Example 1
- Example 1 A population of patients independent of that of Example 1 was created. This independent population consisted of 310 patients of the hospital Haut-Levêque (1, avenue Magellan; 33600 Pessac; France) showing a chronic hepatitis as a result of an infection with the hepatitis C virus (HCV), and covering all, or the majority, of the HCV genotypes.
- Haut-Levêque avenue Magellan; 33600 Pessac; France
- HCV hepatitis C virus
- hepatic biopsy puncture (PBH) is virtually no longer used currently, the stage of fibrosis has been determined by using a combination of non-invasive tests based on different principles (blood tests and imaging), as recommended by the scientific community (cf. Castera 2012).
- the algorithm of multivariate classification of Castera et al. is the one described in Castera et al. 2010 and Castera et al. 2014. It is based on the agreement between the results of FIBROTESTTM (blood test), and of FIBROSCANTM (imaging).
- This algorithm allows the classification of the patients into two classes (absence or presence of significant fibrosis) when the non-invasive tests (FIBROTESTTM and FIBROSCANTM) are in agreement.
- the algorithm of Castera et al. has been modified by adding a second level of analysis.
- This second level of analysis aims at samples that provide incongruent results by the tests FIBROTESTTM and FIBROSCANTM.
- This second level of analysis performs several non-invasive tests, in this case FIBROTESTTM (FT), FIBROSCANTM (FS), HEPASCORETM (HS), APRI and FORNS.
- the test FIBROSCANTM is an imaging method using transient elastography, which allows to determine the stiffness of the liver (expressed in kPa equivalent of fibrosis); cf. Castera et al. 2005.
- the device FIBROSCANTM is commercialized by the company ECHOSENS (30 place d'Italie, 75013 Paris, France).
- At least three of these tests are applied to the samples that provided incongruent results on the first level of analysis.
- the stage of fibrosis obtained with each of these tests has thus been determined.
- the stage identified by the majority of these tests was assigned to the analyzed sample. If there is no majority, the modified algorithm envisages the assignment of the label “stage of fibrosis not determined” to the sample.
- the thus modified classification algorithm (or model) is shown in FIG. 3 . It allows the patients to be classified into two classes according to their stage of fibrosis: significant fibrosis (Metavir hepatic fibrosis score ⁇ F2) and non-significant fibrosis (Metavir hepatic fibrosis score ⁇ F2), without recurring to a PBH.
- the serum concentrations of HA and CXCL10 were measured as described in Example 1 above.
- the distribution of these concentrations according to the degree of hepatic fibrosis (Metavir score ⁇ F2 or ⁇ F2) is shown in FIG. 4 (CXCL10) and FIG. 5 (HA).
- the values of serum concentrations of CXCL10 and HA were combined by the mROC method, in order to establish a discriminating rule allowing to discriminate the patients showing a significant fibrosis (Metavir score ⁇ F2) from those showing a non-significant fibrosis (Metavir score ⁇ F2).
- the values of serum concentrations of CXCL10 and HA were also combined by the mROC method with clinical parameters, such as the body mass index at the sampling date (BMI), and the viral load of the patient at the sampling date (VL), in order to establish a discriminating rule allowing to discriminate the patients showing a significant fibrosis (Metavir score ⁇ F2) from those showing a non-significant fibrosis (Metavir score ⁇ F2).
- HA serum concentration of hyaluronic acid, expressed in ng/mL
- CXCL10 serum concentration of protein CXCL10, expressed in pg/mL
- Age age of the patient at the sampling date
- BMI body mass index of the patient at the sampling date (mass/height 2 )
- VL viral load of the patient at the sampling date, in IU/mL
- HA HA with CXCL10 (optionally combined with one or more additional markers (clinical or anatomical marker(s) and/or virological marker(s))) allows to obtain excellent results of classification (rate of unclassified patients, sensitivity, specificity, PPV and NPV), with only two biomarkers and without PBH.
- additional markers clinical or anatomical marker(s) and/or virological marker(s)
- the performances of Se, Spe, PPV, NPV, correct classification rate and AUC of the combination HA+CXCL10 are superior to the performances of marker HA alone as well as to those of marker CXCL10 alone.
- the performances of the combination HA+CXCL10 (optionally combined with one or more additional markers (clinical or anatomical marker(s) and/or virological marker(s))) thus go beyond a simple juxtaposition of the individual performances of each of the two markers of the combination.
- This juxtaposition test is based on the fact that the simple addition of the respective performances of the biomarkers HA and CXCL10 corresponds to the addition of the information provided by HA to that provided by CXCL10: according to this juxtaposition test, the test is positive (fibrosis score greater than or equal to F2) when at least one of the two biomarkers indicates that the test is positive (fibrosis score greater than or equal to F2).
- Fibrosis score given by Fibrosis score given by score given by a HA test alone (cf. CXCL10 test alone (cf. test that juxtaposes HA Example 3) Example 3) to CXCL10 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F2 ⁇ F
- the correct classification rate which allows to evaluate the performances of the biomarkers generally, is very much better with the combination of the two biomarkers (83%) as compared to their juxtaposition (75%).
- Example 1 a synergistic effect was also observed in Example 1 above (population of 118 patients).
- the AUC value is the value of the area under the ROC curve.
- the value of the correct classification rate is the value of the percentage of correctly classified patients.
- FIGS. 13A, 13B, 14A and 14B The results are shown in FIGS. 13A, 13B, 14A and 14B .
- FIGS. 13A and 13B present the values of the differences of AUC and precision that have been measured between, on the one hand, the mROC discriminating rule with “fix coefficients” (or “coef fix”) and, on the other hand, the mROC discriminating rule with “optimized coefficients” (or “coef optim”) in the form of histograms.
- the mROC discriminating rule employed the combination of HA+CXCL10.
- FIGS. 13A and 13B show that there is little difference between the performances when either fix coefficients of coefficients optimized for the studied population are applied.
- FIGS. 13A and 13B demonstrate that the performances are not due to the coefficients, but due to the markers themselves, since irrespective of the coefficients employed (optimized coefficients or fix coefficients), the performances obtained are comparable.
- FIGS. 14A and 14B present the values of the differences of AUC and correct classification rate that have been measured for the mROC discriminating rule between, on the one hand, the combination of HA+CXCL10 and, on the other hand, the HA marker alone in the form of histograms.
- Example 4 Comparison with Non-Invasive Tests Available to the Public (Same Population of Patients as in Example 3)
- Example 3 The 310 patients of Example 3 were tested for comparison with tests of measuring the stage of hepatic fibrosis that are additionally available to the public (tests that are commercially available or described in scientific articles).
- test HEPASCORETM the test HEPASCORETM
- test FIBROTESTTM the test APRI
- test FORNS the test FORNS
- test FIBROSCANTM Five tests were performed: the test HEPASCORETM, the test FIBROTESTTM, the test APRI, the test FORNS and the test FIBROSCANTM.
- test HEPASCORETM is commercialized by QUEST DIAGNOSTICS (3 Giralda Farms, Madison, N.J. 07940, USA), and is described in Adams et al. 2005.
- test FIBROTESTTM is commercialized by BIOPREDICTIVE (40, rue du Bac, 75007 Paris, France), and is described in Imbert-Bismut et al. 2001.
- test APRI is described in Wai et al. 2003.
- test FORNS is described in Forns et al. 2002.
- the test FIBROSCANTM is an imaging method using transient elastography, which allows to determine the stiffness of the liver (expressed in kPa equivalent of fibrosis); cf. Castera et al. 2005.
- the device FIBROSCANTM is commercialized by the company ECHOSENS (30 place d'Italie, 75013 Paris, France).
- A2M concentration of alpha 2 macroglobulin
- GGT concentration of gamma glutamyl transpeptidase
- APOA1 concentration of apolipoprotein A1
- Hapto concentration of haptoglobin
- Bilirubin concentration of total bilirubin
- Age age at the date of sampling
- Sex sex of the patient (female or male)
- Table 12 below further shows a comparison of these results with those obtained with the combination of the biomarkers HA+CXCL10 (combinations HA+CXCL10 of Example 3 above) for the same population of patients.
- the combination of HA with CXCL10 (optionally combined with one or more additional markers (clinical or anatomical marker(s) and/or virological marker(s))) has, in particular:
- the combination of HA with CXCL10 (optionally combined with one or more additional markers (clinical or anatomical marker(s) and/or virological marker(s))) has, in particular, the advantage of requiring the determination of only two biomarkers (HA and CXCL10), while for the test HEPASCORETM, four biomarkers must be determined (A2M, GGT, Bilirubin and HA).
- Example 4 the performances of the different non-invasive tests measured here with the tests HEPASCORETM, FIBROTESTTM, FIBROSCANTM, APRI and FORNS (Example 4) are probably favored, given that these tests are part of the references used for determining the stage of fibrosis of the patients (cf. Example 3 above; cf. FIG. 3 ). This was not the case for the comparative measurements of Example 2 above (stage of fibrosis determined by PBH).
- HA HA with CXCL10
- additional markers clinical or anatomical marker(s) and/or virological marker(s)
- HA serum concentration of hyaluronic acid, expressed in ng/mL
- CXCL10 serum concentration of protein CXCL10, expressed in pg/mL
- FS measure of stiffness of liver expressed in kPa equivalent fibrosis (FIBROSCANTM)
- Example 6 Determination and Application of HA+CXCL10 Combinations for a Fine Classification of Fibrosis Stages (F0-F1/F2-F3/F4) (Same Population of Patients as in Example 3)
- the modified algorithm comprises a second analysis level (cf. FIG. 6 ) using the combination of several non-invasive tests, in this case FIBROSCANTM (FS), HEPASCORETM (HS), APRI and FORNS.
- FIBROSCANTM FS
- HEPASCORETM HS
- FORNS FORNS
- test FIBROSCANTM was described in Example 3 above.
- stage identified by the majority of these tests was assigned to the analyzed sample. If there is no majority, the modified algorithm envisages the assignment of the label “stage of fibrosis not determined” to the sample.
- the serum concentrations of HA and CXCL10 were measured as described in Example 1 above.
- the distribution of these concentrations according to the degree of hepatic fibrosis is shown in FIG. 7 (CXCL10) and FIG. 8 (HA).
- the measurements of FIBROSCANTM were compared to the threshold value recommended by this test to classify the stage of hepatic fibrosis with respect to the Metavir score F4, namely a threshold of 12.5 kPa.
- the patients whose Metavir hepatic fibrosis score was thus determined to be lower than F4 were previously classified by means of the combination of markers HA+CXCL10 (2nd level of analysis).
- the values of serum concentrations of CXCL10 and HA were combined by the mROC method in order to establish a discriminating rule allowing the stage of fibrosis to be determined (Metavir score F0-F1 or F2-F3).
- the values of serum concentrations of CXCL10 and HA were also combined:
- HA serum concentration of hyaluronic acid, expressed in ng/mL
- CXCL10 serum concentration of protein CXCL10, expressed in pg/mL
- Age age of the patient at the sampling date
- BMI body mass index at the sampling date (mass/height 2 )
- VL viral load of the patient at the sampling date, in IU/mL
- HA HA with CXCL10
- additional markers clinical or anatomical marker(s) and/or virological marker(s)
- the mROC method is a method of multivariate classification based on a linear function.
- cf Example 1.
- cf examples of mROC linear functions
- the methods of multivariate classification that, like the mROC method, are based on a linear function are not the only methods that can be performed to establish a model of classification of patients using the combination of biomarkers CXCL10 and HA.
- the population of patients is identical with that presented in Example 3 above. This population consisted of 310 patients whose state of fibrosis was determined according to the classification algorithm shown in FIG. 3 . The characteristics of these patients are shown in Table 6 above.
- a learning group and a validation group were drawn randomly with 10 replacements among the population of 310 patients.
- the learning group consisted of 2 ⁇ 3 of the patients, i.e., 207 patients, and the validation group consisted of 1 ⁇ 3 of the patients, i.e., 103 patients.
- the classification models CART and LR were established on learning groups (cf. Table 19 below).
- the performances, more particularly the synergistic effect, of the combination of HA and CXCL10 do not depend on the nature of the method of multivariate classification employed.
- the methods mROC, CART and LR were also applied to the total population of 310 patients of Example 3. Examples of discriminating rules obtained on the population of 310 patients for the methods CART and LR are presented in Table 22 below (Metavir hepatic fibrosis score lower than F2, or Metavir hepatic fibrosis score higher than or equal to F2).
- the mROC functions employed are those of Example 3 above (cf. Table 7 above).
- HA serum concentration of hyaluronic acid, in ng/mL
- CXCL10 serum concentration of protein CXCL10, in pg/mL
- the ranges of values of the parameters and thresholds employed by the classification methods can be calculated by using the Bootstrap method (cf. Efron 1979). In accordance with this method, a random population of 310 patients was drawn randomly 1000 times in succession.
- LOGIT Intercept+ k (CXCL10)+ l (AH), [function LOGIT 1 ] with ⁇ 5 ⁇ Intercept ⁇ 1 0.001 ⁇ k ⁇ 0.010 0.010 ⁇ l ⁇ 0.050.
- the set of different CART trees can be formulated as follows:
- the values of the parameters can be selected in accordance with the indicated ranges of values.
- the mROC function or LR function or CART tree resulting therefrom can be tested on a reference population, for example, on a population of 310 patients as described in Example 3.
- the mROC function or LR function or CART tree actually leads to the expected or desired performances, especially to the expected or desired value of AUC and/or value of correct classification rate.
- the performances can be measured on a population of HCV-positive patients having a stage of hepatic fibrosis covering at least stages F1 to F3 (Metavir score), such as the population of 118 patients of Example 1 or the population of 310 patients of Example 3.
- the associated threshold can, for example, be the threshold maximizing the Youden index, ⁇ , whose value is a real number going from ⁇ 7 to 25.
- the value of the correct classification rate is the value of the percentage of correctly classified patients.
- the AUC value is the value of the area under the ROC curve.
- FIG. 17 demonstrates that for 1000 different populations, the performances of the combination HA+CXCL10 are robust (values of AUC within a range of 0.84 to 0.96, which are high performances).
- FIG. 16B ordinate, sensitivity; abscissa, specificity; curves of Z1 and Z4.
- Example 10 Combination of HA with CXCL10 in Multiplex Mode
- spot contains a capture ligand, namely either an anti-human CXCL10 capture ligand or an anti-human HA capture ligand.
- the capture ligand bonds to the surface of the well.
- the anti-human CXCL10 capture ligand is a mouse monoclonal anti-human CXCL10 antibody commercially available from R&D SYSTEMS, Inc. (614 McKinley Place NE; Minneapolis, Minn. 55413; USA) under the catalogue reference MAB266 (clone 33036, class IgG1).
- the anti-human HA capture ligand is a recombinant human protein aggrecan protein G1-IGD-G2 commercially available from the company R&D SYSTEMS, Inc. (614 McKinley Place NE; Minneapolis, Minn. 55413; USA) under the catalogue reference 1220-PG-025.
- the samples are serum or plasma samples from patients infected by HCV. They originate from the hospital Haut-Levêque (1, avenue Magellan; 33600 Pessac; France) or from the hospital Beaujon (100, boulevard du traditional Leclerc; 92110 Clichy; France).
- the patients include, for example, patients of Example 3 or Example 1.
- CXCL10 A standard range of CXCL10 was prepared by diluting a recombinant CXCL10 protein (PEPROTECH; Princeton Business Park; 5 Crescent Avenue; P.O. Box 275; Rocky Hill, N.J. 08553; USA; reference catalogue 300 ⁇ 12) in a PBS buffer solution (phosphate buffered saline) at pH 7.4 containing bovine serum albumin at 5%, glycerol at 20%, and a preservative at 0.1% (PROCLIN® 300; product SUPELCO commercially available from SIGMA-ALDRICH CHIMIE; 38297 Saint-Quentin-Fallavier CEDEX; France).
- PBS buffer solution phosphate buffered saline
- bovine serum albumin at 5%
- glycerol glycerol
- preservative 0.1%
- a standard range of HA was prepared by diluting a recombinant human hyaluronic acid (R&D SYSTEMS; Minneapolis; USA) in a PBS buffer solution at pH 7.4 containing bovine serum albumin at 5%, glycerol at 20%, and the preservative PROCLIN® 300 at 0.1%.
- each well of the microplate there are successively distributed (on each spot): 40 ⁇ L of the PBS buffer solution at pH 7.4 containing bovine serum albumin at 5%, glycerol at 20%, and the preservative PROCLIN® 300 at 0.1%; and
- the mixture is incubated at 37° C. with stirring for 40 min.
- washing solution TRIS 10 mM at pH 7.4 containing NaCl 218 mM, TWEEN® 20 (SIGMA-ALDRICH CHIMIE; 38297 Saint-Quentin-Fallavier CEDEX; France; catalogue reference 2287) at 0.1%, and the preservative PROCLIN® 300 at 0.002%.
- each reaction well there are subsequently distributed (onto each spot) 50 ⁇ L of a PBS buffer solution 10 mM at pH 7.4 containing NaCl at 150 mM, glycerol at 10%, mouse IgG (MERIDIAN LIFE SCIENCE, Inc.; 5171 Wilfong Road; Memphis Tenn. 38134; USA; catalogue reference A66185M) at 50 g/L, the preservative PROCLIN® 300 at 0.1%, as well as a ligand for the detection of human CXCL10 at a concentration of 0.2 ⁇ g/mL, and a ligand of human HA at a concentration of 0.2 to 0.5 ⁇ g/mL.
- a PBS buffer solution 10 mM at pH 7.4 containing NaCl at 150 mM, glycerol at 10%, mouse IgG (MERIDIAN LIFE SCIENCE, Inc.; 5171 Wilfong Road; Memphis Tenn. 38134; USA; catalogue reference A66185M) at 50 g/L, the pre
- the ligand for the detection of CXCL10 is a biotin-coupled goat polyclonal anti-human CXCL10 antibody available from R&D SYSTEMS, Inc. (614 McKinley Place NE; Minneapolis, Minn. 55413; USA; catalogue reference BAF266).
- the ligand for the detection of human HA is the biotin-coupled recombinant protein aggrecan G1-IGD-G2 available from R&D SYSTEMS, Inc. (614 McKinley Place NE; Minneapolis, Minn. 55413; USA, under the catalogue reference 1220-PG-025.
- the mixture is incubated at 37° C. with stirring for 15 min.
- washing solution TRIS 10 mM at pH 7.4 containing NaCl 218 mM, TWEEN® 20 (SIGMA-ALDRICH CHIMIE; 38297 Saint-Quentin-Fallavier CEDEX; France; catalogue reference 2287) at 0.1%, and the preservative PROCLIN® 300 at 0.002%.
- the reporter namely (onto each spot) 50 ⁇ L of a citrate buffer solution 50 mM, pH 6.7, containing NaCl 150 mM, EDTA 5.6 mM, TRITON® 2%, sheep serum 10%, mouse IgG 500 ⁇ g/mL, the preservative PROCLIN® 300 0.5%, cow's milk (100% skimmed) 15%, glycerol 10%, NaN 3 0.095%) and further containing streptavidin coupled to horseradish peroxydase (streptavidin-POD, available from ROCHE DIAGNOSTICS GmbH; Roche Applied Science; 68298 Mannheim; Germany; catalogue reference 11089153001) (cf. Nakane and Kawaoi 1974) at 3 ⁇ g/mL.
- streptavidin-POD available from ROCHE DIAGNOSTICS GmbH; Roche Applied Science; 68298 Mannheim; Germany; catalogue reference 11089153001
- the mixture is incubated at 37° C. with stirring for 15 min.
- the mixture is incubated at 37° C. with stirring for 1 min.
- the acquisition of the luminescence signal is realized during 180 seconds.
- the concentration of biomarkers CXCL10 and HA is recalculated for each sample by means of the recombinant CXCL10 standard range for CXCL10 in pg/mL and of the recombinant HA standard range for HA in ng/mL.
- the ligand for the detection of human CXCL10 and the ligand for human HA cannot be placed each in different spots, but on the contrary both in the same spot.
- the detection is realized by differentiating the bonded CXCL10 molecules from the bonded HA molecules, for example, not in chemiluminescence, but in fluorescence (by means of two different fluorophores, one borne by the CXCL10 detection ligand, the other one borne by the HA detection ligand).
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Physics & Mathematics (AREA)
- Medical Informatics (AREA)
- Biotechnology (AREA)
- General Health & Medical Sciences (AREA)
- Data Mining & Analysis (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Urology & Nephrology (AREA)
- Chemical & Material Sciences (AREA)
- Epidemiology (AREA)
- Bioinformatics & Computational Biology (AREA)
- Theoretical Computer Science (AREA)
- Spectroscopy & Molecular Physics (AREA)
- Evolutionary Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Software Systems (AREA)
- Artificial Intelligence (AREA)
- Bioethics (AREA)
- Biophysics (AREA)
- Computer Vision & Pattern Recognition (AREA)
- Public Health (AREA)
- Databases & Information Systems (AREA)
- Evolutionary Computation (AREA)
- Cell Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Microbiology (AREA)
- Pathology (AREA)
- General Physics & Mathematics (AREA)
- Medicinal Chemistry (AREA)
- Food Science & Technology (AREA)
- Biochemistry (AREA)
- Analytical Chemistry (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
Description
-
- the stages for which the fibrosis is mild at most (Metavir fibrosis score F0 or F1);
- advanced fibrosis stages (Metavir fibrosis score F2 or F3).
-
- in Example 1 (cf. Table 3),
- in Example 3 (cf. Tables 8 and 10), and
- in Example 7 (cf. Tables 20 and 21).
-
- Example 7, especially Tables 20, 21 and 23,
- Example 8, especially Table 24.
-
- methods comprising the quantification of the selected biomarkers (such as CXCL10 and HA, in particular);
- products or reagents specifically suitable for such quantification;
- articles of manufacture, compositions, pharmaceutical compositions, kits, tubes, solid supports comprising such products or reagents, as well as
- computing systems (especially computer program and computing device product), which are especially suitable for the application of the means of the invention.
-
- on the one hand, when the applied mROC discriminating rule has those coefficients initially determined on the population of 310 patients (“fix coefficients” or “coef fix”); and
- on the other hand, when the applied mROC discriminating rule has those coefficients determined for each of the 1000 subpopulations (“optimized coefficients” or “coef optim”).
AUC=area under the ROC curve
correct classification rate=percentage of correctly classified patients.
-
- absence of fibrosis,
- portal fibrosis without septum,
- portal fibrosis with septums (i.e., with at least one or more septums),
- septal fibrosis without cirrhosis, and
- cirrhosis.
| TABLE 25 |
| Correspondence between the stages of fibrosis and the Metavir fibrosis |
| scores. |
| Stage of fibrosis | Metavir fibrosis score | ||
| Absence of fibrosis | F0 | ||
| Portal fibrosis without septum | F1 | ||
| Portal fibrosis with septums | F2 | ||
| Septal fibrosis without cirrhosis | F3 | ||
| Cirrhosis | F4 | ||
| TABLE 26 |
| Correspondence between the stages of fibrosis and Ishak's fibrosis |
| scores. |
| Stage of fibrosis | Ishak's fibrosis score | ||
| Absence of fibrosis | F0 | ||
| Portal fibrosis without septum | F1/F2 | ||
| Portal fibrosis with septums | F3 | ||
| Septal fibrosis without cirrhosis | F4 | ||
| Cirrhosis | F5/F6 | ||
-
- the protein CXCL10 (complete form and cleaved forms),
- hyaluronic acid or hyaluronan (HA),
- gamma-glutamyl transpeptidase (GGT),
- aspartate aminotransferase (AST),
- alanine aminotransferase (ALT),
- apolipoprotein A1 (ApoA1),
- alpha-2-macroglobuline (A2M),
-
inhibitor 1 of metalloproteinase (TIMP1), - vimentin (VIM),
- secreted phosphoprotein-1 (SPP1),
- interleukin-6 signal transducer (IL6ST),
- cyclin-dependent kinase 2A inhibitor (p14ARF),
- matrix metallopeptidase 9 (MMP9),
- angiopoietin 2 (ANGPT2),
-
chemokine ligand 11 motif CXC (CXCL11), - matrix metallopeptidase 2 (MMP2),
- matrix metalloproteinase 7 (MMP7),
- S100 calcium binding protein A4 (S100A4),
-
inhibitor 1 of metalloproteinase (TIMP1), - chitinase-3 type protein 1 (CHI3L1),
- collagen alpha-1(I) chain (COL1A1),
-
chemokine 1 of the growth-controlling protein alpha motif CXC (CXCL1), - chemokine ligand 6 motif CXC (CXCL6),
- “Indian hedgehog” protein (IHH),
- interferon-stimulated transcription factor 3G (IRF9),
- matrix metalloproteinase 1 (MMP1).
-
- in Example 1 (cf. Table 3),
- in Example 3 (cf. Tables 8 and 10), and
- in Example 7 (cf. Tables 20 and 21).
| [SEQ ID NO: 1] |
| MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLE |
| IIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
| or |
| [SEQ ID NO: 2] |
| MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLE |
| IIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKEMSKRSP, |
wherein these two sequences differ by only one amino acid positioned in the C-terminal portion (ERS in the C-terminal portion of SEQ ID NO: 1 versus EMS in the C-terminal portion of SEQ ID NO: 2).
| [SEQ ID NO: 3] | |
| MNQTAILICCLIFLTLSGIQG, |
-
- a form called agonist, constituted of 77 amino acids;
- a form called antagonist, constituted of 75 amino acids; and
- a form resulting from cleavage after secretion (proteolytic cleavage by keratinocytes), constituted of 73 amino acids.
| [SEQ ID NO: 6] |
| LSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEK |
| RCLNPESKAIKNLLKAVSKERSKRSP, |
| or |
| [SEQ ID NO: 7] |
| LSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEK |
| CLNPESKAIKNLLKAVSKEMSKRSP, |
| [SEQ ID NO: 8] |
| VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGE |
| KRCLNPESKAIKNLLKAVSKERS, |
| or |
| [SEQ ID NO: 9] |
| VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGE |
| KRCLNPESKAIKNLLKAVSKEMS, |
-
- SEQ ID NO: 4 and/or NO: 5,
- SEQ ID NO: 6 and/or NO: 7, and
- SEQ ID NO: 8 and/or NO: 9.
-
- the formed elements of the blood (for example, the platelets),
- the clinical or anatomical characteristics (or markers) of said patient, and
- the virological characteristics (or markers) of said patient.
-
- the clinical or anatomical characteristics (or markers) of said patient, and
- the virological characteristics (or markers) of said patient.
-
- the age of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done;
- the age of said patient at the date when the diagnostics of an infection by a hepatitis virus was done;
- the age of said patient at the date when they received an antihepatitis therapy for the first time;
more particularly the age of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done.
-
- the BMI of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done;
- the BMI of said patient at the date when the diagnostics of an infection by a hepatitis virus was done;
- the BMI of said patient at the date when they received an antihepatitis therapy for the first time;
more particularly the BMI of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done.
-
- the age of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done;
- the BMI of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done;
- the sex of said patient (male or female), and
- the stiffness of the liver of said patient (FS);
more particularly: - the age of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done;
- the BMI of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done; and
- the stiffness of the liver of said patient (FS).
-
- the age of said patient (more particularly the age of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done);
- the BMI of said patient (more particularly the BMI of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done); and
- the stiffness of the liver of said patient (FS).
-
- the nature of the virus(es) contained in the blood of said patient;
- the viral load of said patient (VL), more particularly their viral load of hepatitis virus;
- the genotype(s) of said hepatitis virus(es) with which said patient is infected.
-
- zero, one, two or three (different) clinical or anatomical markers as described above; and
- zero or one virological marker as described above.
-
- zero clinical or anatomical marker as described above, or else one, two or three (different) markers selected from the age, BMI and stiffness of the liver; and
- zero virological marker as described above, or else the virological marker viral load.
Selected Biological Markers:
-
- six, five, four, three or two different circulating molecules as described above, more particularly five, four, three or two circulating molecules as described above, more particularly four, three or two circulating molecules as described above, more particularly three or two circulating molecules as described above, more particularly two circulating molecules as described above, said different circulating molecules comprising at least HA and CXCL10; and
- zero, one, two, three, four or five, or more than five different additional markers selected from:
- the age of said patient (more particularly the age of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done);
- the BMI of said patient (more particularly the BMI of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done);
- the stiffness of the liver of said patient (FS); and
- the viral load of said patient (VL), more particularly the viral load of said patient in hepatitis virus, for example, their viral load in HCV and/or HBV and/or HDV, more particularly in HCV and/or HBV, more particularly in HCV.
-
- two different circulating molecules as described above, said two different circulating molecules consisting of HA and CXCL10; and
- zero, one, two, three, four, five, or more than five different additional markers selected from:
- the age of said patient (more particularly the age of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done);
- the BMI of said patient (more particularly the BMI of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done);
- the stiffness of the liver of said patient (FS); and
- the viral load of said patient (VL), more particularly the viral load of said patient in hepatitis virus, for example, their viral load in HCV and/or HBV and/or HDV, more particularly in HCV and/or HBV, more particularly in HCV.
-
- two different circulating molecules as described above, said two different circulating molecules consisting of HA and CXCL10; and
- zero, one, two or three or four different additional markers selected from:
- the age of said patient (more particularly the age of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done);
- the BMI of said patient (more particularly the BMI of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done);
- the stiffness of the liver of said patient (FS); and
- the viral load of said patient (VL), more particularly the viral load of said patient in hepatitis virus, for example, their viral load in HCV and/or HBV and/or HDV, more particularly in HCV and/or HBV, more particularly in HCV.
-
- HA;
- CXCL10;
- the age of said patient (more particularly the age of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done); and
- the BMI of said patient (more particularly the BMI of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done).
-
- HA;
- CXCL10;
- the age of said patient (more particularly the age of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done); and
- the viral load of said patient (VL), more particularly the viral load of said patient in hepatitis virus, for example, their viral load in HCV and/or HBV and/or HDV, more particularly in HCV and/or HBV, more particularly in HCV.
-
- HA;
- CXCL10;
- the age of said patient (more particularly the age of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done); and
- the stiffness of the liver of said patient (FS).
-
- HA;
- CXCL10;
- the BMI of said patient (more particularly the BMI of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done); and
- the viral load of said patient (VL), more particularly the viral load of said patient in hepatitis virus, for example, their viral load in HCV and/or HBV and/or HDV, more particularly in HCV and/or HBV, more particularly in HCV.
-
- HA;
- CXCL10;
- the BMI of said patient (more particularly the BMI of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done); and
- the stiffness of the liver of said patient (FS).
-
- HA;
- CXCL10;
- the viral load of said patient (VL), more particularly the viral load of said patient in hepatitis virus, for example, their viral load in HCV and/or HBV and/or HDV, more particularly in HCV and/or HBV, more particularly in HCV; and
- the stiffness of the liver of said patient (FS).
-
- HA;
- CXCL10;
- the age of said patient (more particularly the age of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done);
- the BMI of said patient (more particularly the BMI of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done); and
- the viral load of said patient (VL), more particularly the viral load of said patient in hepatitis virus, for example, their viral load in HCV and/or HBV and/or HDV, more particularly in HCV and/or HBV, more particularly in HCV.
-
- HA;
- CXCL10;
- the age of said patient (more particularly the age of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done);
- the BMI of said patient (more particularly the BMI of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done); and
- the stiffness of the liver of said patient (FS).
-
- HA;
- CXCL10;
- the BMI of said patient (more particularly the BMI of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules was done);
- the viral load of said patient (VL), more particularly the viral load of said patient in hepatitis virus, for example, their viral load in HCV and/or HBV and/or HDV, more particularly in HCV and/or HBV, more particularly in HCV; and
- the stiffness of the liver of said patient (FS).
-
- the biomarker CXCL10 is the value of quantification of circulating forms of CXCL10 in said patient, more particularly the serum concentration of CXCL10, expressed, for example, in mg/mL, μg/mL, ng/mL or μg/mL, more particularly in pg/m L;
- the biomarker HA is the value of quantification of HA in said patient, more particularly may be the serum concentration of HA, expressed, for example, in mg/mL, μg/mL, ng/mL or μg/mL, more particularly in ng/mL;
- the biomarker BMI is the BMI of said patient, more particularly the BMI calculated as the mass of said patient in kg divided by (the height of said patient in m)2, more particularly the BMI of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules CXCL10 and HA was done;
- the biomarker age is the age of said patient, expressed, for example, in the number of years (whole number or with decimals), more particularly the age of said patient at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules CXCL10 and HA was done;
- the biomarker VL is the viral load of said patient in hepatitis virus, for example, their viral load in HCV and/or HBV and/or HDV, more particularly in HCV and/or HBV, more particularly in HCV, expressed, for example, in copies/mL, or in IU/mL, or as a multiple of one of these units, such as 103 copies/mL, more particularly this load at the date when the taking of the sample of biological fluid required for the detection or quantification of the circulating molecules CXCL10 and HA was done;
- the biomarker FS is the stiffness of the liver of said patient, expressed, for example, in kPA (this measurement can be done non-invasively by transient elastography, especially by FIBROSCAN™.
Detection and Quantification of the Biological Markers:
-
- a first reference cohort in which the stage of hepatic fibrosis of the individuals does not pass beyond said stage of mild fibrosis (i.e., a first reference cohort in which the stage of hepatic fibrosis of the individuals does not pass beyond that of the stages of hepatic fibrosis that show a score F1 according to the Metavir fibrosis scores system); and
- a second reference cohort in which the stage of hepatic fibrosis of the individuals passes beyond said stage of mild fibrosis (i.e., a second reference cohort in which the stage of hepatic fibrosis of the individuals passes beyond that of the stages of hepatic fibrosis that show a score F1 according to the Metavir fibrosis scores system).
ii) comparing the thus obtained values of concentrations for each of said circulating molecules to their values, or to the distribution of their values, in the predefined reference cohorts according to the stage (or degree) of hepatic fibrosis, in order to classify said patient into the one of these reference cohorts to which they most probably belong, said reference cohorts including or being:
-
- a first reference cohort in which the stage of hepatic fibrosis of the individuals does not pass beyond said stage of mild fibrosis; and
- a second reference cohort in which the stage of hepatic fibrosis of the individuals passes beyond said stage of mild fibrosis;
classification into said first cohort indicating that the stage of hepatic fibrosis of said patient has not passed beyond the stage of portal fibrosis without septum;
classification into said second cohort indicating that the stage of hepatic fibrosis of said patient has passed beyond the stage of portal fibrosis without septum.
-
- a) different (human) circulating molecules, said different (human) circulating molecules comprising or consisting of HA and CXCL10 (cf. “Circulating molecules”, “Selected biological markers”, and “Detection and quantification of the biological markers” above); and
- b) zero, one, two, three or four additional markers from the list of markers comprised of the age, body mass index (BMI), viral load (VL) and the stiffness of the liver (FS) (cf. “Optional additional markers”, “Selected biological markers”, and “Detection and quantification of the biological markers” above);
ii) quantifying the different biological markers (or variables) selected in step i) by measuring in vitro the concentrations of each of said (human) circulating molecules of step i)a) above in a sample of biological fluid obtained in advance from said patient, more particularly by measuring in vitro the quantities of each of said (human) circulating molecules of step i)a) above in a sample of biological fluid obtained in advance from said (human) patient to determine the value of the concentration of each of said circulating molecules [in said sample and/or in said patient]; and
when one, two, three, four or five additional markers are selected from said list of step i)b) above, and when this (or these) additional marker(s) is (are) or includes (include) one or more markers selected from the age, body mass index and stiffness of the liver: by collecting the value of quantification of this or each of these additional markers that was determined in advance for or on said patient;
when one, two, three, four or five additional markers are selected from said list of step i)b) above, and when this (or these) additional marker(s) is (are) or includes (include) the viral load: by measuring this viral load in vitro in a sample of biological fluid obtained in advance from said patient, or by collecting the value of this viral load that was determined in advance for said patient;
iii) comparing the values of quantification obtained in step ii) to their values, or to the distribution of their values, in the predefined reference cohorts according to the stage (or degree) of hepatic fibrosis, in order to classify said patient into the one of these reference cohorts to which they most probably belong, said reference cohorts including or being: - a first reference cohort in which the stage of hepatic fibrosis of the individuals does not pass beyond said stage of mild fibrosis; and
- a second reference cohort in which the stage of hepatic fibrosis of the individuals passes beyond said stage of mild fibrosis;
classification into said first cohort indicating that the stage of hepatic fibrosis of said patient has not passed beyond the stage of portal fibrosis without septum;
classification into said second cohort indicating that the stage of hepatic fibrosis of said patient has passed beyond the stage of portal fibrosis without septum.
-
- hyaluronic acid (HA) and the protein CXCL10, or
- hyaluronic acid (HA), the protein CXCL10, the age and the BMI, or
- hyaluronic acid (HA), the protein CXCL10, the age, the BMI, and the viral load (VL), or
- hyaluronic acid (HA), the protein CXCL10, and the stiffness of the liver (FS);
cf. “Circulating molecules”, “Optional additional markers”, “Selected biological markers”, and “Detection and quantification of the biological markers” above.
-
- constituting at least two reference cohorts created in advance according to the stage (or degree or score) of hepatic fibrosis;
- a first reference cohort consisting of individuals in which the stage of hepatic fibrosis does not pass beyond said stage of mild fibrosis, and
- a second reference cohort consisting of individuals in which the stage of hepatic fibrosis passes beyond said stage of mild fibrosis (cf. “Determination of the stage of hepatic fibrosis from values of quantification of biological markers” above);
- quantifying each of said selected different biological markers in said first reference cohort and in said second reference cohort;
- comparison (mathematical and/or statistical) of the values of quantification shown by said markers in the first reference cohort to those they show (respectively) in the second reference cohort.
- constituting at least two reference cohorts created in advance according to the stage (or degree or score) of hepatic fibrosis;
-
- a first reference cohort in which the stage (or degree or score) of hepatic fibrosis of the individuals does not pass beyond the stage of portal fibrosis without septum (i.e., does not pass beyond the Metavir fibrosis score F1); and
- a second reference cohort in which the stage (or degree or score) of hepatic fibrosis of the individuals passes beyond the stage of portal fibrosis without septum (i.e., passes beyond the Metavir fibrosis score F1);
β) for each of said individuals, quantifying the different biological markers selected in step i) ofclaim 1; and
γ) making a comparison between the cohorts of the values of quantification obtained in step β), or the distribution of these values, to create a classification model that, from the values of quantification of said selected biological markers (more particularly, from a combination of these values), induces classification into one of said reference cohorts.
-
- a method of statistical analysis, more particularly of multivariate statistical analysis, for example:
- an ROC (receiver operating characteristics) method;
- a linear or non-linear mathematical function, especially a linear mathematical function, such as a function generated by the mROC (multivariate ROC) method, or
- a linear or non-linear regression method, such as logistic regression, more particularly logistic regression using an affine function (LOGIT);
- a PLS-DA (partial least squares—discriminant analysis) method;
- an LDA (linear discriminant analysis) method;
- a classification method by learning or artificial intelligence, for example, a learning or artificial intelligence algorithm, a non-parametric or heuristic classification method or probabilistic prediction method, such as:
- a decision tree, such as the CART (classification and regression tree) method; or
- a method of the boosting type based on binary classificators (from Adaboost) or a method related to boosting (bagging); or
- a method of k-nearest neighbors (or KNN), or more generally the method of weighted k-nearest neighbors (or WKNN); or
- a method (for example, an algorithm) of support vector machines (or SVM); or
- a random forest (or RF); or
- a Bayesian network; or
- a neural network; or
- a Galois lattice (or formal concept analysis).
- a method of statistical analysis, more particularly of multivariate statistical analysis, for example:
-
- which is based on a mathematical function, such as, for example:
- a linear function (for example, an mROC function), or
- a non-linear function, such as, for example, an affine function (for example, a logistic regression LOGIT), or
- which is not based on a mathematical function, such as, for example, a method, a software or an algorithm of learning or artificial intelligence (for example, a decision tree CART).
- which is based on a mathematical function, such as, for example:
-
- mROC
- of logistic regression (more particularly of logistic regression using a LOGIT affine function);
- KNN, WKNN (more particularly WKNN),
- RF, or
- NN, or
- CART,
more particularly mROC, logistic regression (more particularly logistic regression using a LOGIT affine function) or CART.
-
- Example 7, more particularly Tables 20, 21 and 23,
- Example 8, more particularly Table 24.
Se=TP/(TP+FN), with TP=number of true positives and FN=number of false negatives;
Sp=TN/(TN+FP), with TN=number of true negatives and FP=number of false positives;
PPV=TP/(TP+FP) with TP=true positives and FP=false positives;
NPV=TN/(TN+FN), with TN=true negatives and FN=false negatives; with positive test=said stage of mild fibrosis has been passed
negative test=said stage of mild fibrosis has not been passed.
-
- a specificity (Spe) of at least 85%, and/or
- a PPV of at least 85%.
-
- sensitivity and specificity, or of
- sensitivity and PPV, or of
- sensitivity and NPV, or of
- sensitivity and AUC, or of
- sensitivity and correct classification rate, or of
- specificity and PPV, or of
- specificity and NPV, or of
- specificity and AUC, or of
- specificity and correct classification rate, or of
- PPV and NPV, or of
- PPV and AUC, or of
- PPV and correct classification rate, or of
- NPV and AUC, or of
- NPV and correct classification rate, or of
- AUC and correct classification rate, or of
- sensitivity, specificity and PPV, or of
- sensitivity, specificity and NPV, or of
- sensitivity, specificity and AUC, or of
- sensitivity, specificity and correct classification rate, or of
- sensitivity, PPV and NPV, or of
- sensitivity, PPV and AUC, or of
- sensitivity, PPV and correct classification rate, or of
- sensitivity, NPV and AUC, or of
- sensitivity, NPV and correct classification rate, or of
- sensitivity, AUC and correct classification rate, or of
- sensitivity, specificity, PPV and NPV, or of
- sensitivity, specificity, PPV and AUC, or of
- sensitivity, specificity, PPV and correct classification rate, or of
- sensitivity, specificity, NPV and AUC, or of
- sensitivity, specificity, NPV and correct classification rate, or of
- sensitivity, PPV, NPV and correct classification rate, or of
- specificity, PPV, NPV and AUC, or of
- specificity, PPV, NPV and correct classification rate, or of
- sensitivity, specificity, PPV, NPV and AUC, or of
- sensitivity, specificity, PPV, NPV and correct classification rate, or of
- specificity, PPV, NPV, AUC and correct classification rate, or of
- sensitivity, specificity, PPV, NPV, AUC and correct classification rate,
are explicitly included in the description of the application.
-
- to that obtained under the same conditions but without the marker HA,
- to that obtained under the same conditions but without the marker CXCL10.
-
- in Example 1 (cf. Table 3),
- in Example 3 (cf. Tables 8 and 10), and
- in Example 7 (cf. Tables 20 and 21).
-
- Example 7, more particularly Tables 20, 21 and 23,
- Example 8, more particularly Table 24.
Mathematical Function (for Example, mROC, Logistic Regression)
BMQt=(BMQλ−1)/λ.
Z=a(CXCL10t)+b(HAt)+c(BMIt)+d(aget)+e(VLt)+f(FSt) [function Z13]
with:
a and b each being independently a positive real number going from +0.1 to +6.0;
c, d, e and f each being independently a real number going from −10.0 to +10.0; λCXCL10, λHA, λBMI, λage, λVL and λFS each being independently a real number going from −6.0 to 1.2, but excluding zero;
cf. Example 8.
Z=a(CXCL10t)+b(HAt)+c(BMIt)+d(aget)+e(VLt)+f(FSt) [function Z12]
with:
a and b each being independently a positive real number going from +0.1 to +6.0, more particularly from +0.3 to +5.5;
c being a real number going from −10.0 to +4.0;
d being a real number going from −0.8 to +0.2;
e being a real number going from −0.003 to +0.002;
f being a real number going from +0.0 to +10.0;
λCXCL10, λHA, λBMI, λage, λVL and λFS each being independently a real number going from −6.0 to 1.2, but excluding zero;
cf. Example 8 below.
Z=a(CXCL10t)+b(HAt) [function Z10]
with:
0.812≤a≤5.089
2.033≤b≤4.462
−0.262≤λCXCL10≤0.030
−0.382≤λHA≤−0.219;
a, b, λCXCL10 and λHA being different from zero.
Z=(1.999)×CXCL10t+(2.852)×HAt [function Z4]
with λCXCL10=−0.116 and λHA=−0.288.
Z=0.386×CXCL10t+0.3064×HAt [function Z1]
with λCXCL10=−0.013 and λHA=0.099.
Z=(1.849)×CXCL10t+(2.368)×HAt [function Z7]
with λCXCL10=−0.116 and λHA=−0.27.
Z=a(CXCL10t)+b(HAt)+c(BMIt)+d(aget)+e(VLt) [function Z11]
with:
0.748≤a≤5.357
2.075≤b≤4.690
−0.848≤c≤3.697
−0.746≤d≤0.147
−0.003≤e≤0.002
−0.262≤λCXCL10≤0.047
−0.882≤λHA≤−0.219
−5.545≤λBMI≤0.485
−0.116≤λage≤0.828
0.236≤λVL≤0.305
a, b, c, d, e, λCXCL10, λHA, λBMI, λVL being different from zero.
Z=(0.2914)×CXCL10t+(0.2569)×HAt+(−9.3855)×BMIt+(0.01419)×aget+(0.0140)×VLt [function Z3]
with
λCXCL10=−0.013
λHA=0.099
λage=1.086
λBMI=−0.923
λVL=0.159.
Z=(1.999)×CXCL10t+(2.958)×HAt+(0.616)×BMIt+(−0.053)×aget+(−0.00024)×VLt [function Z5]
with
λCXCL10=−0.116
λHA=−0.288
λage=0.433
λBMI=−0.039
λVL=0.279.
Z=(1.853)×CXCL10t+(2.511)×HAt+(0.4246)×BMIt+(−0.0343)×aget+(−0.00027)×VLt [function Z8]
with
λCXCL10=−0.116
λHA=−0.27
λage=0.536
λBMI=−0.0056
λVL=0.288.
Z=(0.3313)×CXCL10t+(0.25154)×HAt+(−9.8818)×BMIt+(0.0143)×aget [function Z2]
with
λCXCL10=−0.013
λHA=0.099
λage=1.086
λBMI=−0.923.
Z=(1.686)×CXCL10t+(2.216)×HAt+(6.947)×FS [function Z6]
FS being the value of quantification of the stiffness of the liver, for example, in kDa, with
λCXCL10=−0.016
λHA=0.2888
λFS=−0.888.
Z 7=(1.585)×CXCL10t+(2.181)×HAt+(2.910)×FS [function Z9]
FS being the value of quantification of the stiffness of the liver, for example, in kDa, with
λCXCL10=−0.016
λHA=−0.27
λFS=−0.27.
LOGIT=Intercept+k(BMQ1)+l(BMQ2),
in which BMQ1 and BMQ2 are two different biomarkers (for example, CXCL10 and HA), and in which Intercept, k and l are numerical values of the constants of the function of logistic regression.
LOGIT=Intercept+k(CXCL10)+l(AH), [function LOGIT1]
with
−5≤Intercept≤−1
0.001≤k≤0.010
0.010≤l≤0.050.
LOGIT=Intercept+k(CXCL10)+l(HA), [function LOGIT2]
with
−4.481≤Intercept≤−2.398
0.003≤k≤0.008
0.013≤l≤0.045;
(cf. Example 8, Table 24).
LOGIT3=Intercept+k(CXCL10)+l(HA), [function LOGIT3]
with
−3.57≤Intercept≤−2.67
0.003≤k≤0.007; and
0.02≤l≤0.04 (cf. Example 7, Table 19);
LOGIT=Intercept+k(CXCL10)+l(HA), [function LOGIT4]
with
Intercept=−3.164
k=0.005; and
l=0.024 (cf. Example 7, Table 22).
-
- a first threshold value (for example, h) assigned to the value of quantification of one of the two biomarkers (for example, the value of quantification of HA) and creating a branching point with two branches according to whether the value of quantification is lower or higher than the threshold value, then
- two more threshold values (for example, i and j) each assigned to the value of quantification of the other one of the two biomarkers (for example, the value of quantification of CXCL10), one of these two more threshold values being assigned to one of the two branches, and the other one of these two more threshold values being assigned to the other one of the two branches.
-
- said patient is classified into said first cohort (Metavir fibrosis score <F2) if the value of quantification of CXCL10 is lower than j;
- said patient is classified into said second cohort (Metavir fibrosis score ≥F2) if the value of quantification of CXCL10 is higher than or equal to j; and
if the value of quantification of HA for said patient is higher than or equal to h, the threshold of the marker CXCL10 is i, and: - said patient is classified into said first cohort (Metavir fibrosis score <F2) if the value of quantification of CXCL10 is lower than i;
- said patient is classified into said second cohort (Metavir fibrosis score ≥F2) if the value of quantification of CXCL10 is higher than or equal to i.
-
- by a decision tree, more particularly by a CART tree, for one or at least one marker selected from the viral load, age, BMI and the stiffness of the liver, more particularly for (at least) the marker stiffness of the liver, then
- by a linear or affine function, more particularly by mROC or logistic regression, for markers selected as described above, more particularly for at least the markers CXCL10 and HA.
-
- mouse monoclonal anti-human CXCL10 antibody commercially available from R&D SYSTEMS, Inc. (614 McKinley Place NE; Minneapolis, Minn. 55413; USA), under the catalogue reference MAB266 (clone 33036, class IgG1);
- goat polyclonal anti-human CXCL10 antibody available from R&D SYSTEMS, Inc. (614 McKinley Place NE; Minneapolis, Minn. 55413; USA), under the catalogue reference AF-266-NA for a form not coupled to biotin);
- mouse monoclonal anti-human CXCL10 antibody available from R&D SYSTEMS, Inc. (614 McKinley Place NE; Minneapolis, Minn. 55413; USA; catalogue reference MAB266).
-
- a first ligand (for example, a first protein) that binds specifically to one of the selected circulating molecules, for example, a first ligand (more particularly a first protein, more particularly an antibody) that binds specifically to CXCL10; and
- a second ligand (for example, a second protein) that binds specifically to another one of the selected circulating molecules, for example, a second ligand (more particularly a second protein) that binds specifically to HA.
-
- one or more tubes;
- a kit, especially a kit comprising one or more tubes;
- a solid or semi-solid support, for example, made of plastic, polystyrene, polypropylene, glass, silicon, nitrocellulose, poly(vinylidene fluoride) [PVDF] or polymer, or comprising a magnetic material, such as iron oxide, for example:
- a plate or microplate with wells, for example, made of microplate with wells suitable for titration and/or high throughput screening (high throughput screening microplates);
- a chip or microarray (with integrated circuit) made of a conducting or semiconducting material, more particularly a silicon wafer chip (or microarray), more particularly a chip (or microarray) made of silicon;
- a capillary, more particularly a glass capillary;
- a magnetic bead having a mean diameter lower than a micrometer;
- a glass slide;
- a membrane (for example, a membrane made of nitrocellulose or PVDF).
-
- a first ligand (for example, a first protein) that binds specifically to HA;
- a second ligand (for example, a second protein, more particularly an antibody) that binds specifically to CXCL10.
-
- an instrument for collecting said sample, especially:
- a needle and/or syringe, more particularly a needle and/or syringe for collecting an intracorporeal fluid, such as blood; and/or
- a needle suitable for hepatic cytopuncture, for example, a needle having a diameter of 18 to 22G); and/or
- a needle and/or catheter and/or biopsy gun suitable for PBH;
- a computer program or software product, especially a computer program or software product for statistical analysis, for example, a computer program product of the invention as described below.
- an instrument for collecting said sample, especially:
-
- a first ligand that bears a first detection marker, and
- a second ligand that bears a second detection marker.
-
- nucleic acids that bind specifically to one or more hepatitis viruses, and further comprising
- ligands that bind to molecules contained in acellular form in a biological fluid, said ligands being contained in the kit in a combined preparation for separate, distributed or simultaneous use in time, more particularly for simultaneous use in time, more particularly for use in admixture.
-
- a first ligand that bears a first detection marker, and
- a second ligand that bears a second detection marker.
-
- the use of said ligand(s) in a process of the invention for determining whether or not the score of hepatic fibrosis of a patient has passed beyond that of a mild fibrosis, more particularly for determining whether the hepatic fibrosis of a patient has a Metavir fibrosis score of at most F1, or else of at least F2; and
- administering to said patient a treatment aiming at blocking the progression of hepatic fibrosis (such as a treatment comprising standard or pegylated interferon in a monotherapy, or in a pluritherapy involving ribavirin), if the patient has a score of hepatic fibrosis that has passed beyond that of a mild fibrosis (Metavir fibrosis score of at least F2).
- the use of said ligand(s) in a process of the invention for determining whether or not the score of hepatic fibrosis of a patient has passed beyond that of a mild fibrosis, more particularly for determining whether the hepatic fibrosis of a patient has a Metavir fibrosis score of at most F1, or else of at least F2; and
-
- pegylated interferon alpha-2b (such as PEG-INTRON®, Schering Plough Corporation, Kenilworth, N.J.) at a dose of approximately 1.5 g/kg/week, and ribavirin (REBETOL®; Schering Plough Corporation, Kenilworth, N.J.) at a dose of 800 to 1200 mg/kg/day (if the liver disease implies an HCV of
2 or 3, a dose of approximately 800 mg/kg/day is generallygenotype - pegylated interferon alpha-2a (such as PEGASYS®; Roche Corp., F. Hoffmann-La Roche Ltd.; Basel, Switzerland) at a concentration of 180 g/kg/week and ribavirin (COPEGUS®, Roche Corp.; F. Hoffmann-La Roche Ltd.; Basel, Switzerland) at a dose of 1000 to 1200 mg/kg/day.
- pegylated interferon alpha-2b (such as PEG-INTRON®, Schering Plough Corporation, Kenilworth, N.J.) at a dose of approximately 1.5 g/kg/week, and ribavirin (REBETOL®; Schering Plough Corporation, Kenilworth, N.J.) at a dose of 800 to 1200 mg/kg/day (if the liver disease implies an HCV of
-
- viral chronic hepatitis (especially chronic hepatitis B, chronic hepatitis C, chronic hepatitis D);
- steatoses and steatohepatitis (associated with the metabolic syndrome, obesity, diabetes);
- alcoholic hepatitis;
- genetic hemochromatosis and secondary iron overload;
- autoimmune diseases;
- biliary diseases (primitive biliary cirrhosis and primitive sclerosing cholangitis);
- poisoning by medicament or toxic substance;
- metabolic diseases;
- non-alcoholic steatohepatitis (NASH).
-
- a computer program product of the application, and optionally
- values of quantification of the selected biomarkers.
| TABLE 1 | |||
| Variables | Total population | F1 patients | F2 patients |
| n | 118 | 73 | 45 |
| Sex [male (%)/female (%)] | 54 (46)/64 (54) | 27 (37)/46 (63) | 27 (60)/18 (40) |
| Age on the date of sampling | 49.1 ± 11.2 | (21-71) | 46.7 ± 11.0 | (21-71) | 53.1 ± 10.4 | (32-71) |
| [mean ± SD (min-max)] | ||||||
| Alanine aminotransferase (ALT) IU/L | 95 ± 83 | (22-647) | 77 ± 54 | (22-308) | 122 ± 111 | (36-647) |
| [mean ± SD (min-max)] | ||||||
| HCV genotype [n (%)] | ||||||
| 1 | 61 | (52) | 34 | (47) | 27 | (60) |
| 2 | 15 | (13) | 11 | (15) | 4 | (9) |
| 3 | 12 | (10) | 7 | (10) | 5 | (11) |
| 4 | 23 | (19) | 16 | (22) | 7 | (16) |
| 5 | 4 | (3) | 3 | (4) | 1 | (2) |
| 6 | 2 | (2) | 1 | (1) | 1 | (2) |
| unknown | 1 | (1) | 1 | (1) | 0 | (0) |
| Viral load on the date of sampling (VL): | 5.6 × 106 | 4.8 × 106 | 7.0 × 106 |
| copies/mL [mean (min-max)] | (1.4 × 104-5.9 × 107) | (3.7 × 104-2.7 × 107) | (1.4 × 104-5.9 × 107) |
| SD = standard deviation; | |||
| IU = international units | |||
| TABLE 2 | |||
| Discriminating rule | Threshold example | ||
| linear function | Box-Cox normalization | (threshold maximizing the | |
| Biomarkers | (generated by mROC) | parameters (λ) | Youden index (δ)) |
| CXCL10 | Z = CXCL10t | CXCL10: −0.013 | 5.611 |
| HA | Z = HAt | HA: 0.099 | 4.683 |
| HA + CXCL10 | Z = (0.3686) × CXCL10t + | CXCL10: −0.013 | 3.382 |
| (0.3064) × HAt [function Z1] | HA: 0.099 | ||
| HA + CXCL10 + BMI + Age | Z = (0.3313) × CXCL10t + | CXCL10: −0.013 | −6.263 |
| (0.25154) × HAt + (0.0143) × | HA: 0.099 | ||
| Aget + (−9.8818) × BMIt | Age: 1.086 | ||
| [function Z2] | BMI: −0.923 | ||
| HA + CXCL10 + BMI + Age + VL | Z = (0.2914) × CXCL10t + | CXCL10: −0.013 | −5.730 |
| (0.2569) × HAt + (0.01419) × | HA: 0.099 | ||
| aget + (−9.3855) × BMIt + | Age: 1.086 | ||
| (0.0140) × VLt | BMI: −0.923 | ||
| [function Z3] | VL: 0.159 | ||
-
- this patient is assigned to the class of Metavir hepatic fibrosis scores greater than or equal to F2 if the value of this function Z for this patient is greater than or equal to the threshold value maximizing the Youden index (8) that is associated with this function Z;
- conversely, this patient is assigned to the class of Metavir hepatic fibrosis scores lower than F2 if the value of this function Z for this patient is lower than the threshold value δ.
-
- if the value of this function Z for a given patient is greater than or equal to the threshold value 3.382, this patient is assigned to the class of Metavir hepatic fibrosis scores greater than or equal to F2;
- conversely, if the value of this function Z for a given patient is lower than the threshold value 3.382, this patient is assigned to the class of Metavir hepatic fibrosis scores lower than F2.
-
- if the value of this function Z for a given patient is greater than or equal to the threshold value −6.263, this patient is assigned to the class of Metavir hepatic fibrosis scores greater than or equal to F2;
- conversely, if the value of this function Z for a given patient is lower than the threshold value −6.263, this patient is assigned to the class of Metavir hepatic fibrosis scores lower than F2.
| TABLE 3 | |||||||
| Rate of | correct | ||||||
| unclassified | classification | ||||||
| Biomarkers | patients | Se | Spe | PPV | NPV | | AUC |
| CXCL10 | |||||||
| 0% | 73% | 55% | 50% | 77% | 62% | 0.583 | |
| |
0% | 62% | 73% | 58% | 76% | 69% | 0.681 |
| HA + |
0% | 78% | 59% | 54% | 81% | 66% | 0.704 |
| HA + CXCL10 + | 0% | 76% | 70% | 61% | 82% | 72% | 0.729 |
| BMI + Age | |||||||
| HA + CXCL10 + | 0% | 76% | 71% | 62% | 83% | 73% | 0.731 |
| BMI + Age + | |||||||
| VL | |||||||
| TABLE 4 | ||
| Name of test | ||
| FIBROTEST ™ | HEPASCORE ™ | APRI | FORNS | SHASTA | ||
| Number of | 7 including 5 | 6 including 4 | 2 | 4 including 3 | 3 |
| biomarkers | biochemical | biochemical | biochemical | ||
| involved in the | biomarkers | biomarkers | biomarkers | ||
| test | requiring | requiring | requiring | ||
| determination | determination | determination | |||
| Biochemical | A2M | A2M | ASAT | GGT | Albumin |
| biomarkers | GGT | GGT | Platelets | Platelets | AST |
| APOA1 | Bilirubin | Cholesterol | HA | ||
| Hapto | HA | ||||
| Bilirubin | |||||
| Clinical | Age | Age | — | Age | — |
| biomarkers | Sex | Sex |
| Reference | 0.48: ≥F2 | ≥0.5: ≥F2 | >1.5: ≥F2 | >6.9: ≥ | Threshold | 1 | |
| thresholds | 0.28: <F2 | <0.5: <F2 | ≤0.5: <F2 | <4.21: <F2 | ≥0.8: ≥F2 | ≥0.3: ≥F2 | |
| recommended | from 0.28 to 0.47: | from 0.5 to 1.5: | from 4.21 to 6.9: | <0.8: <F2 | <0.3: <F2 | ||
| by the test | non-determined | non-determined | non-determined | ||||
| patients who | patients who cannot | patients who cannot | |||||
| cannot be classified | be classified | be classified | |||||
| TABLE 5 | |||||||
| Rate of | Rate of | Global rate of | |||||
| unclassified | correct | correct | |||||
| patients | Se | Spe | PPV | NPV | classification (*) | classification ($) | |
| |
0% | 67% | 75% | 63 | 79 | 72% | 72 |
| SHASTA | |||||||
| 0% | 51% | 15% | 27 | 33 | 29% | 29% | |
| [threshold 1] | |||||||
| |
0% | 67% | 14% | 32 | 40 | 34% | 34% |
| [threshold 2] | |||||||
| FIBROTEST ™ | 22% | 74% | 68% | 59 | 81 | 71% | 55% |
| APRI | 42% | 26% | 96% | 71 | 77 | 76% | 44% |
| FORNS | 50% | 35% | 93% | 67 | 78 | 76% | 38% |
| As seen before, the results of the combination HA + CXCL10 (combinations of Example 1 |
| according to the application, cf. Table 3 above) are: |
| HA + |
0% | 78% | 59% | 54% | 81% | 66% | 66% |
| HA + CXCL10 + | 0% | 76% | 70% | 61% | 82% | 72% | 72% |
| BMI + Age | |||||||
| HA + CXCL10 + | 0% | 76% | 71% | 62% | 83% | 73% | 73% |
| BMI + Age + VL | |||||||
| (*): rate calculated for patients who could be classified | |||||||
| ($): rate calculated for the total population (n = 118) | |||||||
-
- the advantage of allowing a classification of all the patients, while with the test FIBROTEST™, 22% of the patients do not receive a fibrosis score, and further
- the advantage of requiring the determination of only two biomarkers (HA and CXCL10), while for the test FIBROTEST™, five biomarkers must be determined (A2M, GGT, APOA1, Hapto and Bilirubin).
| TABLE 6 | |||
| Patients whose Metavir | Patients whose Metavir | ||
| Variables | Total population | hepatic fibrosis score is < F2 | hepatic fibrosis score is ≥ F2 |
| n | 310 | 141 | 169 |
| Sex [male (%)/female (%)] | 140 (45)/170 (55) | 55 (39)/86 (61) | 85 (50)/84 (50) |
| Age on the date of sampling | 57.9 ± 11.0 | (27-88) | 55.2 ± 10.0 | (27-88) | 60.2 ± 11.2 | (35-88) |
| [mean ± SD (min-max)] | ||||||
| Alanine aminotransferase (ALT) IU/L | 87 ± 83 | (16-795) | 54 ± 34 | (16-271) | 113 ± 101 | (21-795) |
| [mean ± SD (min-max)] | ||||||
| HCV genotype [n (%)] | ||||||
| 1 | 213 | (69) | 95 | (67) | 118 | (70) |
| 2 | 32 | (10) | 19 | (13) | 13 | (8) |
| 3 | 26 | (8) | 10 | (7) | 16 | (9) |
| 4 | 33 | (11) | 13 | (9) | 20 | (12) |
| 5 | 3 | (1) | 2 | (1) | 1 | (1) |
| 7 | 1 | (0) | 1 | (0) | 0 | (0) |
| unknown | 2 | (1) | 1 | (0) | 1 | (1) |
| Viral load on the date of sampling (VL): | 1.5 × 106 | 1.5 × 106 | 1.5 × 106 |
| IU/mL [mean (min-max)] | (14-1.1 × 107) | (14-8.9 × 107) | (39-1.1 × 107) |
| SD = standard deviation; | |||
| IU = international units | |||
| TABLE 7 | |||
| Discriminating rule | Threshold example | ||
| linear function | Box-Cox normalization | (threshold maximizing the | |
| Biomarkers | (generated by mROC) | parameters (λ) | Youden index (δ)) |
| HA | Z = HAt | HA: −0.288 | 2.330 |
| CXCL10 | Z = CXCL10t | CXCL10: −0.116 | 4.242 |
| HA + CXCL10 | Z = (1.999) × CXCL10t + | CXCL10: −0.116 | 15.170 |
| (2.852) × HAt [function Z4] | HA: −0.288 | ||
| HA + CXCL10 + BMI + Age + VL | Z = (1.999) × CXCL10t + | CXCL10: −0.116 | 16.543 |
| (2.958) × HAt + (0.616) × | HA: −0.288 | ||
| BMIt + (−0.053) × Aget − | Age: 0.433 | ||
| (0.00024) × VLt | BMI: −0.039 | ||
| [function Z5] | VL: 0.279 | ||
| TABLE 8 | |||||||
| Rate of | correct | ||||||
| unclassified | classification | ||||||
| Biomarkers | patients | Se | Spe | PPV | NPV | | AUC |
| HA | |||||||
| 0% | 76% | 79% | 82% | 74% | 78% | 0.840 | |
| CXCL10 | 0% | 72% | 76% | 78% | 69% | 74% | 0.810 |
| HA + |
0% | 78% | 90% | 90% | 77% | 83% | 0.898 |
| HA + CXCL10 + | 0% | 80% | 87% | 88% | 78% | 83% | 0.899 |
| BMI + Age + VL | |||||||
| TABLE 9 | ||
| Fibrosis | ||
| Fibrosis score given by | Fibrosis score given by | score given by a |
| HA test alone (cf. | CXCL10 test alone (cf. | test that juxtaposes HA |
| Example 3) | Example 3) | to CXCL10 |
| ≥F2 | ≥F2 | ≥F2 |
| ≥F2 | <F2 | ≥F2 |
| <F2 | ≥F2 | ≥F2 |
| <F2 | <F2 | <F2 |
| TABLE 10 | |||||||
| Rate of | correct | ||||||
| unclassified | classification | ||||||
| Biomarkers | patients | Se | Spe | PPV | NPV | rate | AUC |
| HA alone | 0% | 76% | 79% | 82% | 74% | 78% | 0.840 |
| (cf. Table 8 above) | |||||||
| CXCL10 alone | 0% | 72% | 76% | 78% | 69% | 74% | 0.810 |
| (cf. Table 8 above) | |||||||
| HA/ |
0% | 90% | 57% | 72% | 83% | 75% | NA |
| Test juxtaposing | |||||||
| HA to CXCL10 | |||||||
| HA + |
0% | 78% | 90% | 90% | 77% | 83% | 0.898 |
| Test combining HA | |||||||
| with CXCL10 | |||||||
| (cf. Table 8 above) | |||||||
| NA = not applicable | |||||||
-
- the juxtaposition of HA to CXCL10 allows the sensitivity and NPV to be strongly increased as compared to each marker taken separately;
- in contrast, the specificity and the PPV are reduced, which leads to a correct classification rate of 75% (intermediate between the rate obtained for HA alone and for CXCL10 alone).
-
- on the one hand, when the applied mROC discriminating rule has as the coefficients those initially determined on the population of 310 patients (“fix coefficients” or “coef fix”); and
- on the other hand, when the applied mROC discriminating rule has those coefficients determined for each of the 1000 subpopulations (“optimized coefficients” or “coef optim”).
-
- that in terms of AUC, the mean of the difference is 0.001 (with a 95% confidence interval of [−0.002; 0.008]); and
- that in terms of correct classification rate, the mean of the difference is 1.04 (with a 95% confidence interval of [−0.33; 3.55]).
-
- that in terms of AUC, the gain of the combination of HA+CXCL10 as compared to the marker HA alone is always greater than zero, the mean of this difference is 0.06 (with a 95% confidence interval of [0.027; 0.092]); and
- that in terms of correct classification rate, gain of the combination of HA+CXCL10 as compared to the marker HA alone is greater than zero in 99% of the cases, the mean of the difference is 5.5% (with a 95% confidence interval of [1.29; 10]).
| TABLE 11 | ||
| Name of test | ||
| FIBROTEST ™ | HEPASCORE ™ | APRI | FORNS | FIBROSCAN ™ | ||
| Number of | 7 including 5 | 6 including 4 | 2 | 4 including 3 | 0 (measurement of |
| biomarkers | biochemical | biochemical | biochemical | elastometry in kPa) | |
| involved in the | biomarkers | biomarkers | biomarkers | ||
| test | requiring | requiring | requiring | ||
| determination | determination | determination | |||
| Biochemical | A2M | A2M | ASAT | GGT | — |
| biomarkers | GGT | GGT | Platelets | Platelets | |
| APOA1 | Bilirubin | Cholesterol | |||
| Hapto | HA | ||||
| Bilirubin | |||||
| Clinical | Age | Age | — | Age | — |
| biomarkers | Sex | Sex | |||
| Reference | 0.48: ≥F2 | ≥0.5: ≥F2 | >1.5: ≥F2 | >6.9: ≥F2 | <7.1: <F2 |
| thresholds | 0.28: <F2 | <0.5: <F2 | ≤0.5: <F2 | <4.21: <F2 | ≥7.1: ≥F2 |
| recommended | from 0.28 to 0.47: | from 0.5 to 1.5: | from 4.21 to 6.9: | ≥9.5: ≥F3 | |
| by the test | non-determined | non-determined | non-determined | ≥12.5: F4 | |
| patients who | patients who cannot | patients who cannot | |||
| cannot be classified | be classified | be classified | |||
| TABLE 12 | |||||||
| Measurements | |||||||
| done and treated | |||||||
| in accordance with | |||||||
| instructions from | Rate of | Rate of | Global rate | ||||
| manufacturer or | unclassified | correct | of correct | ||||
| from authors | patients | Se | Spe | PPV | NPV | classification (*) | classification ($) |
| |
0% | 95% | 90% | 94% | 90% | 93% | 93 |
| FIBROSCAN ™ | |||||||
| 0% | 62% | 94% | 95% | 58% | 74% | 74 | |
| FIBROTEST ™ | |||||||
| 15% | 100% | 58% | 81% | 100% | 85% | 72% | |
| FORNS | 54% | 49% | 44% | 100% | 100% | 47% | 45% |
| APRI | 45% | 36% | 64% | 98% | 81% | 46% | 50% |
| As seen before, the results of the combination HA + CXCL10 (combinations of Example 3 |
| according to the application, cf. Table 8 above) are: |
| HA + |
0% | 78% | 90% | 90% | 77% | 83% | 83% |
| HA + CXCL10 + | 0% | 80% | 87% | 88% | 78% | 83% | 83% |
| BMI + Age + VL | |||||||
| (*): rate calculated for patients who could be classified | |||||||
| ($): rate calculated for the total population (n = 310) | |||||||
-
- the advantage of allowing a classification of all the patients, while with the test FIBROTEST™, 15% of the patients of the population do not receive a fibrosis score;
- the advantage of showing better performances of specificity and PPV (in addition to the better correct classification rate); and further
- the advantage of requiring the determination of only two biomarkers (HA and CXCL10), while for the test FIBROTEST™, five biomarkers must be determined (A2M, GGT, APOA1, Hapto and Bilirubin).
| TABLE 13 | |||
| Discriminating rule | Threshold example | ||
| linear function | Box-Cox normalization | (threshold maximizing the | |
| Biomarkers | (generated by mROC) | parameters (λ) | Youden index (δ)) |
| FS | Z = FSt | HA: −0.888 | 0.893 |
| HA + CXCL10 | Z = (1.999) × CXCL10t + | CXCL10: −0.116 | 15.170 |
| (2.852) × HAt [function Z4] | HA: −0.288 | ||
| HA + CXCL10 + FS | Z = (1.686) × CXCL10t + | CXCL10: −0.116 | 18.375 |
| (2.216) × HAt + (6.947) × FSt | HA: −0.288 | ||
| [function Z6] | FS: −0.888 | ||
| TABLE 14 | ||||||
| correct | ||||||
| classification | ||||||
| Se | Spe | PPV | NPV | rate | AUC | |
| FS | 76% | 82% | 83% | 74% | 78% | 0.858 |
| HA + CXCL10 | 78% | 90% | 90% | 77% | 83% | 0.898 |
| HA + CXCL10 + | 83% | 89% | 90% | 81% | 86% | 0.931 |
| FS | ||||||
| As seen before: | ||||||
| HA (cf. Example | 76% | 79% | 82% | 74% | 78% | 0.840 |
| 3, Table 8 | ||||||
| above) | ||||||
| CXCL10 (cf. | 72% | 76% | 78% | 69% | 74% | 0.810 |
| Example 3, | ||||||
| Table 8 above) | ||||||
| TABLE 15 | ||||
| Variables | Total population | Patients F0-F1 | Patients F2-F3 | Patients F4 |
| n | 310 | 141 | 128 | 41 |
| Sex [male (%)/female (%)] | 140 (45)/170 (55) | 55 (39)/86 (61) | 57 (45)/71 (55) | 28 (68)/13 (32) |
| Age on the date of sampling | 57.9 ± 11.0 | 55.2 ± 10.0 | 60.7 ± 11.3 | 58.9 ± 11.0 |
| [mean ± SD (min-max)] | (27-88) | (27-88) | (35-88) | (41-85) |
| Alanine aminotransferase (ALT) IU/L | 87 ± 83 | 54 ± 34 | 103 ± 91 | 149 ± 121 |
| [mean ± SD (min-max)] | (16-795) | (16-271) | (21-795) | (23-741) |
| HCV genotype [n (%)] | ||||
| 1 | 213 (69) | 95 (67) | 90 (70) | 28 (68) |
| 2 | 32 (10) | 19 (13) | 9 (7) | 4 (10) |
| 3 | 26 (8) | 10 (7) | 12 (9) | 4 (10) |
| 4 | 33 (11) | 13 (9) | 15 (12) | 5 (12) |
| 5 | 3 (1) | 2 (1) | 1 (0) | 0 (0) |
| 7 | 1 (0) | 1 (0) | 0 (0) | 0 (0) |
| unknown | 2 (1) | 1 (0) | 1 (0) | 0 (0) |
| Viral load on the date of sampling | 1.5 × 106 | 1.5 × 106 | 1.7 × 106 | 1.0 × 106 |
| (VL): IU/mL [mean (min-max)] | (14-1.1 × 107) | (14-8.9 × 107) | (39-1.1 × 107) | (1.3 × 103-4.2 × 106) |
| SD = standard deviation; | ||||
| IU = international units | ||||
-
- those patients whose value of measurement by FIBROSCAN™ (FS) was lower than 12.5 kPa were assigned to the class “Metavir hepatic fibrosis score lower than F4”; and
- those patients whose value of measurement by FIBROSCAN™ (FS) was higher than or equal to 12.5 kPa were assigned to the class “Metavir hepatic fibrosis score=F4”.
-
- with clinical parameters, such as the body mass index (BMI), the age and the viral load of the patient (VL);
- with the values measured by FIBROSCAN™;
in accordance with the mROC method in order to establish a discriminating rule allowing the stage of fibrosis to be determined (Metavir score F0-F1 or F2-F3).
| TABLE 16 | ||||
| Discriminating rule | Threshold example | |||
| Box-Cox | (threshold | Algorithm of | ||
| linear function | normalization | maximizing the | multivariate | |
| Biomarkers | (generated by mROC) | parameters (λ) | Youden index (δ)) | classification |
| HA + CXCL10 | Z = (1.849) × CXCL10t + (2.368) × | HA: −0.27 | 13.5 | FIG. 11 |
| HAt [function Z7] | CXCL10: −0.116 | |||
| HA + CXCL10 + | Z = (1.853) × CXCL10t + (2.511) × | HA: −0.27 | 14.7 | FIG. 12 |
| BMI + Age + VL | HAt + (−0.00027) × VLt + (−0.0343) × | CXCL10: −0.116 | ||
| aget + (0.4246) × BMIt | VL: 0.288 | |||
| [function Z8] | Age: 0.536 | |||
| BMI: 0.056 | ||||
| HA + CXCL10 + FS | Z = (1.585) × CXCL10t + (2.181) × | HA: −0.27 | 15.7 | FIG. 13 |
| HAt + (2.910) × FSt | CXCL10: −0.116 | |||
| [function Z9] | FS: −0.27 | |||
| FS = measurement of stiffness of liver expressed in kPa equivalent fibrosis (FIBROSCAN ™) | ||||
| TABLE 17 |
| (correct classification rates): |
| Combination | Correct classification rate |
| applied to those | Metavir hepatic fibrosis score |
| patients whose Metavir | F4 (score known | |||
| hepatic fibrosis | or determined by | Total | ||
| score is lower than F4 | F0-F1 | F2-F3 | FIBROSCAN ™) | population |
| Combination | 89% | 69% | 100% | 82% |
| HA + CXCL10 | ||||
| Combination | 84% | 73% | 100% | 82% |
| HA + CXCL10 + | ||||
| VL + Age + BMI | ||||
| Combination | 82% | 84% | 100% | 85% |
| HA + CXCL10 + FS | ||||
-
- methods not based on a linear function can be used; and
- experimental demonstration of a general mROC formulation
-
- methods of multivariate classification based on a function that is not a linear function, for example, methods of multivariate classification based on an affine function, such as the method of logistic regression (LR); or
- methods of multivariate classification that are not based on a (mathematical) function, such as methods based on a decision tree, for example, the CART (Classification And Regression Tree) method.
-
- the mROC method (with linear function);
- the LR method (with affine function);
- the CART method (no mathematical function; classification by decision tree).
| TABLE 18 | |||
| Discriminating rule | Threshold example | ||
| linear function | Box-Cox | (threshold | |
| (generated | normalization | maximizing the | |
| Biomarkers | by mROC) | parameters (λ) | Youden index (δ)) |
| HA | Z = HAt | HA: −0.288 | 2.330 |
| CXCL10 | Z = CXCL10t | CXCL10: −0.116 | 4.242 |
| HA + CXCL10 | Z = (1.999) × | CXCL10: −0.116 | 15.170 |
| CXCL10t + | HA: −0.288 | ||
| (2.852) × HAt | |||
| [function Z4] | |||
| TABLE 19 | |||
| Discriminating rule | |||
| Method | Marker(s) | Function or decision tree | Parameters | Example of threshold(s) |
| CART | HA + CXCL10 | cf. FIG. 12 | NA | h ∈ [42.18; 77.4] |
| i ∈ [209.3; 266.7] | ||||
| j ∈ [454.7; 553.1] | ||||
| [CART3 tree] | ||||
| HA | if HA < threshold, | NA | threshold ∈ [42.18; 77.4] | |
| the score is < F2 | ||||
| if HA ≥ threshold, | ||||
| the score is ≥ F2 | ||||
| CXCL10 | if CXCL10 < threshold, | NA | threshold ∈ [220.8; 440.3] | |
| the score is < F2 | ||||
| if CXCL10 ≥ threshold, | ||||
| the score is ≥ F2 | ||||
| LR | HA + CXCL10 | LOGIT = Intercept + | Intercept ∈ [−3.57; −2.67] | Logit = 0.5 |
| k(CXCL10) + I(HA) | k ∈ [0.003; 0.007] | |||
| [function LOGIT3] | I ∈ [0.02; 0.04] | |||
| HA | LOGIT = Intercept + I(HA) | Intercept ∈ [−2.13; −1.36] | ||
| I ∈ [0.02; 0.04] | ||||
| CXCL10 | LOGIT = Intercept + | Intercept ∈ [−2.41; −1.55] | ||
| k(CXCL10) | k ∈ [0.005; 0.007] | |||
| TABLE 20 | ||
| Learning group n = 207 | ||
| Correct | |||||||
| classification | |||||||
| Combination | Method | Se | Spe | PPV | NPV | rate | AUC |
| HA + CXCL10 | mROC | 76 | 92 | 92 | 76 | 83 | 0.898 |
| HA | mROC | 78 | 79 | 82 | 75 | 78 | 0.845 |
| CXCL10 | mROC | 72 | 75 | 78 | 70 | 74 | 0.802 |
| HA + CXCL10 | CART | 77 | 91 | 91 | 77 | 83 | NA |
| HA | CART | 78 | 79 | 82 | 75 | 78 | NA |
| CXCL10 | CART | 72 | 75 | 78 | 70 | 74 | NA |
| HA + CXCL10 | LR | 76 | 86 | 86 | 75 | 80 | 0.878 |
| HA | LR | 68 | 84 | 84 | 68 | 75 | 0.845 |
| CXCL10 | LR | 72 | 73 | 76 | 68 | 72 | 0.802 |
| TABLE 21 | ||
| Validation group n = 103 | ||
| Correct | |||||||
| classification | |||||||
| Markers | Method | Se | Spe | PPV | NPV | rate | AUC |
| HA + CXCL10 | mROC | 76 | 88 | 88 | 76 | 81 | 0.898 |
| HA | mROC | 76 | 73 | 78 | 73 | 75 | 0.831 |
| CXCL10 | mROC | 73 | 71 | 77 | 70 | 72 | 0.832 |
| HA + CXCL10 | CART | 78 | 91 | 91 | 78 | 84 | NA |
| HA | CART | 76 | 73 | 78 | 73 | 75 | NA |
| CXCL10 | CART | 73 | 71 | 77 | 70 | 72 | NA |
| HA + CXCL10 | LR | 78 | 86 | 87 | 77 | 82 | 0.888 |
| HA | LR | 68 | 83 | 83 | 68 | 75 | 0.831 |
| CXCL10 | LR | 77 | 72 | 77 | 72 | 75 | 0.832 |
| HA = serum concentration of hyaluronic acid (HA), in ng/mL | |||||||
| CXCL10 = serum concentration of protein CXCL10 (CXCL10), in pg/mL | |||||||
| NA = not applicable | |||||||
-
- methods of multivariate classification based on a function that is not a linear function, for example, methods of multivariate classification based on an affine function, such as the LR method;
- as well as classification methods that are not based on a (mathematical) function, such as methods based on a decision tree, for example, the CART method.
| TABLE 22 | |||
| Discriminating rule | |||
| Function or | Example | ||
| Method | decision tree | Parameters | of threshold(s) |
| mROC | Z = a × (CXCL10t) + | a = 1.999 | δ1 = 15.170 |
| b × (HAt) | b = 2.852 | ||
| [function Z4] | λCXCL10 = −0.116 | ||
| λHA = −0.288 | |||
| mROC | Z = a × (CXCL10t) + | a = 1.999 | δ2 = 16.543 |
| b × (HAt) + c × | b = 2.958 | ||
| (BMIt) + d × (aget) + | c = 0.616 | ||
| e × (VLt) | d = −0.053 | ||
| [function Z5] | e = −0.00024 | ||
| λCXCL10 = −0.116 | |||
| λHA = −0.288 | |||
| λBMI = −0.039 | |||
| λAge = 0.433 | |||
| λVL = 0.279 | |||
| CART | cf. FIG. 12 | NA | h = 47.29 |
| i = 209.3 | |||
| j = 503.4 | |||
| [CART4 tree] | |||
| LR | LOGIT = Intercept + | Intercept = −3.164 | Logit = 0.5 |
| k(CXCL10) + | k = 0.005 | ||
| I(HA), | I = 0.024 | ||
| [function LOGIT4] | |||
| HA = serum concentration of hyaluronic acid, in ng/mL | |||
| CXCL10 = serum concentration of protein CXCL10, in pg/mL | |||
-
- a Metavir hepatic fibrosis score lower than F2 if their serum concentration of protein CXCL10 in pg/mL was lower than the value of the parameter j (503.4); and
- a Metavir hepatic fibrosis score greater than or equal to F2 if their serum concentration of protein CXCL10 in pg/mL was greater than or equal to the value of parameter j (503.4).
-
- a Metavir hepatic fibrosis score lower than F2 if their serum concentration of protein CXCL10 in pg/mL was lower than the value of the parameter i (209.3); and
- a Metavir hepatic fibrosis score greater than or equal to F2 if their serum concentration of protein CXCL10 in pg/mL was greater than or equal to the value of parameter i (209.3).
| TABLE 23 | ||
| Total population n = 310 | ||
| Correct | |||||||
| classification | |||||||
| Combination | Method | Se | Spe | PPV | NPV | rate | AUC |
| HA + CXCL10 | mROC | 78 | 90 | 90 | 77 | 83 | 0.898 |
| HA + | mROC | 80 | 87 | 88 | 78 | 83 | 0.899 |
| CXCL10 + | |||||||
| BMI + Age + | |||||||
| VL | |||||||
| HA + CXCL10 | CART | 82 | 89 | 90 | 80 | 85 | NA |
| HA + CXCL10 | LR | 77 | 87 | 87 | 76 | 81 | 0.882 |
| HA = serum concentration of hyaluronic acid (HA), in ng/mL | |||||||
| CXCL10 = serum concentration of protein CXCL10 (CXCL10), in pg/mL | |||||||
| Age = age of the patient at the sampling date | |||||||
| BMI = body mass index of the patient at the sampling date (mass/height2) | |||||||
| VL = viral load of the patient at the sampling date, in IU/mL | |||||||
| NA = not applicable | |||||||
| TABLE 24 | |||
| Multivariate classification method | |||
| Discriminating rule | Parameters | Example of threshold(s) | Performance |
| mROC | 0.812 ≤ a ≤ 5.089 | 11.68 ≤ δ ≤ 23.71 | AUC ≥0.865 |
| Z = a(CXCL10t) + b(HAt) | 2.033 ≤ b ≤ 4.462 | [0.865 ≤ AUC ≤ 0.931] | |
| [function Z10] | −0.262 ≤ λCXCL10 ≤ 0.030 | CCR ≥80% | |
| −0.382 ≤ λHA ≤ −0.219 | [80% ≤ CCR ≤ 88%] | ||
| mROC | 0.748 ≤ a ≤ 5.357 | 11 ≤ δ ≤ 25.87 | AUC ≥0.868 |
| Z = a(CXCL10t) + b(HAt) + c(BMIt) + d(aget) + | 2.075 ≤ b ≤ 4.690 | [0.868 ≤ AUC ≤ 0.933] | |
| e(VLt) | −0.848 ≤ c ≤ 3.697 | CCR ≥80% | |
| [function Z11] | −0.746 ≤ d ≤ 0.147 | [80% ≤ CCR ≤ 88%] | |
| −0.003 ≤ e ≤ 0.002 | |||
| −0.262 ≤ λCXCL10 ≤ 0.047 | |||
| −0.882 ≤ λHA ≤ −0.219 | |||
| −5.545 ≤ λBMI ≤ 0.485 | |||
| −0.116 ≤ λage ≤ 0.828 | |||
| 0.236 ≤ λVL ≤ 0.305 | |||
| Multivariate classification | CART (Classification And | NA | 41.96 ≤ h ≤ 77.43 | CCR ≥81% |
| method not based on a | Regression Tree) | 159.0 ≤ i ≤ 266.7 | [81% ≤ CCR ≤ 89%] | |
| linear function | cf. FIG. 12 (markers | 410.7 < j < 613.5 | ||
| HA and CXCL10) | [CART2 tree] | |||
| LR (logistic regression) | −4.481 ≤ Intercept ≤ | Logit = 0.5, for example | AUC ≥0.844 | |
| LOGIT = Intercept + | −2.398 | [0.844 ≤ AUC ≤ 0.921] | ||
| k(CXCL10) + I(HA) | 0.003 ≤ k ≤ 0.008 | CCR ≥77% | ||
| [function LOGIT2] | 0.013 ≤ I ≤ 0.045 | [77% ≤ CCR ≤ 86%] | ||
| CCR = correct classification rate; | ||||
| NA = not applicable | ||||
Z=a(CXCL10t)+b(HAt)+c(BMIt)+d(aget)+e(VLt)+f(FSt) [function Z12]
with:
a and b each being independently a positive real number going from +0.1 to +6.0, more particularly from +0.3 to +5.5;
c being a real number going from −10.0 to +4.0;
d being a real number going from −0.8 to +0.2;
e being a real number going from −0.003 to +0.002;
f being a real number going from +0.0 to +10.0;
λCXCL10, λHA, λBMI, λage, λVL and λFS each being independently a real number going from −6.0 to 1.2, but excluding zero.
Z=a(CXCL10t)+b(HAt)+c(BMIt)+d(aget)+e(VLt)+f(FSt) [function Z13]
with:
a and b each being independently a positive real number going from +0.1 to +6.0;
c, d, e and f each being independently a real number going from −10.0 to +10.0;
λCXCL10, λHA, λBMI, λage, λVL and λFS each being independently a real number going from −6.0 to 1.2, but excluding zero.
LOGIT=Intercept+k(CXCL10)+l(AH), [function LOGIT1]
with
−5≤Intercept≤−1
0.001≤k≤0.010
0.010≤l≤0.050.
-
- on the one hand, when the applied mROC discriminating rule has the coefficients and threshold initially established on the population of 310 patients (“fix coefficients” or “coef fix”); and
- on the other hand, when the applied mROC discriminating rule has those coefficients and threshold determined for each of the 1000 subpopulations (“optimized coefficients” or “coef optim”);
cf. Example 3 above.
- Adam et al. 2005. Clinical. Chemistry 51(10): 1867-1873.
- Anastasiadis et al. 2005; New globally convergent training scheme based on the resilient propagation algorithm. Neurocomputing 64; 253-270.
- Berkson 1944. Application of the Logistic Function to Bio-Easy, Journal of the American Statistical Association, volume 39, pages 357-365.
- Berkson 1951. Why I Prefer Logits to Probits. Biometrics, vol., 7, 1951, p. 327-329.
- Booth et al. 2002. Biochemistry 41 (33): 10418-10425.
- Boursier et al. 2012. Hepatology 55(1): 58-67.
- Box et Cox 1964. An analysis of transformations. Journal of the Royal Statistical Society, Series B 26; 211-243,
- Breiman Friedman, Stone et Olshen 1984. Classification and regression trees. Monterey, Calif.: Wadsworth & Brooks/Cole Advanced Books & Software. ISBN 978-0-412-04841-8.
- Breiman 2001; Random Forests. Machine Learning 45:5-32.
- Castera et al. 2005. Gastroenterology 128: 343-350.
- Castera et al. 2010. Journal of Hepatology 52: 191-198.
- Castera et al. 2014. Comparison of transient elastography (Fibroscan), Fibrotest, APRI and two algorithms combining these non-invasive tests for liver fibrosis staging in HIV/HCV coninfected patients: ANRS CO13 HEPAVIH and FIBROSTIC collaboration. HIV Medicine 15(1):30-39.
- Castera 2012. Gastroenterology 142; 1293-1302.
- Chambers 2008; Software for data analysis: programming with R. Springer, New York, ISBN 978-0-387-75935-7.
- Efron 1979. Bootstrap Methods: Another Look at the Jacknife. Annals of Statistics, volume no. 7, no. 1, pages 1-26.
- Falissard 2005; Comprendre et utiliser les statistiques dans les sciences de la vie, Masson.
- Forms et al. 2002. Hepatology 36: 986-992.
- Goodman 2007. Journal of Hepatology 47: 598-607.
- Hastle, Tibishirani et Friedman, 2009; “The Elements of Statistical Learning: Data Mining, Inference and Predication”, 2nd Edition, Springer.
- Imbert-Bismut et al. 2001. The Lancet 357: 1069-1075.
- Intrator et Intrator 1993; Using Neural Nets for Interpretation of Nonlinear Models. Proceedings of the Statistical Computing Section, San Francisco: American Statistical Society (eds), pages 244-249.
- Kelleher et al. 2005. Journal of Hepatology 43; 78-84.
- Kramar et al. 1999; Critéres ROC généralisés pour l'évaluation de plusieurs marqueurs tumoraux. Revue d'Epidémiologie et Santé Publique 47: 376-383.
- Kramar et al. 2001. mROC: a computer program for combining tumour markers in predicting disease states. Computer methods and programs in biomedicine 66: 199-207.
- Liaw et Wiener 2002; Classification and regression by Random Forest. R. News 23: 18-22.
- Nakane et Kawaol 1974. J. Histochem. Cytochem. 22(12): 1084-1091.
- Reiser et Faraggi 1997; Confidence intervals for the generalized ROC criterion. Biometrics 53: 644-652.
- Riedmiller 1994; Rprop—Description and Implementation Details. Technical Report. University of Karlsruhe.
- Riedmiller et Braun 1993; A direct adaptive method for faster backpropagation learning: the RPROP algorithm. Proceedings of the IEEE International Conference on Neural Networks (ICNN), San Francisco, pages 586-591.
- Shapiro 1999; The interpretation of diagnostic tests. Statistical Methods in Medical Research, 8: 113-134.
- Su et Liu 1993; Linear combinations of multiple diagnostic markers. Journal of the American Statistical Association 88: 1350-1355.
- Swaminathan et al. 2003. Structure 11(5):521-532.
- Theodoridis et Koutroumbos 2009; Pattern Recognition. Academic Press, Elsevier.
- Wai et al. 2003. Hepatology 38: 518-526.
- Zerenski et al. 2009. The Journal of Infectious Diseases 200: 1774-1780.
- U.S. Pat. No. 7,141,380 B2
- US 2007/0225919 A1
- U.S. Pat. No. 6,986,995 B2
- U.S. Pat. No. 8,489,335 B2
Claims (9)
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| FR1456037A FR3023003B1 (en) | 2014-06-27 | 2014-06-27 | SYNERGISTIC COMBINATION OF BIOMARKERS FOR THE DETECTION AND EVALUATION OF A HEPATIC FIBROSIS |
| FR1456037 | 2014-06-27 | ||
| PCT/FR2015/051518 WO2015197934A1 (en) | 2014-06-27 | 2015-06-09 | Synergistic combination of biomarkers for detecting and assessing hepatic fibrosis |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/FR2015/051518 A-371-Of-International WO2015197934A1 (en) | 2014-06-27 | 2015-06-09 | Synergistic combination of biomarkers for detecting and assessing hepatic fibrosis |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/226,129 Division US20210239713A1 (en) | 2014-06-27 | 2021-04-09 | Synergistic combination of biomarkers for detecting and assessing hepatic fibrosis |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| US20170160289A1 US20170160289A1 (en) | 2017-06-08 |
| US10976324B2 true US10976324B2 (en) | 2021-04-13 |
Family
ID=51659814
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/320,862 Active 2037-06-26 US10976324B2 (en) | 2014-06-27 | 2015-06-09 | Synergistic combination of biomarkers for detecting and assessing hepatic fibrosis |
| US17/226,129 Pending US20210239713A1 (en) | 2014-06-27 | 2021-04-09 | Synergistic combination of biomarkers for detecting and assessing hepatic fibrosis |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/226,129 Pending US20210239713A1 (en) | 2014-06-27 | 2021-04-09 | Synergistic combination of biomarkers for detecting and assessing hepatic fibrosis |
Country Status (5)
| Country | Link |
|---|---|
| US (2) | US10976324B2 (en) |
| EP (1) | EP3161492B1 (en) |
| KR (1) | KR102403106B1 (en) |
| FR (1) | FR3023003B1 (en) |
| WO (1) | WO2015197934A1 (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11808772B2 (en) | 2017-07-19 | 2023-11-07 | Bio-Rad Europe Gmbh | Biomarker combinations to simultaneously evaluate non-alcoholic steatohepatitis and hepatic fibrosis status |
| US12110551B2 (en) | 2011-02-09 | 2024-10-08 | Bio-Rad Europe Gmbh | Combination of biomarkers for detecting and evaluating a hepatic fibrosis |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FR3023003B1 (en) | 2014-06-27 | 2016-07-15 | Bio-Rad Innovations | SYNERGISTIC COMBINATION OF BIOMARKERS FOR THE DETECTION AND EVALUATION OF A HEPATIC FIBROSIS |
| CN119147755B (en) * | 2024-11-18 | 2025-05-23 | 北京科跃中楷生物技术有限公司 | Early warning kit for liver fibrosis and antibody preparation thereof |
Citations (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2002016949A1 (en) | 2000-08-21 | 2002-02-28 | Assistance Publique - Hopitaux De Paris | Diagnosis method of fibrotic disease using biochemical markers |
| US6631330B1 (en) | 2000-08-21 | 2003-10-07 | Assistance Publique-Hopitaux De Paris (Ap-Hp) | Diagnosis method of inflammatory, fibrotic or cancerous disease using biochemical markers |
| WO2006082522A1 (en) | 2005-02-03 | 2006-08-10 | Assistance Publique - Hopitaux De Paris | Diagnosis method of hepatic steatosis using biochemical markers |
| WO2006103570A2 (en) | 2005-02-03 | 2006-10-05 | Assistance Publique-Hopitaux De Paris | Diagnosis method of alcoholic or non-alcoholic steato-hepatitis using biochemical markers |
| WO2007072290A2 (en) | 2005-12-21 | 2007-06-28 | Koninklijke Philips Electronics N.V. | Method of performing a microarray assay |
| US20070172907A1 (en) | 2000-04-28 | 2007-07-26 | Michael Volker | Liver disease-related methods and systems |
| US20080161203A1 (en) | 2006-12-27 | 2008-07-03 | Su Chun-Lin | Markers identified for liver fibrosis and cirrhosis and the microarray panel thereof |
| US20100041069A1 (en) | 2008-07-17 | 2010-02-18 | Ramot At Tel Aviv University Ltd. | Methods for diagnosing and monitoring liver diseases |
| US20100136579A1 (en) | 2008-12-02 | 2010-06-03 | Industrial Technology Research Institute | Biomarkers useful in liver fibrosis diagnosis |
| US20100203553A1 (en) | 2009-02-11 | 2010-08-12 | Abdeen Suad M | Histochemical and biomarker for liver fibrosis |
| US7824871B2 (en) | 2007-06-14 | 2010-11-02 | George Mason Intellectual Properties | Methods of diagnosing non-alcoholic steatohepatitis (NASH) |
| US20110014126A1 (en) | 2007-11-06 | 2011-01-20 | Evans Ronald M | Use of vitamin d receptor agonists and precursors to treat fibrosis |
| WO2012107528A1 (en) | 2011-02-09 | 2012-08-16 | Bio-Rad Innovations | Combination of biomarkers for forecasting a response or non-response to an anti-hcv treatment |
| WO2012107530A1 (en) | 2011-02-09 | 2012-08-16 | Bio-Rad Innovations | Combination of biomarkers for detecting and evaluating a hepatic fibrosis |
| US20170160289A1 (en) | 2014-06-27 | 2017-06-08 | Bio-Rad Innovations | Synergistic combination of biomarkers for detecting and assessing hepatic fibrosis |
| WO2019018610A1 (en) | 2017-07-19 | 2019-01-24 | Bio-Rad Europe Gmbh | Biomarker combinations to simultaneously evaluate non-alcoholic steatohepatitis and hepatic fibrosis status |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4376110A (en) | 1980-08-04 | 1983-03-08 | Hybritech, Incorporated | Immunometric assays using monoclonal antibodies |
| ES2288962T3 (en) | 2000-04-28 | 2008-02-01 | Bayer Aktiengesellschaft | DIAGNOSIS OF HEPATIC FIBROSIS WITH ALGORITHMS OF SERIAL MARKERS. |
| US6986995B2 (en) | 2002-02-28 | 2006-01-17 | Prometheus Laboratories, Inc. | Methods of diagnosing liver fibrosis |
| FR2870348B1 (en) | 2004-05-14 | 2010-08-27 | Univ Angers | METHOD FOR DIAGNOSING THE PRESENCE AND / OR SEVERITY OF A HEPATHIC PATHOLOGY IN A SUBJECT |
| US8676511B2 (en) | 2006-03-24 | 2014-03-18 | Gary Jeffrey | Method and system for predicting liver fibrosis and related pathologies |
-
2014
- 2014-06-27 FR FR1456037A patent/FR3023003B1/en active Active
-
2015
- 2015-06-09 WO PCT/FR2015/051518 patent/WO2015197934A1/en not_active Ceased
- 2015-06-09 KR KR1020177002714A patent/KR102403106B1/en active Active
- 2015-06-09 US US15/320,862 patent/US10976324B2/en active Active
- 2015-06-09 EP EP15733814.6A patent/EP3161492B1/en active Active
-
2021
- 2021-04-09 US US17/226,129 patent/US20210239713A1/en active Pending
Patent Citations (22)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20070172907A1 (en) | 2000-04-28 | 2007-07-26 | Michael Volker | Liver disease-related methods and systems |
| WO2002016949A1 (en) | 2000-08-21 | 2002-02-28 | Assistance Publique - Hopitaux De Paris | Diagnosis method of fibrotic disease using biochemical markers |
| US6631330B1 (en) | 2000-08-21 | 2003-10-07 | Assistance Publique-Hopitaux De Paris (Ap-Hp) | Diagnosis method of inflammatory, fibrotic or cancerous disease using biochemical markers |
| WO2006082522A1 (en) | 2005-02-03 | 2006-08-10 | Assistance Publique - Hopitaux De Paris | Diagnosis method of hepatic steatosis using biochemical markers |
| WO2006103570A2 (en) | 2005-02-03 | 2006-10-05 | Assistance Publique-Hopitaux De Paris | Diagnosis method of alcoholic or non-alcoholic steato-hepatitis using biochemical markers |
| WO2007072290A2 (en) | 2005-12-21 | 2007-06-28 | Koninklijke Philips Electronics N.V. | Method of performing a microarray assay |
| US20080161203A1 (en) | 2006-12-27 | 2008-07-03 | Su Chun-Lin | Markers identified for liver fibrosis and cirrhosis and the microarray panel thereof |
| US7824871B2 (en) | 2007-06-14 | 2010-11-02 | George Mason Intellectual Properties | Methods of diagnosing non-alcoholic steatohepatitis (NASH) |
| US20110014126A1 (en) | 2007-11-06 | 2011-01-20 | Evans Ronald M | Use of vitamin d receptor agonists and precursors to treat fibrosis |
| US20100041069A1 (en) | 2008-07-17 | 2010-02-18 | Ramot At Tel Aviv University Ltd. | Methods for diagnosing and monitoring liver diseases |
| US20100136579A1 (en) | 2008-12-02 | 2010-06-03 | Industrial Technology Research Institute | Biomarkers useful in liver fibrosis diagnosis |
| US20100203553A1 (en) | 2009-02-11 | 2010-08-12 | Abdeen Suad M | Histochemical and biomarker for liver fibrosis |
| US20130316332A1 (en) | 2011-02-09 | 2013-11-28 | Bio-Rad Innovations | Combination of biomarkers for the prognosis of response or non-response to an anti-hcv treatment |
| WO2012107530A1 (en) | 2011-02-09 | 2012-08-16 | Bio-Rad Innovations | Combination of biomarkers for detecting and evaluating a hepatic fibrosis |
| WO2012107528A1 (en) | 2011-02-09 | 2012-08-16 | Bio-Rad Innovations | Combination of biomarkers for forecasting a response or non-response to an anti-hcv treatment |
| US20130323720A1 (en) * | 2011-02-09 | 2013-12-05 | Bio Rad Innovations | Combination of biomarkers for the detection and evaluation of hepatitis fibrosis |
| US9624541B2 (en) | 2011-02-09 | 2017-04-18 | Bio-Rad Innovations | Combination of biomarkers for the detection and evaluation of hepatitis fibrosis |
| US10435744B2 (en) | 2011-02-09 | 2019-10-08 | Bio-Rad Europe Gmbh | Combination of biomarkers for detecting and evaluating a hepatic fibrosis |
| US20200056235A1 (en) | 2011-02-09 | 2020-02-20 | Bio-Rad Europe Gmbh | Combination of biomarkers for detecting and evaluating a hepatic fibrosis |
| US20170160289A1 (en) | 2014-06-27 | 2017-06-08 | Bio-Rad Innovations | Synergistic combination of biomarkers for detecting and assessing hepatic fibrosis |
| WO2019018610A1 (en) | 2017-07-19 | 2019-01-24 | Bio-Rad Europe Gmbh | Biomarker combinations to simultaneously evaluate non-alcoholic steatohepatitis and hepatic fibrosis status |
| US20200249242A1 (en) | 2017-07-19 | 2020-08-06 | Bio-Rad Europe Gmbh | Biomarker combinations to simultaneously evaluate non-alcoholic steatohepatitis and hepatic fibrosis status |
Non-Patent Citations (101)
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12110551B2 (en) | 2011-02-09 | 2024-10-08 | Bio-Rad Europe Gmbh | Combination of biomarkers for detecting and evaluating a hepatic fibrosis |
| US11808772B2 (en) | 2017-07-19 | 2023-11-07 | Bio-Rad Europe Gmbh | Biomarker combinations to simultaneously evaluate non-alcoholic steatohepatitis and hepatic fibrosis status |
| US12601747B2 (en) | 2017-07-19 | 2026-04-14 | Bio-Rad Laboratories, Inc. | Biomarker combinations to simultaneously evaluate non-alcoholic steatohepatitis and hepatic fibrosis status |
Also Published As
| Publication number | Publication date |
|---|---|
| FR3023003A1 (en) | 2016-01-01 |
| EP3161492B1 (en) | 2019-12-04 |
| US20210239713A1 (en) | 2021-08-05 |
| KR102403106B1 (en) | 2022-05-27 |
| US20170160289A1 (en) | 2017-06-08 |
| FR3023003B1 (en) | 2016-07-15 |
| EP3161492A1 (en) | 2017-05-03 |
| WO2015197934A1 (en) | 2015-12-30 |
| KR20170023174A (en) | 2017-03-02 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20210239713A1 (en) | Synergistic combination of biomarkers for detecting and assessing hepatic fibrosis | |
| US20220205039A1 (en) | Combination of biomarkers for detecting and evaluating a hepatic fibrosis | |
| US20240426842A1 (en) | Novel biomarkers and methods for diagnosing and evaluating traumatic brain injury | |
| Blaho et al. | Autoimmune pancreatitis–An ongoing challenge | |
| EP3349011B1 (en) | Liver cancer test method | |
| Rajaei et al. | Evaluating the relationship between serum level of interleukin-6 and rheumatoid arthritis severity and disease activity | |
| JP5518836B2 (en) | Method for diagnosing pulmonary arterial hypertension | |
| US9879320B2 (en) | Combination of biomarkers for the prognosis of response or non-response to an anti-HCV treatment | |
| US20140186293A1 (en) | Immunoglobulin-bound extracellular vesicles and uses thereof | |
| KR20260003222A (en) | Diagnosis of terminal hepatocellular carcinoma | |
| Chan et al. | Predictive value of urinary aquaporin 2 for acute kidney injury in patients with acute decompensated heart failure | |
| Bian et al. | Serum HBV RNA is associated with liver fibrosis regression in HBeAg‐positive chronic hepatitis B patients treated with nucleos (t) ide analogues | |
| CN103376324A (en) | Application of albumin as obesity-diabetes marker | |
| JP2008241704A (en) | New stress biomarkers and their uses | |
| CN103376326A (en) | Application of vitamin D binding protein as obesity-diabetes marker | |
| WO2025193825A1 (en) | Diagnosis and monitoring of liver disease | |
| Surma et al. | Pediatric inflammatory multisystem syndrome and SARS-CoV-2 | |
| WO2016003893A1 (en) | Detection of colorectal cancer with two novel heme-related molecules in human feces | |
| JP2024140805A (en) | Methods for determining autoimmune subfornical organ disease | |
| CN113789387A (en) | Use of markers in the diagnosis of abdominal aortic aneurysm | |
| Class et al. | Patent application title: COMBINATION OF BIOMARKERS FOR THE PROGNOSIS OF RESPONSE OR NON-RESPONSE TO AN ANTI-HCV TREATMENT Inventors: Ivan Bieche (Suresnes, FR) Bénédicte Watelet (Saint Clement De Riviere, FR) Bénédicte Watelet (Saint Clement De Riviere, FR) Bénédicte Watelet (Saint Clement De Riviere, FR) Tarik Asselah (Paris, FR) Isabelle Catherine Batxelli (Aigues-Vives, FR) Eve Laure Mathieu (Montpellier, FR) Nathalie Jullian (Montrouge, FR) Michel Vidaud (Fontenay Sous Bois, FR) Patrick Marcellin (Paris, FR) Mohammad Afshar (Paris, FR) Assignees: BIO-RAD INNOVATIONS ARIANA PHARMACEUTICALS CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE Assistance Publique-Hopitaux De Paris Institut National de la Sante et de la Recherche Medicale | |
| US20180136222A1 (en) | Method for detecting and measuring endogenous complexes as a new tumour marker | |
| CN105452484A (en) | Novel biomarkers |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE AFTER FINAL ACTION FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED |
|
| STCF | Information on status: patent grant |
Free format text: PATENTED CASE |
|
| AS | Assignment |
Owner name: UNIVERSITE DE PARIS, FRANCE Free format text: MERGER;ASSIGNOR:UNIVERSITE PARIS DIDEROT - PARIS 7;REEL/FRAME:056817/0647 Effective date: 20200101 |
|
| AS | Assignment |
Owner name: UNIVERSITE PARIS CITE, FRANCE Free format text: CHANGE OF NAME;ASSIGNOR:UNIVERSITE DE PARIS;REEL/FRAME:059504/0225 Effective date: 20220304 |
|
| MAFP | Maintenance fee payment |
Free format text: PAYMENT OF MAINTENANCE FEE, 4TH YEAR, LARGE ENTITY (ORIGINAL EVENT CODE: M1551); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY Year of fee payment: 4 |
