US10933064B2 - Crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine and new salts - Google Patents

Crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine and new salts Download PDF

Info

Publication number
US10933064B2
US10933064B2 US16/616,844 US201816616844A US10933064B2 US 10933064 B2 US10933064 B2 US 10933064B2 US 201816616844 A US201816616844 A US 201816616844A US 10933064 B2 US10933064 B2 US 10933064B2
Authority
US
United States
Prior art keywords
seq
amino acid
acid sequence
cancer
crystalline form
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Expired - Fee Related
Application number
US16/616,844
Other versions
US20200163963A1 (en
Inventor
Kai Cui
Julio Cesar Castro-Palomino Laria
Weiyong KONG
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novartis AG
Ruibo Suzhou Pharmaceutical Co Ltd
Palobiofarma SL
Original Assignee
Novartis AG
Palobiofarma SL
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Novartis AG, Palobiofarma SL filed Critical Novartis AG
Assigned to PALOBIOFARMA S.L. reassignment PALOBIOFARMA S.L. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: CASTRO-PALOMINO LARIA, JULIO CESAR
Assigned to NOVARTIS AG reassignment NOVARTIS AG ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: SUZHOU NOVARTIS PHARMA TECHNOLOGY CO., LTD.
Assigned to SUZHOU NOVARTIS PHARMA TECHNOLOGY CO., LTD. reassignment SUZHOU NOVARTIS PHARMA TECHNOLOGY CO., LTD. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: KONG, Weiyong, CUI, Kai
Publication of US20200163963A1 publication Critical patent/US20200163963A1/en
Application granted granted Critical
Publication of US10933064B2 publication Critical patent/US10933064B2/en
Expired - Fee Related legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/506Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim not condensed and containing further heterocyclic rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D403/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00
    • C07D403/14Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing three or more hetero rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07BGENERAL METHODS OF ORGANIC CHEMISTRY; APPARATUS THEREFOR
    • C07B2200/00Indexing scheme relating to specific properties of organic compounds
    • C07B2200/13Crystalline forms, e.g. polymorphs
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]

Definitions

  • the present disclosure generally relates to crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine and new salts.
  • the present disclosure also generally relates to a pharmaceutical composition comprising the crystalline forms, as well of methods of using the crystalline forms in the treatment of particular cancers, and methods for obtaining such crystalline forms.
  • the compound of Formula I is useful in the treatment of various disease states associated with the inhibition of the activity of Adenosine A2a receptor. As such, the compound of Formula I is therefore useful in the treatment of certain cancers, including, for example, a lung cancer, a melanoma, a renal cancer, a liver cancer, a myeloma, a prostate cancer, a breast cancer, a colorectal cancer, a pancreatic cancer, a head and neck cancer, anal cancer, gastro-esophageal cancer, thyroid cancer, cervical cancer, a lymphoproliferative disease or a hematological cancer, T-cell lymphoma, B-cell lymphoma, a non-Hogdkin lymphoma, or a leukemia.
  • cancers including, for example, a lung cancer, a melanoma, a renal cancer, a liver cancer, a myeloma, a prostate cancer, a breast cancer, a colorectal cancer, a
  • Compound of Formula I is also useful in the treatment of neurodegenerative diseases such as Parkinson's disease, Huntington's or Alzheimer diseases, neuropsychiatric disorders and dysfunctions such as depression, excessive daytime sleepiness, restless legs syndrome, attention deficit hyperactivity disorder and cognitive fatigue.
  • neurodegenerative diseases such as Parkinson's disease, Huntington's or Alzheimer diseases
  • neuropsychiatric disorders and dysfunctions such as depression, excessive daytime sleepiness, restless legs syndrome, attention deficit hyperactivity disorder and cognitive fatigue.
  • the solid state form of the active pharmaceutical ingredient (API) of a particular drug is often an important determinant of the drug's ease of preparation, hygroscopicity, stability, solubility, storage stability, ease of formulation, rate of dissolution in gastrointestinal fluids and in vivo bioavailability.
  • Crystalline forms occur where the same composition of matter crystallizes in a different lattice arrangement resulting in different thermodynamic properties and stabilities specific to the particular crystalline form. Crystalline forms may also include different hydrates or solvates of the same compound. In deciding which form is preferable, the numerous properties of the forms are compared and the preferred form chosen based on the many physical property variables.
  • the present disclosure provides crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine hydrochloride salts.
  • the hydrochloride salts further include water (referred to herein as hydrates).
  • the present disclosure also provides crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine sulfate salt and 2 mesylate salt forms.
  • the present disclosure further provide two crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine in its free form (or non-salt form).
  • Embodiments of these crystalline forms include those forms designated herein as Form A, Form B, Form C, Form D, Form E, Form F and Form G.
  • the names used herein to identify a specific form e.g. “Form A” etc., should not be considered limiting with respect to any other substance possessing similar or identical physical and chemical characteristics, but rather it should be understood that these designations are mere identifiers that should be interpreted according to the characterization information also presented herein.
  • FIG. 1 provides an illustrative XRPD spectrum for the mono-hydrochloride hydrate salt of the compound of Formula I, designated herein as Form A, showing degrees 2 ⁇ (2-theta) on the X-axis and relative intensity on the Y-axis.
  • FIG. 2 provides an illustrative DSC/TGA for the mono-hydrochloride hydrate salt of the compound of Formula I, designated herein as Form A.
  • FIG. 3 provides an illustrative XRPD spectrum for the di-hydrochloride hydrate salt of the compound of Formula I, designated herein as Form B, showing degrees 2 ⁇ (2-theta) on the X-axis and relative intensity on the Y-axis.
  • FIG. 4 provides an illustrative DSC/TGA for the di-hydrochloride hydrate salt of the compound of Formula I, designated herein as Form B.
  • FIG. 5 provides an illustrative XRPD spectrum for the sulfate salt of the compound of Formula I, designated herein as Form C, showing degrees 2 ⁇ (2-theta) on the X-axis and relative intensity on the Y-axis.
  • FIG. 6 provides an illustrative DSC/TGA for the sulfate salt of the compound of Formula I, designated herein as Form C.
  • FIG. 7 provides an illustrative XRPD spectrum for the mesylate salt (Modification 1) of the compound of Formula I, designated herein as Form D, showing degrees 2 ⁇ (2-theta) on the X-axis and relative intensity on the Y-axis.
  • FIG. 8 provides an illustrative DSC/TGA for the mesylate salt (Modification 1) of the compound of Formula I, designated herein as Form D.
  • FIG. 9 provides an illustrative XRPD spectrum for the mesylate salt (Modification 2) of the compound of Formula I, designated herein as Form E, showing degrees 2 ⁇ (2-theta) on the X-axis and relative intensity on the Y-axis.
  • FIG. 10 provides an illustrative DSC/TGA for the mesylate salt (Modification 2) of the compound of Formula I, designated herein as Form E.
  • FIG. 11 provides an illustrative XRPD spectrum for the free form of the compound of Formula I (modification 1), designated herein as Form F, showing degrees 2 ⁇ (2-theta) on the X-axis and relative intensity on the Y-axis.
  • FIG. 12 provides an illustrative DSC/TGA for the free form of the compound of Formula I (modification 1), designated herein as Form F.
  • FIG. 13 provides an illustrative XRPD spectrum for the free form of the compound of Formula I (modification 2), designated herein as Form G, showing degrees 2 ⁇ (2-theta) on the X-axis and relative intensity on the Y-axis.
  • FIG. 14 provides an illustrative DSC/TGA for the free form of the compound of Formula I (modification 2), designated herein as Form G.
  • measured values from XRPD experiments and DSC/TGA experiments can vary as a result of, for example, sample preparation and/or storage and/or environmental conditions, and yet the measured values will still be considered to be representative of a particular solid state form of the crystalline materials described herein.
  • the present disclosure relates to crystalline forms of various salts of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (the compound of Formula I), which are described and characterized herein.
  • the present invention also relates to various crystalline forms of the free form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine, which are described and characterized herein.
  • the present disclosure provides a crystalline form of the mono-hydrochloride hydrate salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (Form A) having an X-ray powder diffraction (XRPD) pattern comprising a representative peak, in terms of °2 ⁇ , at 10.0 ⁇ 0.2 °2 ⁇ .
  • the XRPD pattern further comprises one or more additional representative peaks chosen from 29.1 ⁇ 0.2 °2 ⁇ , 28.5 ⁇ 0.2 °2 ⁇ , and 20.8 ⁇ 0.2 °2 ⁇ .
  • the XRPD pattern for the crystalline form of the mono-hydrochloride hydrate salt of the compound of Formula I may comprise one, two, three, or four representative peaks above.
  • the crystalline form of the mono-hydrochloride hydrate salt of the compound of Formula I has an XRPD pattern that may further include one or more additional representative peaks chosen from 25.3 ⁇ 0.2 °2 ⁇ and 15.6 ⁇ 0.2 °2 ⁇ .
  • the XRPD pattern for the crystalline form of the mono-hydrochloride hydrate salt of the compound of Formula I may comprise one, two, three, four, five or six representative peaks disclosed above or disclosed in table 1.
  • a crystalline form of the mono-hydrochloride hydrate salt of the compound of Formula I has an XRPD pattern substantially as shown in FIG. 1 . It should be understood that the water content of Form A can be in the range of about 3.0% to about 5.0% and still be considered to be a monohydrate having the XRPD pattern comprising the one, two, three, four, five or six representative peaks described above. The water content for Form A is 4.87%.
  • a crystalline form of the mono-hydrochloride hydrate salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine may be characterized thermally.
  • a crystalline form of the mono-hydrochloride hydrate salt of the compound of Formula I has a differential thermogravimetric profile comprising an endothermic peak starting at about 78.16° C. with an enthalpy ⁇ H of 300.87 J/g (corresponding to the dehydration) and an endothermic peak starting at about 212.48° C. with an enthalpy ⁇ H of 86.83 J/g (corresponding to the melting).
  • a crystalline form of the mono-hydrochloride hydrate salt of the compound of Formula I has a DSC thermogram that is substantially as shown in FIG. 2 . It should be understood that hydrated forms may yield different thermograms (in terms of peak shape and profile) depending on instrument parameters, thus the same material may have thermograms that look substantially different from each other when the data is generated on two different instruments.
  • a crystalline form of the mono-hydrochloride hydrate salt of the compound of Formula I has a thermo gravimetric analysis (TGA) diagram substantially the same as that shown in shown in FIG. 2 .
  • the weight loss by TGA is about 14.9% at 88° C.
  • the crystalline form A is substantially phase pure.
  • the present disclosure provides a crystalline form of the di-hydrochloride hydrate salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (Form B) having an X-ray powder diffraction (XRPD) pattern comprising a representative peak, in terms of °2 ⁇ , at 26.4 ⁇ 0.2 °2 ⁇ .
  • the XRPD pattern further comprises one or more additional representative peaks chosen from 9.6 ⁇ 0.2 °2 ⁇ , 22.1 ⁇ 0.2 °2 ⁇ , 28.4 ⁇ 0.2 °2 ⁇ and 30.6 ⁇ 0.2 °2 ⁇ .
  • the XRPD pattern for the crystalline form of the di-hydrochloride hydrate salt of the compound of Formula I may comprise one, two, three, or four representative peaks above.
  • the crystalline form of the di-hydrochloride hydrate salt of the compound of Formula I has an XRPD pattern that may further include one or more additional representative peaks chosen from 22.4 ⁇ 0.2 °2 ⁇ , 27.4 ⁇ 0.2 °2 ⁇ and 27.9 ⁇ 0.2 °2 ⁇ .
  • the XRPD pattern for the crystalline form of the di-hydrochloride monohydrate salt of the compound of Formula I may comprise one, two, three, four, five or six representative peaks disclosed above or disclosed in table 2.
  • a crystalline form of the di-hydrochloride monohydrate salt of the compound of Formula I has an XRPD pattern substantially as shown in FIG. 3 .
  • the water content of Form B can be in the range of about 3.0% to about 5.0% and still be considered to be a monohydrate having the XRPD pattern comprising the one, two, three, four, five or six representative peaks described above.
  • the water content for Form B is 4.5%.
  • a crystalline form of the di-hydrochloride hydrate salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine may be characterized thermally.
  • a crystalline form of the di-hydrochloride hydrate salt of the compound of Formula I has a differential thermogravimetric profile comprising an endothermic peak starting at about 78.92° C. with enthalpy ⁇ H of 399.81 J/g, and an endothermic peak starting at about 212.18° C. with enthalpy ⁇ H of 81.06 J/g.
  • a crystalline form of the di-hydrochloride hydrate salt of the compound of Formula I has a DSC thermogram that is substantially as shown in FIG. 4 . It should be understood that hydrated forms may yield different thermograms (in terms of peak shape and profile) depending on instrument parameters, thus the same material may have thermograms that look substantially different from each other when the data is generated on two different instruments.
  • a crystalline form of the di-hydrochloride hydrate salt of the compound of Formula I has a thermo gravimetric analysis (TGA) diagram substantially the same as that shown in shown in FIG. 4 .
  • the weight loss by TGA is about 24.4% at 96° C.
  • the crystalline form B is substantially phase pure.
  • the present disclosure provides a crystalline form of the sulfate salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (Form C) having an X-ray powder diffraction (XRPD) pattern comprising a representative peak, in terms of °2 ⁇ , at 9.4 ⁇ 0.2 °2 ⁇ .
  • the XRPD pattern further comprises one or more additional representative peaks chosen from 23.2 ⁇ 0.2 °2 ⁇ , 24.8 ⁇ 0.2 °2 ⁇ and 26.8 ⁇ 0.2 °2 ⁇ .
  • the XRPD pattern for the crystalline form of the sulfate salt of the compound of Formula I may comprise one, two, three, or four representative peaks above.
  • the crystalline form of the sulfate salt of the compound of Formula I has an XRPD pattern that may further include one or more additional representative peaks chosen from 12.3 ⁇ 0.2 °2 ⁇ , 17.1 ⁇ 0.2 °2 ⁇ , 26.5 ⁇ 0.2 °2 ⁇ and 26.1 ⁇ 0.2 °2 ⁇ .
  • the XRPD pattern for the crystalline form of the sulfate salt of the compound of Formula I may comprise one, two, three, four, five or six representative peaks disclosed above or disclosed in table 3.
  • a crystalline form of the sulfate salt of the compound of Formula I has an XRPD pattern substantially as shown in FIG. 5 .
  • the crystalline form of the sulfate salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine may be characterized thermally.
  • a crystalline form of the sulfate salt of the compound of Formula I has a differential thermogravimetric profile comprising an endothermic peak starting at about 188.44° C. with an enthalpy ⁇ H of 117.42 J/g.
  • a crystalline form of the sulfate salt of the compound of Formula I has a DSC thermogram that is substantially as shown in FIG. 6 . It should be understood that hydrated forms may yield different thermograms (in terms of peak shape and profile) depending on instrument parameters, thus the same material may have thermograms that look substantially different from each other when the data is generated on two different instruments.
  • a crystalline form of the sulfate salt of the compound of Formula I has a thermo gravimetric analysis (TGA) diagram substantially the same as that shown in shown in FIG. 6 .
  • the weight loss is 0.4% at 166° C. by TGA.
  • the crystalline form C is substantially phase pure.
  • the XRPD pattern further comprises one or more additional representative peaks chosen from 20.3 ⁇ 0.2 °2 ⁇ , and 10.1 ⁇ 0.2 °2 ⁇ .
  • the XRPD pattern for the crystalline form 1 (also referred to as modification 1) of the mesylate salt of the compound of Formula I may comprise one, two or three representative peaks above.
  • the crystalline form 1 of the mesylate salt of the compound of Formula I has an XRPD pattern that may further include one or more additional representative peaks chosen from 17.9 ⁇ 0.2 °2 ⁇ , 26.4 ⁇ 0.2 °2 ⁇ and 33.3 ⁇ 0.2 °2 ⁇ .
  • the XRPD pattern for the crystalline form 1 of the mesylate salt of the compound of Formula I may comprise one, two, three, four, five or six representative peaks disclosed above or disclosed in table 4.
  • a crystalline form 1 of the mesylate salt of the compound of Formula I has an XRPD pattern substantially as shown in FIG. 7 .
  • the crystalline form 1 (also referred to as modification 1) of the mesylate salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine may be characterized thermally.
  • a crystalline form of the mesylate salt of the compound of Formula I has a differential thermogravimetric profile comprising an endothermic peak starting at about 177.10° C. with enthalpy ⁇ H of 122.19 J/g.
  • a crystalline form 1 of the mesylate salt of the compound of Formula I has a DSC thermogram that is substantially as shown in FIG. 8 . It should be understood that hydrated forms may yield different thermograms (in terms of peak shape and profile) depending on instrument parameters, thus the same material may have thermograms that look substantially different from each other when the data is generated on two different instruments.
  • a crystalline form 1 of the mesylate salt of the compound of Formula I has a thermo gravimetric analysis (TGA) diagram substantially the same as that shown in shown in FIG. 8 .
  • the weight loss by TGA is about 1.7% at 157° C.
  • the crystalline form D is substantially phase pure.
  • the XRPD pattern further comprises one or more additional representative peaks chosen from 22.1 ⁇ 0.2 °2 ⁇ , 23.4 ⁇ 0.2 °2 ⁇ and 16.6 ⁇ 0.2 °2 ⁇ .
  • the XRPD pattern for the crystalline form 2 of the mesylate salt of the compound of Formula I may comprise one, two, three or four representative peaks above.
  • the crystalline form 2 of the mesylate salt of the compound of Formula I has an XRPD pattern that may further include one or more additional representative peaks chosen from 9.0 ⁇ 0.2 °2 ⁇ , 21.0 ⁇ 0.2 °2 ⁇ , 24.1 ⁇ 0.2 °2 ⁇ and 29.9 ⁇ 0.2 °2 ⁇ .
  • the XRPD pattern for the crystalline form 2 of the mesylate salt of the compound of Formula I may comprise one, two, three, four, five or six representative peaks disclosed above or disclosed in table 5.
  • a crystalline form 2 of the mesylate salt of the compound of Formula I has an XRPD pattern substantially as shown in FIG. 9 .
  • the crystalline form 2 of the mesylate salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine may be characterized thermally.
  • a crystalline form of the mesylate salt of the compound of Formula I has a differential thermogravimetric profile comprising an endothermic peak starting at about 168.84° C. with enthalpy ⁇ H of 113.21 J/g.
  • a crystalline form 2 of the mesylate salt of the compound of Formula I has a DSC thermogram that is substantially as shown in FIG. 10 . It should be understood that hydrated forms may yield different thermograms (in terms of peak shape and profile) depending on instrument parameters, thus the same material may have thermograms that look substantially different from each other when the data is generated on two different instruments.
  • a crystalline form 2 of the mesylate salt of the compound of Formula I has a thermo gravimetric analysis (TGA) diagram substantially the same as that shown in shown in FIG. 10 .
  • the weight loss by TGA is about 0.7% at 150° C.
  • the crystalline form E is substantially phase pure.
  • the XRPD pattern further comprises one or more additional representative peaks chosen from 24.9 ⁇ 0.2 °2 ⁇ , 25.7 ⁇ 0.2 °2 ⁇ and 26.5 ⁇ 0.2 °2 ⁇ .
  • the XRPD pattern for the crystalline form 1 (also referred to as modification 1) of the free form of the compound of Formula I may comprise one, two, three or four representative peaks above.
  • the crystalline form 1 of the free form of the compound of Formula I has an XRPD pattern that may further include one or more additional representative peaks chosen from 11.5 ⁇ 0.2 °2 ⁇ , 16.4 ⁇ 0.2 °2 ⁇ and 30.8 ⁇ 0.2 °2 ⁇ , and.
  • the XRPD pattern for the crystalline form 1 of the free form of the compound of Formula I may comprise one, two, three, four, five or six representative peaks disclosed above or disclosed in table 6.
  • a crystalline form 1 of the free form of the compound of Formula I has an XRPD pattern substantially as shown in FIG. 11 .
  • the crystalline form 1 of the free form of 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine may be characterized thermally.
  • a crystalline form 1 of the free form of the compound of Formula I has a differential thermogravimetric profile comprising an endothermic peak starting at about 212.62° C. with an enthalpy ⁇ H of 104.22 J/g.
  • a crystalline form 1 of the free form of the compound of Formula I has a DSC thermogram that is substantially as shown in FIG. 12 . It should be understood that hydrated forms may yield different thermograms (in terms of peak shape and profile) depending on instrument parameters, thus the same material may have thermograms that look substantially different from each other when the data is generated on two different instruments.
  • a crystalline form 1 of the free form of the compound of Formula I has a thermo gravimetric analysis (TGA) diagram substantially the same as that shown in shown in FIG. 12 .
  • the weight loss by TGA is about 0.6% at 190° C.
  • the crystalline form F is substantially phase pure.
  • the XRPD pattern further comprises one or more additional representative peaks chosen from 8.3 ⁇ 0.2 °2 ⁇ , 25.2 ⁇ 0.2 °2 ⁇ and 26.8 ⁇ 0.2 °2 ⁇ .
  • the XRPD pattern for the crystalline form 2 (also referred to as modification 2) of the free form of the compound of Formula I may comprise one, two, three or four representative peaks above.
  • the crystalline form 2 of the free form of the compound of Formula I has an XRPD pattern that may further include one or more additional representative peaks chosen from 14.0 ⁇ 0.2 °2 ⁇ , 16.7 ⁇ 0.2 °2 ⁇ , and 30.7 ⁇ 0.2 °2 ⁇ .
  • the XRPD pattern for the crystalline form 2 of the free form of the compound of Formula I may comprise one, two, three, four, five or six representative peaks disclosed above or disclosed in table 7.
  • a crystalline form 2 of the free form of the compound of Formula I has an XRPD pattern substantially as shown in FIG. 13 .
  • crystalline form 2 of the free form of 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine may be characterized thermally.
  • a crystalline form of the free form 2 of the compound of Formula I has a differential thermogravimetric profile comprising an endothermic peak starting at about 202.95° C. with enthalpy ⁇ H of 14.84 J/g, and an endothermic peak starting at about 212.96° C. with enthalpy ⁇ H of 91.99 J/g.
  • a crystalline form 2 of the free form of the compound of Formula I has a DSC thermogram that is substantially as shown in FIG. 14 . It should be understood that hydrated forms may yield different thermograms (in terms of peak shape and profile) depending on instrument parameters, thus the same material may have thermograms that look substantially different from each other when the data is generated on two different instruments.
  • a crystalline form 2 of the free form of the compound of Formula I has a thermo gravimetric analysis (TGA) diagram substantially the same as that shown in shown in FIG. 14 .
  • the weight loss by TGA is about 1.06% at 190° C.
  • the invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a therapeutically effective amount of a crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (any one of forms A to G according to any one of embodiments 1 to 7 and any sub embodiments thereof), and at least one pharmaceutically acceptable excipient.
  • the invention relates to a pharmaceutical composition comprising crystalline form F, and a pharmaceutically acceptable excipient.
  • the invention relates to a pharmaceutical composition comprising crystalline form F in substantially pure phase.
  • the invention relates to a pharmaceutical formulation comprising crystalline form F and further comprising at least one other solid state form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine.
  • the other solid state form is crystalline form G.
  • the other solid state form is an amorphous form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine.
  • the amorphous form is a non-salt (free base) of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine.
  • the invention relates to a combination, in particular a pharmaceutical combination, comprising a therapeutically effective amount of a crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (any one of forms A to G, preferably form F), and one or more immunotherapeutic agents.
  • the invention relates to a method of treating cancer, in a subject in need thereof, the method comprising: administering to a subject in need thereof, a therapeutically effective amount of a crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (any one of forms A to G according to any one of embodiments 1 to 7 and any sub embodiments thereof, preferably form F), or a pharmaceutical composition according to embodiment 8, alone or in combination with one or more immunotherapeutic agents.
  • the invention relates to the use of a crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (any one of forms A to G according to any one of embodiments 1 to 7 and any sub embodiments thereof, preferably form F), or the use of a pharmaceutical composition according to embodiment 8, alone or in combination with one or more immunotherapeutic agents, for the treatment of cancer.
  • the invention pertains to a crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (any one of forms A to G according to any one of embodiments 1 to 7 and any sub embodiments thereof, preferably form F), or a pharmaceutical composition according to embodiment 8, for use in the treatment of cancer.
  • the invention pertains to a combination of a crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (any one of forms A to G according to any one of embodiments 1 to 7 and any sub embodiments thereof, preferably form F), and one or more immunotherapeutic agents, for use in the treatment of cancer.
  • the invention relates to a method of inhibiting adenosine A2a receptor, in a subject in need thereof comprising: administering to a subject a therapeutically effective amount of a crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (any one of forms A to G according to any one of embodiments 1 to 7 and any sub embodiments thereof, preferably form F), or a pharmaceutical composition according to embodiment 8.
  • the invention relates to a method according to embodiment 10, a use according to embodiment 11, a compound for use according to embodiment 12, or a combination for use according to embodiment 13, wherein the cancer is selected from wherein the cancer is selected from a lung cancer, a melanoma, a renal cancer, a liver cancer, a myeloma, a prostate cancer, a breast cancer, a colorectal cancer, a pancreatic cancer, a head and neck cancer, anal cancer, gastro-esophageal cancer, thyroid cancer, cervical cancer, a lymphoproliferative disease or a hematological cancer, T-cell lymphoma, B-cell lymphoma, a non-Hogdkin lymphoma, or a leukemia.
  • the invention relates to the method, use, crystalline form or combination for use of embodiment 15 wherein the cancer is carcinomas, specifically lung cancer and more specifically non-small cell lung cancer.
  • the invention relates to the method of embodiment 10, 15 or 16, a use according to embodiment 11, 15 or 16, or the combination for use according to embodiment 13, 15 or 16, wherein one or more immunotherapeutic agents are selected from the group consisting of anti-CTLA4 antibodies, anti-PD-1 antibodies and anti-PD-L1 antibodies.
  • the invention relates to the method of embodiment 10, 15 or 16, a use according to embodiment 11, 15 or 16, or the combination for use according to embodiment 13, 15 or 16, wherein the immunotherapeutic agent is selected from the group consisting of: Ipilimumab, Tremelimumab, Nivolumab, Pembrolizumab, Pidilizumab (CT-011), AMP-224, AMP-514 (MEDI0680-Medimmune), MPDL3280A (Genentech Roche), MEDI4736, MSB0010718C (Merck Serono), YW243.55.S70 and MDX-1105.
  • the immunotherapeutic agent is selected from the group consisting of: Ipilimumab, Tremelimumab, Nivolumab, Pembrolizumab, Pidilizumab (CT-011), AMP-224, AMP-514 (MEDI0680-Medimmune), MPDL3280A (Genentech Roche), MEDI4736, MSB0010718
  • the invention relates to the method of embodiment 10, 15 or 16, a use according to embodiment 11, 15 or 16, or the combination for use according to embodiment 13, 15 or 16, wherein the immunotherapeutic agents is an anti-PD-1 antibody.
  • the invention relates to the method of embodiment 10, 15 or 16, a use according to embodiment 11, 15 or 16, or the combination for use according to embodiment 13, 15 or 16, wherein the immunotherapeutic agents is an anti-PD-1 antibody selected from Nivulomab, Pembrolizumab, Pidilizumab, MEDI0680 (AMP514 Medimmune), AMP224 (Medimmune), and antibodies described in US 2015/0210769)
  • the immunotherapeutic agents is an anti-PD-1 antibody selected from Nivulomab, Pembrolizumab, Pidilizumab, MEDI0680 (AMP514 Medimmune), AMP224 (Medimmune), and antibodies described in US 2015/0210769)
  • the invention relates to the method, the use or the combination for use according to embodiment 19, wherein the anti-PD-1 antibody comprises:
  • VH heavy chain variable region
  • VL light chain variable region
  • a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 1; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 12;
  • a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 41, a VHCDR2 amino acid sequence of SEQ ID NO: 5, and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 13, a VLCDR2 amino acid sequence of SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 15;
  • VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 41; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 12.
  • the invention pertains to the method, the use or the combination for use according to embodiment 19, wherein the anti-PD-1 comprises a VH comprising the amino acid sequence of SEQ ID NO: 6 and a VL comprising the amino acid sequence of SEQ ID NO: 20.
  • the invention pertains to the method, the use or the combination for use according to embodiment 19, wherein the anti-PD-1 antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 8 and a light chain comprising the amino acid sequence of SEQ ID NO: 22.
  • the invention pertains to the method, the use or the combination for use according to embodiment 19, wherein the anti-PD-1 antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 6 and a VL comprising the amino acid sequence of SEQ ID NO: 16.
  • the invention pertains to the method, the use or the combination for use according to embodiment 19, wherein the anti-PD-1 antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 8 and a light chain comprising the amino acid sequence of SEQ ID NO: 18.
  • the invention pertains to the method, the use or the combination for use according to any one of embodiments 19-24, wherein the anti-PD-1 antibody molecule is administered at a dose of about 300 mg once every three weeks.
  • the invention pertains to the method, the use or the combination for use according to any one of embodiments 19-24, wherein the anti-PD-1 antibody molecule is administered at a dose of about 400 mg once every four weeks.
  • the invention relates to the method of embodiment 10, 15 or 16, a use according to embodiment 11, 15 or 16, or the combination for use according to embodiment 13, 15 or 16, wherein the immunotherapeutic agents is is an anti-PD-L1 antibody.
  • the invention relates to the method, the use or the combination for use according to embodiment 27, wherein the anti PD-L1 antibody molecule is selected from YW243.55.S70, MPDL3280A, MEDI-4736, MSB-0010718C, MDX-1105 and an anti PD-L1 antibody described in US 2016/0108123.
  • the invention relates to the method, the use or the combination for use according to embodiment 27, wherein the anti PD-L1 antibody molecule comprises:
  • the invention relates to the method, the use or the combination for use according to embodiment 27, wherein the anti PD-L1 antibody molecule comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 55 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 58.
  • the invention relates to the method, the use or the combination for use according to any one of embodiments 17-29, wherein immunotherapeutic agent is administered together in a single composition or administered separately in two or more different compositions forms.
  • the invention pertains to the method the method, the use or the combination for use according to any one of embodiments 17-29 wherein the immunotherapeutic agent is administered concurrently with, prior to, or subsequent to, a crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine.
  • the crystalline forms described herein have been found to have advantageous properties.
  • the criteria for selection are toxicological considerations, crystallinity, monomorphism, melting point, hygroscopicity, stability in bulk, compatibility with excipients, pH of aqueous solution, solubility in water and aqueous media, morphology, handling and polymorphism behaviors. Free form F has demonstrated superior behaviors.
  • crystalline Form F is the more thermodynamically stable as compared to the other free form G.
  • crystalline Form F was shown to have better chemical stability properties than crystalline Form G.
  • Form F was shown to be physically and chemically stable in bulk when exposed for one week at 80° C. at ambient relative humidity (RH).
  • RH ambient relative humidity
  • analysis of the crystalline Form F drug substance indicated that there was less than 1% degradation of the Form F material under these conditions.
  • Form F also proved to be physically and chemically stable in bulk for one to two weeks at 50° C. at ambient relative humidity as well as at 50° C. at 75% relative humidity.
  • analysis of the crystalline Form F drug substance indicated that there was less than 1% degradation of the Form F material under both sets of conditions.
  • Form F was physically and chemically stable under light stressed exposure.
  • Form F In a pH stability study, 0.1% suspension/solution of Form F showed less than 0.5% degradation in buffer solutions of various pHs at 50° C. for one week, except at pH 1.2, where 1% degradation resulted. Additionally, form F shows superior property over the sulfate form C in term of stability in organic solvents. Therefore the crystalline form F has shown chemical stability in both solution and solid states.
  • Crystalline form F was shown to have better thermal stability properties than other disclosed crystalline forms A-E and G. After heating to 220° C. (melt) then cooling to 30° C., the crystalline form F remains unchanged.
  • XRPD was carried out to study the stability of the crystalline form upon heating and cooling, and the results did not indicate a form change except some peaks shifted at high temperature.
  • Crystalline Form F was shown to have better physical stability properties than other disclosed crystalline forms (A-E and G).
  • the crystallinity of form F was evaluated by XRPD after compression for 5 minutes at 0.5 ton with 0.8 cm diameter disc. The XRPD indicated no form change after compression.
  • the physical stability of crystalline form F was also evaluated in granulation simulation experiments.
  • granulating solvent was added dropwise to the crystalline form F until the solid is wetted sufficiently.
  • the mixture was then ground in a mortar/pestle at room temperature (25° C. for 2-3 minutes) between each addition.
  • the crystallinity of the material was re-evaluated by XRPD and DSC. Under the aforementioned conditions using water or ethanol as the granulation solvent, XRPD results indicated no form change.
  • Both the free form F and the sulfate form C exhibited good stability when blended with four selected excipients, which are 1.Gelatin, 2 HPMC, 3 wet granulation mixture [MCC PH101 (45%); lactose monohydrate (44%); PVP K30 (4%), Crospovidone XL (5%), Aerosil (0.5%); Mg-Stearate (1.5%) and 20% w/w water added to the mixture)] and 4 dry blended mixture [Lactose USP (73%), Starch 1500 (20%), Explotab (5 wt %), Aerosil (0.5 wt %); Mg-Stearate (1.5 wt)] under 50° C./75% RH where about 1% degradation was observed.
  • excipients which are 1.Gelatin, 2 HPMC, 3 wet granulation mixture [MCC PH101 (45%); lactose monohydrate (44%); PVP K30 (4%), Crospovidone XL (5%), Aerosil (0.5%); Mg-Stearate
  • DVS dynamic vapor sorption
  • Form F shows little to no phase change on exposure to humidity.
  • Form F shows solubility in aqueous buffers across pH 1 to pH 10 and bio-relevant media, of about 0.1 mg/mL in all tested media.
  • the sulfate salt Form C is very hygroscopic when the relative humidity is above 70%.
  • the sulfate salt (Form C) shows better morphology and therefore improve flow-ability but does not show any better solubility than the free form F since it dissociates in aqueous media.
  • the terms “about” and “substantially” indicate with respect to features such as endotherms, endothermic peak, exotherms, baseline shifts, etc., that their values can vary.
  • “about” or “substantially” means that typical peak position and intensity variability are taken into account.
  • the peak positions (2 ⁇ ) will show some inter-apparatus variability, typically as much as 0.2°. Occasionally, the variability could be higher than 0.2° depending on apparatus calibration differences.
  • polymorph refers to crystalline forms having the same chemical composition but different spatial arrangements of the molecules, atoms, and/or ions forming the crystal.
  • solvate refers to a crystalline form of a molecule, atom, and/or ions that further comprises molecules of a solvent or solvents incorporated into the crystalline lattice structure.
  • the solvent molecules in the solvate may be present in a regular arrangement and/or a non-ordered arrangement.
  • the solvate may comprise either a stoichiometric or nonstoichiometric amount of the solvent molecules.
  • a solvate with a nonstoichiometric amount of solvent molecules may result from partial loss of solvent from the solvate.
  • solvates may occur as dimers or oligomers comprising more than one molecule or within the crystalline lattice structure.
  • amorphous refers to a solid form of a molecule, atom, and/or ions that is not crystalline. An amorphous solid does not display a definitive X-ray diffraction pattern.
  • phase pure when used in reference to any crystalline form of the compound of Formula I, means a compound having a phase purity of greater than about 90% by weight, including greater than about 90, 91, 92, 93, 94, 95, 96, 97, 98, and about 99% by weight, and also including equal to about 100% by weight of the compound of Formula I, based on the weight of the compound on an anhydrous basis.
  • phase pure or phase purity herein refers to phase homogeneity with respect to a particular solid state form of the compound of Formula I and does not necessarily imply a high degree of chemical purity absent an express statement to that effect.
  • Phase purity may be determined according to methods known in the art, for example, using XRPD to do quantitative phase analysis using one or more approaches known in the art, for example, via an external standard method, direct comparisons of line (peak) characteristics which are attributed to different phases in a particular spectra, or via an internal standard method.
  • XRPD quantification of phase purity can be complicated by the presence of amorphous material. Accordingly, other methods that may be useful for determining phase purity include, for example, solid state NMR spectroscopy, Raman and/or infrared spectroscopy.
  • solid state NMR spectroscopy Raman and/or infrared spectroscopy.
  • One of skilled in the art would readily understand these methods and how to employ these additional (or alternative) methods for determining phase purity.
  • substantially chemically pure when used in reference to any crystalline form of the compound of Formula I, means a compound having a chemical purity greater than about 90% by weight, including greater than about 90, 91, 92, 93, 94, 95, 96, 97, 98, and about 99% by weight, and also including equal to about 100% by weight of the compound of Formula I, based on the weight of the salt (on an anhydrous basis).
  • the remaining material generally comprises other compounds, such as for example, other stereoisomers of the compound of Formula I, reaction impurities, starting materials, reagents, side products, and/or other processing impurities arising from the preparation and/or isolation and/or purification of the particular crystalline form.
  • a crystalline form of the compound of Formula I may be deemed to be substantially chemically pure if it has been determined to have a chemical purity of greater than about 90% by weight, as measured by standard and generally accepted methods known in the art, where the remaining less than about 10% by weight constitutes other materials such as other stereoisomers of the compound of Formula I, reaction impurities, starting materials, reagents, side products, and/or processing impurities.
  • Chemical purity may be determined according to methods known in the art, for example, high performance liquid chromatography (HPLC), LC-MS (liquid chromatography-mass spectrometry), nuclear magnetic resonance (NMR) spectroscopy, or infrared spectroscopy.
  • HPLC high performance liquid chromatography
  • LC-MS liquid chromatography-mass spectrometry
  • NMR nuclear magnetic resonance
  • a therapeutically effective amount of a compound of the present invention refers to an amount of the compound of the present invention that will elicit a biological or medical response in a subject, for example, reduction or inhibition of an enzyme or a protein activity, or ameliorate symptoms, alleviate conditions, or slow or delay disease progression, etc.
  • a therapeutically effective amount refers to the amount of the compound of the present invention that, when administered to a subject, is effective to (1) at least partially alleviating, inhibiting, and/or ameliorating a condition, or a disorder or a disease (i) mediated by adenosine A2a receptor, or (ii) associated with adenosine or the activity of adenosine A2a receptor, or (iii) characterized by activity (normal or abnormal) of adenosine A2a receptor; or (2) reducing or inhibiting the activity of adenosine A2a receptor.
  • a therapeutically effective amount refers to the amount of the compound of the present invention that, when administered to a cell, or a tissue, or a non-cellular biological material, or a medium, is effective to at least partially reducing or inhibiting the activity of adenosine A2a receptor; or at least partially reducing or inhibiting the expression of adenosine A2a receptor.
  • the term “subject” refers to an animal.
  • the animal is a mammal.
  • a subject refers to for example, primates (e.g. humans), cows, sheep, goats, horses, dogs, cats, rabbits, rats, mice, fish, birds and the like.
  • the subject is a human.
  • the term “inhibit”, “inhibition” or “inhibiting” refers to the reduction or suppression of a given condition, symptom, or disorder, or disease, or a significant decrease in the baseline activity of a biological activity or process.
  • the terms “treat,” “treating,” or “treatment” of any disease or disorder refers in one embodiment, to ameliorating the disease or disorder (i.e., slowing or arresting or reducing the development of the disease or at least one of the clinical symptoms thereof).
  • “treat,” “treating,” or “treatment” refers to alleviating or ameliorating at least one physical parameter including those which may not be discernible by the patient.
  • “treat,” “treating,” or “treatment” refers to modulating the disease or disorder, either physically, (e.g., stabilization of a discernible symptom), physiologically, (e.g., stabilization of a physical parameter), or both.
  • “treat” or “treating” refers to delaying the progression of the disease or disorder.
  • the term “prevent”, “preventing” or “prevention” of any disease or disorder refers to the prophylactic treatment of the disease or disorder; or delaying the onset of the disease or disorder.
  • cancer is used to designate a group of diseases involving abnormal cell growth with the potential to invade or spread to other parts of the body. Cancers are classified by the type of cell that the tumor cells resemble and is therefore presumed to be the origin of the tumor. These types include carcinoma, sarcoma, lymphoma and leukemia, germ cell tumor and blastoma.
  • carcinoma is used to designate cancers derived from epithelial cells. This group includes many of the most common cancers, particularly in the aged, and include nearly all those developing in the breast, prostate, lung, pancreas, and colon.
  • cancer includes but is not limited to, a solid tumor, a hematological cancer (e.g., leukemia, lymphoma, myeloma, e.g., multiple myeloma), and a metastatic lesion.
  • the cancer is a solid tumor.
  • solid tumors include malignancies, e.g., sarcomas and carcinomas, e.g., adenocarcinomas of the various organ systems, such as those affecting the lung, breast, ovarian, lymphoid, gastrointestinal (e.g., colon), anal, genitals and genitourinary tract (e.g., renal, urothelial, bladder cells, prostate), pharynx, CNS (e.g., brain, neural or glial cells), head and neck, skin (e.g., melanoma), and pancreas, as well as adenocarcinomas which include malignancies such as colon cancers, rectal cancer, renal-cell carcinoma, liver cancer, non-small cell lung cancer, cancer of the small intestine and cancer of the esophagus.
  • the cancer may be at an early, intermediate, late stage or metastatic cancer.
  • the cancer is chosen from a lung cancer (e.g., a non-small cell lung cancer (NSCLC) (e.g., a NSCLC with squamous and/or non-squamous histology, or a NSCLC adenocarcinoma)), a melanoma (e.g., an advanced melanoma), a renal cancer (e.g., a renal cell carcinoma), a liver cancer, a myeloma (e.g., a multiple myeloma), a prostate cancer, a breast cancer (e.g., a breast cancer that does not express one, two or all of estrogen receptor, progesterone receptor, or Her2/neu, e.g., a triple negative breast cancer), a colorectal cancer, a pancreatic cancer, a head and neck cancer (e.g., head and neck squamous cell carcinoma (HNSCC), anal cancer, gastro-esophageal cancer,
  • the cancer can be, e.g., a cancer described herein, such as lung cancer (squamous), lung cancer (adenocarcinoma), head and neck cancer, cervical cancer (squamous), stomach cancer, thyroid cancer, melanoma, nasopharyngeal cancer (e.g., differentiated or undifferentiated metastatic or locally recurrent nasopharyngeal carcinoma), or breast cancer.
  • a cancer described herein such as lung cancer (squamous), lung cancer (adenocarcinoma), head and neck cancer, cervical cancer (squamous), stomach cancer, thyroid cancer, melanoma, nasopharyngeal cancer (e.g., differentiated or undifferentiated metastatic or locally recurrent nasopharyngeal carcinoma), or breast cancer.
  • the cancer is chosen form a carcinoma (e.g., advanced or metastatic carcinoma), melanoma or a lung carcinoma, e.g., a non-small cell lung carcinoma.
  • a carcinoma e.g., advanced or metastatic carcinoma
  • melanoma e.g., a non-small cell lung carcinoma.
  • the cancer is a lung cancer, e.g., a non-small cell lung cancer or small cell lung cancer.
  • lung cancer also known as carcinoma of the lung or pulmonary carcinoma
  • carcinoma of the lung or pulmonary carcinoma is used to designate malignant lung tumors characterized by uncontrolled cell growth in tissues of the lung.
  • non-small-cell lung carcinoma is used to designate any type of lung cancer other than small cell lung carcinoma (SCLC).
  • immunotherapeutic treatment refers to a broad class of therapies designated to elicit immune-mediated destruction of tumor cells. In said therapies are used immunotherapeutic agents.
  • immunotherapeutic agents refer to compounds useful to carrying out immunotherapeutic treatment of cancer, such as agent selected from the group consisting of anti-CTLA4 antibodies, such as Ipilimumab and Tremelimumab, anti-PD-1 antibodies such as MDX-1106, MK3475, CT-011, AMP-224 or an anti-PD-1 antibody molecule as described in WO2015/112900; and anti-PD-L1 antibodies such as MEDI4736, MDX-1105 or an anti-PD-L1 antibody described in US 2016/0108123.
  • anti-CTLA4 antibodies such as Ipilimumab and Tremelimumab
  • anti-PD-1 antibodies such as MDX-1106, MK3475, CT-011, AMP-224 or an anti-PD-1 antibody molecule as described in WO2015/112900
  • anti-PD-L1 antibodies such as MEDI4736, MDX-1105 or an anti-PD-L1 antibody described in US 2016/0108123.
  • PD-1 Programmed Death 1
  • isoforms mammalian, e.g., human PD-1, species homologs of human PD-1, and analogs comprising at least one common epitope with PD-1.
  • the amino acid sequence of PD-1, e.g., human PD-1 is known in the art, e.g., Shinohara T et al. (1994) Genomics 23(3):704-6; Finger L R, et al. Gene (1997) 197(1-2):177-87.
  • the term “Programmed Death Ligand 1” or “PD-L1” include isoforms, mammalian, e.g., human PD-L1, species homologs of human PD-1, and analogs comprising at least one common epitope with PD-L1.
  • the amino acid sequence of PD-L1, e.g., human PD-1 is known in the art, e.g., Dong et al. (1999) Nat Med. 5(12):1365-9; Freeman et al. (2000) J Exp Med. 192(7):1027-34).
  • the term “combination” refers to either a fixed combination in one dosage unit form, or a combined administration where a crystalline form of compound of Formula I and a combination partner (i.e. an immunotherapeutic agent) may be administered independently at the same time or separately within time intervals, especially where these time intervals allow that the combination partners show a cooperative, e.g. synergistic effect.
  • the single components may be packaged in a kit or separately.
  • One or both of the components e.g., powders or liquids
  • co-administration or “combined administration” or the like as utilized herein are meant to encompass administration of the selected combination partner to a single subject in need thereof (e.g. a patient), and are intended to include treatment regimens in which the agents are not necessarily administered by the same route of administration or at the same time.
  • pharmaceutical combination and “combination product” are used interchangeably and refers to either a fixed combination in one dosage unit form, or non-fixed combination or a kit of parts for the combined administration where two or more therapeutic agents may be administered independently at the same time or separately within time intervals, especially where these time intervals allow that the combination partners show a cooperative, e.g. synergistic effect.
  • fixed combination means that a crystalline form of the compound of Formula I and a combination partner (i.e. immunotherapeutic agent), are both administered to a patient simultaneously in the form of a single entity or dosage.
  • non-fixed combination means that a crystalline form of the compound of Formula I and a combination partner (i.e.
  • the immunotherapeutic agent are both administered to a patient as separate entities either simultaneously, concurrently or sequentially with no specific time limits, wherein such administration provides therapeutically effective levels of the two compounds in the body of the patient.
  • cocktail therapy e.g. the administration of three or more therapeutic agent.
  • the pharmaceutical combination is a non-fixed combination.
  • composition therapy refers to the administration of two or more therapeutic agents to treat a cancer as described in the present disclosure.
  • administration encompasses co-administration of these therapeutic agents in a substantially simultaneous manner, such as in a single capsule having a fixed ratio of active ingredients.
  • administration encompasses co-administration in multiple, or in separate containers (e.g., tablets, capsules, powders, and liquids) for each active ingredient. Powders and/or liquids may be reconstituted or diluted to a desired dose prior to administration.
  • administration also encompasses use of each type of therapeutic agent in a sequential manner, either at approximately the same time or at different times. In either case, the treatment regimen will provide beneficial effects of the drug combination in treating the conditions or disorders described herein.
  • the crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine described herein can be used alone or they can be formulated into a pharmaceutical composition that also contains at least one pharmaceutically acceptable excipient, and often contains at least two or more pharmaceutically acceptable excipients.
  • suitable excipients are disclosed herein.
  • Other excipients may be used that are known in the art without departing from the intent and scope of the present application.
  • the present invention utilizes a pharmaceutical composition
  • a pharmaceutical composition comprising a compound of the present invention and a pharmaceutically acceptable excipient.
  • the pharmaceutical composition can be formulated for particular routes of administration such as oral administration, parenteral administration, and rectal administration, etc.
  • the pharmaceutical compositions of the present invention can be made up in a solid form (including without limitation capsules, tablets, pills, granules, powders or suppositories), or in a liquid form (including without limitation solutions, suspensions or emulsions).
  • compositions can be subjected to conventional pharmaceutical operations such as sterilization and/or can contain conventional inert diluents, lubricating agents, carriers or buffering agents, as well as adjuvants, such as solvents, preservatives, stabilizers, wetting agents, emulsifiers and bulking agents, etc.
  • the pharmaceutical compositions are tablets or capsules comprising the active ingredient together with at least one excipient, such as:
  • diluents e.g., lactose, dextrose, sucrose, mannitol, sorbitol, cellulose and/or glycine;
  • lubricants e.g., silica, talcum, stearic acid, its magnesium or calcium salt and/or polyethyleneglycol; for tablets also
  • lubricants e.g., silica, talcum, stearic acid, its magnesium or calcium salt and/or polyethyleneglycol
  • binders e.g., magnesium aluminum silicate, starch paste, gelatin, tragacanth, methylcellulose, sodium carboxymethylcellulose and/or polyvinylpyrrolidone; if desired;
  • d) carriers such as an aqueous vehicle containing a co-solvating material such as captisol, PEG, glycerin, cyclodextrin, or the like;
  • disintegrants e.g., starches, agar, alginic acid or its sodium salt, or effervescent mixtures; and/or
  • Tablets may be either film coated or enteric coated according to methods known in the art.
  • the compound or composition is prepared for oral administration, such as a tablet or capsule, for example, and optionally packaged in a multi-dose format suitable for storing and/or dispensing unit doses of a pharmaceutical product.
  • suitable packaging include, but are not limited to, hermetically sealed foils, unit dose containers (e.g., vials), blister packs, and strip packs.
  • Tablets may contain the active ingredient in admixture with nontoxic, pharmaceutically acceptable excipients which are suitable for the manufacture of tablets.
  • excipients are, for example, inert diluents, such as calcium carbonate, sodium carbonate, lactose, calcium phosphate or sodium phosphate; granulating and disintegrating agents, for example, corn starch, or alginic acid; binding agents, for example, starch, gelatin or acacia; and lubricating agents, for example magnesium stearate, stearic acid or talc.
  • the tablets are uncoated or coated by known techniques to delay disintegration and absorption in the gastrointestinal tract and thereby provide a sustained action over a longer period.
  • a time delay material such as glyceryl monostearate or glyceryl distearate can be employed.
  • Formulations for oral use can be presented as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluent, for example, calcium carbonate, calcium phosphate or kaolin, or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium, for example, peanut oil, liquid paraffin or olive oil.
  • the present invention further provides anhydrous pharmaceutical compositions and dosage forms comprising the compounds of the present invention as active ingredients, since water may facilitate the degradation of certain compounds.
  • Anhydrous pharmaceutical compositions and dosage forms of the invention can be prepared using anhydrous or low moisture containing ingredients and low moisture or low humidity conditions.
  • An anhydrous pharmaceutical composition may be prepared and stored such that its anhydrous nature is maintained.
  • anhydrous compositions are preferably packaged using materials known to prevent exposure to water such that they can be included in suitable formulary kits. Examples of suitable packaging include, but are not limited to, hermetically sealed foils, plastics, unit dose containers (e.g., vials), blister packs, and strip packs.
  • compositions and dosage forms that comprise one or more agents that reduce the rate by which the compound of the present invention as an active ingredient will decompose.
  • agents which are referred to herein as “stabilizers,” include, but are not limited to, antioxidants such as ascorbic acid, pH buffers, or salt buffers, etc.
  • the pharmaceutical composition or combination of the present invention can be in unit dosage of about 1-1000 mg of active ingredient(s) for a subject of about 50-70 kg, or about 1-500 mg or about 1-250 mg or about 1-150 mg or about 0.5-100 mg, or about 1-50 mg of active ingredients.
  • the therapeutically effective dosage of a compound, the pharmaceutical composition, or the combinations thereof is dependent on the species of the subject, the body weight, age and individual condition, the disorder or disease or the severity thereof being treated. A physician, clinician or veterinarian of ordinary skill can readily determine the effective amount of each of the active ingredients necessary to prevent, treat or inhibit the progress of the disorder or disease.
  • the above-cited dosage properties are demonstrable in vitro and in vivo tests using advantageously mammals, e.g., mice, rats, dogs, monkeys or isolated organs, tissues and preparations thereof.
  • the compounds of the present invention can be applied in vitro in the form of solutions, e.g., preferably aqueous solutions, and in vivo either enterally, parenterally, advantageously intravenously, e.g., as a suspension or in aqueous solution.
  • the dosage in vitro may range between about 10 ⁇ 3 molar and 10 ⁇ 9 molar concentrations.
  • a therapeutically effective amount in vivo may range depending on the route of administration, between about 0.1-500 mg/kg, or between about 1-100 mg/kg.
  • a pharmaceutical composition which comprises at least one compound according to the embodiments supra and at least one carrier.
  • the crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine described herein are also useful as active pharmaceutical ingredients (APIs) as well as materials for preparing formulations that incorporate one or more pharmaceutically acceptable excipients and are suitable for administration to human subjects.
  • these formulations will be a pharmaceutical product, such as, for example, a solid oral dosage form such as tablets and/or capsules.
  • a pharmaceutical product such as, for example, a solid oral dosage form such as tablets and/or capsules.
  • the crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine is not detectable in any sufficient amount.
  • a crystalline API is contacted with one or more pharmaceutically acceptable excipients in the presence of a solvent such as, for example, water, in an amount sufficient to promote dissolution of the API such that its crystalline character is lost and therefore is absent in the final pharmaceutical product.
  • a solvent such as, for example, water
  • the term “pharmaceutically acceptable excipients” includes any and all solvents, carriers, diluents, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g., antibacterial agents, antifungal agents, antioxidants), isotonic agents, absorption delaying agents, salts, drug stabilizers, binders, additives, bulking agents, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, and the like and combinations thereof, as would be known to those skilled in the art (see, for example, Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, pp. 1289-1329). It should be understood that unless a conventional excipient is incompatible with the active ingredient, the use of any conventional excipient in any therapeutic or pharmaceutical compositions is contemplated by the present application.
  • a crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (any of Form A to G) is provided in a substantially phase pure form.
  • This crystalline form of a 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (any of Form A to G) in substantially phase pure form may be used to prepare pharmaceutical compositions which may further comprising one or more pharmaceutically acceptable excipients.
  • the crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine may not retain its crystallinity in the pharmaceutical composition.
  • crystalline Form A, B, C, D, E, F or G may be used in a process to prepare a pharmaceutical composition that, for example, involves spray drying or wet granulation; thus it is expected that little to no crystalline Form A, B, C, D, E, F or G will be detected in the resulting pharmaceutical composition.
  • contacting expressly includes methods of combining the crystalline forms of the compound of Formula I described herein where the crystallinity of the API is maintained or the crystallinity of the API is lost as a result of the process of preparing the pharmaceutical composition or pharmaceutical product.
  • the invention provides a kit comprising two or more separate pharmaceutical compositions, at least one of which contains a crystalline form of the compound of formula (I) (any one of Form A to G).
  • the kit comprises means for separately retaining said compositions, such as a container, divided bottle, or divided foil packet.
  • An example of such a kit is a blister pack, as typically used for the packaging of tablets, capsules and the like.
  • the kit of the invention may be used for administering different dosage forms, for example, oral and parenteral, for administering the separate compositions at different dosage intervals, or for titrating the separate compositions against one another.
  • the kit of the invention typically comprises directions for administration.
  • a crystalline form of a compound of Formula (I) i.e. any one of Form A through G
  • the other immunotherapeutic agent may be manufactured and/or formulated by the same or different manufacturers.
  • a crystalline form of the compound of Formula (I) and the other therapeutic may be brought together into a combination therapy: (i) prior to release of the combination product to physicians (e.g. in the case of a kit comprising a crystalline form of compound of Formula (I) and the other therapeutic agent); (ii) by the physician themselves (or under the guidance of the physician) shortly before administration; (iii) in the patient themselves, e.g. during sequential administration of a crystalline form of the compound of Formula (I) and the other therapeutic agent.
  • the invention provides the use of a crystalline form according to any one of embodiments 1 to 7 (any one of form A to G), for treating cancer, wherein the medicament is prepared for administration with another immunotherapeutic agent.
  • the invention also provides the use of an immunotherapeutic agent for treating cancer, wherein the medicament is administered with a crystalline form of the compound of Formula (I).
  • the invention also provides a crystalline form of the compound of Formula (I) (i.e. any one of Form A to G), for use in a method of treating cancer, wherein the crystalline form of compound of Formula (I) is prepared for administration with another immunotherapeutic agent.
  • the invention also provides another immunotherapeutic agent for use in a method of treating cancer, wherein the other immunotherapeutic agent is prepared for administration with a crystalline form of compound of Formula (I).
  • the invention also provides crystalline form of compound of Formula (I), for use in a method of treating cancer, wherein the crystalline form of compound of Formula (I) is administered with another immunotherapeutic agent.
  • the invention also provides another immunotherapeutic agent for use in a method of treating cancer, wherein the other therapeutic agent is administered with a crystalline form of compound of Formula (I).
  • the invention also provides the use of a crystalline form of compound of Formula (I), for treating cancer, wherein the patient has previously (e.g. within 24 hours) been treated with another immunotherapeutic agent.
  • the invention also provides the use of another immunotherapeutic agent for treating cancer, wherein the patient has previously (e.g. within 24 hours) been treated with a crystalline form of compound of Formula (I).
  • a pharmaceutical combination comprises a crystalline form according to any one of embodiments 1 to 7, and one or more immunotherapeutic agents selected from the group consisting of anti-CTLA4 antibodies, such as Ipilimumab and Tremelimumab, anti-PD-1 antibodies such as MDX-1106 (Nivolumab), MK3475 (Pembrolizumab), CT-011 (Pidilizumab), AMP-224, AMP-514 (MEDI0680 Medimmune) or an anti-PD-1 antibody molecule as described in WO2015/112900 (US2015/0210769); and anti-PD-L1 antibodies such as MPDL3280A, MEDI4736, MSB0010718C (Merch Sorono), YW243.55.S70, MDX-1105 or an anti-PD-L1 antibody molecules are disclosed in US 2016/0108123, filed Oct. 13, 2015, entitled “Antibody Molecules to PD-L1 and Uses Thereof”.
  • anti-CTLA4 antibodies such
  • the components of the combination product are in the same formulation or in separate formulations.
  • the combination product comprises a crystalline form according to any one of embodiments 1 to 7, and one or more immunotherapeutic agent useful in the treatment of cancer, specifically in immunotherapeutic treatment of cancer, such agent is selected from the group consisting of anti-PD-1PD-1 antibodies such as MDX-1106, MK3475, CT-011, AMP-224 or an anti-PD-1 antibody molecule as described in WO2015/112900 (US2015/0210769); and anti-PD-L1 antibodies such as MPDL3280A, MEDI4736, MDX-1105 or an anti-PD-L1 antibody molecules are disclosed in US 2016/0108123.
  • anti-PD-1PD-1 antibodies such as MDX-1106, MK3475, CT-011, AMP-224 or an anti-PD-1 antibody molecule as described in WO2015/112900 (US2015/0210769
  • anti-PD-L1 antibodies such as MPDL3280A, MEDI4736, MDX-1105 or an anti-PD-L1 antibody molecules are disclosed in US 2016/0108123.
  • the combination product comprises a crystalline form according to any one of embodiments 1 to 7, and an anti-PD-1 antibody molecule such as those described herein.
  • PD-1 is a CD28/CTLA-4 family member expressed, e.g., on activated CD4 + and CD8 + T cells, T regs , and B cells. It negatively regulates effector T cell signaling and function. PD-1 is induced on tumor-infiltrating T cells, and can result in functional exhaustion or dysfunction (Keir et al. (2008) Annu. Rev. Immunol. 26:677-704; Pardoll et al. (2012) Nat Rev Cancer 12(4):252-64). PD-1 delivers a coinhibitory signal upon binding to either of its two ligands, Programmed Death-Ligand 1 (PD-L1) or Programed Death-Ligand 2 (PD-L2).
  • PD-1 delivers a coinhibitory signal upon binding to either of its two ligands, Programmed Death-Ligand 1 (PD-L1) or Programed Death-Ligand 2 (PD-L2).
  • PD-L1 is expressed on a number of cell types, including T cells, Natural killer (NK) cells, macrophages, dendritic cells (DCs), B cells, epithelial cells, vascular endothelial cells, as well as many types of tumors.
  • High expression of PD-L1 on murine and human tumors has been linked to poor clinical outcomes in a variety of cancers (Keir et al. (2008) Annu. Rev. Immunol. 26:677-704; Pardoll et al. (2012) Nat Rev Cancer 12(4):252-64).
  • PD-L2 is expressed on dendritic cells, macrophages, and some tumors. Blockade of the PD-1 pathway has been pre-clinically and clinically validate for cancer immunotherapy.
  • blockade of PD-1 pathway can restore exhausted/dysfunctional effector T cell function (e.g. proliferation, IFN-g secretion, or cytolytic function) and/or inhibit T reg cell function (Keir et al. (2008) Annu. Rev. Immunol. 26:677-704; Pardoll et al. (2012) Nat Rev Cancer 12(4):252-64).
  • Blockade of the PD-1 pathway can be effected with an antibody, an antigen binding fragment thereof, an immunoadhesin, a fusion protein, or oligopeptide of PD-1, PD-L1 and/or PD-L2.
  • the PD-1 inhibitor is an anti-PD-1 antibody molecule. In one embodiment, the PD-1 inhibitor is an anti-PD-1 antibody molecule as described in US 2015/0210769, published on Jul. 30, 2015, entitled “Antibody Molecules to PD-1 and Uses Thereof,” incorporated by reference in its entirety.
  • the anti-PD-1 antibody molecule comprises at least one, two, three, four, five or six complementarity determining regions (CDRs) (or collectively all of the CDRs) from a heavy and light chain variable region comprising an amino acid sequence shown in Table A (e.g., from the heavy and light chain variable region sequences of BAP049-Clone-E or BAP049-Clone-B disclosed in Table A), or encoded by a nucleotide sequence shown in Table A.
  • the CDRs are according to the Kabat definition (e.g., as set out in Table A).
  • the CDRs are according to the Chothia definition (e.g., as set out in Table A).
  • the CDRs are according to the combined CDR definitions of both Kabat and Chothia (e.g., as set out in Table A).
  • the combination of Kabat and Chothia CDR of VH CDR1 comprises the amino acid sequence GYTFTTYWMH (SEQ ID NO: 41).
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions (e.g., conservative amino acid substitutions) or deletions, relative to an amino acid sequence shown in Table A, or encoded by a nucleotide sequence shown in Table A.
  • the anti-PD-1 antibody molecule comprises a heavy chain variable region (VH) comprising a VHCDR1 amino acid sequence of SEQ ID NO: 1, a VHCDR2 amino acid sequence of SEQ ID NO: 2, and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a light chain variable region (VL) comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 12, each disclosed in Table A.
  • VH heavy chain variable region
  • VL light chain variable region
  • the antibody molecule comprises a VH comprising a VHCDR1 encoded by the nucleotide sequence of SEQ ID NO: 24, a VHCDR2 encoded by the nucleotide sequence of SEQ ID NO: 25, and a VHCDR3 encoded by the nucleotide sequence of SEQ ID NO: 26; and a VL comprising a VLCDR1 encoded by the nucleotide sequence of SEQ ID NO: 29, a VLCDR2 encoded by the nucleotide sequence of SEQ ID NO: 30, and a VLCDR3 encoded by the nucleotide sequence of SEQ ID NO: 31, each disclosed in Table A.
  • the anti-PD-1 antibody molecule comprises a VH comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 6. In one embodiment, the anti-PD-1 antibody molecule comprises a VL comprising the amino acid sequence of SEQ ID NO: 20, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 20. In one embodiment, the anti-PD-1 antibody molecule comprises a VL comprising the amino acid sequence of SEQ ID NO: 16, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 16.
  • the anti-PD-1 antibody molecule comprises a VH comprising the amino acid sequence of SEQ ID NO: 6 and a VL comprising the amino acid sequence of SEQ ID NO: 20. In one embodiment, the anti-PD-1 antibody molecule comprises a VH comprising the amino acid sequence of SEQ ID NO: 6 and a VL comprising the amino acid sequence of SEQ ID NO: 16.
  • the antibody molecule comprises a VH encoded by the nucleotide sequence of SEQ ID NO: 7, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 7. In one embodiment, the antibody molecule comprises a VL encoded by the nucleotide sequence of SEQ ID NO: 21 or 17, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 21 or 17. In one embodiment, the antibody molecule comprises a VH encoded by the nucleotide sequence of SEQ ID NO: 7 and a VL encoded by the nucleotide sequence of SEQ ID NO: 21 or 17.
  • the anti-PD-1 antibody molecule comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 8, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 8. In one embodiment, the anti-PD-1 antibody molecule comprises a light chain comprising the amino acid sequence of SEQ ID NO: 22, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 22. In one embodiment, the anti-PD-1 antibody molecule comprises a light chain comprising the amino acid sequence of SEQ ID NO: 18, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 18.
  • the anti-PD-1 antibody molecule comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 8 and a light chain comprising the amino acid sequence of SEQ ID NO: 22. In one embodiment, the anti-PD-1 antibody molecule comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 8 and a light chain comprising the amino acid sequence of SEQ ID NO: 18.
  • the antibody molecule comprises a heavy chain encoded by the nucleotide sequence of SEQ ID NO: 9, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 9.
  • the antibody molecule comprises a light chain encoded by the nucleotide sequence of SEQ ID NO: 23 or 19, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 23 or 19.
  • the antibody molecule comprises a heavy chain encoded by the nucleotide sequence of SEQ ID NO: 9 and a light chain encoded by the nucleotide sequence of SEQ ID NO: 23 or 19.
  • the antibody molecules described herein can be made by vectors, host cells, and methods described in US 2015/0210769, incorporated by reference in its entirety.
  • VH and VL regions can be subdivided into regions of hypervariability, termed “complementarity determining regions” (CDR), interspersed with regions that are more conserved, termed “framework regions” (FR or FW).
  • CDR complementarity determining regions
  • FR framework regions
  • CDR complementarity determining region
  • the precise amino acid sequence boundaries of a given CDR can be determined using any of a number of well-known schemes, including those described by Kabat et al. (1991), “Sequences of Proteins of Immunological Interest,” 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (“Kabat” numbering scheme), Al-Lazikani et al., (1997) JMB 273, 927-948 (“Chothia” numbering scheme). As used herein, the CDRs defined according the “Chothia” number scheme are also sometimes referred to as “hypervariable loops.”
  • the CDR amino acid residues in the heavy chain variable domain (VH) are numbered 31-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3); and the CDR amino acid residues in the light chain variable domain (VL) are numbered 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3).
  • the CDR amino acids in the VH are numbered 26-32 (HCDR1), 52-56 (HCDR2), and 95-102 (HCDR3); and the amino acid residues in VL are numbered 26-32 (LCDR1), 50-52 (LCDR2), and 91-96 (LCDR3).
  • the CDRs consist of amino acid residues 26-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3) in human VH and amino acid residues 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3) in human VL.
  • the anti-PD-1 antibody molecules can include any combination of one or more Kabat CDRs and/or Chothia CDRs, e.g., described in Table A.
  • the following definitions are used for the anti-PD-1 antibody molecules described in Table A: HCDR1 according to the combined CDR definitions of both Kabat and Chothia, and HCCDRs 2-3 and LCCDRs 1-3 according the CDR definition of Kabat.
  • each VH and VL typically includes three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
  • the length of a reference sequence aligned for comparison purposes is at least 30%, preferably at least 40%, more preferably at least 50%, 60%, and even more preferably at least 70%, 80%, 90%, 100% of the length of the reference sequence.
  • the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
  • amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid “homology”.
  • the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
  • the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
  • the percent identity between two amino acid sequences is determined using the Needleman and Wunsch ((1970) J. Mol. Biol. 48:444-453) algorithm which has been incorporated into the GAP program in the GCG software package (available at www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
  • the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
  • a particularly preferred set of parameters are a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
  • the percent identity between two amino acid or nucleotide sequences can be determined using the algorithm of E. Meyers and W. Miller ((1989) CABIOS, 4:11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
  • nucleic acid and protein sequences described herein can be used as a “query sequence” to perform a search against public databases to, for example, identify other family members or related sequences.
  • Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10.
  • Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res. 25:3389-3402.
  • the default parameters of the respective programs e.g., XBLAST and NBLAST
  • XBLAST and NBLAST can be used. See www.ncbi.nlm.nih.gov.
  • a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
  • the anti-PD-1 antibody molecule is Nivolumab (Bristol-Myers Squibb), also known as MDX-1106, MDX-1106-04, ONO-4538, BMS-936558, or OPDIVO®.
  • Nivolumab clone 5C4
  • other anti-PD-1 antibodies are disclosed in U.S. Pat. No. 8,008,449 and WO 2006/121168, incorporated by reference in their entirety.
  • the anti-PD-1 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of Nivolumab, e.g., as disclosed in Table B.
  • the anti-PD-1 antibody molecule is Pembrolizumab (Merck & Co), also known as Lambrolizumab, MK-3475, MK03475, SCH-900475, or KEYTRUDA®.
  • Pembrolizumab and other anti-PD-1 antibodies are disclosed in Hamid, O. et al. (2013) New England Journal of Medicine 369 (2): 134-44, U.S. Pat. No. 8,354,509, and WO 2009/114335, incorporated by reference in their entirety.
  • the anti-PD-1 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of Pembrolizumab, e.g., as disclosed in Table B.
  • the anti-PD-1 antibody molecule is Pidilizumab (CureTech), also known as CT-011. Pidilizumab and other anti-PD-1 antibodies are disclosed in Rosenblatt, J. et al. (2011) J Immunotherapy 34(5): 409-18, U.S. Pat. Nos. 7,695,715, 7,332,582, and 8,686,119, incorporated by reference in their entirety.
  • the anti-PD-1 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of Pidilizumab, e.g., as disclosed in Table B.
  • the anti-PD-1 antibody molecule is MEDI0680 (Medimmune), also known as AMP-514.
  • MEDI0680 and other anti-PD-1 antibodies are disclosed in U.S. Pat. No. 9,205,148 and WO 2012/145493, incorporated by reference in their entirety.
  • the anti-PD-1 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of MEDI0680.
  • anti-PD-1 antibodies include those described, e.g., in WO 2015/112800, WO 2016/092419, WO 2015/085847, WO 2014/179664, WO 2014/194302, WO 2014/209804, WO 2015/200119, U.S. Pat. Nos. 8,735,553, 7,488,802, 8,927,697, 8,993,731, and 9,102,727, incorporated by reference in their entirety.
  • the anti-PD-1 antibody is an antibody that competes for binding with, and/or binds to the same epitope on PD-1 as, one of the anti-PD-1 antibodies described herein.
  • the PD-1 inhibitor is a peptide that inhibits the PD-1 signaling pathway, e.g., as described in U.S. Pat. No. 8,907,053, incorporated by reference in its entirety.
  • the PD-1 inhibitor is an immunoadhesin (e.g., an immunoadhesin comprising an extracellular or PD-1 binding portion of PD-L1 or PD-L2 fused to a constant region (e.g., an Fc region of an immunoglobulin sequence).
  • the PD-1 inhibitor is AMP-224 (B7-DCIg (Amplimmune), e.g., disclosed in WO 2010/027827 and WO 2011/066342, incorporated by reference in their entirety).
  • the combination product comprises a crystalline form according to any one of embodiments 1 to 7, and an anti-PD-L1 antibody molecule such as those described herein.
  • PD-L1 Programmed Death Ligand 1
  • PD-1 has been described as a ligand for the immunoinhibitory receptor Programmed Death 1 (PD-1). Binding of PD-L1 to PD-1 leads to the inhibition of T cell receptor-mediated lymphocyte proliferation and cytokine secretion (Freeman et al. (2000) J Exp Med 192:1027-34). Thus, blocking of PD-L1 can lead to enhancement of antitumor immunity.
  • PD-L1 is expressed on activated T cells, dendritic cells (DCs), natural killer (NK) cells, macrophages, B cells, monocytes, and vascular endothelium cells.
  • DCs dendritic cells
  • NK natural killer
  • macrophages macrophages
  • B cells monocytes
  • vascular endothelium cells Several cell types express PD-L1.
  • PD-L1 is expressed on activated T cells, dendritic cells (DCs), natural killer (NK) cells, macrophages, B cells, monocytes, and vascular endothelium cells.
  • PD-L1 is expressed in many cancers, including human lung, ovarian and colon carcinoma and various myelomas, (Iwai et al. (2002) PNAS 99:12293-7; Ohigashi et al. (2005) Clin Cancer Res 11:2947-53; Okazaki et al. (2007) Intern. Immun. 19:813-24; Thompson et al
  • T lymphocytes predominantly express PD-1 compared to T lymphocytes in normal tissues and peripheral blood T lymphocytes. This indicates that up-regulation of PD-1 on tumor-reactive T cells can contribute to impaired antitumor immune responses (Ahmadzadeh et al. (2009) Blood 114:1537-44).
  • PD-L1 signaling mediated by PD-L1 expressing tumor cells interacting with PD-1 expressing T cells may lead to attenuation of T cell activation and evasion of immune surveillance (Sharpe et al. (2002) Nat Rev Immunol. 2:116-26; Keir et al. (2008) Annu Rev Immunol. 26:677-704).
  • PD-1 blockade can inhibit hematogenous spread of poorly immunogenic tumor cells by enhanced recruitment of effector T cells (Iwai et al. (2005) Int. Immunol. 17:133-144).
  • Anti-PD-L1 can enhance T-cell immunity, e.g., through blocking both its inhibitory interactions with PD-1 and B7-1. Anti-PD-1 can also allow for immune regulation via PD-L2/PD-1. Both PD-1 and B7-1 are expressed on T cells, B cells, DCs, and macrophages, which provides potential for bidirectional interactions between B7-1 and PD-L1 on these cell types. PD-L1 on non-hematopoietic cells may interact with B7-1 as well as PD-1 on T cells.
  • the anti-PD-L1 antibody molecule is chosen from YW243.55.S70, MPDL3280A, MEDI-4736, MSB-0010718C, or MDX-1105.
  • the anti-PD-L1 antibody is MSB0010718C.
  • MSB0010718C (also referred to as A09-246-2; Merck Serono) is a monoclonal antibody that binds to PD-L1.
  • MSB0010718C and other humanized anti-PD-L1 antibodies are disclosed in WO2013/079174, and having a sequence disclosed herein (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
  • the heavy and light chain amino acid sequences of MSB0010718C include at least the following:
  • Heavy chain (SEQ ID NO: 24 as disclosed in WO2013/079174) (SEQ ID NO: 42) EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYIMMWVRQAPGKGLEW VSSIYPSGGITFYADKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYC ARIKLGTVTTVDYWGQGTLVTVSS
  • Light chain (SEQ ID NO: 25 as disclosed in WO2013/079174) (SEQ ID NO: 43) QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPK LMIYDVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYT SSSTRVFGTGTKVTVL
  • the PD-L1 inhibitor is YW243.55.S70.
  • the YW243.55.S70 antibody is an anti-PD-L1 described in WO 2010/077634 (heavy and light chain variable region sequences shown in SEQ ID NOs. 20 and 21, respectively), and having a sequence disclosed therein (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
  • the PD-L1 inhibitor is MDX-1105.
  • MDX-1105 also known as BMS-936559, is an anti-PD-L1 antibody described in WO2007/005874, and having a sequence disclosed therein (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
  • the PD-L1 inhibitor is MDPL3280A (Genentech/Roche).
  • MDPL3280A is a human Fc optimized IgG1 monoclonal antibody that binds to PD-L1.
  • MDPL3280A and other human monoclonal antibodies to PD-L1 are disclosed in U.S. Pat. No. 7,943,743 and U.S Publication No.: 20120039906.
  • the PD-L1 inhibitor is an anti-PD-L1 antibody molecule disclosed in US 2016/0108123, filed Oct. 13, 2015, entitled “Antibody Molecules to PD-L1 and Uses Thereof,” incorporated by reference in its entirety.
  • the anti-PD-L1 antibody molecule includes at least one or two heavy chain variable domains (optionally including a constant region), at least one or two light chain variable domains (optionally including a constant region), or both, comprising the amino acid sequence of any of BAP058-hum01, BAP058-hum02, BAP058-hum03, BAP058-hum04, BAP058-hum05, BAP058-hum06, BAP058-hum07, BAP058-hum08, BAP058-hum09, BAP058-hum10, BAP058-hum11, BAP058-hum12, BAP058-hum13, BAP058-hum14, BAP058-hum15, BAP058-hum16, BAP058-hum17, BAP058-Clone-K, BAP058-Clone-L, BAP058-Clone-M, BAP058-Clone-N, or BAP058-Clone-
  • the anti-PD-L1 antibody molecule includes at least one, two, or three complementarity determining regions (CDRs) from a heavy chain variable region and/or a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP058-hum01, BAP058-hum02, BAP058-hum03, BAP058-hum04, BAP058-hum05, BAP058-hum06, BAP058-hum07, BAP058-hum08, BAP058-hum09, BAP058-hum10, BAP058-hum11, BAP058-hum12, BAP058-hum13, BAP058-hum14, BAP058-hum15, BAP058-hum16, BAP058-hum17, BAP058-Clone-K, BAP058-Clone-L, BAP058-Clone-M, BAP058-Clone-N, or BAP058
  • the anti-PD-L1 antibody molecule includes at least one, two, or three CDRs (or collectively all of the CDRs) from a heavy chain variable region comprising an amino acid sequence shown in Table 1 of US 2016/0108123, or encoded by a nucleotide sequence shown in Table 1 of US 2016/0108123.
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1 of US 2016/0108123, or encoded by a nucleotide sequence shown in Table 1 of US 2016/0108123.
  • the anti-PD-L1 antibody molecule includes at least one, two, or three CDRs (or collectively all of the CDRs) from a light chain variable region comprising an amino acid sequence shown in Table 1 of US 2016/0108123, or encoded by a nucleotide sequence shown in Table 1.
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1 of US 2016/0108123, or encoded by a nucleotide sequence shown in Table 1 of US 2016/0108123.
  • the anti-PD-L1 antibody molecule includes a substitution in a light chain CDR, e.g., one or more substitutions in a CDR1, CDR2 and/or CDR3 of the light chain.
  • the anti-PD-L1 antibody molecule includes at least one, two, three, four, five or six CDRs (or collectively all of the CDRs) from a heavy and light chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1 of US 2016/0108123.
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1 of US 2016/0108123, or encoded by a nucleotide sequence shown in Table 1 of US 2016/0108123.
  • the anti-PD-L1 antibody molecule includes at least one, two or three CDRs or hypervariable loops from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP058-hum01, BAP058-hum02, BAP058-hum03, BAP058-hum04, BAP058-hum05, BAP058-hum06, BAP058-hum07, BAP058-hum08, BAP058-hum09, BAP058-hum10, BAP058-hum11, BAP058-hum12, BAP058-hum13, BAP058-hum14, BAP058-hum15, BAP058-hum16, BAP058-hum17, BAP058-Clone-K, BAP058-Clone-L, BAP058-Clone-M, BAP058-Clone-N, or BAP058-Clone-O, according to the Kabat and
  • the anti-PD-L1 antibody molecule can include VH CDR1 according to Kabat et al. ((1991), “Sequences of Proteins of Immunological Interest,” 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md.) or VH hypervariable loop 1 according to Chothia et al. (1992) J. Mol. Biol. 227:799-817, or a combination thereof, e.g., as shown in Table 1 of US 2016/0108123.
  • the combination of Kabat and Chothia CDR of VH CDR1 comprises the amino acid sequence GYTFTSYWMY (SEQ ID NO: 63), or an amino acid sequence substantially identical thereto (e.g., having at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions)).
  • the anti-PD-L1 antibody molecule can further include, e.g., VH CDRs 2-3 according to Kabat et al. and VL CDRs 1-3 according to Kabat et al., e.g., as shown in Table 1 of US 2016/0108123.
  • the anti PD-L1 antibody molecule for use in the invention comprises:
  • VH heavy chain variable region
  • VL light chain variable region
  • VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 44; a VHCDR2 amino acid sequence of SEQ ID NO: 45; and a VHCDR3 amino acid sequence of SEQ ID NO: 46; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 49, a VLCDR2 amino acid sequence of SEQ ID NO: 50, and a VLCDR3 amino acid sequence of SEQ ID NO: 51;
  • a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 63, a VHCDR2 amino acid sequence of SEQ ID NO: 48, and a VHCDR3 amino acid sequence of SEQ ID NO: 46; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 52, a VLCDR2 amino acid sequence of SEQ ID NO: 53, and a VLCDR3 amino acid sequence of SEQ ID NO: 54; or
  • VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 63; a VHCDR2 amino acid sequence of SEQ ID NO: 45; and a VHCDR3 amino acid sequence of SEQ ID NO: 46; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 52, a VLCDR2 amino acid sequence of SEQ ID NO: 53, and a VLCDR3 amino acid sequence of SEQ ID NO: 54.
  • the anti-PD-L1 antibody molecule for use in the invention comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 55 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 58.
  • the anti-PD-L1 antibody molecule for use in the invention comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 62 and a light chain comprising the amino acid sequence of SEQ ID NO: 60.
  • Table C Amino acid and nucleotide sequences for humanized anti-PD-L1 mAb BAP058-hum013. The amino acid and nucleotide sequences of the heavy and light chain CDRs, the heavy and light chain variable regions, and the heavy and light chains are shown.
  • the immunotherapeutic agent (Such as an anti-PD-1 antibody molecule or an anti-PD-L1 molecule antibody) can be administered to the subject systemically (e.g., orally, parenterally, subcutaneously, intravenously, rectally, intramuscularly, intraperitoneally, intranasally, transdermally, or by inhalation or intracavitary installation), topically, or by application to mucous membranes, such as the nose, throat and bronchial tubes.
  • the subject systemically e.g., orally, parenterally, subcutaneously, intravenously, rectally, intramuscularly, intraperitoneally, intranasally, transdermally, or by inhalation or intracavitary installation
  • mucous membranes such as the nose, throat and bronchial tubes.
  • the immunotherapeutic agent e.g. anti-PD-1 antibody molecule or anti PD-L1 antibody molecule
  • the immunotherapeutic agent e.g. anti-PD-1 antibody molecule
  • is administered by injection e.g., subcutaneously or intravenously
  • a dose of about 1 to 30 mg/kg e.g., about 5 to 25 mg/kg, about 10 to 20 mg/kg, about 1 to 5 mg/kg, or about 3 mg/kg.
  • the dosing schedule can vary from e.g., once a week to once every 2, 3, or 4 weeks.
  • the anti-PD-1 antibody molecule is administered at a dose from about 10 to 20 mg/kg every other week. In another embodiment, the anti-PD-1 antibody molecule is administered at a dose from about 1 to 10 mg/Kg, or from about 1 to 5 mg/Kg or about 3 mg/kg every 4 weeks.
  • the anti-PD-1 antibody molecule is administered or used at a flat or fixed dose.
  • the anti-PD-1 antibody molecule is administered by injection (e.g., subcutaneously or intravenously) at a dose (e.g., a flat dose) of about 200 mg to 500 mg, e.g., about 250 mg to 450 mg, about 300 mg to 400 mg, about 250 mg to 350 mg, about 350 mg to 450 mg, or about 300 mg or about 400 mg.
  • the dosing schedule e.g., flat dosing schedule
  • the anti-PD-1 antibody molecule is administered at a dose from about 300 mg to 400 mg once every three weeks or once every four weeks. In one embodiment, the anti-PD-1 antibody molecule is administered at a dose from about 300 mg once every three weeks. In one embodiment, the anti-PD-1 antibody molecule is administered at a dose from about 400 mg once every four weeks. In one embodiment, the anti-PD-1 antibody molecule is administered at a dose from about 300 mg once every four weeks. In one embodiment, the anti-PD-1 antibody molecule is administered at a dose from about 400 mg once every three weeks.
  • the anti-PD-1 antibody molecule is administered at a flat dose of about 300 mg to 400 mg once every three weeks or once every four weeks. In a subset of this embodiment, the anti-PD-1 antibody molecule is administered at a flat dose of about 400 mg every four weeks. In yet another subset of this embodiment, the anti-PD-1 antibody molecule is administered at a flat dose of about 300 mg every three weeks.
  • Crystalline forms may be prepared by a variety of methods, including for example, crystallization or recrystallization from a suitable solvent, sublimation, growth from a melt, solid state transformation from another phase, crystallization from a supercritical fluid, and jet spraying.
  • Techniques for crystallization or recrystallization of crystalline forms from a solvent mixture include, for example, evaporation of the solvent, decreasing the temperature of the solvent mixture, crystal seeding a supersaturated solvent mixture of the molecule and/or salt, freeze drying the solvent mixture, and addition of antisolvents (countersolvents) to the solvent mixture.
  • Exemplary methods of preparing the crystalline forms described herein are set forth in detail below.
  • solvents For crystallization techniques that employ solvents, the choice of solvent or solvents is typically dependent upon one or more factors, such as solubility of the compound, crystallization technique, and vapor pressure of the solvent. Combinations of solvents may be employed, for example, the compound may be solubilized into a first solvent to afford a solution, followed by the addition of an antisolvent to decrease the solubility of the compound in the solution and to afford the formation of crystals.
  • An antisolvent is a solvent in which the compound has low solubility.
  • a compound is suspended and/or stirred in a suitable solvent to afford a slurry, which may be heated to promote dissolution.
  • a suitable solvent to afford a slurry, which may be heated to promote dissolution.
  • slurry means a saturated solution of the compound, which may also contain an additional amount of the compound to afford a heterogeneous mixture of the compound and a solvent at a given temperature. This may also be referred to as a suspension.
  • Seed crystals may be added to any crystallization mixture to promote crystallization. Seeding may be employed to control growth of a particular polymorph or to control the particle size distribution of the crystalline product. Accordingly, calculation of the amount of seeds needed depends on the size of the seed available and the desired size of an average product particle as described, for example, in “Programmed Cooling of Batch Crystallizers,” J. W. Mullin and J. Nyvlt, Chemical Engineering Science, 1971, 26, 369-377. In general, seeds of small size are needed to control effectively the growth of crystals in the batch. Seed of small size may be generated by sieving, milling, or micronizing of large crystals, or by micro-crystallization of solutions. Care should be taken that milling or micronizing of crystals does not result in any change in crystallinity form the desired crystal form (i.e., change to amorphous or to another polymorph).
  • a cooled crystallization mixture may be filtered under vacuum, and the isolated solids may be washed with a suitable solvent, such as cold recrystallization solvent, and dried under a nitrogen purge to afford the desired crystalline form.
  • the isolated solids may be analyzed by a suitable spectroscopic or analytical technique, such as solid state nuclear magnetic resonance, differential scanning calorimetry, x-ray powder diffraction, or the like, to assure formation of the preferred crystalline form of the product.
  • the resulting crystalline form is typically produced in an amount of greater than about 70 weight % isolated yield, preferably greater than 90 weight % isolated yield, based on the weight of the compound originally employed in the crystallization procedure.
  • the product may be co-milled or passed through a mesh screen to delump the product, if necessary.
  • crystalline forms may be prepared directly from the reaction medium of the final process for preparing 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine. This may be achieved, for example, by employing in the final process step a solvent or a mixture of solvents from which 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine or salt thereof may be crystallized.
  • crystalline forms may be obtained by distillation or solvent addition techniques.
  • the solid was analyzed by XRPD after isolation.
  • Step 1 To a reactor, were charged pyrazole (252 g, 9.0 eq.), acetonitrile (5 L) and potassium carbonate (860 g, 3.02 eq.). The mixture was heated at 65-75° C. for 30 minutes. The reaction mixture was cooled to 35-45° C., when 5-bromo-2,6-dichloropyrimidin-4-amine (500 g, 1.0 eq.) was added under N 2 protection. The resulting mixture was heated at 72-78° C. for 24 h. The reaction mixture was cooled to 40-50° C. and deemed complete by HPLC analysis. Water (20.2 kg) was added over a period of 2 hours. The temperature was controlled at 20° C. for 2 hours.
  • the crude product was collected by filtration and washed with water (5.0 kg).
  • the crude material was slurred with acetonitrile (0.8 kg) and water (4 kg) at 50-60° C. for 1 hour.
  • Wet cake was obtained by filtration and washing with water (2.0 kg).
  • the wet cake was dissolved in acetonitrile (153.0 kg) and water (2.3 kg) at 47° C., and active carbon (0.075 kg) was added.
  • the mixture was stirred at 42-52° C. for 1.5 hours.
  • Solid was filtered off through microcrystalline cellulose.
  • the filtrate was concentrated under vacuum at 55° C. till the total volume left was around 2.7 L. Water (4.0 kg) was added to the solution.
  • the mixture was concentrated under vacuum at 55° C.
  • Step 1 To a reactor, was charged 5-bromo-2,6-dichloropyrimidin-4-amine (50 g, 1.0 eq.), pyrazole (126.1 g, 9 eq.) and DMSO (350 mL). To the mixture was charged KOH (26 g, 2.25 eq.) with internal temperature kept under 35° C. The reaction was stirred for additional 30 min with internal temperature maintained under 35° C. by adjusting the jacket temperature. The reaction was then stirred at 35° C. for 2 hr, followed by stirring at 50° C. for 3 hr, and deemed complete by HPLC analysis. To the mixture, was added 0.5% KOH solution (60 mL) dropwise at 50° C.
  • Step 2 Recrystallization Procedure: To a reactor was added the crude 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (5 g) from the above step, methanol (140 g, 28 ⁇ ) and water (20 g, 4 ⁇ ). The mixture was heated at 50° C. to obtain a clear solution and filtered. The filtrate was concentrated under vacuum to the total weight of around 110 g (22 ⁇ ). The suspension was heated to reflux until all solid was dissolved. The solution was cooled slowly to 42° C. over a 1 h period. Solid precipitated out. Water (160 g, 32 ⁇ ) was added slowly at 42° C. Stirred for 2 hours and cooled to 20° C. After holding at 20° C.
  • a saturated ethanol solution of 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine (300 mg) was prepared at 60° C., then fast cooled to 4° C. with 400 r/s stir speed in easy-max for several hours. The resulting solid was collected via vacuum filtration and dry at r.t overnight. Free form of 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine (modification 2) was obtained as a crystalline white solid (Form G) with 42% yield. The solid was analyzed by XRPD after isolation.
  • XRPD X-ray powder diffraction
  • XRPD Instrument Bruker D8 Discover with XYZ stage Detector VANTEC-500 including controller 19′′ Radiation CuK ⁇ (0.15406 nm)
  • X-ray generator power 40 kV, 1 mA (Micro source) Step size, resolution 0.02 degrees Measuring slice 0.3 mm and 0.2 mm Scan range 4° to 45° (2 theta value)
  • Scan time 2 min X-ray optics I ⁇ s MONTEL optic for Cu Source slit Fixed, 1 mm Detector distance ⁇ 30 cm
  • DSC Accurately weigh 10 mg of test substance into the closed sample pan with pinhole. An empty sample pan is used as reference.
  • the DSC thermogram is recorded as follow: the temperature of the apparatus is adjusted to about 30° C., and heated to 300° C. at a heating rate of 10° C./min, under a nitrogen flow of 20 mL/min.
  • the instrument is calibrated for temperature and enthalpy with Indium, at least 99.9999% pure.
  • the accuracy of the measured sample temperature with this method is within about ⁇ 1° C., and the heat of fusion can be measured within a relative error of about ⁇ 5%.
  • TGA Accurately weigh 10 mg of test substance into the open sample pan.
  • the TGA thermogram is recorded as follows: the sample is loaded into the furnace, and heated to 300° C. at a heating rate of 10° C./min, under a flow of nitrogen at 20 mL/min. The instrument is calibrated for temperature with nickel, and calibrated for weight with a 100 mg standard.
  • FIGS. 2, 4, 6, 8, 10, 12 and 14 Illustrative DSC/TGA traces generated using crystalline Forms A, B, C, D, E, F and G are shown in FIGS. 2, 4, 6, 8, 10, 12 and 14 , respectively.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Mycology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Endocrinology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Plural Heterocyclic Compounds (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)

Abstract

This application relates to various crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine and salt thereof, as well as compositions and methods of using the same. In some embodiments the crystalline forms also contain water (“hydrates”). These materials are useful in the treatment of various diseases, including carcinomas, specifically lung cancer and more specifically non-small cell lung cancer.

Description

FIELD OF INVENTION
The present disclosure generally relates to crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine and new salts. The present disclosure also generally relates to a pharmaceutical composition comprising the crystalline forms, as well of methods of using the crystalline forms in the treatment of particular cancers, and methods for obtaining such crystalline forms.
BACKGROUND
5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine was first disclosed in WO2011/121418, filed Mar. 29, 2011, which is incorporated by reference in its entirety, and is an Adenosine 2a receptor inhibitor having the structure of Formula I:
Figure US10933064-20210302-C00001
The compound of Formula I is useful in the treatment of various disease states associated with the inhibition of the activity of Adenosine A2a receptor. As such, the compound of Formula I is therefore useful in the treatment of certain cancers, including, for example, a lung cancer, a melanoma, a renal cancer, a liver cancer, a myeloma, a prostate cancer, a breast cancer, a colorectal cancer, a pancreatic cancer, a head and neck cancer, anal cancer, gastro-esophageal cancer, thyroid cancer, cervical cancer, a lymphoproliferative disease or a hematological cancer, T-cell lymphoma, B-cell lymphoma, a non-Hogdkin lymphoma, or a leukemia. Additionally, Compound of Formula I is also useful in the treatment of neurodegenerative diseases such as Parkinson's disease, Huntington's or Alzheimer diseases, neuropsychiatric disorders and dysfunctions such as depression, excessive daytime sleepiness, restless legs syndrome, attention deficit hyperactivity disorder and cognitive fatigue.
It is well known that the solid state form of the active pharmaceutical ingredient (API) of a particular drug is often an important determinant of the drug's ease of preparation, hygroscopicity, stability, solubility, storage stability, ease of formulation, rate of dissolution in gastrointestinal fluids and in vivo bioavailability. Crystalline forms occur where the same composition of matter crystallizes in a different lattice arrangement resulting in different thermodynamic properties and stabilities specific to the particular crystalline form. Crystalline forms may also include different hydrates or solvates of the same compound. In deciding which form is preferable, the numerous properties of the forms are compared and the preferred form chosen based on the many physical property variables. It is entirely possible that one form can be preferable in some circumstances where certain aspects such as ease of preparation, stability, etc. are deemed to be critical. In other situations, a different form may be preferred for greater dissolution rate and/or superior bioavailability. It is not yet possible to predict whether a particular compound or salt of a compound will form polymorphs, whether any such polymorphs will be suitable for commercial use in a therapeutic composition, or which polymorphs will display such desirable properties.
SUMMARY
The present disclosure provides crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine hydrochloride salts. In a particular embodiment, the hydrochloride salts further include water (referred to herein as hydrates).
The present disclosure also provides crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine sulfate salt and 2 mesylate salt forms.
The present disclosure further provide two crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine in its free form (or non-salt form). Embodiments of these crystalline forms include those forms designated herein as Form A, Form B, Form C, Form D, Form E, Form F and Form G. The names used herein to identify a specific form, e.g. “Form A” etc., should not be considered limiting with respect to any other substance possessing similar or identical physical and chemical characteristics, but rather it should be understood that these designations are mere identifiers that should be interpreted according to the characterization information also presented herein.
BRIEF DESCRIPTION OF THE DRAWINGS
FIG. 1 provides an illustrative XRPD spectrum for the mono-hydrochloride hydrate salt of the compound of Formula I, designated herein as Form A, showing degrees 2θ (2-theta) on the X-axis and relative intensity on the Y-axis.
FIG. 2 provides an illustrative DSC/TGA for the mono-hydrochloride hydrate salt of the compound of Formula I, designated herein as Form A.
FIG. 3 provides an illustrative XRPD spectrum for the di-hydrochloride hydrate salt of the compound of Formula I, designated herein as Form B, showing degrees 2θ (2-theta) on the X-axis and relative intensity on the Y-axis.
FIG. 4 provides an illustrative DSC/TGA for the di-hydrochloride hydrate salt of the compound of Formula I, designated herein as Form B.
FIG. 5 provides an illustrative XRPD spectrum for the sulfate salt of the compound of Formula I, designated herein as Form C, showing degrees 2θ (2-theta) on the X-axis and relative intensity on the Y-axis.
FIG. 6 provides an illustrative DSC/TGA for the sulfate salt of the compound of Formula I, designated herein as Form C.
FIG. 7 provides an illustrative XRPD spectrum for the mesylate salt (Modification 1) of the compound of Formula I, designated herein as Form D, showing degrees 2θ (2-theta) on the X-axis and relative intensity on the Y-axis.
FIG. 8 provides an illustrative DSC/TGA for the mesylate salt (Modification 1) of the compound of Formula I, designated herein as Form D.
FIG. 9 provides an illustrative XRPD spectrum for the mesylate salt (Modification 2) of the compound of Formula I, designated herein as Form E, showing degrees 2θ (2-theta) on the X-axis and relative intensity on the Y-axis.
FIG. 10 provides an illustrative DSC/TGA for the mesylate salt (Modification 2) of the compound of Formula I, designated herein as Form E.
FIG. 11 provides an illustrative XRPD spectrum for the free form of the compound of Formula I (modification 1), designated herein as Form F, showing degrees 2θ (2-theta) on the X-axis and relative intensity on the Y-axis.
FIG. 12 provides an illustrative DSC/TGA for the free form of the compound of Formula I (modification 1), designated herein as Form F.
FIG. 13 provides an illustrative XRPD spectrum for the free form of the compound of Formula I (modification 2), designated herein as Form G, showing degrees 2θ (2-theta) on the X-axis and relative intensity on the Y-axis.
FIG. 14 provides an illustrative DSC/TGA for the free form of the compound of Formula I (modification 2), designated herein as Form G.
More detailed listings of the XRPD peaks for each of forms A through G are set forth in Tables 1 through 7, respectively below, in which the % relative intensity (I/I0×100) is also provided. It should be understood that in the X-ray powder diffraction spectra or pattern that there is inherent variability in the values measured in degrees 2θ (° 2θ) as a result of, for example, instrumental variation (including differences between instruments). As such, it should be understood that there is a variability of up to ±0.2 °2θ in XRPD peak measurements and yet such peak values would still be considered to be representative of a particular solid state form of the crystalline materials described herein. It should also be understood that other measured values from XRPD experiments and DSC/TGA experiments, such as relative intensity and water content, can vary as a result of, for example, sample preparation and/or storage and/or environmental conditions, and yet the measured values will still be considered to be representative of a particular solid state form of the crystalline materials described herein.
DETAILED DESCRIPTION OF THE DISCLOSURE
The present disclosure relates to crystalline forms of various salts of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (the compound of Formula I), which are described and characterized herein. The present invention also relates to various crystalline forms of the free form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine, which are described and characterized herein.
In embodiment 1, the present disclosure provides a crystalline form of the mono-hydrochloride hydrate salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (Form A) having an X-ray powder diffraction (XRPD) pattern comprising a representative peak, in terms of °2θ, at 10.0±0.2 °2θ. In another embodiment, the XRPD pattern further comprises one or more additional representative peaks chosen from 29.1±0.2 °2θ, 28.5±0.2 °2θ, and 20.8±0.2 °2θ. Accordingly, the XRPD pattern for the crystalline form of the mono-hydrochloride hydrate salt of the compound of Formula I may comprise one, two, three, or four representative peaks above. In another embodiment, the crystalline form of the mono-hydrochloride hydrate salt of the compound of Formula I has an XRPD pattern that may further include one or more additional representative peaks chosen from 25.3±0.2 °2θ and 15.6±0.2 °2θ. Thus, the XRPD pattern for the crystalline form of the mono-hydrochloride hydrate salt of the compound of Formula I may comprise one, two, three, four, five or six representative peaks disclosed above or disclosed in table 1.
In another embodiment, the mono-hydrochloride hydrate form is characterized by a x-ray powder diffraction pattern comprising four or more 2θ values (CuKα λ=1.54184 Å) selected from the group consisting of 10.0±0.2°, 15.6±0.2°, 20.8±0.2°, 22.6±0.2°, 24.5±0.2°, 25.3±0.2°, 28.5±0.2°, 29.1±0.2°, 30.7±0.2, measured at a temperature of about 25° C. and an x-ray wavelength, λ, of 1.54184 Å.
In yet another embodiment, a crystalline form of the mono-hydrochloride hydrate salt of the compound of Formula I has an XRPD pattern substantially as shown in FIG. 1. It should be understood that the water content of Form A can be in the range of about 3.0% to about 5.0% and still be considered to be a monohydrate having the XRPD pattern comprising the one, two, three, four, five or six representative peaks described above. The water content for Form A is 4.87%.
The crystalline form of the mono-hydrochloride hydrate salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine may be characterized thermally. In one embodiment, a crystalline form of the mono-hydrochloride hydrate salt of the compound of Formula I has a differential thermogravimetric profile comprising an endothermic peak starting at about 78.16° C. with an enthalpy ΔH of 300.87 J/g (corresponding to the dehydration) and an endothermic peak starting at about 212.48° C. with an enthalpy ΔH of 86.83 J/g (corresponding to the melting).
In another embodiment, a crystalline form of the mono-hydrochloride hydrate salt of the compound of Formula I has a DSC thermogram that is substantially as shown in FIG. 2. It should be understood that hydrated forms may yield different thermograms (in terms of peak shape and profile) depending on instrument parameters, thus the same material may have thermograms that look substantially different from each other when the data is generated on two different instruments.
In another embodiment, a crystalline form of the mono-hydrochloride hydrate salt of the compound of Formula I has a thermo gravimetric analysis (TGA) diagram substantially the same as that shown in shown in FIG. 2. The weight loss by TGA is about 14.9% at 88° C.
In yet another embodiment, the crystalline form A is substantially phase pure.
In embodiment 2, the present disclosure provides a crystalline form of the di-hydrochloride hydrate salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (Form B) having an X-ray powder diffraction (XRPD) pattern comprising a representative peak, in terms of °2θ, at 26.4±0.2 °2θ. In another embodiment, the XRPD pattern further comprises one or more additional representative peaks chosen from 9.6±0.2 °2θ, 22.1±0.2 °2θ, 28.4±0.2 °2θ and 30.6±0.2 °2θ. Accordingly, the XRPD pattern for the crystalline form of the di-hydrochloride hydrate salt of the compound of Formula I may comprise one, two, three, or four representative peaks above. In another embodiment, the crystalline form of the di-hydrochloride hydrate salt of the compound of Formula I has an XRPD pattern that may further include one or more additional representative peaks chosen from 22.4±0.2 °2θ, 27.4±0.2 °2θ and 27.9±0.2 °2θ. Thus, the XRPD pattern for the crystalline form of the di-hydrochloride monohydrate salt of the compound of Formula I may comprise one, two, three, four, five or six representative peaks disclosed above or disclosed in table 2.
In another aspect of embodiment 2, the di-hydrochloride hydrate form is characterized by a x-ray powder diffraction pattern comprising four or more 2θ values (CuKα λ=1.54184 Å) selected from the group consisting of 9.6±0.2°, 16.1±0.2°, 21.5±0.2°, 22.1±0.2°, 22.4±0.2°, 23.1±0.2°, 26.4±0.2°, 27.4±0.2°, 27.9±0.2, 28.4±0.2, 30.6±0.2 and 34.8±0.2, measured at a temperature of about 25° C. and an x-ray wavelength, λ, of 1.54184 Å.
In yet another aspect of embodiment 2, a crystalline form of the di-hydrochloride monohydrate salt of the compound of Formula I has an XRPD pattern substantially as shown in FIG. 3. It should be understood that the water content of Form B can be in the range of about 3.0% to about 5.0% and still be considered to be a monohydrate having the XRPD pattern comprising the one, two, three, four, five or six representative peaks described above. The water content for Form B is 4.5%.
The crystalline form of the di-hydrochloride hydrate salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine may be characterized thermally. In one embodiment, a crystalline form of the di-hydrochloride hydrate salt of the compound of Formula I has a differential thermogravimetric profile comprising an endothermic peak starting at about 78.92° C. with enthalpy ΔH of 399.81 J/g, and an endothermic peak starting at about 212.18° C. with enthalpy ΔH of 81.06 J/g.
In another aspect of embodiment 2, a crystalline form of the di-hydrochloride hydrate salt of the compound of Formula I has a DSC thermogram that is substantially as shown in FIG. 4. It should be understood that hydrated forms may yield different thermograms (in terms of peak shape and profile) depending on instrument parameters, thus the same material may have thermograms that look substantially different from each other when the data is generated on two different instruments.
In another aspect of embodiment 2, a crystalline form of the di-hydrochloride hydrate salt of the compound of Formula I has a thermo gravimetric analysis (TGA) diagram substantially the same as that shown in shown in FIG. 4. The weight loss by TGA is about 24.4% at 96° C.
In yet another embodiment, the crystalline form B is substantially phase pure.
In embodiment 3, the present disclosure provides a crystalline form of the sulfate salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (Form C) having an X-ray powder diffraction (XRPD) pattern comprising a representative peak, in terms of °2θ, at 9.4±0.2 °2θ. In another embodiment, the XRPD pattern further comprises one or more additional representative peaks chosen from 23.2±0.2 °2θ, 24.8±0.2 °2θ and 26.8±0.2 °2θ. Accordingly, the XRPD pattern for the crystalline form of the sulfate salt of the compound of Formula I may comprise one, two, three, or four representative peaks above. In another embodiment, the crystalline form of the sulfate salt of the compound of Formula I has an XRPD pattern that may further include one or more additional representative peaks chosen from 12.3±0.2 °2θ, 17.1±0.2 °2θ, 26.5±0.2 °2θ and 26.1±0.2 °2θ. Thus, the XRPD pattern for the crystalline form of the sulfate salt of the compound of Formula I may comprise one, two, three, four, five or six representative peaks disclosed above or disclosed in table 3.
In another aspect of embodiment 3, the sulfate form is characterized by a x-ray powder diffraction pattern comprising four or more 2θ values (CuKα λ=1.54184 Å) selected from the group consisting of 9.4±0.2°, 12.3±0.2°, 12.7±0.2°, 17.1±0.2°, 23.2±0.2°, 24.8±0.2°, 26.1±0.2°, 26.4±0.2°, 26.8±0.2, and 29.9±0.2, measured at a temperature of about 25° C. and an x-ray wavelength, λ, of 1.54184 Å.
In yet another aspect of embodiment 3, a crystalline form of the sulfate salt of the compound of Formula I has an XRPD pattern substantially as shown in FIG. 5.
The crystalline form of the sulfate salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine may be characterized thermally. In one embodiment, a crystalline form of the sulfate salt of the compound of Formula I has a differential thermogravimetric profile comprising an endothermic peak starting at about 188.44° C. with an enthalpy ΔH of 117.42 J/g.
In another aspect of embodiment 3, a crystalline form of the sulfate salt of the compound of Formula I has a DSC thermogram that is substantially as shown in FIG. 6. It should be understood that hydrated forms may yield different thermograms (in terms of peak shape and profile) depending on instrument parameters, thus the same material may have thermograms that look substantially different from each other when the data is generated on two different instruments.
In another aspect of embodiment 3, a crystalline form of the sulfate salt of the compound of Formula I has a thermo gravimetric analysis (TGA) diagram substantially the same as that shown in shown in FIG. 6. The weight loss is 0.4% at 166° C. by TGA.
In yet another embodiment, the crystalline form C is substantially phase pure.
In embodiment 4, the present disclosure provides a crystalline form of the mesylate salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (modification 1=Form D) having an X-ray powder diffraction (XRPD) pattern comprising a representative peak, in terms of °2θ, at 24.0±0.2 °2θ. In another aspect of embodiment 4, the XRPD pattern further comprises one or more additional representative peaks chosen from 20.3±0.2 °2θ, and 10.1±0.2 °2θ. Accordingly, the XRPD pattern for the crystalline form 1 (also referred to as modification 1) of the mesylate salt of the compound of Formula I may comprise one, two or three representative peaks above. In another embodiment, the crystalline form 1 of the mesylate salt of the compound of Formula I has an XRPD pattern that may further include one or more additional representative peaks chosen from 17.9±0.2 °2θ, 26.4±0.2 °2θ and 33.3±0.2 °2θ. Thus, the XRPD pattern for the crystalline form 1 of the mesylate salt of the compound of Formula I may comprise one, two, three, four, five or six representative peaks disclosed above or disclosed in table 4.
In another aspect of embodiment 4, the mesylate form is characterized by a x-ray powder diffraction pattern comprising four or more 2θ values (CuKα λ=1.54184 Å) selected from the group consisting of 9.1±0.2°, 10.1±0.2°, 17.9±0.2°, 20.3±0.2°, 24.0±0.2°, 25.0±0.2°, 26.4±0.2°, and 33.3±0.2°, measured at a temperature of about 25° C. and an x-ray wavelength, λ, of 1.54184 Å.
In yet another aspect of embodiment 4, a crystalline form 1 of the mesylate salt of the compound of Formula I has an XRPD pattern substantially as shown in FIG. 7.
The crystalline form 1 (also referred to as modification 1) of the mesylate salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine may be characterized thermally. In one embodiment, a crystalline form of the mesylate salt of the compound of Formula I has a differential thermogravimetric profile comprising an endothermic peak starting at about 177.10° C. with enthalpy ΔH of 122.19 J/g.
In another aspect of embodiment 4, a crystalline form 1 of the mesylate salt of the compound of Formula I has a DSC thermogram that is substantially as shown in FIG. 8. It should be understood that hydrated forms may yield different thermograms (in terms of peak shape and profile) depending on instrument parameters, thus the same material may have thermograms that look substantially different from each other when the data is generated on two different instruments.
In another aspect of embodiment 4, a crystalline form 1 of the mesylate salt of the compound of Formula I has a thermo gravimetric analysis (TGA) diagram substantially the same as that shown in shown in FIG. 8. The weight loss by TGA is about 1.7% at 157° C.
In yet another embodiment, the crystalline form D is substantially phase pure.
In embodiment 5, the present disclosure provides a crystalline form of the mesylate salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (modification 2=Form E) having an X-ray powder diffraction (XRPD) pattern comprising a representative peak, in terms of °2θ, at 26.6±0.2 °2θ. In another aspect of embodiment 5, the XRPD pattern further comprises one or more additional representative peaks chosen from 22.1±0.2 °2θ, 23.4±0.2 °2θ and 16.6±0.2 °2θ. Accordingly, the XRPD pattern for the crystalline form 2 of the mesylate salt of the compound of Formula I may comprise one, two, three or four representative peaks above. In another embodiment, the crystalline form 2 of the mesylate salt of the compound of Formula I has an XRPD pattern that may further include one or more additional representative peaks chosen from 9.0±0.2 °2θ, 21.0±0.2 °2θ, 24.1±0.2 °2θ and 29.9±0.2 °2θ. Thus, the XRPD pattern for the crystalline form 2 of the mesylate salt of the compound of Formula I may comprise one, two, three, four, five or six representative peaks disclosed above or disclosed in table 5.
In another aspect of embodiment 5, the mesylate form is characterized by a x-ray powder diffraction pattern comprising four or more 2θ values (CuKα λ=1.54184 Å) selected from the group consisting of 9.0±0.2°, 16.6±0.2°, 18.0±0.2°, 21.0±0.2°, 22.1±0.2°, 23.4±0.2°, 24.1±0.2°, 25.0±0.2 °2θ, 26.7±0.2 °2θ and 29.9±0.2°, measured at a temperature of about 25° C. and an x-ray wavelength, λ, of 1.54184 Å.
In yet another aspect of embodiment 5, a crystalline form 2 of the mesylate salt of the compound of Formula I has an XRPD pattern substantially as shown in FIG. 9.
The crystalline form 2 of the mesylate salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine may be characterized thermally. In one embodiment, a crystalline form of the mesylate salt of the compound of Formula I has a differential thermogravimetric profile comprising an endothermic peak starting at about 168.84° C. with enthalpy ΔH of 113.21 J/g.
In another aspect of embodiment 5, a crystalline form 2 of the mesylate salt of the compound of Formula I has a DSC thermogram that is substantially as shown in FIG. 10. It should be understood that hydrated forms may yield different thermograms (in terms of peak shape and profile) depending on instrument parameters, thus the same material may have thermograms that look substantially different from each other when the data is generated on two different instruments.
In another aspect of embodiment 5, a crystalline form 2 of the mesylate salt of the compound of Formula I has a thermo gravimetric analysis (TGA) diagram substantially the same as that shown in shown in FIG. 10. The weight loss by TGA is about 0.7% at 150° C.
In yet another embodiment, the crystalline form E is substantially phase pure.
In embodiment 6, the present disclosure provides a crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine in its free form (modification 1=Form F) having an X-ray powder diffraction (XRPD) pattern comprising a representative peak, in terms of °2θ, at 8.2±0.2 °2θ. In another embodiment, the XRPD pattern further comprises one or more additional representative peaks chosen from 24.9±0.2 °2θ, 25.7±0.2 °2θ and 26.5±0.2 °2θ. Accordingly, the XRPD pattern for the crystalline form 1 (also referred to as modification 1) of the free form of the compound of Formula I may comprise one, two, three or four representative peaks above. In another embodiment, the crystalline form 1 of the free form of the compound of Formula I has an XRPD pattern that may further include one or more additional representative peaks chosen from 11.5±0.2 °2θ, 16.4±0.2 °2θ and 30.8±0.2 °2θ, and. Thus, the XRPD pattern for the crystalline form 1 of the free form of the compound of Formula I may comprise one, two, three, four, five or six representative peaks disclosed above or disclosed in table 6.
In another aspect of embodiment 6, the crystalline form 1 of the free form is characterized by a x-ray powder diffraction pattern comprising four or more 2θ values (CuKα λ=1.54184 Å) selected from the group consisting of 8.2±0.2°, 11.5±0.2°, 16.4±0.2°, 16.9±0.2°, 18.1±0.2°, 24.9±0.2°, 25.6±0.2°, 25.7±0.2 °2θ, 26.5±0.2 °2θ and 30.8±0.2°, measured at a temperature of about 25° C. and an x-ray wavelength, λ, of 1.54184 Å.
In yet another aspect of embodiment 6, a crystalline form 1 of the free form of the compound of Formula I has an XRPD pattern substantially as shown in FIG. 11.
The crystalline form 1 of the free form of 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine may be characterized thermally. In one embodiment, a crystalline form 1 of the free form of the compound of Formula I has a differential thermogravimetric profile comprising an endothermic peak starting at about 212.62° C. with an enthalpy ΔH of 104.22 J/g.
In another aspect of embodiment 6, a crystalline form 1 of the free form of the compound of Formula I has a DSC thermogram that is substantially as shown in FIG. 12. It should be understood that hydrated forms may yield different thermograms (in terms of peak shape and profile) depending on instrument parameters, thus the same material may have thermograms that look substantially different from each other when the data is generated on two different instruments.
In another aspect of embodiment 6, a crystalline form 1 of the free form of the compound of Formula I has a thermo gravimetric analysis (TGA) diagram substantially the same as that shown in shown in FIG. 12. The weight loss by TGA is about 0.6% at 190° C.
In yet another embodiment, the crystalline form F is substantially phase pure.
In embodiment 7, the present disclosure provides a crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine in its free form (modification 2=Form G) having an X-ray powder diffraction (XRPD) pattern comprising a representative peak, in terms of °2θ, at 21.8±0.2 °2θ. In another embodiment, the XRPD pattern further comprises one or more additional representative peaks chosen from 8.3±0.2 °2θ, 25.2±0.2 °2θ and 26.8±0.2 °2θ. Accordingly, the XRPD pattern for the crystalline form 2 (also referred to as modification 2) of the free form of the compound of Formula I may comprise one, two, three or four representative peaks above.
In another embodiment, the crystalline form 2 of the free form of the compound of Formula I has an XRPD pattern that may further include one or more additional representative peaks chosen from 14.0±0.2 °2θ, 16.7±0.2 °2θ, and 30.7±0.2 °2θ. Thus, the XRPD pattern for the crystalline form 2 of the free form of the compound of Formula I may comprise one, two, three, four, five or six representative peaks disclosed above or disclosed in table 7.
In another aspect of embodiment 7, the crystalline form 2 of the free form is characterized by a x-ray powder diffraction pattern comprising four or more 2θ values (CuKα λ=1.54184 Å) selected from the group consisting of 8.3±0.2°, 10.4±0.2°, 14.0±0.2°, 16.7±0.2°, 21.8±0.2°, 24.6±0.2°, 25.1±0.2°, 26.8±0.2°, 30.7±0.2°, 32.8±0.2°, and 42.5±0.2 °2θ measured at a temperature of about 25° C. and an x-ray wavelength, λ, of 1.54184 Å.
In yet another of embodiment 7, a crystalline form 2 of the free form of the compound of Formula I has an XRPD pattern substantially as shown in FIG. 13.
The crystalline form 2 of the free form of 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine may be characterized thermally. In one embodiment, a crystalline form of the free form 2 of the compound of Formula I has a differential thermogravimetric profile comprising an endothermic peak starting at about 202.95° C. with enthalpy ΔH of 14.84 J/g, and an endothermic peak starting at about 212.96° C. with enthalpy ΔH of 91.99 J/g.
In another aspect of embodiment 7, a crystalline form 2 of the free form of the compound of Formula I has a DSC thermogram that is substantially as shown in FIG. 14. It should be understood that hydrated forms may yield different thermograms (in terms of peak shape and profile) depending on instrument parameters, thus the same material may have thermograms that look substantially different from each other when the data is generated on two different instruments.
In another aspect of embodiment 7, a crystalline form 2 of the free form of the compound of Formula I has a thermo gravimetric analysis (TGA) diagram substantially the same as that shown in shown in FIG. 14. The weight loss by TGA is about 1.06% at 190° C.
In embodiment 8, the invention relates to a pharmaceutical composition comprising a therapeutically effective amount of a crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (any one of forms A to G according to any one of embodiments 1 to 7 and any sub embodiments thereof), and at least one pharmaceutically acceptable excipient. In a particular embodiment, the invention relates to a pharmaceutical composition comprising crystalline form F, and a pharmaceutically acceptable excipient. In yet another aspect of embodiment 8, the invention relates to a pharmaceutical composition comprising crystalline form F in substantially pure phase. In yet another embodiment, the invention relates to a pharmaceutical formulation comprising crystalline form F and further comprising at least one other solid state form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine. In one aspect of this embodiment, the other solid state form is crystalline form G. In yet another embodiment, the other solid state form is an amorphous form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine. In a further embodiment, the amorphous form is a non-salt (free base) of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine.
In embodiment 9, the invention relates to a combination, in particular a pharmaceutical combination, comprising a therapeutically effective amount of a crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (any one of forms A to G, preferably form F), and one or more immunotherapeutic agents.
In embodiment 10, the invention relates to a method of treating cancer, in a subject in need thereof, the method comprising: administering to a subject in need thereof, a therapeutically effective amount of a crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (any one of forms A to G according to any one of embodiments 1 to 7 and any sub embodiments thereof, preferably form F), or a pharmaceutical composition according to embodiment 8, alone or in combination with one or more immunotherapeutic agents.
In embodiment 11, the invention relates to the use of a crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (any one of forms A to G according to any one of embodiments 1 to 7 and any sub embodiments thereof, preferably form F), or the use of a pharmaceutical composition according to embodiment 8, alone or in combination with one or more immunotherapeutic agents, for the treatment of cancer.
In embodiment 12, the invention pertains to a crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (any one of forms A to G according to any one of embodiments 1 to 7 and any sub embodiments thereof, preferably form F), or a pharmaceutical composition according to embodiment 8, for use in the treatment of cancer.
In embodiment 13, the invention pertains to a combination of a crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (any one of forms A to G according to any one of embodiments 1 to 7 and any sub embodiments thereof, preferably form F), and one or more immunotherapeutic agents, for use in the treatment of cancer.
In embodiment 14, the invention relates to a method of inhibiting adenosine A2a receptor, in a subject in need thereof comprising: administering to a subject a therapeutically effective amount of a crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (any one of forms A to G according to any one of embodiments 1 to 7 and any sub embodiments thereof, preferably form F), or a pharmaceutical composition according to embodiment 8.
In embodiment 15, the invention relates to a method according to embodiment 10, a use according to embodiment 11, a compound for use according to embodiment 12, or a combination for use according to embodiment 13, wherein the cancer is selected from wherein the cancer is selected from a lung cancer, a melanoma, a renal cancer, a liver cancer, a myeloma, a prostate cancer, a breast cancer, a colorectal cancer, a pancreatic cancer, a head and neck cancer, anal cancer, gastro-esophageal cancer, thyroid cancer, cervical cancer, a lymphoproliferative disease or a hematological cancer, T-cell lymphoma, B-cell lymphoma, a non-Hogdkin lymphoma, or a leukemia.
In embodiment 16, the invention relates to the method, use, crystalline form or combination for use of embodiment 15 wherein the cancer is carcinomas, specifically lung cancer and more specifically non-small cell lung cancer.
In embodiment 17, the invention relates to the method of embodiment 10, 15 or 16, a use according to embodiment 11, 15 or 16, or the combination for use according to embodiment 13, 15 or 16, wherein one or more immunotherapeutic agents are selected from the group consisting of anti-CTLA4 antibodies, anti-PD-1 antibodies and anti-PD-L1 antibodies.
In embodiment 18, the invention relates to the method of embodiment 10, 15 or 16, a use according to embodiment 11, 15 or 16, or the combination for use according to embodiment 13, 15 or 16, wherein the immunotherapeutic agent is selected from the group consisting of: Ipilimumab, Tremelimumab, Nivolumab, Pembrolizumab, Pidilizumab (CT-011), AMP-224, AMP-514 (MEDI0680-Medimmune), MPDL3280A (Genentech Roche), MEDI4736, MSB0010718C (Merck Serono), YW243.55.S70 and MDX-1105.
In embodiment 19, the invention relates to the method of embodiment 10, 15 or 16, a use according to embodiment 11, 15 or 16, or the combination for use according to embodiment 13, 15 or 16, wherein the immunotherapeutic agents is an anti-PD-1 antibody.
In embodiment 19A, the invention relates to the method of embodiment 10, 15 or 16, a use according to embodiment 11, 15 or 16, or the combination for use according to embodiment 13, 15 or 16, wherein the immunotherapeutic agents is an anti-PD-1 antibody selected from Nivulomab, Pembrolizumab, Pidilizumab, MEDI0680 (AMP514 Medimmune), AMP224 (Medimmune), and antibodies described in US 2015/0210769)
In embodiment 20, the invention relates to the method, the use or the combination for use according to embodiment 19, wherein the anti-PD-1 antibody comprises:
(a) a heavy chain variable region (VH) comprising a VHCDR1 amino acid sequence of SEQ ID NO: 4, a VHCDR2 amino acid sequence of SEQ ID NO: 5, and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a light chain variable region (VL) comprising a VLCDR1 amino acid sequence of SEQ ID NO: 13, a VLCDR2 amino acid sequence of SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 15;
(b) a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 1; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 12;
(c) a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 41, a VHCDR2 amino acid sequence of SEQ ID NO: 5, and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 13, a VLCDR2 amino acid sequence of SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 15; or
(d) a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 41; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 12.
In embodiment 21, the invention pertains to the method, the use or the combination for use according to embodiment 19, wherein the anti-PD-1 comprises a VH comprising the amino acid sequence of SEQ ID NO: 6 and a VL comprising the amino acid sequence of SEQ ID NO: 20.
In embodiment 22, the invention pertains to the method, the use or the combination for use according to embodiment 19, wherein the anti-PD-1 antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 8 and a light chain comprising the amino acid sequence of SEQ ID NO: 22.
In embodiment 23, the invention pertains to the method, the use or the combination for use according to embodiment 19, wherein the anti-PD-1 antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 6 and a VL comprising the amino acid sequence of SEQ ID NO: 16.
In embodiment 24, the invention pertains to the method, the use or the combination for use according to embodiment 19, wherein the anti-PD-1 antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 8 and a light chain comprising the amino acid sequence of SEQ ID NO: 18.
In embodiment 25, the invention pertains to the method, the use or the combination for use according to any one of embodiments 19-24, wherein the anti-PD-1 antibody molecule is administered at a dose of about 300 mg once every three weeks.
In embodiment 26, the invention pertains to the method, the use or the combination for use according to any one of embodiments 19-24, wherein the anti-PD-1 antibody molecule is administered at a dose of about 400 mg once every four weeks.
In embodiment 27, the invention relates to the method of embodiment 10, 15 or 16, a use according to embodiment 11, 15 or 16, or the combination for use according to embodiment 13, 15 or 16, wherein the immunotherapeutic agents is is an anti-PD-L1 antibody.
In embodiment 27A, the invention relates to the method, the use or the combination for use according to embodiment 27, wherein the anti PD-L1 antibody molecule is selected from YW243.55.S70, MPDL3280A, MEDI-4736, MSB-0010718C, MDX-1105 and an anti PD-L1 antibody described in US 2016/0108123.
In embodiment 28, the invention relates to the method, the use or the combination for use according to embodiment 27, wherein the anti PD-L1 antibody molecule comprises:
    • (a) a heavy chain variable region (VH) comprising a VHCDR1 amino acid sequence of SEQ ID NO: 47, a VHCDR2 amino acid sequence of SEQ ID NO: 48, and a VHCDR3 amino acid sequence of SEQ ID NO: 46; and a light chain variable region (VL) comprising a VLCDR1 amino acid sequence of SEQ ID NO: 52, a VLCDR2 amino acid sequence of SEQ ID NO: 53, and a VLCDR3 amino acid sequence of SEQ ID NO: 54;
    • (b) a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 44; a VHCDR2 amino acid sequence of SEQ ID NO: 45; and a VHCDR3 amino acid sequence of SEQ ID NO: 46; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 49, a VLCDR2 amino acid sequence of SEQ ID NO: 50, and a VLCDR3 amino acid sequence of SEQ ID NO: 51;
    • (c) a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 63, a VHCDR2 amino acid sequence of SEQ ID NO: 48, and a VHCDR3 amino acid sequence of SEQ ID NO: 46; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 52, a VLCDR2 amino acid sequence of SEQ ID NO: 53, and a VLCDR3 amino acid sequence of SEQ ID NO: 54; or
    • (d) a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 63; a VHCDR2 amino acid sequence of SEQ ID NO: 45; and a VHCDR3 amino acid sequence of SEQ ID NO: 46; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 49, a VLCDR2 amino acid sequence of SEQ ID NO: 50, and a VLCDR3 amino acid sequence of SEQ ID NO: 51.
In embodiment 29, the invention relates to the method, the use or the combination for use according to embodiment 27, wherein the anti PD-L1 antibody molecule comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 55 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 58.
In embodiment 30, the invention relates to the method, the use or the combination for use according to any one of embodiments 17-29, wherein immunotherapeutic agent is administered together in a single composition or administered separately in two or more different compositions forms.
In embodiment 31, the invention pertains to the method the method, the use or the combination for use according to any one of embodiments 17-29 wherein the immunotherapeutic agent is administered concurrently with, prior to, or subsequent to, a crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine.
The crystalline forms described herein have been found to have advantageous properties. The criteria for selection are toxicological considerations, crystallinity, monomorphism, melting point, hygroscopicity, stability in bulk, compatibility with excipients, pH of aqueous solution, solubility in water and aqueous media, morphology, handling and polymorphism behaviors. Free form F has demonstrated superior behaviors.
Two crystalline forms of the free form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine were identified, which included the crystalline form F and a crystalline form G, as discussed herein. Among the different free forms identified, crystalline Form F is the more thermodynamically stable as compared to the other free form G.
Competitive slurry experiments using 1:1 mixture of modification F and modification G were carried out at room temperature. The mixture of modification F and modification G completely converted to Modification F after equilibrium for 5 days. Modification G upon melting recrystallizes into modification F, thus indicating that Form F is more stable than form G.
Moreover, crystalline Form F was shown to have better chemical stability properties than crystalline Form G. In particular, Form F was shown to be physically and chemically stable in bulk when exposed for one week at 80° C. at ambient relative humidity (RH). Specifically, analysis of the crystalline Form F drug substance indicated that there was less than 1% degradation of the Form F material under these conditions. Form F also proved to be physically and chemically stable in bulk for one to two weeks at 50° C. at ambient relative humidity as well as at 50° C. at 75% relative humidity. Specifically, analysis of the crystalline Form F drug substance indicated that there was less than 1% degradation of the Form F material under both sets of conditions. Furthermore, Form F was physically and chemically stable under light stressed exposure.
In a pH stability study, 0.1% suspension/solution of Form F showed less than 0.5% degradation in buffer solutions of various pHs at 50° C. for one week, except at pH 1.2, where 1% degradation resulted. Additionally, form F shows superior property over the sulfate form C in term of stability in organic solvents. Therefore the crystalline form F has shown chemical stability in both solution and solid states.
Crystalline form F was shown to have better thermal stability properties than other disclosed crystalline forms A-E and G. After heating to 220° C. (melt) then cooling to 30° C., the crystalline form F remains unchanged. XRPD was carried out to study the stability of the crystalline form upon heating and cooling, and the results did not indicate a form change except some peaks shifted at high temperature.
Crystalline Form F was shown to have better physical stability properties than other disclosed crystalline forms (A-E and G). The crystallinity of form F was evaluated by XRPD after compression for 5 minutes at 0.5 ton with 0.8 cm diameter disc. The XRPD indicated no form change after compression.
The physical stability of crystalline form F was also evaluated in granulation simulation experiments. In these experiments granulating solvent was added dropwise to the crystalline form F until the solid is wetted sufficiently. The mixture was then ground in a mortar/pestle at room temperature (25° C. for 2-3 minutes) between each addition. The crystallinity of the material (post-grinding) was re-evaluated by XRPD and DSC. Under the aforementioned conditions using water or ethanol as the granulation solvent, XRPD results indicated no form change.
Both the free form F and the sulfate form C exhibited good stability when blended with four selected excipients, which are 1.Gelatin, 2 HPMC, 3 wet granulation mixture [MCC PH101 (45%); lactose monohydrate (44%); PVP K30 (4%), Crospovidone XL (5%), Aerosil (0.5%); Mg-Stearate (1.5%) and 20% w/w water added to the mixture)] and 4 dry blended mixture [Lactose USP (73%), Starch 1500 (20%), Explotab (5 wt %), Aerosil (0.5 wt %); Mg-Stearate (1.5 wt)] under 50° C./75% RH where about 1% degradation was observed.
The crystalline 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (Form F) exists primarily as a highly crystalline material.
Crystalline form F is non-hygroscopic. Water sorption-desorption isotherm recorded on a DVS (dynamic vapor sorption) instrument, 50%-90%-0% (cycle 1) and 0%-90%-50% (cycle 2) relative humidity (RH) at 25° C. in steps of 10% RH, dm/dt=0.002%/min showed that the crystalline form F absorbs less than 0.2% moisture up to 90% relative humidity.
Form F shows little to no phase change on exposure to humidity.
Form F shows solubility in aqueous buffers across pH 1 to pH 10 and bio-relevant media, of about 0.1 mg/mL in all tested media.
The free form F showed a slow intrinsic dissolution in 0.01N HCl pH=2 (0.0115 mg/cm2/min), acetate buffer pH 4.7 (0.0085 mg/cm2/min) and phosphate buffer pH 6.8 (0.0084 mg/cm2/min).
The sulfate salt Form C is very hygroscopic when the relative humidity is above 70%.
It was further determined that the intrinsic dissolution rate of the sulfate salt (Form C) is slightly greater than that of the free form F in 0.01N HCl pH=2 (0.0592 mg/cm2/min), acetate buffer pH 4.7 (0.0264 mg/cm2/min) and phosphate buffer pH 6.8 (0.0277 mg/cm2/min).
The sulfate salt (Form C) shows better morphology and therefore improve flow-ability but does not show any better solubility than the free form F since it dissociates in aqueous media.
Definition
As used herein, the terms “about” and “substantially” indicate with respect to features such as endotherms, endothermic peak, exotherms, baseline shifts, etc., that their values can vary. With reference to X-ray diffraction peak positions, “about” or “substantially” means that typical peak position and intensity variability are taken into account. For example, one skilled in the art will appreciate that the peak positions (2Θ) will show some inter-apparatus variability, typically as much as 0.2°. Occasionally, the variability could be higher than 0.2° depending on apparatus calibration differences. Further, one skilled in the art will appreciate that relative peak intensities will show inter-apparatus variability as well as variability due to degree of crystallinity, preferred orientation, prepared sample surface, and other factors known to those skilled in the art, and should be taken as qualitative measure only. For DSC, variation in the temperatures observed will depend upon the rate of temperature change as well as sample preparation technique and the particular instrument employed. Thus, the endotherm/melting point values reported herein relating to DSC/TGA thermograms can vary ±2° C. (and still be considered to be characteristic of the particular crystalline form described herein). When used in the context of other features, such as, for example, percent by weight (% by weight) the term “about” indicates a variance of ±3%.
As used herein “polymorph” refers to crystalline forms having the same chemical composition but different spatial arrangements of the molecules, atoms, and/or ions forming the crystal.
As used herein “solvate” refers to a crystalline form of a molecule, atom, and/or ions that further comprises molecules of a solvent or solvents incorporated into the crystalline lattice structure. The solvent molecules in the solvate may be present in a regular arrangement and/or a non-ordered arrangement. The solvate may comprise either a stoichiometric or nonstoichiometric amount of the solvent molecules. For example, a solvate with a nonstoichiometric amount of solvent molecules may result from partial loss of solvent from the solvate. Alternatively, solvates may occur as dimers or oligomers comprising more than one molecule or within the crystalline lattice structure.
As used herein “amorphous” refers to a solid form of a molecule, atom, and/or ions that is not crystalline. An amorphous solid does not display a definitive X-ray diffraction pattern.
As used herein, “substantially phase pure,” when used in reference to any crystalline form of the compound of Formula I, means a compound having a phase purity of greater than about 90% by weight, including greater than about 90, 91, 92, 93, 94, 95, 96, 97, 98, and about 99% by weight, and also including equal to about 100% by weight of the compound of Formula I, based on the weight of the compound on an anhydrous basis. The term “phase pure” or “phase purity” herein refers to phase homogeneity with respect to a particular solid state form of the compound of Formula I and does not necessarily imply a high degree of chemical purity absent an express statement to that effect. Phase purity may be determined according to methods known in the art, for example, using XRPD to do quantitative phase analysis using one or more approaches known in the art, for example, via an external standard method, direct comparisons of line (peak) characteristics which are attributed to different phases in a particular spectra, or via an internal standard method. However XRPD quantification of phase purity can be complicated by the presence of amorphous material. Accordingly, other methods that may be useful for determining phase purity include, for example, solid state NMR spectroscopy, Raman and/or infrared spectroscopy. One of skilled in the art would readily understand these methods and how to employ these additional (or alternative) methods for determining phase purity.
As used herein, “substantially chemically pure” when used in reference to any crystalline form of the compound of Formula I, means a compound having a chemical purity greater than about 90% by weight, including greater than about 90, 91, 92, 93, 94, 95, 96, 97, 98, and about 99% by weight, and also including equal to about 100% by weight of the compound of Formula I, based on the weight of the salt (on an anhydrous basis). The remaining material generally comprises other compounds, such as for example, other stereoisomers of the compound of Formula I, reaction impurities, starting materials, reagents, side products, and/or other processing impurities arising from the preparation and/or isolation and/or purification of the particular crystalline form. For example, a crystalline form of the compound of Formula I may be deemed to be substantially chemically pure if it has been determined to have a chemical purity of greater than about 90% by weight, as measured by standard and generally accepted methods known in the art, where the remaining less than about 10% by weight constitutes other materials such as other stereoisomers of the compound of Formula I, reaction impurities, starting materials, reagents, side products, and/or processing impurities. Chemical purity may be determined according to methods known in the art, for example, high performance liquid chromatography (HPLC), LC-MS (liquid chromatography-mass spectrometry), nuclear magnetic resonance (NMR) spectroscopy, or infrared spectroscopy. One of skill in the art would readily understand these methods and how to employ these additional (or alternative) methods for determining chemical purity.
The term “a therapeutically effective amount” of a compound of the present invention refers to an amount of the compound of the present invention that will elicit a biological or medical response in a subject, for example, reduction or inhibition of an enzyme or a protein activity, or ameliorate symptoms, alleviate conditions, or slow or delay disease progression, etc. In one non-limiting embodiment, the term “a therapeutically effective amount” refers to the amount of the compound of the present invention that, when administered to a subject, is effective to (1) at least partially alleviating, inhibiting, and/or ameliorating a condition, or a disorder or a disease (i) mediated by adenosine A2a receptor, or (ii) associated with adenosine or the activity of adenosine A2a receptor, or (iii) characterized by activity (normal or abnormal) of adenosine A2a receptor; or (2) reducing or inhibiting the activity of adenosine A2a receptor. In another non-limiting embodiment, the term “a therapeutically effective amount” refers to the amount of the compound of the present invention that, when administered to a cell, or a tissue, or a non-cellular biological material, or a medium, is effective to at least partially reducing or inhibiting the activity of adenosine A2a receptor; or at least partially reducing or inhibiting the expression of adenosine A2a receptor.
As used herein, the term “subject” refers to an animal. Preferably, the animal is a mammal. A subject refers to for example, primates (e.g. humans), cows, sheep, goats, horses, dogs, cats, rabbits, rats, mice, fish, birds and the like. In a preferred embodiment, the subject is a human.
As used herein, the term “a,” “an,” “the” and similar terms used in the context of the present invention (especially in the context of the claims) are to be construed to cover both the singular and plural unless otherwise indicated herein or clearly contradicted by the context.
All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g. “such as”) provided herein is intended merely to better illuminate the invention and does not pose a limitation on the scope of the invention otherwise claimed.
As used herein, the term “inhibit”, “inhibition” or “inhibiting” refers to the reduction or suppression of a given condition, symptom, or disorder, or disease, or a significant decrease in the baseline activity of a biological activity or process.
As used herein, the terms “treat,” “treating,” or “treatment” of any disease or disorder refers in one embodiment, to ameliorating the disease or disorder (i.e., slowing or arresting or reducing the development of the disease or at least one of the clinical symptoms thereof). In another embodiment, “treat,” “treating,” or “treatment” refers to alleviating or ameliorating at least one physical parameter including those which may not be discernible by the patient. In yet another embodiment, “treat,” “treating,” or “treatment” refers to modulating the disease or disorder, either physically, (e.g., stabilization of a discernible symptom), physiologically, (e.g., stabilization of a physical parameter), or both. In one embodiment, “treat” or “treating” refers to delaying the progression of the disease or disorder.
As used herein, the term “prevent”, “preventing” or “prevention” of any disease or disorder refers to the prophylactic treatment of the disease or disorder; or delaying the onset of the disease or disorder.
As used in the present document the term “cancer” is used to designate a group of diseases involving abnormal cell growth with the potential to invade or spread to other parts of the body. Cancers are classified by the type of cell that the tumor cells resemble and is therefore presumed to be the origin of the tumor. These types include carcinoma, sarcoma, lymphoma and leukemia, germ cell tumor and blastoma.
As used in the present document the term carcinoma is used to designate cancers derived from epithelial cells. This group includes many of the most common cancers, particularly in the aged, and include nearly all those developing in the breast, prostate, lung, pancreas, and colon.
For example the term “cancer” includes but is not limited to, a solid tumor, a hematological cancer (e.g., leukemia, lymphoma, myeloma, e.g., multiple myeloma), and a metastatic lesion. In one embodiment, the cancer is a solid tumor. Examples of solid tumors include malignancies, e.g., sarcomas and carcinomas, e.g., adenocarcinomas of the various organ systems, such as those affecting the lung, breast, ovarian, lymphoid, gastrointestinal (e.g., colon), anal, genitals and genitourinary tract (e.g., renal, urothelial, bladder cells, prostate), pharynx, CNS (e.g., brain, neural or glial cells), head and neck, skin (e.g., melanoma), and pancreas, as well as adenocarcinomas which include malignancies such as colon cancers, rectal cancer, renal-cell carcinoma, liver cancer, non-small cell lung cancer, cancer of the small intestine and cancer of the esophagus. The cancer may be at an early, intermediate, late stage or metastatic cancer.
In one embodiment, the cancer is chosen from a lung cancer (e.g., a non-small cell lung cancer (NSCLC) (e.g., a NSCLC with squamous and/or non-squamous histology, or a NSCLC adenocarcinoma)), a melanoma (e.g., an advanced melanoma), a renal cancer (e.g., a renal cell carcinoma), a liver cancer, a myeloma (e.g., a multiple myeloma), a prostate cancer, a breast cancer (e.g., a breast cancer that does not express one, two or all of estrogen receptor, progesterone receptor, or Her2/neu, e.g., a triple negative breast cancer), a colorectal cancer, a pancreatic cancer, a head and neck cancer (e.g., head and neck squamous cell carcinoma (HNSCC), anal cancer, gastro-esophageal cancer, thyroid cancer, cervical cancer, a lymphoproliferative disease (e.g., a post-transplant lymphoproliferative disease) or a hematological cancer, T-cell lymphoma, B-cell lymphoma, a non-Hogdkin lymphoma, or a leukemia (e.g., a myeloid leukemia or a lymphoid leukemia).
In another embodiment, the cancer can be, e.g., a cancer described herein, such as lung cancer (squamous), lung cancer (adenocarcinoma), head and neck cancer, cervical cancer (squamous), stomach cancer, thyroid cancer, melanoma, nasopharyngeal cancer (e.g., differentiated or undifferentiated metastatic or locally recurrent nasopharyngeal carcinoma), or breast cancer.
In another embodiment, the cancer is chosen form a carcinoma (e.g., advanced or metastatic carcinoma), melanoma or a lung carcinoma, e.g., a non-small cell lung carcinoma.
In one embodiment, the cancer is a lung cancer, e.g., a non-small cell lung cancer or small cell lung cancer.
As used in the present document the term lung cancer (also known as carcinoma of the lung or pulmonary carcinoma) is used to designate malignant lung tumors characterized by uncontrolled cell growth in tissues of the lung.
As used in the present document the term non-small-cell lung carcinoma (NSCLC) is used to designate any type of lung cancer other than small cell lung carcinoma (SCLC).
As used in the present document the term immunotherapeutic treatment refers to a broad class of therapies designated to elicit immune-mediated destruction of tumor cells. In said therapies are used immunotherapeutic agents.
As used in the present document the term immunotherapeutic agents refer to compounds useful to carrying out immunotherapeutic treatment of cancer, such as agent selected from the group consisting of anti-CTLA4 antibodies, such as Ipilimumab and Tremelimumab, anti-PD-1 antibodies such as MDX-1106, MK3475, CT-011, AMP-224 or an anti-PD-1 antibody molecule as described in WO2015/112900; and anti-PD-L1 antibodies such as MEDI4736, MDX-1105 or an anti-PD-L1 antibody described in US 2016/0108123.
As used herein, the term “Programmed Death 1” or “PD-1” include isoforms, mammalian, e.g., human PD-1, species homologs of human PD-1, and analogs comprising at least one common epitope with PD-1. The amino acid sequence of PD-1, e.g., human PD-1, is known in the art, e.g., Shinohara T et al. (1994) Genomics 23(3):704-6; Finger L R, et al. Gene (1997) 197(1-2):177-87.
As used herein, the term “Programmed Death Ligand 1” or “PD-L1” include isoforms, mammalian, e.g., human PD-L1, species homologs of human PD-1, and analogs comprising at least one common epitope with PD-L1. The amino acid sequence of PD-L1, e.g., human PD-1, is known in the art, e.g., Dong et al. (1999) Nat Med. 5(12):1365-9; Freeman et al. (2000) J Exp Med. 192(7):1027-34).
As used herein the term “combination” refers to either a fixed combination in one dosage unit form, or a combined administration where a crystalline form of compound of Formula I and a combination partner (i.e. an immunotherapeutic agent) may be administered independently at the same time or separately within time intervals, especially where these time intervals allow that the combination partners show a cooperative, e.g. synergistic effect. The single components may be packaged in a kit or separately. One or both of the components (e.g., powders or liquids) may be reconstituted or diluted to a desired dose prior to administration.
The terms “co-administration” or “combined administration” or the like as utilized herein are meant to encompass administration of the selected combination partner to a single subject in need thereof (e.g. a patient), and are intended to include treatment regimens in which the agents are not necessarily administered by the same route of administration or at the same time.
The term “pharmaceutical combination” and “combination product” are used interchangeably and refers to either a fixed combination in one dosage unit form, or non-fixed combination or a kit of parts for the combined administration where two or more therapeutic agents may be administered independently at the same time or separately within time intervals, especially where these time intervals allow that the combination partners show a cooperative, e.g. synergistic effect. The term “fixed combination” means that a crystalline form of the compound of Formula I and a combination partner (i.e. immunotherapeutic agent), are both administered to a patient simultaneously in the form of a single entity or dosage. The term “non-fixed combination” means that a crystalline form of the compound of Formula I and a combination partner (i.e. the immunotherapeutic agent), are both administered to a patient as separate entities either simultaneously, concurrently or sequentially with no specific time limits, wherein such administration provides therapeutically effective levels of the two compounds in the body of the patient. The latter also applies to cocktail therapy, e.g. the administration of three or more therapeutic agent. In a preferred embodiment, the pharmaceutical combination is a non-fixed combination.
The term “combination therapy” refers to the administration of two or more therapeutic agents to treat a cancer as described in the present disclosure. Such administration encompasses co-administration of these therapeutic agents in a substantially simultaneous manner, such as in a single capsule having a fixed ratio of active ingredients. Alternatively, such administration encompasses co-administration in multiple, or in separate containers (e.g., tablets, capsules, powders, and liquids) for each active ingredient. Powders and/or liquids may be reconstituted or diluted to a desired dose prior to administration. In addition, such administration also encompasses use of each type of therapeutic agent in a sequential manner, either at approximately the same time or at different times. In either case, the treatment regimen will provide beneficial effects of the drug combination in treating the conditions or disorders described herein.
Pharmaceutical Composition, Combination, Dosage and Administration
In some embodiments the crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine described herein can be used alone or they can be formulated into a pharmaceutical composition that also contains at least one pharmaceutically acceptable excipient, and often contains at least two or more pharmaceutically acceptable excipients. Some suitable excipients are disclosed herein. Other excipients may be used that are known in the art without departing from the intent and scope of the present application.
In some embodiments, the present invention utilizes a pharmaceutical composition comprising a compound of the present invention and a pharmaceutically acceptable excipient. The pharmaceutical composition can be formulated for particular routes of administration such as oral administration, parenteral administration, and rectal administration, etc. In addition, the pharmaceutical compositions of the present invention can be made up in a solid form (including without limitation capsules, tablets, pills, granules, powders or suppositories), or in a liquid form (including without limitation solutions, suspensions or emulsions). The pharmaceutical compositions can be subjected to conventional pharmaceutical operations such as sterilization and/or can contain conventional inert diluents, lubricating agents, carriers or buffering agents, as well as adjuvants, such as solvents, preservatives, stabilizers, wetting agents, emulsifiers and bulking agents, etc.
Typically, the pharmaceutical compositions are tablets or capsules comprising the active ingredient together with at least one excipient, such as:
a) diluents, e.g., lactose, dextrose, sucrose, mannitol, sorbitol, cellulose and/or glycine;
b) lubricants, e.g., silica, talcum, stearic acid, its magnesium or calcium salt and/or polyethyleneglycol; for tablets also
c) binders, e.g., magnesium aluminum silicate, starch paste, gelatin, tragacanth, methylcellulose, sodium carboxymethylcellulose and/or polyvinylpyrrolidone; if desired;
d) carriers such as an aqueous vehicle containing a co-solvating material such as captisol, PEG, glycerin, cyclodextrin, or the like;
e) disintegrants, e.g., starches, agar, alginic acid or its sodium salt, or effervescent mixtures; and/or
f) absorbents, colorants, flavors and sweeteners.
Tablets may be either film coated or enteric coated according to methods known in the art.
Preferably, the compound or composition is prepared for oral administration, such as a tablet or capsule, for example, and optionally packaged in a multi-dose format suitable for storing and/or dispensing unit doses of a pharmaceutical product. Examples of suitable packaging include, but are not limited to, hermetically sealed foils, unit dose containers (e.g., vials), blister packs, and strip packs.
Tablets may contain the active ingredient in admixture with nontoxic, pharmaceutically acceptable excipients which are suitable for the manufacture of tablets. These excipients are, for example, inert diluents, such as calcium carbonate, sodium carbonate, lactose, calcium phosphate or sodium phosphate; granulating and disintegrating agents, for example, corn starch, or alginic acid; binding agents, for example, starch, gelatin or acacia; and lubricating agents, for example magnesium stearate, stearic acid or talc. The tablets are uncoated or coated by known techniques to delay disintegration and absorption in the gastrointestinal tract and thereby provide a sustained action over a longer period. For example, a time delay material such as glyceryl monostearate or glyceryl distearate can be employed. Formulations for oral use can be presented as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluent, for example, calcium carbonate, calcium phosphate or kaolin, or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium, for example, peanut oil, liquid paraffin or olive oil.
The present invention further provides anhydrous pharmaceutical compositions and dosage forms comprising the compounds of the present invention as active ingredients, since water may facilitate the degradation of certain compounds.
Anhydrous pharmaceutical compositions and dosage forms of the invention can be prepared using anhydrous or low moisture containing ingredients and low moisture or low humidity conditions. An anhydrous pharmaceutical composition may be prepared and stored such that its anhydrous nature is maintained. Accordingly, anhydrous compositions are preferably packaged using materials known to prevent exposure to water such that they can be included in suitable formulary kits. Examples of suitable packaging include, but are not limited to, hermetically sealed foils, plastics, unit dose containers (e.g., vials), blister packs, and strip packs.
The invention further provides pharmaceutical compositions and dosage forms that comprise one or more agents that reduce the rate by which the compound of the present invention as an active ingredient will decompose. Such agents, which are referred to herein as “stabilizers,” include, but are not limited to, antioxidants such as ascorbic acid, pH buffers, or salt buffers, etc.
The pharmaceutical composition or combination of the present invention can be in unit dosage of about 1-1000 mg of active ingredient(s) for a subject of about 50-70 kg, or about 1-500 mg or about 1-250 mg or about 1-150 mg or about 0.5-100 mg, or about 1-50 mg of active ingredients. The therapeutically effective dosage of a compound, the pharmaceutical composition, or the combinations thereof, is dependent on the species of the subject, the body weight, age and individual condition, the disorder or disease or the severity thereof being treated. A physician, clinician or veterinarian of ordinary skill can readily determine the effective amount of each of the active ingredients necessary to prevent, treat or inhibit the progress of the disorder or disease.
The above-cited dosage properties are demonstrable in vitro and in vivo tests using advantageously mammals, e.g., mice, rats, dogs, monkeys or isolated organs, tissues and preparations thereof. The compounds of the present invention can be applied in vitro in the form of solutions, e.g., preferably aqueous solutions, and in vivo either enterally, parenterally, advantageously intravenously, e.g., as a suspension or in aqueous solution. The dosage in vitro may range between about 10−3 molar and 10−9 molar concentrations. A therapeutically effective amount in vivo may range depending on the route of administration, between about 0.1-500 mg/kg, or between about 1-100 mg/kg.
In other embodiments, a pharmaceutical composition is provided which comprises at least one compound according to the embodiments supra and at least one carrier.
The crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine described herein are also useful as active pharmaceutical ingredients (APIs) as well as materials for preparing formulations that incorporate one or more pharmaceutically acceptable excipients and are suitable for administration to human subjects. In some embodiments these formulations will be a pharmaceutical product, such as, for example, a solid oral dosage form such as tablets and/or capsules. In the preparation of these formulations it may be the case that the crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine is not detectable in any sufficient amount. Such is the case where a crystalline API is contacted with one or more pharmaceutically acceptable excipients in the presence of a solvent such as, for example, water, in an amount sufficient to promote dissolution of the API such that its crystalline character is lost and therefore is absent in the final pharmaceutical product.
As used herein, the term “pharmaceutically acceptable excipients” includes any and all solvents, carriers, diluents, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g., antibacterial agents, antifungal agents, antioxidants), isotonic agents, absorption delaying agents, salts, drug stabilizers, binders, additives, bulking agents, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, and the like and combinations thereof, as would be known to those skilled in the art (see, for example, Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, pp. 1289-1329). It should be understood that unless a conventional excipient is incompatible with the active ingredient, the use of any conventional excipient in any therapeutic or pharmaceutical compositions is contemplated by the present application.
Accordingly, in an embodiment of the disclosure, a crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (any of Form A to G) is provided in a substantially phase pure form. This crystalline form of a 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (any of Form A to G) in substantially phase pure form may be used to prepare pharmaceutical compositions which may further comprising one or more pharmaceutically acceptable excipients. In some embodiments the crystalline form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine may not retain its crystallinity in the pharmaceutical composition. For example, in some embodiments crystalline Form A, B, C, D, E, F or G may be used in a process to prepare a pharmaceutical composition that, for example, involves spray drying or wet granulation; thus it is expected that little to no crystalline Form A, B, C, D, E, F or G will be detected in the resulting pharmaceutical composition. It should be understood that the term “contacting” as used herein expressly includes methods of combining the crystalline forms of the compound of Formula I described herein where the crystallinity of the API is maintained or the crystallinity of the API is lost as a result of the process of preparing the pharmaceutical composition or pharmaceutical product.
Therapeutic Kits
In one embodiment, the invention provides a kit comprising two or more separate pharmaceutical compositions, at least one of which contains a crystalline form of the compound of formula (I) (any one of Form A to G). In one embodiment, the kit comprises means for separately retaining said compositions, such as a container, divided bottle, or divided foil packet. An example of such a kit is a blister pack, as typically used for the packaging of tablets, capsules and the like.
The kit of the invention may be used for administering different dosage forms, for example, oral and parenteral, for administering the separate compositions at different dosage intervals, or for titrating the separate compositions against one another. To assist compliance, the kit of the invention typically comprises directions for administration.
In the combination therapies of the invention, a crystalline form of a compound of Formula (I) (i.e. any one of Form A through G) and the other immunotherapeutic agent may be manufactured and/or formulated by the same or different manufacturers. Moreover, a crystalline form of the compound of Formula (I) and the other therapeutic may be brought together into a combination therapy: (i) prior to release of the combination product to physicians (e.g. in the case of a kit comprising a crystalline form of compound of Formula (I) and the other therapeutic agent); (ii) by the physician themselves (or under the guidance of the physician) shortly before administration; (iii) in the patient themselves, e.g. during sequential administration of a crystalline form of the compound of Formula (I) and the other therapeutic agent.
Accordingly, the invention provides the use of a crystalline form according to any one of embodiments 1 to 7 (any one of form A to G), for treating cancer, wherein the medicament is prepared for administration with another immunotherapeutic agent. The invention also provides the use of an immunotherapeutic agent for treating cancer, wherein the medicament is administered with a crystalline form of the compound of Formula (I).
The invention also provides a crystalline form of the compound of Formula (I) (i.e. any one of Form A to G), for use in a method of treating cancer, wherein the crystalline form of compound of Formula (I) is prepared for administration with another immunotherapeutic agent. The invention also provides another immunotherapeutic agent for use in a method of treating cancer, wherein the other immunotherapeutic agent is prepared for administration with a crystalline form of compound of Formula (I). The invention also provides crystalline form of compound of Formula (I), for use in a method of treating cancer, wherein the crystalline form of compound of Formula (I) is administered with another immunotherapeutic agent. The invention also provides another immunotherapeutic agent for use in a method of treating cancer, wherein the other therapeutic agent is administered with a crystalline form of compound of Formula (I).
The invention also provides the use of a crystalline form of compound of Formula (I), for treating cancer, wherein the patient has previously (e.g. within 24 hours) been treated with another immunotherapeutic agent. The invention also provides the use of another immunotherapeutic agent for treating cancer, wherein the patient has previously (e.g. within 24 hours) been treated with a crystalline form of compound of Formula (I).
Combination Therapy:
In one embodiment, a pharmaceutical combination (or combination product) comprises a crystalline form according to any one of embodiments 1 to 7, and one or more immunotherapeutic agents selected from the group consisting of anti-CTLA4 antibodies, such as Ipilimumab and Tremelimumab, anti-PD-1 antibodies such as MDX-1106 (Nivolumab), MK3475 (Pembrolizumab), CT-011 (Pidilizumab), AMP-224, AMP-514 (MEDI0680 Medimmune) or an anti-PD-1 antibody molecule as described in WO2015/112900 (US2015/0210769); and anti-PD-L1 antibodies such as MPDL3280A, MEDI4736, MSB0010718C (Merch Sorono), YW243.55.S70, MDX-1105 or an anti-PD-L1 antibody molecules are disclosed in US 2016/0108123, filed Oct. 13, 2015, entitled “Antibody Molecules to PD-L1 and Uses Thereof”.
The components of the combination product are in the same formulation or in separate formulations.
In a preferred embodiment the combination product comprises a crystalline form according to any one of embodiments 1 to 7, and one or more immunotherapeutic agent useful in the treatment of cancer, specifically in immunotherapeutic treatment of cancer, such agent is selected from the group consisting of anti-PD-1PD-1 antibodies such as MDX-1106, MK3475, CT-011, AMP-224 or an anti-PD-1 antibody molecule as described in WO2015/112900 (US2015/0210769); and anti-PD-L1 antibodies such as MPDL3280A, MEDI4736, MDX-1105 or an anti-PD-L1 antibody molecules are disclosed in US 2016/0108123.
Examples of Anti PD-1 Antibody Molecule
In a preferred embodiment, the combination product comprises a crystalline form according to any one of embodiments 1 to 7, and an anti-PD-1 antibody molecule such as those described herein.
PD-1 is a CD28/CTLA-4 family member expressed, e.g., on activated CD4+ and CD8+ T cells, Tregs, and B cells. It negatively regulates effector T cell signaling and function. PD-1 is induced on tumor-infiltrating T cells, and can result in functional exhaustion or dysfunction (Keir et al. (2008) Annu. Rev. Immunol. 26:677-704; Pardoll et al. (2012) Nat Rev Cancer 12(4):252-64). PD-1 delivers a coinhibitory signal upon binding to either of its two ligands, Programmed Death-Ligand 1 (PD-L1) or Programed Death-Ligand 2 (PD-L2). PD-L1 is expressed on a number of cell types, including T cells, Natural killer (NK) cells, macrophages, dendritic cells (DCs), B cells, epithelial cells, vascular endothelial cells, as well as many types of tumors. High expression of PD-L1 on murine and human tumors has been linked to poor clinical outcomes in a variety of cancers (Keir et al. (2008) Annu. Rev. Immunol. 26:677-704; Pardoll et al. (2012) Nat Rev Cancer 12(4):252-64). PD-L2 is expressed on dendritic cells, macrophages, and some tumors. Blockade of the PD-1 pathway has been pre-clinically and clinically validate for cancer immunotherapy. Both preclinical and clinical studies have demonstrated that anti-PD-1 blockade can restore activity of effector T cells and results in robust anti-tumor response. For example, blockade of PD-1 pathway can restore exhausted/dysfunctional effector T cell function (e.g. proliferation, IFN-g secretion, or cytolytic function) and/or inhibit Treg cell function (Keir et al. (2008) Annu. Rev. Immunol. 26:677-704; Pardoll et al. (2012) Nat Rev Cancer 12(4):252-64). Blockade of the PD-1 pathway can be effected with an antibody, an antigen binding fragment thereof, an immunoadhesin, a fusion protein, or oligopeptide of PD-1, PD-L1 and/or PD-L2.
In one embodiment, the PD-1 inhibitor is an anti-PD-1 antibody molecule. In one embodiment, the PD-1 inhibitor is an anti-PD-1 antibody molecule as described in US 2015/0210769, published on Jul. 30, 2015, entitled “Antibody Molecules to PD-1 and Uses Thereof,” incorporated by reference in its entirety.
In one embodiment, the anti-PD-1 antibody molecule comprises at least one, two, three, four, five or six complementarity determining regions (CDRs) (or collectively all of the CDRs) from a heavy and light chain variable region comprising an amino acid sequence shown in Table A (e.g., from the heavy and light chain variable region sequences of BAP049-Clone-E or BAP049-Clone-B disclosed in Table A), or encoded by a nucleotide sequence shown in Table A. In some embodiments, the CDRs are according to the Kabat definition (e.g., as set out in Table A). In some embodiments, the CDRs are according to the Chothia definition (e.g., as set out in Table A). In some embodiments, the CDRs are according to the combined CDR definitions of both Kabat and Chothia (e.g., as set out in Table A). In one embodiment, the combination of Kabat and Chothia CDR of VH CDR1 comprises the amino acid sequence GYTFTTYWMH (SEQ ID NO: 41). In one embodiment, one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions (e.g., conservative amino acid substitutions) or deletions, relative to an amino acid sequence shown in Table A, or encoded by a nucleotide sequence shown in Table A.
In one embodiment, the anti-PD-1 antibody molecule comprises a heavy chain variable region (VH) comprising a VHCDR1 amino acid sequence of SEQ ID NO: 1, a VHCDR2 amino acid sequence of SEQ ID NO: 2, and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a light chain variable region (VL) comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 12, each disclosed in Table A.
In one embodiment, the antibody molecule comprises a VH comprising a VHCDR1 encoded by the nucleotide sequence of SEQ ID NO: 24, a VHCDR2 encoded by the nucleotide sequence of SEQ ID NO: 25, and a VHCDR3 encoded by the nucleotide sequence of SEQ ID NO: 26; and a VL comprising a VLCDR1 encoded by the nucleotide sequence of SEQ ID NO: 29, a VLCDR2 encoded by the nucleotide sequence of SEQ ID NO: 30, and a VLCDR3 encoded by the nucleotide sequence of SEQ ID NO: 31, each disclosed in Table A.
In one embodiment, the anti-PD-1 antibody molecule comprises a VH comprising the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 6. In one embodiment, the anti-PD-1 antibody molecule comprises a VL comprising the amino acid sequence of SEQ ID NO: 20, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 20. In one embodiment, the anti-PD-1 antibody molecule comprises a VL comprising the amino acid sequence of SEQ ID NO: 16, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 16. In one embodiment, the anti-PD-1 antibody molecule comprises a VH comprising the amino acid sequence of SEQ ID NO: 6 and a VL comprising the amino acid sequence of SEQ ID NO: 20. In one embodiment, the anti-PD-1 antibody molecule comprises a VH comprising the amino acid sequence of SEQ ID NO: 6 and a VL comprising the amino acid sequence of SEQ ID NO: 16.
In one embodiment, the antibody molecule comprises a VH encoded by the nucleotide sequence of SEQ ID NO: 7, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 7. In one embodiment, the antibody molecule comprises a VL encoded by the nucleotide sequence of SEQ ID NO: 21 or 17, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 21 or 17. In one embodiment, the antibody molecule comprises a VH encoded by the nucleotide sequence of SEQ ID NO: 7 and a VL encoded by the nucleotide sequence of SEQ ID NO: 21 or 17.
In one embodiment, the anti-PD-1 antibody molecule comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 8, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 8. In one embodiment, the anti-PD-1 antibody molecule comprises a light chain comprising the amino acid sequence of SEQ ID NO: 22, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 22. In one embodiment, the anti-PD-1 antibody molecule comprises a light chain comprising the amino acid sequence of SEQ ID NO: 18, or an amino acid sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 18. In one embodiment, the anti-PD-1 antibody molecule comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 8 and a light chain comprising the amino acid sequence of SEQ ID NO: 22. In one embodiment, the anti-PD-1 antibody molecule comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 8 and a light chain comprising the amino acid sequence of SEQ ID NO: 18.
In one embodiment, the antibody molecule comprises a heavy chain encoded by the nucleotide sequence of SEQ ID NO: 9, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 9. In one embodiment, the antibody molecule comprises a light chain encoded by the nucleotide sequence of SEQ ID NO: 23 or 19, or a nucleotide sequence at least 85%, 90%, 95%, or 99% identical or higher to SEQ ID NO: 23 or 19. In one embodiment, the antibody molecule comprises a heavy chain encoded by the nucleotide sequence of SEQ ID NO: 9 and a light chain encoded by the nucleotide sequence of SEQ ID NO: 23 or 19.
The antibody molecules described herein can be made by vectors, host cells, and methods described in US 2015/0210769, incorporated by reference in its entirety.
Definitions
The VH and VL regions can be subdivided into regions of hypervariability, termed “complementarity determining regions” (CDR), interspersed with regions that are more conserved, termed “framework regions” (FR or FW).
The extent of the framework region and CDRs has been precisely defined by a number of methods (see, Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242; Chothia, C. et al. (1987) J. Mol. Biol. 196:901-917; and the AbM definition used by Oxford Molecular's AbM antibody modeling software. See, generally, e.g., Protein Sequence and Structure Analysis of Antibody Variable Domains. In: Antibody Engineering Lab Manual (Ed.: Duebel, S. and Kontermann, R., Springer-Verlag, Heidelberg).
The terms “complementarity determining region,” and “CDR,” as used herein refer to the sequences of amino acids within antibody variable regions which confer antigen specificity and binding affinity. In general, there are three CDRs in each heavy chain variable region (HCDR1, HCDR2, HCDR3) and three CDRs in each light chain variable region (LCDR1, LCDR2, LCDR3).
The precise amino acid sequence boundaries of a given CDR can be determined using any of a number of well-known schemes, including those described by Kabat et al. (1991), “Sequences of Proteins of Immunological Interest,” 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (“Kabat” numbering scheme), Al-Lazikani et al., (1997) JMB 273, 927-948 (“Chothia” numbering scheme). As used herein, the CDRs defined according the “Chothia” number scheme are also sometimes referred to as “hypervariable loops.”
For example, under Kabat, the CDR amino acid residues in the heavy chain variable domain (VH) are numbered 31-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3); and the CDR amino acid residues in the light chain variable domain (VL) are numbered 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3). Under Chothia the CDR amino acids in the VH are numbered 26-32 (HCDR1), 52-56 (HCDR2), and 95-102 (HCDR3); and the amino acid residues in VL are numbered 26-32 (LCDR1), 50-52 (LCDR2), and 91-96 (LCDR3). By combining the CDR definitions of both Kabat and Chothia, the CDRs consist of amino acid residues 26-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3) in human VH and amino acid residues 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3) in human VL.
Generally, unless specifically indicated, the anti-PD-1 antibody molecules can include any combination of one or more Kabat CDRs and/or Chothia CDRs, e.g., described in Table A. In one embodiment, the following definitions are used for the anti-PD-1 antibody molecules described in Table A: HCDR1 according to the combined CDR definitions of both Kabat and Chothia, and HCCDRs 2-3 and LCCDRs 1-3 according the CDR definition of Kabat. Under all definitions, each VH and VL typically includes three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
Calculations of homology or sequence identity between sequences (the terms are used interchangeably herein) are performed as follows.
To determine the percent identity of two amino acid sequences, or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). In a preferred embodiment, the length of a reference sequence aligned for comparison purposes is at least 30%, preferably at least 40%, more preferably at least 50%, 60%, and even more preferably at least 70%, 80%, 90%, 100% of the length of the reference sequence. The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid “homology”).
The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. In a preferred embodiment, the percent identity between two amino acid sequences is determined using the Needleman and Wunsch ((1970) J. Mol. Biol. 48:444-453) algorithm which has been incorporated into the GAP program in the GCG software package (available at www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6. In yet another preferred embodiment, the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6. A particularly preferred set of parameters (and the one that should be used unless otherwise specified) are a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
The percent identity between two amino acid or nucleotide sequences can be determined using the algorithm of E. Meyers and W. Miller ((1989) CABIOS, 4:11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
The nucleic acid and protein sequences described herein can be used as a “query sequence” to perform a search against public databases to, for example, identify other family members or related sequences. Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10. BLAST nucleotide searches can be performed with the NBLAST program, score=100, wordlength=12 to obtain nucleotide sequences homologous to a nucleic acid molecule of the invention. BLAST protein searches can be performed with the XBLAST program, score=50, wordlength=3 to obtain amino acid sequences homologous to protein molecules of the invention. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res. 25:3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used. See www.ncbi.nlm.nih.gov.
A “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
TABLE A
Amino acid and nucleotide sequences of exemplary
anti-PD-1 antibody molecules
BAP049-Clone-
B HC
SEQ ID NO: 1 HCDR1 TYWMH
(Kabat)
SEQ ID NO: 2 HCDR2 NIYPGTGGSNFDEKFKN
(Kabat)
SEQ ID NO: 3 HCDR3 WTTGTGAY
(Kabat)
SEQ ID NO: 4 HCDR1 GYTFTTY
(Chothia)
SEQ ID NO: 5 HCDR2 YPGTGG
(Chothia)
SEQ ID NO: 3 HCDR3 WTTGTGAY
(Chothia)
SEQ ID NO: 6 VH EVQLVQSGAEVKKPGESLRISCKGSG
YTFTTYWMHWVRQATGQGLEWMG
NIYPGTGGSNFDEKFKNRVTITADKS
TSTAYMELSSLRSEDTAVYYCTRWT
TGTGAYWGQGTTVTVSS
SEQ ID NO: 7 DNA GAGGTGCAGCTGGTGCAGTCAGGC
VH GCCGAAGTGAAGAAGCCCGGCGAG
TCACTGAGAATTAGCTGTAAAGGT
TCAGGCTACACCTTCACTACCTACT
GGATGCACTGGGTCCGCCAGGCTA
CCGGTCAAGGCCTCGAGTGGATGG
GTAATATCTACCCCGGCACCGGCG
GCTCTAACTTCGACGAGAAGTTTA
AGAATAGAGTGACTATCACCGCCG
ATAAGTCTACTAGCACCGCCTATAT
GGAACTGTCTAGCCTGAGATCAGA
GGACACCGCCGTCTACTACTGCACT
AGGTGGACTACCGGCACAGGCGCC
TACTGGGGTCAAGGCACTACCGTG
ACCGTGTCTAGC
SEQ ID NO: 8 HC EVQLVQSGAEVKKPGESLRISCKGSG
YTFTTYWMHWVRQATGQGLEWMG
NIYPGTGGSNFDEKFKNRVTITADKS
TSTAYMELSSLRSEDTAVYYCTRWT
TGTGAYWGQGTTVTVSSASTKGPSV
FPLAPCSRSTSESTAALGCLVKDYFP
EPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTKTYTCNV
DEIKPSNTKVDKRVESKYGPPCPPCP
APEFLGGPSVFLFPPKPKDTLMISRTP
EVTCVVVDVSQEDPEVQFNWYVDG
VEVHNAKTKPREEQFNSTYRVVSVL
TVLHQDWLNGKEYKCKVSNKGLPS
SIEKTISKAKGQPREPQVYTLPPSQEE
MTKNQVSLTCLVKGFYPSDIAVEWE
SNGQPENNYKTTPPVLDSDGSFFLYS
RLTVDKSRWQEGNVFSCSVMHEAL
HNHYTQKSLSLSLG
SEQ ID NO: 9 DNA GAGGTGCAGCTGGTGCAGTCAGGC
HC GCCGAAGTGAAGAAGCCCGGCGAG
TCACTGAGAATTAGCTGTAAAGGT
TCAGGCTACACCTTCACTACCTACT
GGATGCACTGGGTCCGCCAGGCTA
CCGGTCAAGGCCTCGAGTGGATGG
GTAATATCTACCCCGGCACCGGCG
GCTCTAACTTCGACGAGAAGTTTA
AGAATAGAGTGACTATCACCGCCG
ATAAGTCTACTAGCACCGCCTATAT
GGAACTGTCTAGCCTGAGATCAGA
GGACACCGCCGTCTACTACTGCACT
AGGTGGACTACCGGCACAGGCGCC
TACTGGGGTCAAGGCACTACCGTG
ACCGTGTCTAGCGCTAGCACTAAG
GGCCCGTCCGTGTTCCCCCTGGCAC
CTTGTAGCCGGAGCACTAGCGAAT
CCACCGCTGCCCTCGGCTGCCTGGT
CAAGGATTACTTCCCGGAGCCCGT
GACCGTGTCCTGGAACAGCGGAGC
CCTGACCTCCGGAGTGCACACCTTC
CCCGCTGTGCTGCAGAGCTCCGGG
CTGTACTCGCTGTCGTCGGTGGTCA
CGGTGCCTTCATCTAGCCTGGGTAC
CAAGACCTACACTTGCAACGTGGA
CCACAAGCCTTCCAACACTAAGGT
GGACAAGCGCGTCGAATCGAAGTA
CGGCCCACCGTGCCCGCCTTGTCCC
GCGCCGGAGTTCCTCGGCGGTCCCT
CGGTCTTTCTGTTCCCACCGAAGCC
CAAGGACACTTTGATGATTTCCCGC
ACCCCTGAAGTGACATGCGTGGTC
GTGGACGTGTCACAGGAAGATCCG
GAGGTGCAGTTCAATTGGTACGTG
GATGGCGTCGAGGTGCACAACGCC
AAAACCAAGCCGAGGGAGGAGCA
GTTCAACTCCACTTACCGCGTCGTG
TCCGTGCTGACGGTGCTGCATCAG
GACTGGCTGAACGGGAAGGAGTAC
AAGTGCAAAGTGTCCAACAAGGGA
CTTCCTAGCTCAATCGAAAAGACC
ATCTCGAAAGCCAAGGGACAGCCC
CGGGAACCCCAAGTGTATACCCTG
CCACCGAGCCAGGAAGAAATGACT
AAGAACCAAGTCTCATTGACTTGC
CTTGTGAAGGGCTTCTACCCATCGG
ATATCGCCGTGGAATGGGAGTCCA
ACGGCCAGCCGGAAAACAACTACA
AGACCACCCCTCCGGTGCTGGACT
CAGACGGATCCTTCTTCCTCTACTC
GGCTGACCGTGGATAAGAGCAG
ATGGCAGGAGGGAAATGTGTTCAG
CTGTTCTGTGATGCATGAAGCCCTG
CACAACCACTACACTCAGAAGTCC
CTGTCCCTCTCCCTGGGA
BAP049-Clone-
B LC
SEQ ID NO: 10 LCDR1 KSSQSLLDSGNQKNFLT
(Kabat)
SEQ ID NO: 11 LCDR2 WASTRES
(Kabat)
SEQ ID NO: 12 LCDR3 QNDYSYPYT
(Kabat)
SEQ ID NO: 13 LCDR1 SQSLLDSGNQKNF
(Chothia)
SEQ ID NO: 14 LCDR2 WAS
(Chothia)
SEQ ID NO: 15 LCDR3 DYSYPY
(Chothia)
SEQ ID NO: 16 VL EIVLTQSPATLSLSPGERATLSCKSSQ
SLLDSGNQKNFLTWYQQKPGKAPKL
LIYWASTRESGVPSRFSGSGSGTDFT
FTISSLQPEDIATYYCQNDYSYPYTFG
QGTKVEIK
SEQ ID NO: 17 DNA GAGATCGTCCTGACTCAGTCACCC
VL GCTACCCTGAGCCTGAGCCCTGGC
GAGCGGGCTACACTGAGCTGTAAA
TCTAGTCAGTCACTGCTGGATAGCG
GTAATCAGAAGAACTTCCTGACCT
GGTATCAGCAGAAGCCCGGTAAAG
CCCCTAAGCTGCTGATCTACTGGGC
CTCTACTAGAGAATCAGGCGTGCC
CTCTAGGTTTAGCGGTAGCGGTAGT
GGCACCGACTTCACCTTCACTATCT
CTAGCCTGCAGCCCGAGGATATCG
CTACCTACTACTGTCAGAACGACTA
TAGCTACCCCTACACCTTCGGTCAA
GGCACTAAGGTCGAGATTAAG
SEQ ID NO: 18 LC EIVLTQSPATLSLSPGERATLSCKSSQ
SLLDSGNQKNFLTWYQQKPGKAPKL
LIYWASTRESGVPSRFSGSGSGTDFT
FTISSLQPEDIATYYCQNDYSYPYTFG
QGTKVEIKRTVAAPSVFIFPPSDEQLK
SGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVIEQDSKDSTYSLS
STLTLSKADYEKEIKVYACEVTHQGL
SSPVTKSFNRGEC
SEQ ID NO: 19 DNA GAGATCGTCCTGACTCAGTCACCC
LC GCTACCCTGAGCCTGAGCCCTGGC
GAGCGGGCTACACTGAGCTGTAAA
TCTAGTCAGTCACTGCTGGATAGCG
GTAATCAGAAGAACTTCCTGACCT
GGTATCAGCAGAAGCCCGGTAAAG
CCCCTAAGCTGCTGATCTACTGGGC
CTCTACTAGAGAATCAGGCGTGCC
CTCTAGGTTTAGCGGTAGCGGTAGT
GGCACCGACTTCACCTTCACTATCT
CTAGCCTGCAGCCCGAGGATATCG
CTACCTACTACTGTCAGAACGACTA
TAGCTACCCCTACACCTTCGGTCAA
GGCACTAAGGTCGAGATTAAGCGT
ACGGTGGCCGCTCCCAGCGTGTTC
ATCTTCCCCCCCAGCGACGAGCAG
CTGAAGAGCGGCACCGCCAGCGTG
GTGTGCCTGCTGAACAACTTCTACC
CCCGGGAGGCCAAGGTGCAGTGGA
AGGTGGACAACGCCCTGCAGAGCG
GCAACAGCCAGGAGAGCGTCACCG
AGCAGGACAGCAAGGACTCCACCT
ACAGCCTGAGCAGCACCCTGACCC
TGAGCAAGGCCGACTACGAGAAGC
ATAAGGTGTACGCCTGCGAGGTGA
CCCACCAGGGCCTGTCCAGCCCCG
TGACCAAGAGCTTCAACAGGGGCG
AGTGC
BAP049-Clone-
E HC
SEQ ID NO: 1 HCDR1 TYWMH
(Kabat)
SEQ ID NO: 2 HCDR2 NIYPGTGGSNFDEKFKN
(Kabat)
SEQ ID NO: 3 HCDR3 WTTGTGAY
(Kabat)
SEQ ID NO: 4 HCDR1 GYTFTTY
(Chothia)
SEQ ID NO: 5 HCDR2 YPGTGG
(Chothia)
SEQ ID NO: 3 HCDR3 WTTGTGAY
(Chothia)
SEQ ID NO: 6 VH EVQLVQSGAEVKKPGESLRISCKGSG
YTFTTYWMHWVRQATGQGLEWMG
NIYPGTGGSNFDEKFKNRVTITADKS
TSTAYMELSSLRSEDTAVYYCTRWT
TGTGAYWGQGTTVTVSS
SEQ ID NO: 7 DNA GAGGTGCAGCTGGTGCAGTCAGGC
VH GCCGAAGTGAAGAAGCCCGGCGAG
TCACTGAGAATTAGCTGTAAAGGT
TCAGGCTACACCTTCACTACCTACT
GGATGCACTGGGTCCGCCAGGCTA
CCGGTCAAGGCCTCGAGTGGATGG
GTAATATCTACCCCGGCACCGGCG
GCTCTAACTTCGACGAGAAGTTTA
AGAATAGAGTGACTATCACCGCCG
ATAAGTCTACTAGCACCGCCTATAT
GGAACTGTCTAGCCTGAGATCAGA
GGACACCGCCGTCTACTACTGCACT
AGGTGGACTACCGGCACAGGCGCC
TACTGGGGTCAAGGCACTACCGTG
ACCGTGTCTAGC 
SEQ ID NO: 8 HC EVQLVQSGAEVKKPGESLRISCKGSG
YTFTTYWMHWVRQATGQGLEWMG
NIYPGTGGSNFDEKFKNRVTITADKS
TSTAYMELSSLRSEDTAVYYCTRWT
TGTGAYWGQGTTVTVSSASTKGPSV
FPLAPCSRSTSESTAALGCLVKDYFP
EPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTKTYTCNV
DEIKPSNTKVDKRVESKYGPPCPPCP
APEFLGGPSVFLFPPKPKDTLMISRTP
EVTCVVVDVSQEDPEVQFNWYVDG
VEVHNAKTKPREEQFNSTYRVVSVL
TVLHQDWLNGKEYKCKVSNKGLPS
SIEKTISKAKGQPREPQVYTLPPSQEE
MTKNQVSLTCLVKGFYPSDIAVEWE
SNGQPENNYKTTPPVLDSDGSFFLYS
RLTVDKSRWQEGNVFSCSVMHEAL
HNHYTQKSLSLSLG
SEQ ID NO: 9 DNA GAGGTGCAGCTGGTGCAGTCAGGC
HC GCCGAAGTGAAGAAGCCCGGCGAG
TCACTGAGAATTAGCTGTAAAGGT
TCAGGCTACACCTTCACTACCTACT
GGATGCACTGGGTCCGCCAGGCTA
CCGGTCAAGGCCTCGAGTGGATGG
GTAATATCTACCCCGGCACCGGCG
GCTCTAACTTCGACGAGAAGTTTA
AGAATAGAGTGACTATCACCGCCG
ATAAGTCTACTAGCACCGCCTATAT
GGAACTGTCTAGCCTGAGATCAGA
GGACACCGCCGTCTACTACTGCACT
AGGTGGACTACCGGCACAGGCGCC
TACTGGGGTCAAGGCACTACCGTG
ACCGTGTCTAGCGCTAGCACTAAG
GGCCCGTCCGTGTTCCCCCTGGCAC
CTTGTAGCCGGAGCACTAGCGAAT
CCACCGCTGCCCTCGGCTGCCTGGT
CAAGGATTACTTCCCGGAGCCCGT
GACCGTGTCCTGGAACAGCGGAGC
CCTGACCTCCGGAGTGCACACCTTC
CCCGCTGTGCTGCAGAGCTCCGGG
CTGTACTCGCTGTCGTCGGTGGTCA
CGGTGCCTTCATCTAGCCTGGGTAC
CAAGACCTACACTTGCAACGTGGA
CCACAAGCCTTCCAACACTAAGGT
GGACAAGCGCGTCGAATCGAAGTA
CGGCCCACCGTGCCCGCCTTGTCCC
GCGCCGGAGTTCCTCGGCGGTCCCT
CGGTCTTTCTGTTCCCACCGAAGCC
CAAGGACACTTTGATGATTTCCCGC
ACCCCTGAAGTGACATGCGTGGTC
GTGGACGTGTCACAGGAAGATCCG
GAGGTGCAGTTCAATTGGTACGTG
GATGGCGTCGAGGTGCACAACGCC
AAAACCAAGCCGAGGGAGGAGCA
GTTCAACTCCACTTACCGCGTCGTG
TCCGTGCTGACGGTGCTGCATCAG
GACTGGCTGAACGGGAAGGAGTAC
AAGTGCAAAGTGTCCAACAAGGGA
CTTCCTAGCTCAATCGAAAAGACC
ATCTCGAAAGCCAAGGGACAGCCC
CGGGAACCCCAAGTGTATACCCTG
CCACCGAGCCAGGAAGAAATGACT
AAGAACCAAGTCTCATTGACTTGC
CTTGTGAAGGGCTTCTACCCATCGG
ATATCGCCGTGGAATGGGAGTCCA
ACGGCCAGCCGGAAAACAACTACA
AGACCACCCCTCCGGTGCTGGACT
CAGACGGATCCTTCTTCCTCTACTC
GCGGCTGACCGTGGATAAGAGCAG
ATGGCAGGAGGGAAATGTGTTCAG
CTGTTCTGTGATGCATGAAGCCCTG
CACAACCACTACACTCAGAAGTCC
CTGTCCCTCTCCCTGGGA
BAP049-Clone-
E LC
SEQ ID NO: 10 LCDR1 KSSQSLLDSGNQKNFLT
(Kabat)
SEQ ID NO: 11 LCDR2 WASTRES
(Kabat)
SEQ ID NO: 12 LCDR3 QNDYSYPYT
(Kabat)
SEQ ID NO: 13 LCDR1 SQSLLDSGNQKNF
(Chothia)
SEQ ID NO: 14 LCDR2 WAS
(Chothia)
SEQ ID NO: 15 LCDR3 DYSYPY
(Chothia)
SEQ ID NO: 20 VL EIVLTQSPATLSLSPGERATLSCKSSQ
SLLDSGNQKNFLTWYQQKPGQAPRL
LIYWASTRESGVPSRFSGSGSGTDFT
FTISSLEAEDAATYYCQNDYSYPYTF
GQGTKVEIK
SEQ ID NO: 21 DNA GAGATCGTCCTGACTCAGTCACCC
VL GCTACCCTGAGCCTGAGCCCTGGC
GAGCGGGCTACACTGAGCTGTAAA
TCTAGTCAGTCACTGCTGGATAGCG
GTAATCAGAAGAACTTCCTGACCT
GGTATCAGCAGAAGCCCGGTCAAG
CCCCTAGACTGCTGATCTACTGGGC
CTCTACTAGAGAATCAGGCGTGCC
CTCTAGGTTTAGCGGTAGCGGTAGT
GGCACCGACTTCACCTTCACTATCT
CTAGCCTGGAAGCCGAGGACGCCG
CTACCTACTACTGTCAGAACGACTA
TAGCTACCCCTACACCTTCGGTCAA
GGCACTAAGGTCGAGATTAAG
SEQ ID NO: 22 LC EIVLTQSPATLSLSPGERATLSCKSSQ
SLLDSGNQKNFLTWYQQKPGQAPRL
LIYWASTRESGVPSRFSGSGSGTDFT
FTISSLEAEDAATYYCQNDYSYPYTF
GQGTKVEIKRTVAAPSVFIFPPSDEQL
KSGTASVVCLLNNFYPREAKVQWK
VDNALQSGNSQESVTEQDSKDSTYS
LSSTLTLSKADYEKHKVYACEVTHQ
GLSSPVTKSFNRGEC
SEQ ID NO: 23 DNA GAGATCGTCCTGACTCAGTCACCC
LC GCTACCCTGAGCCTGAGCCCTGGC
GAGCGGGCTACACTGAGCTGTAAA
TCTAGTCAGTCACTGCTGGATAGCG
GTAATCAGAAGAACTTCCTGACCT
GGTATCAGCAGAAGCCCGGTCAAG
CCCCTAGACTGCTGATCTACTGGGC
CTCTACTAGAGAATCAGGCGTGCC
CTCTAGGTTTAGCGGTAGCGGTAGT
GGCACCGACTTCACCTTCACTATCT
CTAGCCTGGAAGCCGAGGACGCCG
CTACCTACTACTGTCAGAACGACTA
TAGCTACCCCTACACCTTCGGTCAA
GGCACTAAGGTCGAGATTAAGCGT
ACGGTGGCCGCTCCCAGCGTGTTC
ATCTTCCCCCCCAGCGACGAGCAG
CTGAAGAGCGGCACCGCCAGCGTG
GTGTGCCTGCTGAACAACTTCTACC
CCCGGGAGGCCAAGGTGCAGTGGA
AGGTGGACAACGCCCTGCAGAGCG
GCAACAGCCAGGAGAGCGTCACCG
AGCAGGACAGCAAGGACTCCACCT
ACAGCCTGAGCAGCACCCTGACCC
TGAGCAAGGCCGACTACGAGAAGC
ATAAGGTGTACGCCTGCGAGGTGA
CCCACCAGGGCCTGTCCAGCCCCG
TGACCAAGAGCTTCAACAGGGGCG
AGTGC
BAP049-Clone-
B HC
SEQ ID NO: 24 HCDR1 ACCTACTGGATGCAC
(Kabat)
SEQ ID NO: 25 HCDR2 AATATCTACCCCGGCACCGGCGGC
(Kabat) TCTAACTTCGACGAGAAGTTTAAG
AAT
SEQ ID NO: 26 HCDR3 TGGACTACCGGCACAGGCGCCTAC
(Kabat)
SEQ ID NO: 27 HCDR1 GGCTACACCTTCACTACCTAC
(Chothia)
SEQ ID NO: 28 HCDR2 TACCCCGGCACCGGCGGC
(Chothia)
SEQ ID NO: 26 HCDR3 TGGACTACCGGCACAGGCGCCTAC
(Chothia)
BAP049-Clone-
B LC
SEQ ID NO: 29 LCDR1 AAATCTAGTCAGTCACTGCTGGAT
(Kabat) AGCGGTAATCAGAAGAACTTCCTG
ACC
SEQ ID NO: 30 LCDR2 TGGGCCTCTACTAGAGAATCA
(Kabat)
SEQ ID NO: 31 LCDR3 CAGAACGACTATAGCTACCCCTAC
(Kabat) ACC
SEQ ID NO: 32 LCDR1 AGTCAGTCACTGCTGGATAGCGGT
(Chothia) AATCAGAAGAACTTC
SEQ ID NO: 33 LCDR2 TGGGCCTCT
(Chothia)
SEQ ID NO: 34 LCDR3 GACTATAGCTACCCCTAC
(Chothia)
BAP049-Clone-
E HC
SEQ ID NO: 24 HCDR1 ACCTACTGGATGCAC
(Kabat)
SEQ ID NO: 25 HCDR2 AATATCTACCCCGGCACCGGCGGC
(Kabat) TCTAACTTCGACGAGAAGTTTAAG
AAT
SEQ ID NO: 26 HCDR3 TGGACTACCGGCACAGGCGCCTAC
(Kabat)
SEQ ID NO: 27 HCDR1 GGCTACACCTTCACTACCTAC
(Chothia)
SEQ ID NO: 28 HCDR2 TACCCCGGCACCGGCGGC
(Chothia)
SEQ ID NO: 26 HCDR3 TGGACTACCGGCACAGGCGCCTAC
(Chothia)
BAP049-Clone-
E LC
SEQ ID NO: 29 LCDR1 AAATCTAGTCAGTCACTGCTGGAT
(Kabat) AGCGGTAATCAGAAGAACTTCCTG
ACC
SEQ ID NO: 30 LCDR2 TGGGCCTCTACTAGAGAATCA
(Kabat)
SEQ ID NO: 31 LCDR3 CAGAACGACTATAGCTACCCCTAC
(Kabat) ACC
SEQ ID NO: 32 LCDR1 AGTCAGTCACTGCTGGATAGCGGT
(Chothia) AATCAGAAGAACTTC
SEQ ID NO: 33 LCDR2 TGGGCCTCT
(Chothia)
SEQ ID NO: 34 LCDR3 GACTATAGCTACCCCTAC
(Chothia)

Other Exemplary PD-1 Inhibitors
In one embodiment, the anti-PD-1 antibody molecule is Nivolumab (Bristol-Myers Squibb), also known as MDX-1106, MDX-1106-04, ONO-4538, BMS-936558, or OPDIVO®. Nivolumab (clone 5C4) and other anti-PD-1 antibodies are disclosed in U.S. Pat. No. 8,008,449 and WO 2006/121168, incorporated by reference in their entirety. In one embodiment, the anti-PD-1 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of Nivolumab, e.g., as disclosed in Table B.
In one embodiment, the anti-PD-1 antibody molecule is Pembrolizumab (Merck & Co), also known as Lambrolizumab, MK-3475, MK03475, SCH-900475, or KEYTRUDA®. Pembrolizumab and other anti-PD-1 antibodies are disclosed in Hamid, O. et al. (2013) New England Journal of Medicine 369 (2): 134-44, U.S. Pat. No. 8,354,509, and WO 2009/114335, incorporated by reference in their entirety. In one embodiment, the anti-PD-1 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of Pembrolizumab, e.g., as disclosed in Table B.
In one embodiment, the anti-PD-1 antibody molecule is Pidilizumab (CureTech), also known as CT-011. Pidilizumab and other anti-PD-1 antibodies are disclosed in Rosenblatt, J. et al. (2011) J Immunotherapy 34(5): 409-18, U.S. Pat. Nos. 7,695,715, 7,332,582, and 8,686,119, incorporated by reference in their entirety. In one embodiment, the anti-PD-1 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of Pidilizumab, e.g., as disclosed in Table B.
In one embodiment, the anti-PD-1 antibody molecule is MEDI0680 (Medimmune), also known as AMP-514. MEDI0680 and other anti-PD-1 antibodies are disclosed in U.S. Pat. No. 9,205,148 and WO 2012/145493, incorporated by reference in their entirety. In one embodiment, the anti-PD-1 antibody molecule comprises one or more of the CDR sequences (or collectively all of the CDR sequences), the heavy chain or light chain variable region sequence, or the heavy chain or light chain sequence of MEDI0680.
Further known anti-PD-1 antibodies include those described, e.g., in WO 2015/112800, WO 2016/092419, WO 2015/085847, WO 2014/179664, WO 2014/194302, WO 2014/209804, WO 2015/200119, U.S. Pat. Nos. 8,735,553, 7,488,802, 8,927,697, 8,993,731, and 9,102,727, incorporated by reference in their entirety.
In one embodiment, the anti-PD-1 antibody is an antibody that competes for binding with, and/or binds to the same epitope on PD-1 as, one of the anti-PD-1 antibodies described herein.
In one embodiment, the PD-1 inhibitor is a peptide that inhibits the PD-1 signaling pathway, e.g., as described in U.S. Pat. No. 8,907,053, incorporated by reference in its entirety. In one embodiment, the PD-1 inhibitor is an immunoadhesin (e.g., an immunoadhesin comprising an extracellular or PD-1 binding portion of PD-L1 or PD-L2 fused to a constant region (e.g., an Fc region of an immunoglobulin sequence). In one embodiment, the PD-1 inhibitor is AMP-224 (B7-DCIg (Amplimmune), e.g., disclosed in WO 2010/027827 and WO 2011/066342, incorporated by reference in their entirety).
TABLE B
Amino acid sequences of other exemplary anti-
PD-1 antibody molecules
Nivolumab
SEQ ID NO: 35 HC QVQLVESGGGVVQPGRSLRLDCKAS
GITFSNSGMHWVRQAPGKGLEWVA
VIWYDGSKRYYADSVKGRFTISRDN
SKNTLFLQMNSLRAEDTAVYYCATN
DDYWGQGTLVTVSSASTKGPSVFPL
APCSRSTSESTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGL
YSLSSVVTVPSSSLGTKTYTCNVDHK
PSNTKVDKRVESKYGPPCPPCPAPEF
LGGPSVFLFPPKPKDTLMISRTPEVTC
VVVDVSQEDPEVQFNWYVDGVEVH
NAKTKPREEQFNSTYRVVSVLTVLH
QDWLNGKEYKCKVSNKGLPSSIEKTI
SKAKGQPREPQVYTLPPSQEEMTKN
QVSLTCLVKGFYPSDIAVEWESNGQ
PENNYKTTPPVLDSDGSFFLYSRLTV
DKSRWQEGNVFSCSVMHEALHNHY
TQKSLSLSLGK
SEQ ID NO: 36 LC EIVLTQSPATLSLSPGERATLSCRASQ
SVSSYLAWYQQKPGQAPRLLIYDAS
NRATGIPARFSGSGSGTDFTLTISSLE
PEDFAVYYCQQSSNWPRTFGQGTKV
EIKRTVAAPSVFIFPPSDEQLKSGTAS
VVCLLNNFYPREAKVQWKVDNALQ
SGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVT
KSFNRGEC
Pembrolizumab
SEQ ID NO: 37 HC QVQLVQSGVEVKKPGASVKVSCKAS
GYTFTNYYMYWVRQAPGQGLEWM
GGINPSNGGTNFNEKFKNRVTLTTDS
STTTAYMELKSLQFDDTAVYYCARR
DYRFDMGFDYWGQGTTVTVSSAST
KGPSVFPLAPCSRSTSESTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFP
AVLQSSGLYSLSSVVTVPSSSLGTKT
YTCNVDHKPSNTKVDKRVESKYGPP
CPPCPAPEFLGGPSVFLFPPKPKDTL
MISRTPEVTCVVVDVSQEDPEVQFN
WYVDGVEVHNAKTKPREEQFNSTY
RVVSVLTVLHQDWLNGKEYKCKVS
NKGLPSSIEKTISKAKGQPREPQVYT
LPPSQEEMTKNQVSLTCLVKGFYPSD
IAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSRLTVDKSRWQEGNVFSCS
VMHEALHNHYTQKSLSLSLGK
SEQ ID NO: 38 LC EIVLTQSPATLSLSPGERATLSCRASK
GVSTSGYSYLHWYQQKPGQAPRLLI
YLASYLESGVPARFSGSGSGTDFTLTI
SSLEPEDFAVYYCQHSRDLPLTFGGG
TKVEIKRTVAAPSVFIFPPSDEQLKSG
TASVVCLLNNFYPREAKVQWKVDN
ALQSGNSQESVTEQDSKDSTYSLSST
LTLSKADYEKHKVYACEVTHQGLSS
PVTKSFNRGEC
Pidilizumab
SEQ ID NO: 39 HC QVQLVQSGSELKKPGASVKISCKAS
GYTFTNYGMNWVRQAPGQGLQWM
GWINTDSGESTYAEEFKGRFVFSLDT
SVNTAYLQITSLTAEDTGMYFCVRV
GYDALDYWGQGTLVTVSSASTKGPS
VFPLAPSSKSTSGGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQ
SSGLYSLSSVVTVPSSSLGTQTYICNV
NHKPSNTKVDKRVEPKSCDKTHTCP
PCPAPELLGGPSVFLFPPKPKDTLMIS
RTPEVTCVVVDVSHEDPEVKFNWYV
DGVEVHNAKTKPREEQYNSTYRVVS
VLTVLHQDWLNGKEYKCKVSNKAL
PAPIEKTISKAKGQPREPQVYTLPPSR
EEMTKNQVSLTCLVKGFYPSDIAVE
WESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMH
EALHNHYTQKSLSLSPGK
SEQ ID NO: 40 LC EIVLTQSPSSLSASVGDRVTITCSARS
SVSYMHWFQQKPGKAPKLWIYRTS
NLASGVPSRFSGSGSGTSYCLTINSLQ
PEDFATYYCQQRSSFPLTFGGGTKLE
IKRTVAAPSVFIFPPSDEQLKSGTASV
VCLLNNFYPREAKVQWKVDNALQS
GNSQESVTEQDSKDSTYSLSSTLTLS
KADYEKHKVYACEVTHQGLSSPVTK
SFNRGEC
Example of Anti PD-L1 Antibody Molecule
In one embodiment, the combination product comprises a crystalline form according to any one of embodiments 1 to 7, and an anti-PD-L1 antibody molecule such as those described herein.
Programmed Death Ligand 1 (PD-L1) has been described as a ligand for the immunoinhibitory receptor Programmed Death 1 (PD-1). Binding of PD-L1 to PD-1 leads to the inhibition of T cell receptor-mediated lymphocyte proliferation and cytokine secretion (Freeman et al. (2000) J Exp Med 192:1027-34). Thus, blocking of PD-L1 can lead to enhancement of antitumor immunity.
Several cell types express PD-L1. For example, PD-L1 is expressed on activated T cells, dendritic cells (DCs), natural killer (NK) cells, macrophages, B cells, monocytes, and vascular endothelium cells. PD-L1 is expressed in many cancers, including human lung, ovarian and colon carcinoma and various myelomas, (Iwai et al. (2002) PNAS 99:12293-7; Ohigashi et al. (2005) Clin Cancer Res 11:2947-53; Okazaki et al. (2007) Intern. Immun. 19:813-24; Thompson et al. (2006) Cancer Res. 66:3381-5). PD-L1 expression strongly correlates with unfavorable prognosis in various types of cancer including kidney, ovarian, bladder, breast, gastric and pancreatic cancer.
Many tumor infiltrating T lymphocytes predominantly express PD-1 compared to T lymphocytes in normal tissues and peripheral blood T lymphocytes. This indicates that up-regulation of PD-1 on tumor-reactive T cells can contribute to impaired antitumor immune responses (Ahmadzadeh et al. (2009) Blood 114:1537-44). Thus, PD-L1 signaling mediated by PD-L1 expressing tumor cells interacting with PD-1 expressing T cells may lead to attenuation of T cell activation and evasion of immune surveillance (Sharpe et al. (2002) Nat Rev Immunol. 2:116-26; Keir et al. (2008) Annu Rev Immunol. 26:677-704). PD-1 blockade can inhibit hematogenous spread of poorly immunogenic tumor cells by enhanced recruitment of effector T cells (Iwai et al. (2005) Int. Immunol. 17:133-144).
Anti-PD-L1 can enhance T-cell immunity, e.g., through blocking both its inhibitory interactions with PD-1 and B7-1. Anti-PD-1 can also allow for immune regulation via PD-L2/PD-1. Both PD-1 and B7-1 are expressed on T cells, B cells, DCs, and macrophages, which provides potential for bidirectional interactions between B7-1 and PD-L1 on these cell types. PD-L1 on non-hematopoietic cells may interact with B7-1 as well as PD-1 on T cells.
In some embodiments, the anti-PD-L1 antibody molecule is chosen from YW243.55.S70, MPDL3280A, MEDI-4736, MSB-0010718C, or MDX-1105.
In some embodiments, the anti-PD-L1 antibody is MSB0010718C. MSB0010718C (also referred to as A09-246-2; Merck Serono) is a monoclonal antibody that binds to PD-L1. MSB0010718C and other humanized anti-PD-L1 antibodies are disclosed in WO2013/079174, and having a sequence disclosed herein (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified). The heavy and light chain amino acid sequences of MSB0010718C include at least the following:
Heavy chain (SEQ ID NO: 24 as disclosed in
WO2013/079174)
(SEQ ID NO: 42)
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYIMMWVRQAPGKGLEW
VSSIYPSGGITFYADKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYC
ARIKLGTVTTVDYWGQGTLVTVSS
Light chain (SEQ ID NO: 25 as disclosed in
WO2013/079174)
(SEQ ID NO: 43)
QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPK
LMIYDVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYT
SSSTRVFGTGTKVTVL
In one embodiment, the PD-L1 inhibitor is YW243.55.S70. The YW243.55.S70 antibody is an anti-PD-L1 described in WO 2010/077634 (heavy and light chain variable region sequences shown in SEQ ID NOs. 20 and 21, respectively), and having a sequence disclosed therein (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
In one embodiment, the PD-L1 inhibitor is MDX-1105. MDX-1105, also known as BMS-936559, is an anti-PD-L1 antibody described in WO2007/005874, and having a sequence disclosed therein (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
In one embodiment, the PD-L1 inhibitor is MDPL3280A (Genentech/Roche). MDPL3280A is a human Fc optimized IgG1 monoclonal antibody that binds to PD-L1. MDPL3280A and other human monoclonal antibodies to PD-L1 are disclosed in U.S. Pat. No. 7,943,743 and U.S Publication No.: 20120039906.
In another embodiment, the PD-L1 inhibitor is an anti-PD-L1 antibody molecule disclosed in US 2016/0108123, filed Oct. 13, 2015, entitled “Antibody Molecules to PD-L1 and Uses Thereof,” incorporated by reference in its entirety.
In one embodiment, the anti-PD-L1 antibody molecule includes at least one or two heavy chain variable domains (optionally including a constant region), at least one or two light chain variable domains (optionally including a constant region), or both, comprising the amino acid sequence of any of BAP058-hum01, BAP058-hum02, BAP058-hum03, BAP058-hum04, BAP058-hum05, BAP058-hum06, BAP058-hum07, BAP058-hum08, BAP058-hum09, BAP058-hum10, BAP058-hum11, BAP058-hum12, BAP058-hum13, BAP058-hum14, BAP058-hum15, BAP058-hum16, BAP058-hum17, BAP058-Clone-K, BAP058-Clone-L, BAP058-Clone-M, BAP058-Clone-N, or BAP058-Clone-O; or as described in Table 1 of US 2016/0108123, or encoded by the nucleotide sequence in Table 1; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
In yet another embodiment, the anti-PD-L1 antibody molecule includes at least one, two, or three complementarity determining regions (CDRs) from a heavy chain variable region and/or a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP058-hum01, BAP058-hum02, BAP058-hum03, BAP058-hum04, BAP058-hum05, BAP058-hum06, BAP058-hum07, BAP058-hum08, BAP058-hum09, BAP058-hum10, BAP058-hum11, BAP058-hum12, BAP058-hum13, BAP058-hum14, BAP058-hum15, BAP058-hum16, BAP058-hum17, BAP058-Clone-K, BAP058-Clone-L, BAP058-Clone-M, BAP058-Clone-N, or BAP058-Clone-O; or as described in Table 1 of US 2016/0108123, or encoded by the nucleotide sequence in Table 1 of US 2016/0108123; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
In yet another embodiment, the anti-PD-L1 antibody molecule includes at least one, two, or three CDRs (or collectively all of the CDRs) from a heavy chain variable region comprising an amino acid sequence shown in Table 1 of US 2016/0108123, or encoded by a nucleotide sequence shown in Table 1 of US 2016/0108123. In one embodiment, one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1 of US 2016/0108123, or encoded by a nucleotide sequence shown in Table 1 of US 2016/0108123.
In yet another embodiment, the anti-PD-L1 antibody molecule includes at least one, two, or three CDRs (or collectively all of the CDRs) from a light chain variable region comprising an amino acid sequence shown in Table 1 of US 2016/0108123, or encoded by a nucleotide sequence shown in Table 1. In one embodiment, one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1 of US 2016/0108123, or encoded by a nucleotide sequence shown in Table 1 of US 2016/0108123. In certain embodiments, the anti-PD-L1 antibody molecule includes a substitution in a light chain CDR, e.g., one or more substitutions in a CDR1, CDR2 and/or CDR3 of the light chain.
In another embodiment, the anti-PD-L1 antibody molecule includes at least one, two, three, four, five or six CDRs (or collectively all of the CDRs) from a heavy and light chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1 of US 2016/0108123. In one embodiment, one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1 of US 2016/0108123, or encoded by a nucleotide sequence shown in Table 1 of US 2016/0108123.
In one embodiment, the anti-PD-L1 antibody molecule includes at least one, two or three CDRs or hypervariable loops from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP058-hum01, BAP058-hum02, BAP058-hum03, BAP058-hum04, BAP058-hum05, BAP058-hum06, BAP058-hum07, BAP058-hum08, BAP058-hum09, BAP058-hum10, BAP058-hum11, BAP058-hum12, BAP058-hum13, BAP058-hum14, BAP058-hum15, BAP058-hum16, BAP058-hum17, BAP058-Clone-K, BAP058-Clone-L, BAP058-Clone-M, BAP058-Clone-N, or BAP058-Clone-O, according to the Kabat and Chothia definition (e.g., at least one, two, or three CDRs or hypervariable loops according to the Kabat and Chothia definition as set out in Table 1 of US 2016/0108123); or encoded by the nucleotide sequence in Table 1 of US 2016/0108123; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, or three CDRs or hypervariable loops according to Kabat and/or Chothia shown in Table 1 of US 2016/0108123.
In one embodiment, the anti-PD-L1 antibody molecule can include VH CDR1 according to Kabat et al. ((1991), “Sequences of Proteins of Immunological Interest,” 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md.) or VH hypervariable loop 1 according to Chothia et al. (1992) J. Mol. Biol. 227:799-817, or a combination thereof, e.g., as shown in Table 1 of US 2016/0108123. In one embodiment, the combination of Kabat and Chothia CDR of VH CDR1 comprises the amino acid sequence GYTFTSYWMY (SEQ ID NO: 63), or an amino acid sequence substantially identical thereto (e.g., having at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions)). The anti-PD-L1 antibody molecule can further include, e.g., VH CDRs 2-3 according to Kabat et al. and VL CDRs 1-3 according to Kabat et al., e.g., as shown in Table 1 of US 2016/0108123.
In a preferred embodiment, the anti PD-L1 antibody molecule for use in the invention comprises:
(a) a heavy chain variable region (VH) comprising a VHCDR1 amino acid sequence of SEQ ID NO: 47, a VHCDR2 amino acid sequence of SEQ ID NO: 48, and a VHCDR3 amino acid sequence of SEQ ID NO: 46; and a light chain variable region (VL) comprising a VLCDR1 amino acid sequence of SEQ ID NO: 52, a VLCDR2 amino acid sequence of SEQ ID NO: 53, and a VLCDR3 amino acid sequence of SEQ ID NO: 54;
(b) a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 44; a VHCDR2 amino acid sequence of SEQ ID NO: 45; and a VHCDR3 amino acid sequence of SEQ ID NO: 46; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 49, a VLCDR2 amino acid sequence of SEQ ID NO: 50, and a VLCDR3 amino acid sequence of SEQ ID NO: 51;
(c) a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 63, a VHCDR2 amino acid sequence of SEQ ID NO: 48, and a VHCDR3 amino acid sequence of SEQ ID NO: 46; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 52, a VLCDR2 amino acid sequence of SEQ ID NO: 53, and a VLCDR3 amino acid sequence of SEQ ID NO: 54; or
(d) a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 63; a VHCDR2 amino acid sequence of SEQ ID NO: 45; and a VHCDR3 amino acid sequence of SEQ ID NO: 46; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 52, a VLCDR2 amino acid sequence of SEQ ID NO: 53, and a VLCDR3 amino acid sequence of SEQ ID NO: 54.
In one aspect of the previous embodiment, the anti-PD-L1 antibody molecule for use in the invention comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 55 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 58.
In one aspect of the previous embodiment, the anti-PD-L1 antibody molecule for use in the invention comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 62 and a light chain comprising the amino acid sequence of SEQ ID NO: 60.
Table C. Amino acid and nucleotide sequences for humanized anti-PD-L1 mAb BAP058-hum013. The amino acid and nucleotide sequences of the heavy and light chain CDRs, the heavy and light chain variable regions, and the heavy and light chains are shown.
TABLE C
BAP058-hum13-
HC
SEQ ID NO: 63 HCDR1 GYTFTSYWMY
(Chothia
and Kabat
combined)
SEQ ID NO: 44 HCDR1 SYWMY
(Kabat)
SEQ ID NO: 45 HCDR2 RIDPNSGSTKYNEKFKN
(Kabat)
SEQ ID NO: 46 HCDR3 DYRKGLYAMDY
(Kabat)
SEQ ID NO: 47 HCDR1 GYTFTSY
(Chothia)
SEQ ID NO: 48 HCDR2 DPNSGS
(Chothia)
SEQ ID NO: 49 HCDR3 DYRKGLYAMDY
(Chothia)
SEQ ID NO: 55 VH EVQLVQSGAEVKKPGATVKISCKVSGYT
FTSYWMYWVRQARGQRLEWIGRIDPNS
GSTKYNEKFKNRFTISRDNSKNTLYLQM
NSLRAEDTAVYYCARDYRKGLYAMDY
WGQGTTVTVSS
SEQ ID NO: 56 DNA GAGGTCCAGCTGGTACAGTCTGGGGCT
VH GAGGTGAAGAAGCCTGGGGCTACAGT
GAAAATCTCCTGCAAGGTTTCTGGCTA
CACCTTCACCAGTTACTGGATGTACTG
GGTGCGACAGGCTCGTGGACAACGCCT
TGAGTGGATAGGTAGGATTGATCCTAA
TAGTGGGAGTACTAAGTACAATGAGAA
GTTCAAGAACAGATTCACCATCTCCAG
AGACAATTCCAAGAACACGCTGTATCT
TCAAATGAACAGCCTGAGAGCCGAGG
ACACGGCCGTGTATTACTGTGCAAGGG
ACTATAGAAAGGGGCTCTATGCTATGG
ACTACTGGGGCCAGGGCACCACCGTGA
CCGTGTCCTCC
SEQ ID NO: 62 Heavy EVQLVQSGAEVKKPGATVKISCKVSGYT
Chain FTSYWMYWVRQARGQRLEWIGRIDPNS
GSTKYNEKFKNRFTISRDNSKNTLYLQM
NSLRAEDTAVYYCARDYRKGLYAMDY
WGQGTTVTVSSASTKGPSVFPLAPCSRST
SESTAALGCLVKDYFPEPVTVSWNSGAL
TSGVHTFPAVLQSSGLYSLSSVVTVPSSS
LGTKTYTCNVDHKPSNTKVDKRVESKY
GPPCPPCPAPEFLGGPSVFLFPPKPKDTL
MISRTPEVTCVVVDVSQEDPEVQFNWYV
DGVEVHNAKTKPREEQFNSTYRVVSVLT
VLHQDWLNGKEYKCKVSNKGLPSSIEKT
ISKAKGQPREPQVYTLPPSQEEMTKNQV
SLTCLVKGFYPSDIAVEWESNGQPENNY
KTTPPVLDSDGSFFLYSRLTVDKSRWQE
GNVFSCSVMHEALHNHYTQKSLSLSLGK
SEQ ID NO: 57 DNA GAGGTCCAGCTGGTACAGTCTGGGGCT
Heavy GAGGTGAAGAAGCCTGGGGCTACAGT
Chain GAAAATCTCCTGCAAGGTTTCTGGCTA
CACCTTCACCAGTTACTGGATGTACTG
GGTGCGACAGGCTCGTGGACAACGCCT
TGAGTGGATAGGTAGGATTGATCCTAA
TAGTGGGAGTACTAAGTACAATGAGAA
GTTCAAGAACAGATTCACCATCTCCAG
AGACAATTCCAAGAACACGCTGTATCT
TCAAATGAACAGCCTGAGAGCCGAGG
ACACGGCCGTGTATTACTGTGCAAGGG
ACTATAGAAAGGGGCTCTATGCTATGG
ACTACTGGGGCCAGGGCACCACCGTGA
CCGTGTCCTCCGCTTCCACCAAGGGCC
CATCCGTCTTCCCCCTGGCGCCCTGCTC
CAGGAGCACCTCCGAGAGCACAGCCGC
CCTGGGCTGCCTGGTCAAGGACTACTT
CCCCGAACCGGTGACGGTGTCGTGGAA
CTCAGGCGCCCTGACCAGCGGCGTGCA
CACCTTCCCGGCTGTCCTACAGTCCTCA
GGACTCTACTCCCTCAGCAGCGTGGTG
ACCGTGCCCTCCAGCAGCTTGGGCACG
AAGACCTACACCTGCAACGTAGATCAC
AAGGCCCAGCAACACCAAGGTGGACAA
GAGAGTTGAGTCCAAATATGGTCCCCC
ATGCCCACCGTGCCCAGCACCTGAGTT
CCTGGGGGGACCATCAGTCTTCCTGTT
CCCCCCAAAACCCAAGGACACTCTCAT
GATCTCCCGGACCCCTGAGGTCACGTG
CGTGGTGGTGGACGTGAGCCAGGAAG
ACCCCGAGGTCCAGTTCAACTGGTACG
TGGATGGCGTGGAGGTGCATAATGCCA
AGACAAAGCCGCGGGAGGAGCAGTTC
AACAGCACGTACCGTGTGGTCAGCGTC
CTCACCGTCCTGCACCAGGACTGGCTG
AACGGCAAGGAGTACAAGTGCAAGGT
GTCCAACAAAGGCCTCCCGTCCTCCAT
CGAGAAAACCATCTCCAAAGCCAAAG
GGCAGCCCCGAGAGCCACAGGTGTACA
CCCTGCCCCCATCCCAGGAGGAGATGA
CCAAGAACCAGGTCAGCCTGACCTGCC
TGGTCAAAGGCTTCTACCCCAGCGACA
TCGCCGTGGAGTGGGAGAGCAATGGGC
AGCCGGAGAACAACTACAAGACCACG
CCTCCCGTGCTGGACTCCGACGGCTCC
TTCTTCCTCTACAGCAGGCTAACCGTG
GACAAGAGCAGGTGGCAGGAGGGGAA
TGTCTTCTCATGCTCCGTGATGCATGAG
GCTCTGCACAACCACTACACACAGAAG
AGCCTCTCCCTGTCTCTGGGTAAA
BAP058-hum13-
LC
SEQ ID NO: 49 LCDR1 KASQDVGTAVA
(Kabat)
SEQ ID NO: 50 LCDR2 WASTRHT
(Kabat)
SEQ ID NO: 51 LCDR3 QQYNSYPLT
(Kabat)
SEQ ID NO: 52 LCDR1 SQDVGTA
(Chothia)
SEQ ID NO: 53 LCDR2 WAS
(Chothia)
SEQ ID NO: 54 LCDR3 YNSYPL
(Chothia)
SEQ ID NO: 58 VL AIQLTQSPSSLSASVGDRVTITCKASQDV
GTAVAWYLQKPGQSPQLLIYWASTRHT
GVPSRFSGSGSGTDFTFTISSLEAEDAAT
YYCQQYNSYPLTFGQGTKVEIK
SEQ ID NO: 59 DNA GCCATCCAGTTGACCCAGTCTCCATCCT
VL CCCTGTCTGCATCTGTAGGAGACAGAG
TCACCATCACTTGCAAGGCCAGTCAGG
ATGTGGGTACTGCTGTAGCCTGGTACC
TGCAGAAGCCAGGGCAGTCTCCACAGC
TCCTGATCTATTGGGCATCCACCCGGC
ACACTGGGGTCCCCTCGAGGTTCAGTG
GCAGTGGATCTGGGACAGATTTCACCT
TTACCATCAGTAGCCTGGAAGCTGAAG
ATGCTGCAACATATTACTGTCAGCAGT
ATAACAGCTATCCTCTCACGTTCGGCC
AAGGGACCAAGGTGGAAATCAAA
SEQ ID NO: 60 Light AIQLTQSPSSLSASVGDRVTITCKASQD
Chain VGTAVAWYLQKPGQSPQLLIYWASTRHT
GVPSRFSGSGSGTDFTFTISSLEAEDAAT
YYCQQYNSYPLTFGQGTKVEIKRTVAAPS
VFIFPPSDEQLKSGTASVVCLLNNFYPRE
AKVQWKVDNALQSGNSQESVTEQDSKD
STYSLSSTLTLSKADYEKHKVYACEVTH
QGLSSPVTKSFNRGEC
SEQ ID NO: 61 DNA GCCATCCAGTTGACCCAGTCTCCATCCT
Light CCCTGTCTGCATCTGTAGGAGACAGAG
Chain TCACCATCACTTGCAAGGCCAGTCAGG
ATGTGGGTACTGCTGTAGCCTGGTACC
TGCAGAAGCCAGGGCAGTCTCCACAGC
TCCTGATCTATTGGGCATCCACCCGGC
ACACTGGGGTCCCCTCGAGGTTCAGTG
GCAGTGGATCTGGGACAGATTTCACCT
TTACCATCAGTAGCCTGGAAGCTGAAG
ATGCTGCAACATATTACTGTCAGCAGT
ATAACAGCTATCCTCTCACGTTCGGCC
AAGGGACCAAGGTGGAAATCAAACGT
ACGGTGGCTGCACCATCTGTCTTCATCT
TCCCGCCATCTGATGAGCAGTTGAAAT
CTGGAACTGCCTCTGTTGTGTGCCTGCT
GAATAACTTCTATCCCAGAGAGGCCAA
AGTACAGTGGAAGGTGGATAACGCCCT
CCAATCGGGTAACTCCCAGGAGAGTGT
CACAGAGCAGGACAGCAAGGACAGCA
CCTACAGCCTCAGCAGCACCCTGACGC
TGAGCAAAGCAGACTACGAGAAACAC
AAAGTCTACGCCTGCGAAGTCACCCAT
CAGGGCCTGAGCTCGCCCGTCACAAAG
AGCTTCAACAGGGGAGAGTGT
Dosage and Administration of the Immunotherapeutic Agent.
The immunotherapeutic agent (Such as an anti-PD-1 antibody molecule or an anti-PD-L1 molecule antibody) can be administered to the subject systemically (e.g., orally, parenterally, subcutaneously, intravenously, rectally, intramuscularly, intraperitoneally, intranasally, transdermally, or by inhalation or intracavitary installation), topically, or by application to mucous membranes, such as the nose, throat and bronchial tubes.
Dosages and therapeutic regimens of the immunotherapeutic agent (e.g. anti-PD-1 antibody molecule or anti PD-L1 antibody molecule) can be determined by a skilled artisan. In certain embodiments, the immunotherapeutic agent (e.g. anti-PD-1 antibody molecule) is administered by injection (e.g., subcutaneously or intravenously) at a dose of about 1 to 30 mg/kg, e.g., about 5 to 25 mg/kg, about 10 to 20 mg/kg, about 1 to 5 mg/kg, or about 3 mg/kg. The dosing schedule can vary from e.g., once a week to once every 2, 3, or 4 weeks. In one embodiment, the anti-PD-1 antibody molecule is administered at a dose from about 10 to 20 mg/kg every other week. In another embodiment, the anti-PD-1 antibody molecule is administered at a dose from about 1 to 10 mg/Kg, or from about 1 to 5 mg/Kg or about 3 mg/kg every 4 weeks.
For example, the anti-PD-1 antibody molecule is administered or used at a flat or fixed dose. In some embodiments, the anti-PD-1 antibody molecule is administered by injection (e.g., subcutaneously or intravenously) at a dose (e.g., a flat dose) of about 200 mg to 500 mg, e.g., about 250 mg to 450 mg, about 300 mg to 400 mg, about 250 mg to 350 mg, about 350 mg to 450 mg, or about 300 mg or about 400 mg. The dosing schedule (e.g., flat dosing schedule) can vary from e.g., once a week to once every 2, 3, 4, 5, or 6 weeks. In one embodiment, the anti-PD-1 antibody molecule is administered at a dose from about 300 mg to 400 mg once every three weeks or once every four weeks. In one embodiment, the anti-PD-1 antibody molecule is administered at a dose from about 300 mg once every three weeks. In one embodiment, the anti-PD-1 antibody molecule is administered at a dose from about 400 mg once every four weeks. In one embodiment, the anti-PD-1 antibody molecule is administered at a dose from about 300 mg once every four weeks. In one embodiment, the anti-PD-1 antibody molecule is administered at a dose from about 400 mg once every three weeks.
In another embodiment, the anti-PD-1 antibody molecule is administered at a flat dose of about 300 mg to 400 mg once every three weeks or once every four weeks. In a subset of this embodiment, the anti-PD-1 antibody molecule is administered at a flat dose of about 400 mg every four weeks. In yet another subset of this embodiment, the anti-PD-1 antibody molecule is administered at a flat dose of about 300 mg every three weeks.
Preparation of Crystalline Form of
Crystalline forms may be prepared by a variety of methods, including for example, crystallization or recrystallization from a suitable solvent, sublimation, growth from a melt, solid state transformation from another phase, crystallization from a supercritical fluid, and jet spraying. Techniques for crystallization or recrystallization of crystalline forms from a solvent mixture include, for example, evaporation of the solvent, decreasing the temperature of the solvent mixture, crystal seeding a supersaturated solvent mixture of the molecule and/or salt, freeze drying the solvent mixture, and addition of antisolvents (countersolvents) to the solvent mixture. Exemplary methods of preparing the crystalline forms described herein are set forth in detail below.
Crystals of drugs, including polymorphs, methods of preparation, and characterization of drug crystals are discussed in Solid-State Chemistry of Drugs, S. R. Byrn, R. R. Pfeiffer, and J. G. Stowell, 2nd Edition, SSCI, West Lafayette, Ind. (1999).
For crystallization techniques that employ solvents, the choice of solvent or solvents is typically dependent upon one or more factors, such as solubility of the compound, crystallization technique, and vapor pressure of the solvent. Combinations of solvents may be employed, for example, the compound may be solubilized into a first solvent to afford a solution, followed by the addition of an antisolvent to decrease the solubility of the compound in the solution and to afford the formation of crystals. An antisolvent is a solvent in which the compound has low solubility.
In one method to prepare crystals, a compound is suspended and/or stirred in a suitable solvent to afford a slurry, which may be heated to promote dissolution. The term “slurry”, as used herein, means a saturated solution of the compound, which may also contain an additional amount of the compound to afford a heterogeneous mixture of the compound and a solvent at a given temperature. This may also be referred to as a suspension.
Seed crystals may be added to any crystallization mixture to promote crystallization. Seeding may be employed to control growth of a particular polymorph or to control the particle size distribution of the crystalline product. Accordingly, calculation of the amount of seeds needed depends on the size of the seed available and the desired size of an average product particle as described, for example, in “Programmed Cooling of Batch Crystallizers,” J. W. Mullin and J. Nyvlt, Chemical Engineering Science, 1971, 26, 369-377. In general, seeds of small size are needed to control effectively the growth of crystals in the batch. Seed of small size may be generated by sieving, milling, or micronizing of large crystals, or by micro-crystallization of solutions. Care should be taken that milling or micronizing of crystals does not result in any change in crystallinity form the desired crystal form (i.e., change to amorphous or to another polymorph).
A cooled crystallization mixture may be filtered under vacuum, and the isolated solids may be washed with a suitable solvent, such as cold recrystallization solvent, and dried under a nitrogen purge to afford the desired crystalline form. The isolated solids may be analyzed by a suitable spectroscopic or analytical technique, such as solid state nuclear magnetic resonance, differential scanning calorimetry, x-ray powder diffraction, or the like, to assure formation of the preferred crystalline form of the product. The resulting crystalline form is typically produced in an amount of greater than about 70 weight % isolated yield, preferably greater than 90 weight % isolated yield, based on the weight of the compound originally employed in the crystallization procedure. The product may be co-milled or passed through a mesh screen to delump the product, if necessary.
Alternatively, crystalline forms may be prepared directly from the reaction medium of the final process for preparing 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine. This may be achieved, for example, by employing in the final process step a solvent or a mixture of solvents from which 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine or salt thereof may be crystallized. In addition, crystalline forms may be obtained by distillation or solvent addition techniques.
In addition to the methods discussed briefly below, it should be understood that various analytical methods may be used for the characterization of any of the materials described herein.
The following non-limiting examples are illustrative of the disclosure.
Examples
The various crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine described herein were prepared as follows. It should be understood that these examples are illustrative and that these materials may be prepared according to other methods described herein or via methods known in the art.
(Form F) Free Form 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (Modification 1)
The solid was analyzed by XRPD after isolation.
Figure US10933064-20210302-C00002

Procedure of Step 1
To a reactor, were charged pyrazole (252 g, 9.0 eq.), acetonitrile (5 L) and potassium carbonate (860 g, 3.02 eq.). The mixture was heated at 65-75° C. for 30 minutes. The reaction mixture was cooled to 35-45° C., when 5-bromo-2,6-dichloropyrimidin-4-amine (500 g, 1.0 eq.) was added under N2 protection. The resulting mixture was heated at 72-78° C. for 24 h. The reaction mixture was cooled to 40-50° C. and deemed complete by HPLC analysis. Water (20.2 kg) was added over a period of 2 hours. The temperature was controlled at 20° C. for 2 hours. The crude product was collected by filtration and washed with water (5.0 kg). The crude material was slurred with acetonitrile (0.8 kg) and water (4 kg) at 50-60° C. for 1 hour. Wet cake was obtained by filtration and washing with water (2.0 kg). The wet cake was dissolved in acetonitrile (153.0 kg) and water (2.3 kg) at 47° C., and active carbon (0.075 kg) was added. The mixture was stirred at 42-52° C. for 1.5 hours. Solid was filtered off through microcrystalline cellulose. The filtrate was concentrated under vacuum at 55° C. till the total volume left was around 2.7 L. Water (4.0 kg) was added to the solution. The mixture was concentrated under vacuum at 55° C. till the total volume left was around 6.0 L. To the mixture acetonitrile (0.4 kg) and process water (4.0 kg) were added. And temperature was controlled at 47° C. for 3 hour and at 20° C. for 2 hours sequentially. The product was collected by filtration and washed with process water (1.5 kg). The wet cake was dried under vacuum for 20 hours at 50° C. to give 450 g of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (71.2% yield) as an off white solid.
Alternative Procedure for Step 1:
To a reactor, was charged 5-bromo-2,6-dichloropyrimidin-4-amine (50 g, 1.0 eq.), pyrazole (126.1 g, 9 eq.) and DMSO (350 mL). To the mixture was charged KOH (26 g, 2.25 eq.) with internal temperature kept under 35° C. The reaction was stirred for additional 30 min with internal temperature maintained under 35° C. by adjusting the jacket temperature. The reaction was then stirred at 35° C. for 2 hr, followed by stirring at 50° C. for 3 hr, and deemed complete by HPLC analysis. To the mixture, was added 0.5% KOH solution (60 mL) dropwise at 50° C. The solution was cooled to 45° C., added by 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine seeds (0.02 g) and aged for 30 min. To the suspension, was added 540 mL 0.5% KOH over 2 hr with the internal temperature kept at 45° C. Upon completion of addition, the suspension was cooled to 23° C. over 90 min. The solid was collected by filtration, rinsed with 200 mL H2O, and dried in a full vacuum oven at 60° C. for 16 hr to give 56.6 g 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (89.8% yield) as a white solid.
Step 2: Recrystallization Procedure:
To a reactor was added the crude 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (5 g) from the above step, methanol (140 g, 28×) and water (20 g, 4×). The mixture was heated at 50° C. to obtain a clear solution and filtered. The filtrate was concentrated under vacuum to the total weight of around 110 g (22×). The suspension was heated to reflux until all solid was dissolved. The solution was cooled slowly to 42° C. over a 1 h period. Solid precipitated out. Water (160 g, 32×) was added slowly at 42° C. Stirred for 2 hours and cooled to 20° C. After holding at 20° C. for 2 hours with stirring, the product was collected by filtration and washed with water (6 g). The wet cake was dried under vacuum for 20 hours at 55° C. to give 4.55 g of crystalline 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (91% yield). Polymorph of solid was characterized with XRPD FIG. 11, table 6 (Form F).
(Form A) Mono-hydrochloride Hydrate Salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine
To a suspension of 50 mg (0.1633 mmol) of 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine (Form F) in 1 mL acetonitrile was added 27.2 uL HCl aqueous solution (6M, 0.1633 mmol) dropwise. The mixture was stirred at 50 degree C. for 20 hours. The mixture was cooled to room temperature within 2 hours and stirring was kept for another 1 hour. The solid was collected with vacuum filtration and dried at r.t overnight. 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-a mono-hydrochloride hydrate was obtained as a crystalline Form A. The solid was analyzed by XRPD after isolation.
(Form B) Di-hydrochloride Hydrate Salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine
To a suspension of 50 mg (0.1633 mmol) of 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine (Form F) in 1 mL ethyl acetate was added 54.5 uL HCl aqueous solution (6M, 0.3266 mmol) dropwise. The mixture was stirred at 50 degree C. for 20 hours. The mixture was cooled to room temperature within 2 hours and the stirring was maintained for another 1 hour. The solid was collected with vacuum filtration and dried at r.t overnight. 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine di-hydrochloride hydrate was obtained as a crystalline Form B. The solid was analyzed by XRPD after isolation.
(Form C) Sulfate Salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine
To a suspension of 3.06 g (10 mmol) of 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine (Form F) in 60 mL acetone at 50° C. was added 1.83 mL (6 mol/L, 11 mmol) sulfuric acid aqueous solution gradually. The resulting mixture was stirred at 50° C. for 10 hours, then cooled to 25 degree C. within 5 hours and stirred for another 1 hour. The solid was separated via suction filtration and dried under vacuum at 40° C. for 4 hours. 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine sulfate salt (2.5 g, 6.2 mmol) was obtained as yellow crystalline solid (Form C) (62% yield). The solid was analyzed by XRPD after isolation.
(Form D) Mesylate Salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine
To a suspension of 50 mg (0.1633 mmol) of 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine (Form F) in 1 mL iso-propyl acetate was added methanesulfonic acid (0.1633 mmol) IPAc solution dropwise. The mixture was stirred at 25 degree C. for 20 hours. The mixture was cooled down to room temperature within 2 hours and the stirring was maintained for another 1 hour. The solid was collected with vacuum filtration and dried at r.t overnight. 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine mesylate salt was obtained as a crystalline white solid (Form D). The solid was analyzed by XRPD after isolation.
(Form E) Mesylate Salt of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine
To a suspension of 50 mg (0.1633 mmol) of 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine (Form F) in 1 mL acetone was added methanesulfonic acid (0.1633 mmol) acetone solution dropwise. The mixture was stirred at 25 degree C. for 20 hours. The mixture was cooled to room temperature within 2 hours and stirring was maintained for another 1 hour. The solid was collected with vacuum filtration and dry at r.t overnight. 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine mesylate salt was obtained as a crystalline white solid (Form E). The solid was analyzed by XRPD after isolation.
(Form G) Free Form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine (Modification 2)
A saturated ethanol solution of 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine (Form F) (300 mg) was prepared at 60° C., then fast cooled to 4° C. with 400 r/s stir speed in easy-max for several hours. The resulting solid was collected via vacuum filtration and dry at r.t overnight. Free form of 5-bromo-2,6-di(1H-pyrazol-1-yl)-pyrimidin-4-amine (modification 2) was obtained as a crystalline white solid (Form G) with 42% yield. The solid was analyzed by XRPD after isolation.
Powder X-Ray Diffraction
X-ray powder diffraction (XRPD) data were obtained using a Brucker™ D8 Discover Diffractometer. The method is summarized below:
XRPD
Instrument Bruker D8 Discover with XYZ stage
Detector VANTEC-500 including controller 19″
Radiation CuKα (0.15406 nm)
X-ray generator power 40 kV, 1 mA (Micro source)
Step size, resolution 0.02 degrees
Measuring slice 0.3 mm and 0.2 mm
Scan range
4° to 45° (2 theta value)
Scan time 2 min
X-ray optics Iμs MONTEL optic for Cu
Source slit Fixed, 1 mm
Detector distance ~30 cm
TABLE 1
X-ray powder diffraction data for Form A
Angle (°2θ) d value (Å) Rel. Intensity (%) Intensity
10.045 8.799 100.00 2436.91
15.605 5.674 18.40 448.40
19.609 4.523 6.25 152.27
20.796 4.268 21.18 516.18
22.588 3.933 15.30 372.87
24.455 3.637 9.79 238.61
24.501 3.630 10.64 259.17
25.290 3.519 18.82 458.67
26.520 3.358 5.23 127.39
28.529 3.126 20.89 509.13
29.097 3.066 30.91 753.18
30.723 2.908 13.08 318.75
33.459 2.676 6.12 149.18
TABLE 2
X-ray powder diffraction data for Form B
Angle (°2θ) d value (Å) Rel. Intensity (%) Intensity
7.803 11.321 12.25 91.72
8.225 10.742 5.81 43.48
9.569 9.235 38.43 287.72
14.437 6.130 11.24 84.15
14.891 5.944 8.37 62.65
16.126 5.492 16.34 122.33
19.350 4.583 13.30 99.61
21.512 4.127 14.57 109.10
22.110 4.017 85.16 637.67
22.369 3.971 30.47 228.17
23.113 3.845 17.02 127.47
23.134 3.842 17.22 128.93
24.260 3.666 12.74 95.42
26.435 3.369 100.00 748.79
27.384 3.254 34.63 259.30
27.951 3.190 29.22 218.80
28.440 3.136 47.62 356.55
29.749 3.001 10.75 80.48
30.653 2.914 37.99 284.43
31.710 2.819 7.40 55.43
34.761 2.579 14.83 111.03
35.529 2.525 9.77 73.17
39.179 2.297 8.89 66.56
TABLE 3
X-ray powder diffraction data for Form C
Angle (°2θ) d value (Å) Rel. Intensity (%) Intensity
9.406 9.395 100.00 1251.30
12.291 7.196 32.11 401.76
12.722 6.953 19.50 244.04
17.124 5.174 37.36 467.54
18.811 4.714 12.49 156.34
19.323 4.590 14.78 184.98
20.498 4.329 17.70 221.53
23.237 3.825 70.62 883.63
24.843 3.581 55.71 697.07
26.063 3.416 27.38 342.63
26.465 3.365 32.55 407.35
26.820 3.321 92.28 1154.66
29.916 2.984 22.10 276.54
31.739 2.817 16.38 204.98
44.701 2.026 10.29 128.79
TABLE 4
X-ray powder diffraction data for Form D
Angle (°2θ) d value (Å) Rel. Intensity (%) Intensity
9.092 9.719 4.98 67.76
10.132 8.723 15.25 207.61
17.925 4.945 11.28 153.59
20.282 4.375 18.02 245.40
24.005 3.704 100.00 1361.52
25.025 3.555 5.77 78.53
26.427 3.370 10.79 146.84
33.355 2.684 12.52 170.50
TABLE 5
X-ray powder diffraction data for Form E
Angle (°2θ) d value (Å) Rel. Intensity (%) Intensity
9.055 9.758 19.44 139.69
16.606 5.334 34.78 249.84
18.024 4.918 13.69 98.34
21.045 4.218 27.71 199.08
22.075 4.024 41.39 297.37
23.447 3.791 34.55 248.21
24.089 3.691 20.97 150.64
25.031 3.555 15.49 111.25
26.669 3.340 100.00 718.44
29.899 2.986 17.59 126.34
TABLE 6
X-ray powder diffraction data for Form F
Angle (°2θ) d value (Å) Rel. Intensity (%) Intensity
8.212 10.758 100.00 2929.96
8.463 10.440 4.58 134.11
11.512 7.681 9.24 270.69
12.079 7.322 4.00 117.10
12.140 7.285 2.91 85.26
16.403 5.400 18.10 530.40
16.928 5.233 8.92 261.31
18.076 4.904 8.88 260.30
18.930 4.684 6.76 197.96
23.008 3.862 5.46 160.05
24.200 3.675 7.31 214.19
24.957 3.565 20.47 599.90
25.662 3.469 25.22 738.79
25.748 3.457 30.82 902.92
26.550 3.355 28.17 825.48
27.851 3.201 8.17 239.45
30.820 2.899 10.56 309.47
34.738 2.580 7.01 205.34
TABLE 7
X-ray powder diffraction data for Form G
Angle (°2θ) d value (Å) Rel. Intensity (%) Intensity
8.334 10.601 69.72 2025.02
10.405 8.495 16.42 476.97
14.034 6.305 24.70 717.44
16.671 5.313 26.31 764.23
20.365 4.357 6.10 177.13
20.838 4.260 5.48 159.14
21.815 4.071 100.00 2904.53
24.650 3.609 11.86 344.60
25.164 3.536 79.43 2307.10
26.774 3.327 46.46 1349.57
28.759 3.102 5.30 153.82
30.689 2.911 16.17 469.55
32.864 2.723 12.43 360.90
34.693 2.584 4.52 131.33
36.671 2.449 8.06 234.05
41.283 2.185 7.96 231.32
42.552 2.123 18.79 545.88

Thermal Analysis (TA):
The crystalline forms were analyzed using TA instrument Discovery (DSC) and thermogravimetric analysis (TGA): Discovery (DSC) and Discovery (TGA) with aluminum pan (T150603); heating rate 10° C./min, temperature range: 30 to 300° C.
DSC:
Accurately weigh 10 mg of test substance into the closed sample pan with pinhole. An empty sample pan is used as reference. The DSC thermogram is recorded as follow: the temperature of the apparatus is adjusted to about 30° C., and heated to 300° C. at a heating rate of 10° C./min, under a nitrogen flow of 20 mL/min. The instrument is calibrated for temperature and enthalpy with Indium, at least 99.9999% pure. The accuracy of the measured sample temperature with this method is within about ±1° C., and the heat of fusion can be measured within a relative error of about ±5%.
TGA:
Accurately weigh 10 mg of test substance into the open sample pan. The TGA thermogram is recorded as follows: the sample is loaded into the furnace, and heated to 300° C. at a heating rate of 10° C./min, under a flow of nitrogen at 20 mL/min.
The instrument is calibrated for temperature with nickel, and calibrated for weight with a 100 mg standard.
Illustrative DSC/TGA traces generated using crystalline Forms A, B, C, D, E, F and G are shown in FIGS. 2, 4, 6, 8, 10, 12 and 14, respectively.
Form A: Melting endotherm: Tonset=78.16° C., ΔH=300.87 J/g; small initial weigh loss of 14.91% before melt onset; and Tonset=212.48° C., ΔH=86.83 J/g.
Form B: Melting endotherm: Tonset=78.92° C., ΔH=399.81 J/g; small initial weigh loss of 24.47% before melt onset; and Tonset=212.18° C., ΔH=81.02 J/g
Form C: Melting endotherm: Tonset=188.44° C., ΔH=117.42 J/g; small initial weigh loss of 0.38% before melt onset.
Form D: Melting endotherm: Tonset=177.11° C., ΔH=122.19 J/g; small initial weigh loss of 1.72% before melt onset.
Form E: Melting endotherm: Tonset=188.44° C., ΔH=117.4 J/g; small initial weigh loss of 0.69% before melt onset.
Form F: Melting endotherm: Tonset=212.63° C., ΔH=104.22 J/g; small initial weigh loss of 0.59% before melt onset.
Form G: Melting endotherm: Tonset=202.95° C., ΔH=14.84 J/g; small initial weigh loss of 1.06% before melt onset; and Tonset=212.96° C., ΔH=91.99 J/g.

Claims (27)

The invention claimed is:
1. A crystalline form of a free form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine characterized by an X-ray powder diffraction (XRPD) pattern comprising a peak at 8.2±0.2 °2θ, 24.9±0.2 °2θ, 25.7±0.2 °2θ and 26.5±0.2 °2θ, when measured using CuKα radiation with a wavelength of 1.5418 Å and at a temperature of about 22° C.
2. A crystalline form according to claim 1 wherein the X-ray powder diffraction pattern comprises one or more peaks chosen from 16.4±0.2 °2θ, 30.8±0.2 °2θ, and 11.5±0.2 °2θ, when measured using CuKα radiation with a wavelength of 1.5418 Å and at a temperature of about 22° C.
3. A crystalline form according to claim 1 wherein said crystalline form is Form F.
4. A crystalline form according to claim 3 wherein said Form F is substantially phase pure.
5. A pharmaceutical composition comprising a crystalline form of the free form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine according to claim 1 and further comprising at least one other solid state form of the free form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine.
6. A pharmaceutical composition comprising a crystalline form of the free form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine according to claim 1 and further comprising an amorphous form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine or a pharmaceutically acceptable salt thereof.
7. A pharmaceutical composition comprising a crystalline form according to claim 1, and a pharmaceutically acceptable excipient.
8. A pharmaceutical combination comprising a therapeutically effective amount of a crystalline form according to claim 1, and one or more immunotherapeutic agents.
9. A method of treating cancer, in a subject in need thereof, comprising: administering to a subject in need thereof, a therapeutically effective amount of a crystalline form according to claim 1, alone or in combination with one or more immunotherapeutic agents.
10. A method of inhibiting adenosine A2a receptor, in a subject in need thereof comprising: administering to a subject a therapeutically effective amount of a crystalline form according to claim 2.
11. A method according to claim 9, wherein the cancer is selected from wherein the cancer is selected from a lung cancer, a melanoma, a renal cancer, a liver cancer, a myeloma, a prostate cancer, a breast cancer, a colorectal cancer, a pancreatic cancer, a head and neck cancer, anal cancer, gastro-esophageal cancer, thyroid cancer, cervical cancer, a lymphoproliferative disease, T-cell lymphoma, B-cell lymphoma, a non-Hogdkin lymphoma, or a leukemia.
12. The method of claim 11 wherein the cancer is lung cancer.
13. The method of claim 9 wherein one or more immunotherapeutic agents are selected from the group consisting of anti-CTLA4 antibodies, anti-PD-1 antibodies and anti-PD-L1 antibodies.
14. The method of claim 9, wherein the immunotherapeutic agent is selected from the group consisting of: Ipilimumab, Tremelimumab, Nivolumab, Pembrolizumab, Pidilizumab, AMP-224, AMP-514, MPDL3280A, MEDI4736, MSB0010718C, YW243.55.S70 and MDX-1105.
15. The method of claim 9, wherein the immunotherapeutic agents is an anti-PD-1 antibody.
16. The method according to claim 15, wherein the anti-PD-1 antibody comprises:
(a) a heavy chain variable region (VH) comprising a VHCDR1 amino acid sequence of SEQ ID NO: 4, a VHCDR2 amino acid sequence of SEQ ID NO: 5, and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a light chain variable region (VL) comprising a VLCDR1 amino acid sequence of SEQ ID NO: 13, a VLCDR2 amino acid sequence of SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 15;
(b) a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 1; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 12;
(c) a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 41, a VHCDR2 amino acid sequence of SEQ ID NO: 5, and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 13, a VLCDR2 amino acid sequence of SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 15; or
(d) a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 41; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 12.
17. The method according to claim 15, wherein the anti-PD-1 comprises a VH comprising the amino acid sequence of SEQ ID NO: 6 and a VL comprising the amino acid sequence of SEQ ID NO: 20.
18. The method according to claim 15, wherein the anti-PD-1 antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 8 and a light chain comprising the amino acid sequence of SEQ ID NO: 22.
19. The method according to claim 15, wherein the anti-PD-1 antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 6 and a VL comprising the amino acid sequence of SEQ ID NO: 16.
20. The method according to claim 15, wherein the anti-PD-1 antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 8 and a light chain comprising the amino acid sequence of SEQ ID NO: 18.
21. The method according to claim 15, wherein the anti-PD-1 antibody molecule is administered at a dose of about 300 mg once every three weeks.
22. The method, according to claim 15, wherein the anti-PD-1 antibody molecule is administered at a dose of about 400 mg once every four weeks.
23. The method of claim 9, wherein the immunotherapeutic agents is is an anti-PD-L1 antibody.
24. The method according to claim 23, wherein the anti PD-L1 antibody molecule comprises:
(a) a heavy chain variable region (VH) comprising a VHCDR1 amino acid sequence of SEQ ID NO: 47, a VHCDR2 amino acid sequence of SEQ ID NO: 48, and a VHCDR3 amino acid sequence of SEQ ID NO: 46; and a light chain variable region (VL) comprising a VLCDR1 amino acid sequence of SEQ ID NO: 52, a VLCDR2 amino acid sequence of SEQ ID NO: 53, and a VLCDR3 amino acid sequence of SEQ ID NO: 54;
(b) a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 44; a VHCDR2 amino acid sequence of SEQ ID NO: 45; and a VHCDR3 amino acid sequence of SEQ ID NO: 46; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 49, a VLCDR2 amino acid sequence of SEQ ID NO: 50, and a VLCDR3 amino acid sequence of SEQ ID NO: 51;
(c) a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 63, a VHCDR2 amino acid sequence of SEQ ID NO: 48, and a VHCDR3 amino acid sequence of SEQ ID NO: 46; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 52, a VLCDR2 amino acid sequence of SEQ ID NO: 53, and a VLCDR3 amino acid sequence of SEQ ID NO: 54; or
(d) a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 63; a VHCDR2 amino acid sequence of SEQ ID NO: 45; and a VHCDR3 amino acid sequence of SEQ ID NO: 46; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 49, a VLCDR2 amino acid sequence of SEQ ID NO: 50, and a VLCDR3 amino acid sequence of SEQ ID NO: 51.
25. The method according to claim 23, wherein the anti PD-L1 antibody molecule comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 55 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 58.
26. The method according to claim 13, wherein immunotherapeutic agent is administered together in a single composition or administered separately in two or more different compositions forms.
27. The method according to claim 13 wherein the immunotherapeutic agent is administered concurrently with, prior to, or subsequent to, a crystalline form of the free form of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine.
US16/616,844 2017-05-31 2018-05-30 Crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine and new salts Expired - Fee Related US10933064B2 (en)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
CN2017086624 2017-05-31
CNPCT/CN2017/086624 2017-05-31
WOPCT/CN2017/086624 2017-05-31
PCT/IB2018/053839 WO2018220546A1 (en) 2017-05-31 2018-05-30 Crystalline forms of 5-bromo-2,6-di(1 h-pyrazol-1-yl)pyrimidin-4-amine and new salts

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2018/053839 A-371-Of-International WO2018220546A1 (en) 2017-05-31 2018-05-30 Crystalline forms of 5-bromo-2,6-di(1 h-pyrazol-1-yl)pyrimidin-4-amine and new salts

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/156,785 Continuation US11654144B2 (en) 2017-05-31 2021-01-25 Crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1- yl)pyrimidin-4-amine and new salts

Publications (2)

Publication Number Publication Date
US20200163963A1 US20200163963A1 (en) 2020-05-28
US10933064B2 true US10933064B2 (en) 2021-03-02

Family

ID=62778954

Family Applications (2)

Application Number Title Priority Date Filing Date
US16/616,844 Expired - Fee Related US10933064B2 (en) 2017-05-31 2018-05-30 Crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1-yl)pyrimidin-4-amine and new salts
US17/156,785 Active 2038-12-14 US11654144B2 (en) 2017-05-31 2021-01-25 Crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1- yl)pyrimidin-4-amine and new salts

Family Applications After (1)

Application Number Title Priority Date Filing Date
US17/156,785 Active 2038-12-14 US11654144B2 (en) 2017-05-31 2021-01-25 Crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1- yl)pyrimidin-4-amine and new salts

Country Status (18)

Country Link
US (2) US10933064B2 (en)
EP (1) EP3630751B1 (en)
JP (1) JP7273732B2 (en)
KR (1) KR20200018503A (en)
CN (1) CN110944995B (en)
AR (1) AR111906A1 (en)
AU (1) AU2018277241B2 (en)
BR (1) BR112019025149A2 (en)
CA (1) CA3065475A1 (en)
CL (2) CL2019003468A1 (en)
IL (2) IL270795B2 (en)
JO (1) JOP20190279A1 (en)
MX (1) MX2021014104A (en)
PH (1) PH12019502703A1 (en)
RU (2) RU2022102355A (en)
TW (1) TWI814725B (en)
WO (1) WO2018220546A1 (en)
ZA (1) ZA201907610B (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180371093A1 (en) * 2015-12-17 2018-12-27 Novartis Ag Antibody molecules to pd-1 and uses thereof
US20210145831A1 (en) * 2017-05-31 2021-05-20 Novartis Ag Crystalline forms of 5-bromo-2,6-di(1h-pyrazol-1-yl)pyrimidin-4-amine and new salts

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2011121418A1 (en) 2010-03-31 2011-10-06 Palobiofarma, S.L. 4 - aminopyrimidine derivatives and their as as adenosine a2a receptor antagonists
US8168179B2 (en) 2002-07-03 2012-05-01 Ono Pharmaceutical Co., Ltd. Treatment method using anti-PD-L1 antibody
WO2017025918A1 (en) 2015-08-11 2017-02-16 Novartis Ag 5-bromo-2,6-di-(lh-pyrazol-l-yl)pyrimidin-4-amine for use in the treatment of cancer

Family Cites Families (35)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
IL129299A0 (en) 1999-03-31 2000-02-17 Mor Research Applic Ltd Monoclonal antibodies antigens and diagnosis of malignant diseases
JP4064671B2 (en) * 2000-02-25 2008-03-19 エフ.ホフマン−ラ ロシュ アーゲー Adenosine receptor modulator
IL149820A0 (en) 2002-05-23 2002-11-10 Curetech Ltd Humanized immunomodulatory monoclonal antibodies for the treatment of neoplastic disease or immunodeficiency
AU2003288675B2 (en) 2002-12-23 2010-07-22 Medimmune Limited Antibodies against PD-1 and uses therefor
JP2007514003A (en) 2003-12-15 2007-05-31 アルミラル プロデスファルマ アーゲー 2,6-bisheteroaryl-4-aminopyrimidines as adenosine receptor antagonists
EP2418278A3 (en) 2005-05-09 2012-07-04 Ono Pharmaceutical Co., Ltd. Human monoclonal antibodies to programmed death 1(PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics
CN105330741B (en) 2005-07-01 2023-01-31 E.R.施贵宝&圣斯有限责任公司 Human monoclonal antibodies to programmed death ligand 1 (PD-L1)
WO2007103776A2 (en) * 2006-03-02 2007-09-13 Cv Therapeutics, Inc. A2a adenosine receptor antagonists
WO2008110891A2 (en) 2007-03-09 2008-09-18 Orchid Research Laboratories Limited, New heterocyclic compounds
WO2008116186A1 (en) 2007-03-22 2008-09-25 Keck Graduate Institute Systems and devices for isothermal biochemical reactions and/or analysis
CA2855098C (en) 2007-06-18 2018-02-27 Merck Sharp & Dohme B.V. Antibodies to human programmed death receptor pd-1
EP2262837A4 (en) 2008-03-12 2011-04-06 Merck Sharp & Dohme BINDING PROTEINS WITH PD-1
CN104740610A (en) 2008-08-25 2015-07-01 安普利穆尼股份有限公司 PD-1 Antagonists and Methods for Treating Infectious Disease
CA2736829C (en) 2008-09-12 2018-02-27 Isis Innovation Limited Pd-1 specific antibodies and uses thereof
EP3133086B1 (en) 2008-09-26 2018-08-01 Dana-Farber Cancer Institute, Inc. Human anti-pd-1, pd-l1, and pd-l2 antibodies and uses thereof
EP2376535B9 (en) 2008-12-09 2017-09-13 F. Hoffmann-La Roche AG Anti-pd-l1 antibodies and their use to enhance t-cell function
EP3192811A1 (en) 2009-02-09 2017-07-19 Université d'Aix-Marseille Pd-1 antibodies and pd-l1 antibodies and uses thereof
WO2011066342A2 (en) 2009-11-24 2011-06-03 Amplimmune, Inc. Simultaneous inhibition of pd-l1/pd-l2
WO2011110604A1 (en) 2010-03-11 2011-09-15 Ucb Pharma, S.A. Pd-1 antibody
US8907053B2 (en) 2010-06-25 2014-12-09 Aurigene Discovery Technologies Limited Immunosuppression modulating compounds
EP3403672A1 (en) 2011-04-20 2018-11-21 Medlmmune, LLC Antibodies and other molecules that bind b7-h1 and pd-1
KR20140041598A (en) 2011-07-24 2014-04-04 큐어 테크 리미티드 Variants of humanized immunomodulatory monoclonal antibodies
CN103987405B (en) 2011-11-28 2017-03-29 默克专利股份公司 Anti- PD L1 antibody and application thereof
PL2992017T3 (en) 2013-05-02 2021-09-06 Anaptysbio, Inc. ANTIBODIES TARGETED AGAINST PROGRAMMED DEATH-1 (PD-1)
US9676853B2 (en) 2013-05-31 2017-06-13 Sorrento Therapeutics, Inc. Antigen binding proteins that bind PD-1
US20160145355A1 (en) 2013-06-24 2016-05-26 Biomed Valley Discoveries, Inc. Bispecific antibodies
ES2927567T3 (en) 2013-09-13 2022-11-08 Beigene Switzerland Gmbh Anti-PD1 antibodies and their use as therapeutic and diagnostic products
ES2746805T3 (en) 2013-12-12 2020-03-06 Shanghai hengrui pharmaceutical co ltd PD-1 antibody, antigen-binding fragment thereof and medical application thereof
TWI681969B (en) 2014-01-23 2020-01-11 美商再生元醫藥公司 Human antibodies to pd-1
JOP20200094A1 (en) 2014-01-24 2017-06-16 Dana Farber Cancer Inst Inc Antibody Molecules of PD-1 and Their Uses
TWI693232B (en) 2014-06-26 2020-05-11 美商宏觀基因股份有限公司 Covalently bonded diabodies having immunoreactivity with pd-1 and lag-3, and methods of use thereof
CN107001478B (en) 2014-10-14 2022-01-11 诺华股份有限公司 Antibody molecules against PD-L1 and uses thereof
TWI595006B (en) 2014-12-09 2017-08-11 禮納特神經系統科學公司 Anti-PD-1 antibodies and methods of using same
JP7161481B2 (en) * 2017-02-10 2022-10-26 ノバルティス アーゲー 1-(4-amino-5-bromo-6-(1H-pyrazol-1-yl)pyrimidin-2-yl)-1H-pyrazol-4-ol and its use in treating cancer
JOP20190279A1 (en) * 2017-05-31 2019-11-28 Novartis Ag Crystalline images of 5-bromo-2,6-dye (1H-pyrazole-1-yl) pyrimidine-4-amine and novel salts

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8168179B2 (en) 2002-07-03 2012-05-01 Ono Pharmaceutical Co., Ltd. Treatment method using anti-PD-L1 antibody
WO2011121418A1 (en) 2010-03-31 2011-10-06 Palobiofarma, S.L. 4 - aminopyrimidine derivatives and their as as adenosine a2a receptor antagonists
US8796284B2 (en) * 2010-03-31 2014-08-05 Palobiofarma, S.L. 4-aminopyrimidine derivatives and their as as adenosine A2a receptor antagonists
WO2017025918A1 (en) 2015-08-11 2017-02-16 Novartis Ag 5-bromo-2,6-di-(lh-pyrazol-l-yl)pyrimidin-4-amine for use in the treatment of cancer
US10561653B2 (en) * 2015-08-11 2020-02-18 Novartis Ag 5-bromo-2,6-di-(1H-pyrazol-1-yl)pyrimidin-4-amine for use in the treatment of cancer

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
Brittain, Harry G. "Polymorphism in Pharmaceutical Solids", Drugs and the Pharmaceutical Sciences, vol. 192, Second Edition, pp. 333-338, 2009.
PCT International Search and Preliminary Examination Guidelines dated 2004 (Year: 2004). *
Shook et al (ACS Chemical Neuroscience vol. 2 p. 555-567 published 2011) (Year: 2011). *

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180371093A1 (en) * 2015-12-17 2018-12-27 Novartis Ag Antibody molecules to pd-1 and uses thereof
US20210145831A1 (en) * 2017-05-31 2021-05-20 Novartis Ag Crystalline forms of 5-bromo-2,6-di(1h-pyrazol-1-yl)pyrimidin-4-amine and new salts
US11654144B2 (en) * 2017-05-31 2023-05-23 Novartis Ag Crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1- yl)pyrimidin-4-amine and new salts

Also Published As

Publication number Publication date
US20200163963A1 (en) 2020-05-28
CL2019003468A1 (en) 2020-08-14
RU2019138329A3 (en) 2022-02-17
TW201920152A (en) 2019-06-01
MX2021014104A (en) 2021-12-10
WO2018220546A1 (en) 2018-12-06
IL270795B1 (en) 2023-08-01
ZA201907610B (en) 2021-10-27
US20210145831A1 (en) 2021-05-20
KR20200018503A (en) 2020-02-19
BR112019025149A2 (en) 2020-06-23
AR111906A1 (en) 2019-08-28
IL270795A (en) 2020-01-30
RU2019138329A (en) 2021-07-01
CA3065475A1 (en) 2018-12-06
IL270795B2 (en) 2023-12-01
JP7273732B2 (en) 2023-05-15
EP3630751B1 (en) 2024-03-27
IL291721B2 (en) 2024-07-01
EP3630751A1 (en) 2020-04-08
AU2018277241B2 (en) 2021-03-04
US11654144B2 (en) 2023-05-23
PH12019502703A1 (en) 2020-10-26
IL291721A (en) 2022-05-01
JOP20190279A1 (en) 2019-11-28
CL2021002667A1 (en) 2022-07-01
JP2020521774A (en) 2020-07-27
RU2022102355A (en) 2022-03-30
IL291721B1 (en) 2024-03-01
CN110944995A (en) 2020-03-31
AU2018277241A1 (en) 2019-12-12
CN110944995B (en) 2024-03-12
TWI814725B (en) 2023-09-11

Similar Documents

Publication Publication Date Title
CN104109149B (en) Deuterated diaminopyrimidine compounds and the pharmaceutical composition comprising the compound
US11654144B2 (en) Crystalline forms of 5-bromo-2,6-di(1H-pyrazol-1- yl)pyrimidin-4-amine and new salts
JP2022500406A (en) Antiviral pyridopyrazinedione compound
US20220202790A1 (en) Novel salts of selective estrogen receptor degraders
CA2929593A1 (en) Morphic forms of hexadecyloxypropyl-phosphonate esters
US10717710B2 (en) Solid forms of substituted 5,6-dihydro-6-phenylbenzo[F]isoquinolin-2-amine compounds
TW201733992A (en) Method for preparing substituted 5,6-dihydro-6-phenylbenzo[F]isoquinolin-2-amine
CN110290808B (en) 1- (4-amino-5-bromo-6- (1H-pyrazol-1-yl) pyrimidin-2-yl) -1H-pyrazol-4-ol and use thereof in the treatment of cancer
HK40048894A (en) Antiviral pyridopyrazinedione compounds
HK40079038A (en) Method of preparing solid forms of substituted 5,6-dihydro-6-phenylbenzo[f]isoquinolin-2-amine compounds

Legal Events

Date Code Title Description
FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY

AS Assignment

Owner name: PALOBIOFARMA S.L., SPAIN

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:CASTRO-PALOMINO LARIA, JULIO CESAR;REEL/FRAME:051354/0834

Effective date: 20180227

Owner name: SUZHOU NOVARTIS PHARMA TECHNOLOGY CO., LTD., CHINA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:CUI, KAI;KONG, WEIYONG;SIGNING DATES FROM 20180227 TO 20180228;REEL/FRAME:051354/0666

Owner name: NOVARTIS AG, SWITZERLAND

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:SUZHOU NOVARTIS PHARMA TECHNOLOGY CO., LTD.;REEL/FRAME:051354/0724

Effective date: 20180228

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STCF Information on status: patent grant

Free format text: PATENTED CASE

FEPP Fee payment procedure

Free format text: MAINTENANCE FEE REMINDER MAILED (ORIGINAL EVENT CODE: REM.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY

LAPS Lapse for failure to pay maintenance fees

Free format text: PATENT EXPIRED FOR FAILURE TO PAY MAINTENANCE FEES (ORIGINAL EVENT CODE: EXP.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY

FP Lapsed due to failure to pay maintenance fee

Effective date: 20250302