UA125168C2 - Insecticidal polypeptides having improved activity spectrum and uses thereof - Google Patents

Abstract

The disclosure provides nucleic acids, and variants and fragments thereof, derived from strains of Bacillus thuringiensis encoding variant polypeptides having increased pesticidal activity against insect pests, including Lepidoptera and Coleopteran. Particular embodiments of the disclosure provide isolated nucleic acids encoding pesticidal proteins, pesticidal compositions, DNA constructs, and transformed microorganisms and plants comprising a nucleic acid of the embodiments. These compositions find use in methods for controlling pests, especially plant pests.

Description

LINK TO THE SEQUENCE LISTING PRESENTED IN THE ELECTRONIC

APPEARANCES

The list of sequences with the file name "5409UMORST 5edyepse| iziiipd. ih", which was created on September 24, 2015 and is 267 kilobytes in size, is provided in machine-readable form at the same time as this description. The sequence listing forms part of this specification and is incorporated herein by reference in its entirety.

FIELD OF THE INVENTION

The present disclosure relates to recombinant nucleic acids that encode pesticidal polypeptides having insecticidal activity against corn borer and/or grass borer and/or an improved spectrum of pesticidal activity against insect pests. The compositions and methods of the present disclosure use the disclosed nucleic acids and the pesticidal polypeptides encoded by them to control plant pests.

BACKGROUND OF THE INVENTION

Insect pests are a major cause of damage to agricultural crops worldwide. For example, bollworm feeding, epsilon bollworm damage, or corn borer damage can be economically devastating to agricultural producers. Insect pest damage caused by corn borer attacks on field and sweet corn alone has reached approximately one billion dollars per year in damage losses and control costs.

Traditionally, the main method of influencing the population of pest insects is the use of broad-spectrum chemical insecticides. However, consumers and government regulators are increasingly concerned about the risk of adverse environmental impacts associated with the production and use of synthetic chemical pesticides. As a result of such concerns, state regulatory bodies have banned or restricted the use of some of the more dangerous pesticides. Thus, the development of alternative pesticides is of considerable interest.

Biological control of agriculturally important insect pests using a microbial agent such as fungi, bacteria, or other insect species is an environmentally friendly and commercially attractive alternative to synthetic chemical pesticides. In general, we can say that the application

Biopesticides pose less risk of contamination and adverse environmental effects, and biopesticides provide greater target specificity than traditional broad-spectrum chemical insecticides. In addition, the production of biopesticides is often cheaper, and as a result, the cost-effective yield of products for a wide range of agricultural crops is improved.

Certain types of microorganisms from the genus Vasiyish5 are known to have pesticidal activity against a wide range of insect pests, including I. Vasiyy5 IPpygipdieepbziz (VO and Vasyyyy5 rariae belong to the most successful means of biological control discovered today. Pathogenicity against insects was also attributed to the strains of V. Iaguaye, V. Iepiytogriv5, V. 5rpayetsy5 (Nagmook, ey., (1989) Vasiyyiv5 (Riepit Rgevv5) , 306), and V. segeiz (M/O 96/10083). As it turned out, pesticidal activity is concentrated in parasporal crystalline protein inclusions, although pesticidal proteins were also isolated from

Vasiya5 in the vegetative stage of growth. Several genes encoding these pesticidal proteins have been isolated and characterized (see, for example, US Patent Nos. 5,366,892 and 5,840,868).

Microbial insecticides, in particular those derived from Vasiy5 strains, play an important role in agriculture as an alternative to chemical pest control. Recently, agricultural scientists have created crop plants with improved resistance to insects by genetically engineering the crop plants to produce pesticidal proteins derived from Vasiy5. For example, maize and cotton plants have been genetically engineered to produce pesticidal proteins isolated from VI strains (see, for example, Agopzop (2002) Sei! Moi. I besi. 59(3):417-425; ZeNperi evi ah!. (1998)

Mystorio! My! Vio! Neu. 62(3):775-806). These genetically engineered crops are now widely used in American agriculture and provide the farmer with an environmentally friendly alternative to traditional insect control. In addition, potato varieties genetically engineered to contain the pesticide Stgu toxins have been marketed by American farmers. Although they have been found to be very commercially successful, these genetically engineered insect-resistant crops provide resistance to only a narrow range of economically important insect pests.

Accordingly, there remains a need for new Vi toxins with an improved spectrum of insecticidal activity against insect pests, for example, toxins with improved activity against insects from the I series Eridoriega and/or SoiIoriega. In addition, there remains a need for biopesticides that have activity against a number of insect pests and for biopesticides that have improved insecticidal activity.

BRIEF DESCRIPTION OF THE INVENTION

Compositions and methods for impacting insect pests are provided. More specifically, embodiments of this disclosure relate to methods of targeting insects using nucleotide sequences encoding insecticidal peptides to produce transformed microorganisms and plants that express an insecticidal polypeptide, according to embodiments. In some embodiments, nucleotide sequences encode polypeptides that are pesticidal to at least one insect that belongs to the order I eridoriega.

In some aspects, nucleic acid molecules and fragments and variants thereof are provided that encode polypeptides having pesticidal activity against insect pests (eg, 5EO IU MO: 4, 5BEO 10 MO: 6, 5EO IU MO: 8, 5EO IU MO: 10, 5EO I MO: 12, 5EO I

MO: 14, 5EO AND MO: 16, 5EO IYUO MO: 18, 5EO IYUO MO: 20, 5EO I MO: 22, 5EO IO MO: 24, 5EO I

MO: 26.5EO IYU MO: 28.5EO IYUO MO: 30.5EO IO MO: 32.5EO IYU MO: 34.5BO I MO: 36.5EO I

MO: 38, 5EO I MO: 40, 5EO IO MO: 42, 5BEO IO MO: 44, and 5BO IUO MO: 46, which encode a polypeptide from FEO IU MO: Z, 5EO IUO MO: 5, 5EO IUO MO: 7, 5EO IO MO: 9, 5EO IYUO MO: 11, 5EO IU

MO: 13, 5EO IO MO: 15, BO IYUO MO: 17, 5EO IO MO: 19, 5EO I MO: 21, 5BEO IO MO: 23, 5EO I

MO: 25.5EO I MO: 27.5EO IYUO MO: 29.5EO IO MO: 31.5EO IYU MO: 33.5BO I MO: 35.5EO I

MO: 37, 5EBO IJU MO: 39, 5BO AND MO: 41, 5BO IO MO: 43 or 5EBO IJU MO: 45, respectively).

A wild-type (e.g., naturally occurring) nucleotide sequence, according to embodiments, that was derived from Vi encodes an insecticidal peptide. Embodiments additionally provide for fragments and variants of the disclosed nucleotide sequence that encode biologically active (for example, insecticidal) polypeptides.

In another aspect, variant Cgu1!B polypeptides encoded by a modified (for example, subjected to mutagenesis or manipulation) nucleic acid molecule are provided in accordance with the variants of implementation. In specific examples, pesticidal proteins according to embodiments include fragments of full-length proteins and polypeptides derived from mutagenized nucleic acids designed to introduce specific amino acid sequences into polypeptides according to embodiments. In specific embodiments, the polypeptides have enhanced pesticidal activity compared to the activity of the naturally occurring polypeptide from which they are derived.

In another aspect, nucleic acids according to embodiments can also be used to produce transgenic (eg, transformed) monocotyledonous or dicotyledonous plants characterized by genomes containing at least one stably integrated nucleotide construct that comprises a coding sequence according to embodiments functionally related to associated with a promoter that controls the expression of the encoded pesticide polypeptide. Accordingly, transformed plant cells, plant tissues, plants and their seeds are also contemplated.

In another aspect, a transformed plant can be obtained using a nucleic acid that has been optimized for increased expression in the host plant. For example, one of the pesticidal polypeptides according to the variants of implementation can be reproduced according to the polypeptide sequence to obtain a nucleic acid containing codons optimized for expression in a particular host, for example in a cultivated plant, such as a corn plant (7ea tauz). Expression of the coding sequence by such a transformed plant (eg, dicotyledonous or monocotyledonous) will result in the production of a pesticidal polypeptide and confer increased resistance to insects in the plant.

Some embodiments provide for transgenic plants expressing pesticide polypeptides that are used in methods of impacting various insect pests.

In another aspect, pesticidal or insecticidal compositions containing variant Stu!B polypeptides according to embodiments are provided, and the compositions may optionally contain additional insecticidal peptides. Embodiments include the application of such compositions to the insect pest habitat to affect the insect pest.

BRIEF DESCRIPTION OF GRAPHIC MATERIALS

Figure 19 shows the alignment of the amino acid sequences of Stui!Va (ZEO I

MO: 1), IRIV-VT (ZEO IU MO: 3), IRIV-B21 (Z5EO IU MO: 5), IRIV-B22 (5EO IO MO: 7), IRIV-V2Z3 (ZEO IU MO: 9), IRTV -B24 (5EO IU MO: 11), IR1IV-B25 (ZEO IO MO: 13), IR1IV-B26 (5EO I MO: 15), 60 IRTV-B27 (ZEO IO MO: 17), IRITV-B28 (ZEO IO MO: 19), IRIV-B29 (5EO IU MO: 21), IRIV-B31 (ZEO

IO MO: 23), IRIV-B32 (5EO IO MO: 25), IRIV-B33 (5EO IU MO: 27), IRIV-B834 (5EO IO MO: 29),

IRTV-8B40 (ZEO IU MO: 31), IRITV-B41 (5EO I MO: 33), IR1TV-B42 (ZEO IU MO: 35), IR1IV-B43 (5EO

IO MO: 37), IRIV-B44 (5EO IO MO: 39), IRIV-B45 (5EO IIU MO: 41), IRIV-B46 (ZEO IO MO: 43),

IRTV-847 (5EO 10 MO: 45), MP258 (ZEO IO MO: 47), and 5060 (5EO IO MO: 49). using the AGISMHF module of the Mesiog MT software package. The difference in amino acid sequences between Sgu18B polypeptides is highlighted.

Figures 2a - 2e show the amino acid sequence of MP258 with the leader region (), domain I (Ж), domain II (8) and domain II (), marked below the sequence.

Figure C shows the alignment of amino acid sequences using the module

ACIOMHO software package Mesiog MTF domain I Stu!Be-type Sgu1Be (amino acids 35-276 of

ZEO IO MO: 58) and domain I Stu!Be-type MP258 (amino acids 36-276 from BEO IJO MO: 47). The difference of amino acid sequences in domains I of Sgu1B polypeptides was highlighted.

Figure 4 shows the alignment of the amino acid sequences of the PP StutAi domain (5EO

IO MO: 61), StuiVa, Stui1vy (5EO I MO: 52), Stui1 Vi (ZEO I MO: 54), and MP258 (5EO IIU MO: 47) using the AGIOMHF module of the Messiog MTF software package. The difference of amino acid sequences in domain II of Stgu1B polypeptides was identified.

Figures 5a - 5c show the alignment of the amino acid sequences of the | domain and HER domain

MP258 (ZEO IO MO: 47), StuiVe (ZEO IO MO: 58), Stu1Vi (5EO IO MO: 54), Stu!B9 (5EO IO MO: 60), Stui VG (ZEO I MO: 59), Stu! Va (5EO IU MO: 55), Stu!Vy (ZEO IU MO: 52), Stut1Va (5EO I

MO: 1), Stu!Vb (ZEO IO MO: 56), and Stu1Vs (Z5EO IO MO: 57) using the AGIOMHF module of the Mesiog MTIF package. The difference between the amino acid sequences in domain I and domain IH of the Stgu1B polypeptides was highlighted.

DETAILED DESCRIPTION

Embodiments of this disclosure are directed to compositions and methods for impacting insect pests, particularly plant pests. More specifically, the isolated nucleic acid according to embodiments, as well as fragments and variants thereof, contain nucleotide sequences that encode pesticidal polypeptides (eg, proteins). Pesticide proteins revealed

Are biologically active (eg, pesticidal) against insect pests, such as, but not limited to, Eridoriega and/or SoiIoriega.

Compositions according to the variants of implementation provide isolated nucleic acids, as well as their fragments and variants that encode pesticide polypeptides, expression cassettes containing nucleotide sequences according to the variants of implementation, isolated pesticide proteins and pesticide compositions. Some embodiments provide modified pesticidal polypeptides having improved insecticidal activity against Lepidoptera compared to the pesticidal activity of the corresponding wild-type protein. Embodiments further provide plants and microorganisms transformed with these novel nucleic acids, and methods involving the use of such nucleic acids, pesticidal compositions, transformed organisms, and products thereof in targeting insect pests.

Nucleic acids and nucleotide sequences according to embodiments can be used to transform any organism to produce the pesticidal proteins encoded by them. Methods are provided that involve the use of such transformed organisms to affect or control plant pests. Nucleic acids and nucleotide sequences according to 3 variants of implementation can also be used for the transformation of organelles, such as chloroplasts (MeViide et al. (1995)

Journal of Journal 13: 362-365; and Koia vii a!. (1999) Rhos. Mai). Asad 5 BOTH 96: 1840-1845).

In addition, embodiments relate to the identification of naturally occurring fragments and variants of the coding sequence that encode biologically active pesticidal proteins. Nucleotide sequences according to variants of implementation are directly used in methods of impact on pests, especially on insect pests, such as pests from the I series of eridoriega. Accordingly, the implementation options provide for new approaches to the impact on insect pests that do not depend on the use of traditional synthetic chemical insecticides. Implementation options involve the detection of naturally occurring biodegradable pesticides and the genes that encode them.

Embodiments further provide fragments and variants of the coding sequence found in nature, which also encode biologically active (eg, pesticidal) polypeptides. Nucleic acids according to variants of implementation include nucleic acid sequences or nucleotide sequences that have been optimized for expression by cells of a particular organism, for example, nucleic acid sequences 60 that have been reproduced from a polypeptide sequence (ie subjected to

"reverse translation") using codons preferred by plants, based on the amino acid sequence of a polypeptide with enhanced pesticidal activity. Embodiments further provide for mutations that provide improved or altered properties to the polypeptides according to the embodiments. see, for example, US Pat. No. 7,462,760.

In the following description, a number of expressions are widely used. The following definitions are presented to facilitate understanding of the embodiments.

Units, prefixes, and designations can be designated in the form adopted in the SI system. Unless otherwise indicated, nucleic acids are written from left to right in a 5' to 3" orientation; amino acid sequences are written, respectively, from left to right in the direction from the amino group to the carboxy group. The range of numerical values includes numbers defining the range.

Amino acids in this document can be named either by their commonly known three-letter designations, or by one-letter designations recommended by the commission on biochemical nomenclature ISRAS-IOV. Nucleotides can similarly be named by their generally accepted one-letter codes. The above expressions are more fully defined with reference to the present invention in general.

As used herein, "nucleic acid" includes reference to a deoxyribonucleotide or ribonucleotide polymer in either single- or double-stranded form and, unless otherwise limited, includes known analogs (e.g., peptido-nucleic acids) having essential properties of natural nucleotides, which consist in the fact that they hybridize with single-stranded nucleic acids in a similar way to naturally occurring nucleotides.

As used herein, the terms "encoding" or "encoded" when used in the context of a particular nucleic acid mean that the nucleic acid contains the necessary information to direct the translation of a nucleotide sequence to produce a particular protein. The information that encodes a protein is determined by the use of codons. Nucleic acid encoding a protein may contain non-translated sequences (eg, introns) within regions of the nucleic acid that are translated or may not contain such intervening non-translated sequences (eg, as in cDNA).

As used herein, the expression "full-length sequence" in relation to a particular polynucleotide or protein encoded by it means the presence of a complete nucleic acid sequence or a complete amino acid sequence of a native (non-synthetic) endogenous sequence. A full-length polynucleotide encodes the full-length catalytically active form of a particular protein.

As used herein, the term "antisense" when used in the context of the orientation of a nucleotide sequence refers to a duplex polynucleotide sequence that is functionally linked to the promoter in the orientation in which the antisense strand is transcribed.

The antisense strand is largely complementary to the endogenous transcription product, so that translation of the endogenous transcription product is often repressed. Thus, in cases where the expression "antisense" is used in the context of a specific nucleotide sequence, the expression refers to the complementary strand of the reference transcription product.

The terms "polypeptide", "peptide" and "protein" are used interchangeably in this document to denote a polymer of amino acid residues. The terms are used to refer to amino acid polymers in which one or more amino acid residues are an artificial chemical analogue of the corresponding naturally occurring amino acid , as well as regarding amino acid polymers found in natural conditions.

The terms "residue," or "amino acid residue," or "amino acid" are used interchangeably herein to refer to an amino acid that is embedded in a protein, polypeptide, or peptide (collectively, "protein"). An amino acid may be a naturally occurring amino acid and, unless otherwise limited, may include known analogs of naturally occurring amino acids that may function similarly to naturally occurring amino acids.

Polypeptides according to variants of implementation can be obtained either from the nucleic acid disclosed herein or using standard molecular biology techniques. For example, a protein according to embodiments can be obtained by expressing a recombinant nucleic acid according to embodiments in a suitable host cell or, alternatively, using a combination of ex mimo procedures.

As used herein, the terms "isolated" and "purified" are used interchangeably and refer to nucleic acids, or polypeptides, or biologically active portions thereof, that are substantially or essentially free of components that normally accompany or interact with the nucleic acid or polypeptide. , when they are in the natural environment.

Thus, the isolated or purified nucleic acid or polypeptide is practically free of other cellular material or culture medium when obtained by recombinant techniques or practically free of chemical precursors or other chemical products if synthesized chemically. An "isolated" nucleic acid typically does not contain sequences (such as, for example, protein-coding sequences) that naturally flank the nucleic acid (ie, sequences located at the 5' and 3' ends of the nucleic acid) in the genomic DNA of the organism, with from which the nucleic acid was obtained. For example, in various embodiments, the isolated nucleic acids may contain less than about 5 cc, 4 cc, 2 cc, 2 cc, 1 cc, 0.5 cc . or 0.1 t.o. nucleotide sequences that under natural conditions flank nucleic acids in the genomic DNA of the cell from which the nucleic acid was obtained.

As used herein, the terms "isolated" or "purified" when used in reference to a polypeptide according to embodiments mean that the isolated protein is substantially free of cellular material and includes protein preparations containing less than about 3095, 2095, 1095 or 595 (by dry weight) of contaminating protein.

If the protein according to embodiments, or a biologically active portion thereof, is produced by recombinant DNA techniques, then the culture medium contains less than about 3095, 2095, 1095, or 595 (by dry weight) chemical precursors or chemical products that are not protein, which is interest. "Recombinant" nucleic acid (or DNA) molecule is used herein to refer to a nucleic acid (or DNA) sequence found in a recombinant bacterial or plant host cell. In some embodiments, the "isolated" or "recombinant" nucleic acid does not contain sequences (preferably protein-coding sequences) that naturally flank the nucleic acid (ie, sequences located at the 5'- and 3-ends of the nucleic acid) in the genomic DNA of the organism from which the nucleic acid was obtained. In the context of this disclosure, the terms "isolated" or "recombinant" when used to refer to nucleic acid molecules exclude isolated chromosomes.

As used herein, "non-genomic nucleic acid sequence" or "non-genomic nucleic acid molecule" refers to a nucleic acid molecule that has one or more changes in the nucleic acid sequence compared to the native or genomic nucleic acid sequence. In some embodiments, a change to a native or genomic nucleic acid molecule includes, without limitation: changes in the nucleic acid sequence due to the degeneracy of the genetic code; codon optimization of the nucleic acid sequence for expression in plants; changes in the nucleic acid sequence to introduce at least one amino acid substitution, insertion, deletion and/or addition compared to the native or genomic sequence; deletion of one or more introns associated with the genomic nucleic acid sequence; insertion of one or more heterologous introns; deletion of one or more regulatory sites, located above or below, associated with the genomic sequence of the nucleic acid; insertion of one or more heterologous regulatory sites located above or below; deletion of the 5'- and/or 3'-nsetranslated region associated with the genomic sequence of the nucleic acid; insertion of a heterologous 5- and/or 3- untranslated site and modification of the polyadenylation site. In some embodiments, the nucleic acid molecule, which differs from the genomic one, is cDNA. In some embodiments, the non-genomic nucleic acid molecule is a synthetic nucleic acid sequence.

It will be understood that throughout the application the expression "containing" or variants such as "comprising" or "which

BO contains", implies the inclusion of the given element, integer, or stage, or group of elements, integers, or stages, and not the exclusion of any other element, integer, or stage, or group of elements, integers, or stages.

As used herein, the expression "effect on insect pests" refers to making changes in the nutrition, growth and/or behavior of an insect at any stage of development, including without limitation the destruction of an insect; growth retardation; preventing the emergence of reproductive capacity; antifeedant activity, etc.

As used herein, the terms "pesticidal activity" and "insecticidal activity" are used interchangeably and refer to the activity of an organism or substance (such as, for example, a protein) that can be measured by, but not limited to, pest mortality, pest weight loss, deterrence of the pest and other changes in behavior and physical characteristics of the pest after feeding and exposure during the relevant time period. Thus, an organism or substance with pesticidal activity has a negative effect on at least one measurable parameter of pest fitness. For example, "pesticidal proteins" are proteins that exhibit pesticidal activity alone or in combination with other proteins.

As used herein, the term "pesticidally effective amount" means the amount of a substance or organism that has pesticidal activity when present in the pest's habitat. For each substance or organism, the pesticidally effective amount is determined empirically for each pest that is affected in a specific environment. Similarly, "Insecticidally effective amount" can be used to refer to "pesticidally effective amount" if the pest is an insect pest.

As used herein, the terms "recombinantly engineered" or "engineered" refer to the use of recombinant DNA technology to introduce (eg, during engineering) a change in protein structure based on an understanding of the protein's mechanism of action and analysis of the amino acids that are introduced, deleted, or replaced.

As used herein, the terms "mutant nucleotide sequence", or "mutation", or "mutagenic nucleotide sequence" mean a nucleotide sequence that has been mutagenized or altered so that it contains one or more nucleotide residues (eg, a base pair ), which are not present in the corresponding wild-type sequence. Such mutagenesis or change consists of one or more additions, deletions, or substitutions or substitutions of nucleic acid residues. If mutations are created by addition, deletion, or substitution of an amino acid at a proteolytic cleavage site, such addition, deletion, or substitution may be present within or adjacent to the proteolytic site motif provided the purpose of the mutation is achieved (ie, subject to altered proteolysis at the site).

A mutant nucleotide sequence can encode a mutant insecticidal toxin that exhibits improved or reduced insecticidal activity, or an amino acid sequence that provides improved or reduced insecticidal activity to a polypeptide that contains it.

As used herein, the terms "mutant" or "mutation" in the context of a protein, polypeptide, or amino acid sequence refer to a sequence that has been mutagenized or altered to contain one or more amino acid residues that are not present in the corresponding wild-type sequence. Such mutagenesis or change consists of one or more additions, deletions, or substitutions or substitutions of amino acid residues. The mutant polypeptide exhibits improved or reduced insecticidal activity or is an amino acid sequence that provides improved insecticidal activity to the polypeptide containing it. Thus, the terms "mutant" or "mutation" refer to either or both of the mutant nucleotide sequence and the amino acids encoded by it. The mutants may be used alone or in any compatible combination with other mutants according to embodiments or with other mutants. "Mutant polypeptide", on the contrary, can show a decrease in insecticidal activity. In the event that more than one mutation is added to a particular nucleic acid or protein, the mutations may be added simultaneously or sequentially; if sequential, mutations can be added in any suitable order.

As used herein, the terms "enhanced insecticidal activity" or "enhanced pesticidal activity" refer to an insecticidal polypeptide according to embodiments that has enhanced insecticidal activity compared to that of its corresponding wild-type protein, and/or an insecticidal polypeptide effective against a broader spectrum of insects , and/or an insecticidal polypeptide, which is characterized by specificity for an insect that is not sensitive to the toxicity of the wild-type protein. A finding of improved or enhanced pesticidal activity requires demonstration of an increase in pesticidal activity of at least 1095 against the target insect or an increase in pesticidal activity of at least 2095, 25965, 3095, 3595, 4095, 4595, 5095, 6095, 7095, 10095, 15095, 20095, or 30,095 or more compared to the pesticidal activity of the wild-type insecticidal polypeptide determined against the same insect.

For example, improved pesticidal or insecticidal activity is provided in cases where the polypeptide exerts an effect on a wider or a narrower spectrum of insects compared to the spectrum of insects affected by the wild-type Vi toxin. A broader spectrum of action may be desirable where versatility is required, while a narrower spectrum of action may be desirable where, for example, beneficial insects may otherwise be affected during application or in the presence of the toxin. Although the implementation options are not related to any specific mechanism of action, improved pesticidal activity can also be provided by changes in one or more characteristics of the polypeptide; for example, the stability or lifetime of the polypeptide in the insect gut may be increased compared to the stability or lifetime of the corresponding wild-type protein.

As used herein, the term "toxin" refers to a polypeptide that exhibits pesticidal activity, or insecticidal activity, or improved pesticidal activity, or improved insecticidal activity. The toxin "Vi" or "Vasiyi5 (Shippdiepvib)" is believed to include a broader class of Sgu-toxins found in different strains of Vi, which includes toxins such as Stu15, Stu25 or Stuzv.

The terms "proteolytic cleavage site" or "cleavage site" refer to an amino acid sequence that confers sensitivity to a class of proteases or a particular protease such that a polypeptide containing that amino acid sequence is cleaved by a class of proteases or a particular protease. A proteolytic cleavage site is considered "sensitive" to the protease(s) that recognize(s) this site. It is known in the art that cleavage efficiency will vary and that a reduction in cleavage efficiency may result in increased stability or longevity of the polypeptide in the insect gut. Thus, a proteolytic site may confer sensitivity to more than one protease or class of proteases, but the efficiency of cleavage at that site may vary among different proteases. Proteolytic cleavage sites include, for example, trypsin sites, chymotrypsin sites, and elastase sites.

The study showed that the intestinal proteases of the Lepidopteran insect include trypsins, chymotrypsins and elastases. see, for example, І еп2 ейі ай. (1991) Agsp. Ipsesi

Viospet. Rpuzioi 16: 201-212; and Nededivz her ai. (2003) Agsp. Ipsesi Viospet. RPuzioi. 53: 30-47.

For example, approximately 18 different trypsins have been identified in the larval midgut of Neisomegra aptidega (see, zaiepoize eyi ai. (1997) Ipsesi Biospet. Moi. BioI. 27: 929-944). The preferred substrate sites for proteolytic cleavage by these proteases were investigated. see, for example; Regegsop evi ai. (1995) Ipsesi Viospet. Mo)/. Vio!. 25: 765-774.

Attempts were made to understand the mechanism of action of Vi-toxins and to construct toxins from

With improved properties. It has been shown that insect gut proteases can influence the action of Sgu-Vi proteins on the insect. Some proteases activate Sgu proteins by processing them from a "protoxin" form to a toxic form or "toxin." See Orreti (1999) Agep. Ipsesi Viospet.

Rpuv 42: 1-12; and Saitoi! her a. (1997) 9. Iplmepergaiye Raipoiodu 70: 41-49. This activation of the toxin may involve the removal of M- and C-terminal peptides from the protein and may also involve internal cleavage of the protein. Other proteases can degrade Sgu proteins. See Orregi, ibid.

Comparison of amino acid sequences of Sgu toxins with different specificity revealed five highly conserved blocks of sequences. From a structural point of view, toxins contain three distinct domains, which are from the M- to the C-terminus: a cluster of seven alpha helices involved in the formation of the pore (called "domain I"), three antiparallel beta sheets involved in binding with a cell (called "domain 2") and a beta-sandwich (called "domain 3. The location and properties of these domains are known to a person skilled in the art. see, for example, Guy et al. (1991) Mashtie, 305: 815-821 and Mogze et al. (2001) Bigisyge, 9:409-417.When a specific domain, such as domain I, is mentioned, it should be understood that the exact final characteristics of the domain with respect to a particular sequence are not critical provided that the sequence or its portion includes a sequence that provides at least any function ascribed to a particular domain Thus, for example, when referring to an "I domain" it is assumed that the particular sequence includes a cluster of seven alpha helices, but the exact endpoints of the sequence used or memory related to this cluster are not decisive. One skilled in the art is familiar with the determination of such endpoints and the evaluation of such functions.

In an attempt to improve Sgtu2B toxins, an attempt was made to identify nucleotide sequences encoding crystal proteins from selected strains that have improved activity compared to the native toxin. Depending on the characteristics of this drug, it is believed that in order to demonstrate pesticidal activity, pre-treatment with trypsin is sometimes required to activate the pesticidal proteins. Thus, it is clear that some pesticidal proteins require protease cleavage for activation (eg, trypsin, chymotrypsin, etc.), while other proteins are biologically active (eg, pesticidal) in the absence of activation.

Such molecules can be modified by means described, for example, in U.S. Pat

Mo 7462760. In addition, nucleic acid sequences can be engineered so that they encode polypeptides that contain additional mutations that provide improved or altered pesticidal activity compared to the naturally occurring pesticidal activity of the polypeptide. Nucleotide sequences of such engineered nucleic acids contain mutations that are not found in wild-type sequences.

Mutant polypeptides according to variants of implementation are usually obtained using a method that includes the steps of: obtaining a nucleic acid sequence encoding a polypeptide of the Stgu family; analysis of the structure of the polypeptide to identify certain "target" sites for mutagenesis of the underlying gene sequence, based on ideas about the likely function of the target domain and the mechanism of action of the toxin; introduction of one or more mutations in the nucleic acid sequence to produce the required change in one or more amino acid residues of the encoded polypeptide sequence and analysis of the resulting polypeptide for pesticidal activity.

Many insecticidal B-toxins are related with varying degrees of similarity in their amino acid sequences and tertiary structure, and the means for obtaining crystal structures of B-toxins are well known. Illustrative results of high-resolution crystal structure calculations for both StuzA and StuzB polypeptides are available in the literature. The calculated structure of StuZzZA (Gi ei aiYi. (1991) Maishtge 353:815-821) provides an understanding of the relationship between the structure and function of the toxin. A joint review of published structural analyzes of Vi toxins and the described function associated with specific structures, motifs, etc., indicates that specific regions of the toxin correlate with specific functions and individual stages of the protein's mechanism of action. For example, many toxins isolated from Vi are commonly described as containing three domains: a seven-helix bundle involved in pore formation, a three-sheet domain involved in receptor binding, and a beta-sandwich motif ( (1991) Maishtsge 305: 815-821).

As described in US patents Mo 7,105,332 and Mo 7,462,760, the toxicity of Stu proteins can be improved by targeting the region between alpha helices C and 4 in domain I of the toxin. This theory is based on a body of knowledge related to insecticidal toxins, including: 1) that alpha helices 4 and 5 in domain | StuZA toxins were reported to be incorporated into the lipid bilayer of cells lining the midgut of sensitive insects (Sa?ii ei aiI. (1998) Rgos. Mai). Asad si. OBA 95: 12289-12294); 2) on knowledge

From the authors of this invention about the location of cleavage sites by trypsin and chymotrypsin in the amino acid sequence of the wild-type protein; 3) on the observation that the wild-type protein was more active against certain insects after activation of ip migo during treatment with trypsin or chymotrypsin; and 4) reports that cleavage of toxins from the 3'-end resulted in reduced toxicity to insects.

A number of mutations can be created and placed in different background sequences to create new polypeptides with enhanced or altered pesticidal activity. See, for example, Pat

US Mo. 7462760. These mutants include, without limitation: the addition of at least one additional protease-sensitive site (eg, a trypsin cleavage site) in the region located between helices C and 4 in domain I; replacement of the original protease-sensitive site in the wild-type sequence with a different protease-sensitive site; addition of several protease-sensitive sites in a specific position; addition of amino acid residues adjacent to the protease-sensitive site(s) to alter polypeptide folding and thereby enhance cleavage of the polypeptide at the protease-sensitive site(s); and adding mutations to protect the polypeptide from destructive cleavage that reduce toxicity (eg, creating a series of mutations in which a wild-type amino acid is replaced with valine to protect the polypeptide from cleavage). Mutations can be used alone or in any combination to provide polypeptides according to embodiments.

Homologous sequences were identified using a similarity search in the non-redundant (n) database of the National Center for Biotechnology Information (NCBI) using

VGABT and RBI-VIA5BT. Homologous proteins consisted of Stgu-toxins mainly from Vasya5

Iipdiepviv.

A mutation that represents an additional or alternative protease-sensitive site may be sensitive to several classes of proteases, such as serine proteases, which include trypsin and chymotrypsin, or enzymes such as elastase. Thus, a mutation that represents an additional or alternative protease-sensitive site can be engineered so that the site is readily recognized and/or cleaved by a class of proteases, such as mammalian proteases or insect proteases. A protease-sensitive site can also be engineered in such a way that , so that it is cleaved by a specific class of enzymes or by a specific enzyme known to be produced in the body, such as, for example, chymotrypsin produced by the corn borer NeiYoipi5 2ea (I ep2 yei a. (1991) Agsp. Inzesi Viospet. Rpuzvio ).16: 201-212.) Mutations can also confer resistance to proteolytic cleavage, such as chymotrypsin cleavage at the C-terminus of the peptide.

The presence of an additional and/or alternative protease-sensitive site in the amino acid sequence of the encoded polypeptide may improve the pesticidal activity and/or specificity of the polypeptide encoded by the nucleic acids according to embodiments. Accordingly, the nucleotide sequences according to embodiments may be recombinantly engineered or can be manipulated to produce polypeptides with improved or altered insecticidal activity and/or specificity compared to that of the unmodified wild-type toxin.In addition, the mutations disclosed herein can be placed in other nucleotide sequences or used in combination with by them to provide improved properties.For example, a protease-sensitive site that is easily cleaved by insect chymotrypsin, such as the chymotrypsin found in Burt's weevil or corn borer (Nededivz et al. (2003) Agsp.

Ipsesi Viospet. Rpuzioi!. 53: 30-47; and I ep eyi ai. (1991) Agsn. Inzesi Viospet. RNuvioi. 16: 201-212), can be placed in the background sequence of Stu to provide improved toxicity of this sequence. Thus, embodiments provide for toxic polypeptides with improved properties.

For example, a mutagenized Stu nucleotide sequence may provide additional mutants containing additional codons that introduce a second trypsin-sensitive amino acid sequence (in addition to the naturally occurring trypsin site) into the encoded polypeptide. An alternative additional mutant according to embodiments provides additional codons designed to introduce at least one additional distinct protease-sensitive site into the polypeptide, for example, a chymotrypsin-sensitive site located immediately 5 or 3 from the naturally occurring trypsin site. Alternatively, substitution mutants can be generated in which at least one nucleic acid codon that encodes a naturally occurring protease-sensitive site is disrupted and alternative codons are introduced into the nucleic acid sequence to provide a different (eg, substituted)

From a protease-sensitive site. A substitution mutant can also be added to the sequence

A strand in which the naturally occurring trypsin cleavage site present in the encoded polypeptide has been destroyed and a chymotrypsin or elastase cleavage site inserted in its place.

Any nucleotide sequence encoding amino acid sequences that are proteolytic cleavage sites or putative proteolytic cleavage sites (e.g., sequences such as CC or

HCM), and that the exact identity of the codons used to introduce any of these cleavage sites into the variant polypeptide may vary depending on the application, i.e. expression in a particular plant species. It is also believed that any of the disclosed mutations can be introduced into any polynucleotide sequence in embodiments that contains codons for amino acid residues that provide a native cleavage site for trypsin that is targeted by the modification. Accordingly, variants of either full-length toxins or fragments thereof may be modified to contain additional or alternative cleavage sites, and such embodiments are intended to be encompassed by the scope of the embodiments disclosed herein.

One skilled in the art will appreciate that any useful mutation can be added to the sequences according to the embodiments, provided that the encoded polypeptides retain pesticidal activity. Thus, the sequences can also be mutagenized so that the encoded polypeptides are resistant to proteolytic cleavage by chymotrypsin. More than one recognition site can be added at a particular position in any combination, and multiple recognition sites can be added to or removed from the toxin. Thus, additional mutations may contain three, four, or more recognition sites. It should be understood that multiple mutations can be engineered into any suitable polynucleotide sequence; accordingly, either full-length sequences or fragments thereof can be modified to contain additional or alternative cleavage sites and to be resistant to proteolytic cleavage. Thus, variants of implementation provide Sgu-toxins containing mutations that improve pesticidal activity, as well as improved compositions and methods of effecting pests using other Vi-toxins.

Mutations can protect a polypeptide from protease degradation, for example, by removing putative proteolytic cleavage sites, such as putative serine protease sites and recognition sites for elastase, from different regions. Some or all of these putative sites can be deleted or altered to reduce proteolysis at the site of origin. Changes in proteolysis can be assessed by comparing the mutant polypeptide with wild-type toxins or by comparing mutant toxins that differ in their amino acid sequence. Predicted proteolytic cleavage sites and proteolytic cleavage sites include, but are not limited to, the following sequences: CC, trypsin cleavage site; I KM, site for chymotrypsin; and a site for trypsin. These sites can be modified by adding or removing any number and type of amino acid residues, provided that the pesticidal activity of the polypeptide is increased. Therefore, polypeptides encoded by nucleotide sequences that contain mutations will contain at least one change or addition of amino acids compared to the native or background sequence or 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 35, 38, 40, 45, 47, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, or 280 or more changes or amino acid additions. The pesticidal activity of the polypeptide can also be improved by truncation of the native sequence or the full-length sequence, as is known in the art.

Compositions according to variants of implementation include nucleic acids, as well as fragments and variants thereof, which encode pesticidal polypeptides. In particular, the implementation options provide isolated nucleic acid molecules containing nucleotide sequences that encode the amino acid sequence of ЭО 10 MO: 3, 5EO AND MO: 5, 5EO AND MO: 7, 5EO IХО MO: 9,

ZEO IU MO: 11, 5EO I MO: 13, BO IYUO MO: 15, 5EO 10 MO: 17, 5EO IYUO MO: 19, 5EO IYUO MO: 21,

ZEO IO MO: 23, 5EO I MO: 25, 5EO IYUO MO: 27, 5EO IO MO: 29, 5EO IO MO: 31, 5EO IO MO: 33,

ZEO IO MO: 35, 5EO I MO: 37, 5EO IUO MO: 39, 5EO I MO: 41, 5EO IUO MO: 43 and 5EO IUO MO: 45, or nucleotide sequences that encode the specified amino acid sequence, for example a nucleotide sequence, presented in BEO 10 MO: 4, 5EO IU MO: 6, 5EO IU MO: 8, 5EO IU MO: 10, 5EO IU MO: 12, 5EO IYUO MO: 14, 5EO IU MO: 16, 5EO I MO: 18, 5EO IU MO: 20, 5EO IYU MO: 22, ZEO IYU MO: 24, 5EO IU MO: 26, 5EO IU MO: 28, 5EO IU MO: 30, 5EO IYUO MO: 32, 5EO IYU MO:

From 34, 5EO IYU MO: 36, 5BO IYU MO: 38, 5EO IYUO MO: 40, 5EO I MO: 42, 5EO IO MO: 44 or 5EO I

MO: 46, as well as their fragments and variants.

In particular, embodiments provide isolated nucleic acid molecules that encode the amino acid sequence shown in 5EO IU MO: 4 or 5EO IU MO: 8, or nucleotide sequences that encode the indicated amino acid sequence, for example, the nucleotide sequence set forth in BEO 10 MO: 4 . IU MO: 22, ZEO IU MO: 24, 5EO I MO: 26, 5EO IO MO: 28, 5BEO I MO: 30, 5EO IYUO MO: 32, 5EO IU MO: 34, 5EO IU MO: 36, 5EO I MO : 38, 5EO IU MO: 40, 5EO IUO MO: 42, 5EO IO MO: 44, and 5EO IU

MO: 46, as well as their fragments and variants.

Also of interest are optimized nucleotide sequences that encode pesticidal proteins according to embodiments. As used herein, the phrase "optimized nucleotide sequences" refers to nucleic acids that are optimized for expression in a particular organism, such as a plant. Optimized nucleotide sequences can be obtained for any organism of interest using methods known in the art. See, for example, US Patent No. 7,462,760, which describes an optimized nucleotide sequence encoding the disclosed pesticide protein. In this example, the nucleotide sequence was obtained by "back-translating" the amino acid sequence of the protein and changing the nucleotide sequence so that it contained codons preferred by maize while still encoding the same amino acid sequence. This procedure is described in more detail in Miggau ei a). (1989) Mysivis Acidv Vev5. 17:477-498.

The optimized nucleotide sequences find use in increasing the expression of a pesticidal protein in a plant, for example, in monocotyledonous plants of the family Roaceae, such as, for example, a maize or corn plant.

In some embodiments, polypeptides are provided that contain the amino acid sequence set forth in ES IJU MO: 3.5EO I MO: 5.5BO IJU MO: 7.5EO IJU MO: 9.5EO I

MO: 11, 5EO IU MO: 13, 5EO IU MO: 15, 5EO IU MO: 17, 5EO IUO MO: 19, 5EO IU MO: 21, 5EO IU

MO: 23.5EO IYU MO: 25.5EO IYU MO: 27.5EO IYUO MO: 29.5EO IYUO MO: 31.5EO IYU MO: 33.5EO IYU

MO: 35, 5EO IJU MO: 37, 5EO IO MO: 39, 5EO IJU MO: 41, 5EO IJU MO: 43 or 5EO IO MO: 45, as well as their fragments and variants.

In some embodiments, polypeptides are provided that contain the amino acid sequence set forth in ES IJU MO: 3.5EO I MO: 5.5BO IJU MO: 7.5EO IJU MO: 9.5EO I

MO: 11, 5EO IU MO: 13, 5EO IU MO: 15, 5EO IO MO: 17, 5EO IUO MO: 19, 5EO IU MO: 21, 5EO IU

MO: 31, 5EO IU MO: 33, 5EO IU MO: 35, 5EO IU MO: 37, 5EO IUO MO: 39, 5EO IU MO: 41, 5EO IU

MO: 43 or 5EO IO MO: 45, as well as their fragments and variants.

In some embodiments, polypeptides comprising the amino acid sequence set forth in 5EO IU MO: 23, BO 10 MO: 25, 5EO IO MO: 27 or 5EO IO MO: 29, as well as fragments and variants thereof, are contemplated.

In some embodiments, variant Stu!B polypeptides with an amino acid substitution compared to the corresponding reference Stu!B polypeptide are provided, having increased insecticidal activity against the corn borer and/or grass bollworm compared to the "corresponding reference Stu1B polypeptide". By "relevant reference Stu1B polypeptide" is meant a wild-type Stu!B polypeptide or a native or variant Stu1B polypeptide according to these embodiments, which can serve as an amino acid sequence that is subjected to mutagenesis to create a variant Stu!B polypeptide. In some embodiments, the corresponding Stu1!B reference polypeptide comprises a | domain Stgu1Ve-type and PI domain

StutAN type. By "Stu!Be-type domain" is meant an amino acid sequence that is at least 9095, at least 9195, at least 9295, at least 93965, at least 9495, at least 9595, at least 9695, at least 97965, at least 9895, at least 9995 or more identical to the sequence of amino acids 36-276 from BEO IYU MO: 58 (Stgu!Ve) or amino acids 35-276 from BEO IJUO MO: 47. Alignment of the amino acid sequence of domain I Stu!iVe (5EBEO IJUO MO: 58) and MP258 (5BO IU MO: 47) are shown in Figure 3. Similarly, other native Stu!B polypeptides can be aligned with Stu1iVe (ZEO IO MO: 58) and MP258 (Z5EO IO MO: 47) to identify other regions of the I domain of Stu !Ve-type.

By "Stutype PI domain" is meant an amino acid sequence that is at least 8096, at least 8195, at least 8295, at least 8395, at least 84965, at least 8595, at least 8695, at least 8795, at least 88595 , at least 8995, at least 9095, at least 9195, at least 92965 at least 9395 at least 9495, at least 9595 at least 96965, at least 9795, at least 9895, at least 9995 or more identical to the sequence of amino acids 483-643 of " EO IU MO: 61 (StutAi) or 494-655 from ZEO IU MO: 47.

Alignment of the amino acid sequence of the III domain StgutAi (5EO IYUO MO: 61), Stui1Va (ZEO IO

MO: 1), StuIVA (ZEO IO MO: 52), Stgu!Vi (ZEO IO MO: 54) and MP258 (5EO IU MO: 47) are shown in Figure 4. Similarly, other native Stgu!B polypeptides can be aligned with StutAi ( ZEO IU MO: 61), Stut1va, StuiVy (ZEO IU MO: 52), Stgui1Vi (ZEO IU MO: 54) and/or MP258 (ZEO IU MO: 47) to identify other StutI-type domain I regions. In some in variants of implementation, the corresponding reference polypeptide Sgu1B contains domain I and domain II of the Stu!Va type. Under "domain I and domain II

Stu!iVa--type mean an amino acid sequence that is at least 7095, at least 7195, at least 7295, at least 7395, at least 745965, at least 7595, at least 7695, at least 7795, at least 785965, at least at least 8095 , at least 929565, at least 9395, at least 945965, at least 95956, at least 969565, at least 9795, at least 9895, at least 9995 or more identical to the sequence of amino acids 30-489 from BEO IYUO MO: 55 (Stu1Va). Amino acid sequence alignment of domain I and PMR258 domain (ZEO IUO MO: 47), Stu!Ve (ZEO IUO MO: 58), StuiVi (ZEO IU MO: 54), Stu!Vd9 (ZEO IUO MO: 60), StuiV ( ZEO I

MO: 59), Stu!Va (5EO and MO: 55), Stu!Vy (ZEO and MO: 52), Stui Va (5EO and MO: 1), Stu!VB (5EO

IO MO: 56), and Stu! Bs (ZEO IU MO: 57) is shown in Figure 5. Similarly, other native polypeptides

Stu1B can be aligned with Stu!Va (ZEO IO MO: 55) and MP258 (ZEO IO MO: 47) to identify other regions of domain I and domain II of Sgu! Va-type.

In some embodiments, the corresponding Stu1B reference polypeptide contains a | domain and domain II Stu!Ve-type. By "domain I and domain II Stu!Ve-type" is meant an amino acid sequence that is at least 7095, at least 7195, at least 72965, at least 7395, at least 7495, at least 7595, at least 76965, at least 7795 , at least 7895, at least 7995, at least 8095, at least 8195, at least 8295, at least 8395, at least 845965, at least 8595, at least 8695, at least 8795, at least 88595, 60 at least 8995, at least 9095, at least 9195, at least 925965,

at least 9395, at least 9495, at least 9595, at least 96965, at least 9795, at least 9895, at least 9995 or more identical to the sequence of amino acids 35-494 with BEO IU MO: 58 (Stu1Ve) or amino acids 35-493 from BEO IU

MO: 47. Alignment of the amino acid sequence of domain I and domain II of MP258 (5EO IO MO: 47),

Stu!Ve (ZEO IU MO: 58), StuiVi (ZEO IO MO: 54), Stu!Vao (5EO IO MO: 60), Stui VE (ZEO I MO: 59), StuiVa (5EO IO MO: 55), Stu! You (ZEO and MO: 52), StuiVa (5EO IO MO: 1), Stu1VB (ZEO and

MO: 56), and Stu!Vs (ZEO IO MO: 57) is shown in Figure 5. Similarly, other native polypeptides

Stu1B can be aligned with Sgu!Ve (ZEO IO MO: 58) and MP258 (ZEO IO MO: 47) to identify other regions of the I domain and the IYI domain of Stu! Ve-type.

By "enhanced activity" or "increased activity" is meant an increase of at least about 1095, at least about 1595, at least about 20956, at least about 2595, at least about 3095, at least about 3595, at least about 4095, at least at least about 5095 at least about 6095 at least about 7095 at least about 8095 at least about 9095 at least about 10095 at least about 11095 at least about 12095 at least about 13095 at least about 14095 at least by about 15095 at least by about 16095 at least by about 17095 at least by about 18095 at least by about 19095 at least by about 20095 at least by about 21095 at least by about 22095 at least by about 23095 at least by about 24095 at least by about 25095 at least about 26095 at least about 27095 at least about 28095 at least about 29095 at least about 30095 at least about 31095 at least about 320956 at least about 33095 at least about 34095 at least about 35095 at least about 36095 at least about 37095 at least about 38095 at least about 39095 at least about 40095 at least about 41095 at least about 42095 at least about 43095 at least about 44095 at least about 45095 at least about 46095 at least about 47095 at least by approx

From 48095, at least about 49095, at least about 50095, at least about 51095, at least about 52095, at least about 53095, at least about 54095, at least about 55095, at least about 56095, at least about 57095, at least about about 58095, at least about 59095, at least about 60095, at least about 65095, at least about 70095, at least about 75095, at least about 80095, at least about 85095, at least about 90095, at least about 95095, at least about about 100095 or more or at least about 11 times at least about 1.2 times at least about 1.3 times at least about 1.4 times or at least about 1.5 times at least about 1.6 times , at least about 1.7 times, at least about 1.8 times, at least about 1.9 times, at least about 2 times, at least about 2, 1 time, at least about 2.2 times, at least about 2.3 times, at least about 2.4 times, at least about 2.5 times, at least about 2.6 times, at least about 2.7 times , at least about 2.8 times, at least about 2.9 times, at least about 3 times, at least about 3.1 times, at least about 3.2 times, at least about 3.3 times, at least about 3.4 times, at least about 3.5 times, at least about 3.6 times, at least about 3.7 times, at least about 3.58 times, at least about 3.9 times, at least about 4 times , at least about 4.1 times, at least about 4.2 times, at least about 4.3 times, at least about 4.4 times, at least about 4.5 times, at least about 4.6 times, at least about 4.7 times, at least about 4.8 times, at least about 4.9 times, at least about 5 times, at least about 5.1 times, whatever more than about 5.2 times, at least about 5.3 times, at least about 5.4 times, at least about 5.5 times, at least about 5.6 times, at least about 5.7 times, at least in about 5.8 times, at least about 5.9 times, at least about b times, at least about 6.1 times, at least about 6.2 times, at least about 6.3 times, at least about 6.4 times, at least about 6.5 times, at least about 6.6 times, because at least about 6.7 times, at least about 6.8 times, at least about 6.9 times, at least about 7 times, at least about 7.1 times at least about 7.2 times at least about 7.3 times at least about 7.4 times at least about 7.5 times at least about 7.6 times at least about 7.7 times, at least about 7.8 times, at least about 7.9 times, at least about 8 times, at least about 8.1 times, at least in about 8.2 times, at least about 8.3 times, at least about 8.4 times, at least about 8.5 times, at least about 8.6 times, at least about 8.7 times, at least about 8 .8 times, at least about 8.9 times, at least about 9 times, at least about 9.1 times, at least about 9.2 times, at least about 9.3 times, at least about 9.4 times, at least about 9.5-fold, at least about 9.6-fold, at least about 9.7-fold, at least about 9.8-fold, at least about 9.9-fold, at least about 10-fold or more increase in pesticidal activity variant protein compared to the activity of the corresponding reference polypeptide Cgu1B.

In some embodiments, the improvement is to reduce EC50 by at least about 1095, at least about 1595, at least about 2095, at least about 2595, at least about 3095, at least about 3595, at least about 4095, at least about 5095, at least at least about 6095, at least about 7095, at least about 8095, at least about 9095, at least about 10095, at least about 11095, at least about 12095, at least about 13095, at least about 14095, at least about 15095, at least at least about 16095 at least about 17095 at least about 18095 at least about 19095 at least about 20095 at least about 21095 at least about 22095 at least about 23095 at least about 24095 at least about 25095 at least by about 26095, at least by about 27095, at least by about 28095 at least about 29095 at least about 30095 at least about 31095 at least about 32095 at least about 33095 at least about 34095 at least about

From 35095, at least about 36095, at least about 37095, at least about 38095, at least about 39095, at least about 40095, at least about 41095, at least about 42095, at least about 43095, at least about 44095, at least about about 45095, at least about 46095, at least about 47095, at least about 48095, at least about 49095, at least about 50095, at least about 51095, at least about 52095, at least about 53095, at least about 54095, at least about about 55095, at least about 56095, at least about 57095, at least about 58095, at least about 590956, at least about 60095, at least about 65095, at least about 70095, at least about 75095, at least about 80095, at least about about 85095, at least by about 90095, at least by about 9509 65, at least by about 100095 or more, or at least about 1.1 times, at least about 1.2 times, at least about 1.3 times, at least about 1.4 times, or at least about 1.5 times, at least about 1.6 times, at least about 1.7 times, at least about 1.8 times, at least about 1.9 times, at least about 2 times, at least about 2.1 times, at least about 2, 2 times, at least about 2.3 times, at least about 2.4 times, at least about 2.5 times, at least about 2.6 times, at least about 2.7 times, at least about 2.8 times , at least about 2.9 times, at least about 3 times, at least about 3.1 times, at least about 3.2 times, at least about 3.3 times, at least about 3.4 times, at least about 3.5 times, at least about 3.6 times, at least about 3.7 times, at least about 3.58 times, at least about 3.9 times, at least about 4 times, at least about 4.1 times, at least about 4.2 times, at least about 4.3 times, at least about 4.4 times, at least about 4.5 times, at least in about 4.6 times at least about 4.7 times at least about 4.8 times at least about 4.9 times at least about 5 times at least about 5.1 times at least about 5.2 times, at least about 5.3 times, at least 60 times, about 5.4 times, at least about 5.5 times, at least about 5.6 times,

at least about 5.7 times, at least about 5.8 times, at least about 5.9 times, at least about b times, at least about 6.1 times, at least about 6.2 times, at least about 6 .3 times, at least about 6.4 times, at least about 6.5 times, at least about 6.6 times, at least about 6.7 times, at least about 6.8 times, at least about 6.9 times, at least about 7 times, at least about 7.1 times, at least about 7.2 times, at least about 7.3 times, at least about 7.4 times, at least about 7.5 times, at least in about 7.6 times at least about 7.7 times at least about 7.8 times at least about 7.9 times at least about 8 times at least about 8.1 times at least about 8.2 times, at least about 8.3 times, at least about 8.4 times, at least about 8.5 times, at least about 8.6 times, at least in about 8.7 times at least about 8.8 times at least about 8.9 times at least about 9 times at least about 9.1 times at least about 9.2 times at least about 9.3 times, at least about 9.4 times, at least about 9.5 times, at least about 9.6 times, at least about 9.7 times, at least about 9.8 times, at least about 9.9 times, at least about a 10-fold or greater reduction in EC50 for the Stu!B variant polypeptide compared to the pesticidal activity of the corresponding Stu18B reference polypeptide.

In some embodiments, the EC50 of the Stu!B variant polypeptide is "100 ppr, -90 ppr, "80 ppr, "70 ppr, "60 ppr, "50 ppr, "45 ppr, "40 ppr, "35 ppr, "30 ppr , "25 rrt, "20 rrt, "19 rrt, "18 rrt, "17 rrt, "16 rrt, "15 rrt, "14 rrt, "13 rrt, "12 rrt, "11 rrt, -10 rrt, " 9 ppr, "8 ppr, "7 ppr, "6 ppr, "5 ppr, "4 ppr, "Z ppr, "2 ppr, "1 ppr, "0.9 ppr, "0.8 ppr, "0, 7 ppr, «0.6 ppr, «0.5 ppr, «0.4 ppr, «0.3 ppr, «0.2 ppr or «01 ppr.

In some embodiments, the improvement is to increase the average value of the EAE index by at least about 1095, at least about 1595, at least about 2095, at least about 2595, at least about 3095, at least about 3595, at least about 4095, at least about

Of 5095, at least about 6095, at least about 7095, at least about 8095, at least about 9095, at least about 10095, at least about 11095, at least about 12095, at least about 13095, at least about 14095, at least about about 15095, at least about 16095, at least about 17095, at least about 18095, at least about 19095, at least about 20095, at least about 21095, at least about 22095, at least about 23095, at least about 24095, at least about about 25095, at least about 26095, at least about 27095, at least about 28095, at least about 29095, at least about 30095, at least about 31095, at least about 32095, at least about 33095, at least about 34095, at least about about 35095 at least about 36095 at least about 37095 less than about 38095, at least about 39095, at least about 40095, at least about 41095, at least about 42095, at least about 43095, at least about 44095, at least about 45095, at least about 46095, at least about 47095, at least about 48095 at least about 49095 at least about 50095 at least about 51095 at least about 52095 at least about 53095 at least about 54095 at least about 55095 at least about 56095 at least about 57095 at least about 58095 at least about 59095 at least about 60095 at least about 65095 at least about 70095 at least about 75095 at least about 80095 at least about 85095 at least about 90095 at least about 95095 at least by about 100095 or more, or at least by about 1.1 times, at least about 1.2 times, at least about 1.3 times, at least about 1.4 times, or at least about 1.5 times, at least about 1.6 times, at least about 1.7 times, at least about 1.8 times, at least about 1.9 times, at least about 2 times, at least about 2.1 times, at least about 2.2 times, at least about 2.3 times, at least about 2 .4 times, at least about 2.5 times, because at least about 2.6 times, at least about 2.7 times, at least about 2.8 times, at least about 2.9 times, at least about 3 times , at least about 3.1 times, at least about 3.2 times, at least about 3.3 times, at least about 3.4 times, at least about 3.5 times, at least about 3.6 times, at least about 3.7 times, at least about 3.8 times, at least about 3.9 times, at least about 4 times, at least about 4.1 times that at least about 4.2 times, at least about 4.3 times, at least about 4.4 times, at least about 4.5 times, at least about 4.6 times, at least about 4.7 times, at least in about 4.8 times at least about 4.9 times at least about 5 times at least about 5.1 times at least about 5.2 times at least about 5.3 times at least about 5.4 times, at least about 5.5 times, at least about 5.6 times, at least about 5.7 times, at least about 5.8 times, at least about 5.9 times, at least about 6 times, at least in about 6.1 times, at least about 6.2 times, at least about 6.3 times, at least about 6.4 times, at least about 6.5 times, at least about 6.6 times, at least about 6 ,/ times, at least approximately 6.8 times, at least approximately 6.9 times, at least approximately 7 times, at least approximately 7.1 times, at least in pr about 7.2 times, at least about 7.3 times, at least about 7.4 times, at least about 7.5 times, at least about 7.6 times, at least about 7.7 times, at least about 7 .8 times, at least about 7.9 times, at least about 8 times, at least about 8.1 times, at least about 8.2 times, at least about 8.3 times, at least about 8.4 times, at least about 8.5 times at least about 8.6 times at least about 8.7 times at least about 8.8 times at least about 8.9 times at least about 9 times at least about 9 .1 times, at least about 9.2 times, at least about 9.3 times, at least about 9.4 times, at least about 9.5 times, at least about 9.6 times, at least about 9.7 times, at least about 9.8 times, at least about 9.9 times, at least about 10 times, or

There is a greater increase in the average value of the BAE index for the variant polypeptide Sgu1B compared to the pesticidal activity of the corresponding reference polypeptide Stu18B. "Average value of the BAEE index" (ME!) refers to the average value for the set

EAESM, average arithmetic value of EAESM. As used herein, "average deviation score" refers to the arithmetic mean of a plurality of deviation scores.

In some embodiments, the improvement is to increase the average value of the deviation index by at least about 1095, at least about 1595, at least about 2095, at least about 2595, at least about 3095, at least about 3595, at least about 4095, at least about 5095, at least about 6095, at least about 7095, at least about 8095, at least about 9095, at least about 10095, at least about 11095, at least about 12095, at least about 13095, at least about 14095, at least about 15095, at least about 16095, at least about 17095, at least about 18095, at least about 19095, at least about 20095, at least about 21095, at least about 22095, at least about 23095, at least about 24095, at least about 25095, at least by about 26095, at least at least about 27095 at least about 28095 at least about 29095 at least about 30095 at least about 31095 at least about 32095 at least about 33095 at least about 34095 at least about 35095 at least about 36095 at least at least about 37095 at least about 38095 at least about 39095 at least about 40095 at least about 41095 at least about 42095 at least about 43095 at least about 44095 at least about 45095 at least about 46095 at least at least about 47095 at least about 48095 at least about 49095 at least about 50095 at least about 51095 at least about 52095 at least about 53095 at least about 54095 at least about 55095 at least about 56095 at least on approximately 57095, at least on approximately 58095, at least on pr and about 59095, at least about 60095, at least about 65095, at least about 70095, at least about 75095, at least about 80095, at least about 85095, at least about 900965, at least about 95095, at least about 100095 or more, or at least about 1.1 times, at least about 1.2 times, at least about 1.3 times, at least about 1.4 times, or at least about 1.5 times, at least about 1.6 times, at least about 1.7 times, at least about 1.8 times, at least about 1.9 times, at least about 2 times, at least about 2.1 times, at least about 2.2 times, at least about 2, 3 times, at least about 2.4 times, at least about 2.5 times, at least about 2.6 times, at least about 2.7 times, at least about 2.8 times, at least about 2.9 times , at least about 3 times, at least about 3.1 times and, at least about 3.2 times, at least about 3.3 times, at least about 3.4 times, at least about 3.5 times, at least about 3.6 times, at least about 3.7 times, at least about 3.8 times, at least about 3.9 times, at least about 4 times, at least about 4.1 times, at least about 4.2 times, at least about 4.3 times, at least about 4 .4 times, at least about 4.5 times, at least about 4.6 times, at least about 4.7 times, at least about 4.8 times, at least about 4.9 times, at least about 5 times, at least about 5.1 times, at least about 5.2 times, at least about 5.3 times, at least about 5.4 times, at least about 5.5 times, at least about 5.6 times, at least in about 5.7 times, at least about 5.8 times, at least about 5.9 times, at least about 6 times, at least about 6.1 times, at least about 6.2 times, at least about 6.3 times, at least about 6.4 times, at least about 6.5 times, at least about 6.6 times, at least about 6./ times, at least about 6.8 times, at least about 6.9 times, at least about 7 times, at least about 7.1 times, at least about 7.2 times, at least about 7.3 times, at least about 7.4 times , at least approximately 7.5 times,

From at least about 7.6 times, at least about 7.7 times, at least about 7.8 times, at least about 7.9 times, at least about 8 times, at least about 8.1 times, at least about 8.2 times, at least about 8.3 times, at least about 8.4 times, at least about 8.5 times, at least about 8.6 times, at least about 8.7 times, at least about 8, 8 times, at least about 8.9 times, at least about 9 times, at least about 9.1 times, at least about 9.2 times, at least about 9.3 times, at least about 9.4 times, at least at least about 9.5 times, at least about 9.6 times, at least about 9.7 times, at least about 9.8 times, at least about 9.9 times, at least about 10 times or more increase in the average value of the indicator deviation for variant polypeptide

Stu!B compared to the pesticidal activity of the corresponding reference polypeptide Stu1B.

In some embodiments, the activity of the Sgu!B variant polypeptide is improved compared to the pesticidal activity of 5EO I MO: 1 (Stu1iVa), 5EO IO MO: 47 (MP2B8), 5EO I

MO: 52 (Stu1VI), ZEO IYUO MO: 54 (Stuyi1Vi), BEO IO MO: 3, 5EO IO MO: 5, 5EO IYU MO: 7, 5EO IYU

MO: 9, 5EO IO MO: 11, 5EO IU MO: 13, 5EO IO MO: 15, 5EO IUO MO: 17, 5EO IO MO: 19, 5EO Ir

MO: 21.5EO IYUO MO: 31.5EO IYUO MO: 33.5EO IYU MO: 35.5EO IYU MO: 37.5EO IO MO: 39.5EO IYU

MO: 41, BEO AND MO: 43 or 5EO IO MO: 45.

In specific embodiments, pesticidal proteins according to embodiments include full-length insecticidal polypeptides, fragments of full-length insecticidal polypeptides, and variant polypeptides derived from mutagenized nucleic acids designed to introduce specific amino acid sequences into polypeptides according to embodiments. In specific embodiments, the amino acid sequences that are introduced into the polypeptides contain a sequence that provides a cleavage site for an enzyme, such as a protease.

It is known from the prior art that the pesticidal activity of B-toxins is usually activated during the cleavage of the peptide in the intestine of the insect by various proteases. Since peptides cannot always be cleaved in the insect gut with full efficiency, fragments of the full-length toxin can be characterized by enhanced pesticidal activity compared to the full-length toxin itself. Thus, some of the polypeptides according to 60 embodiments include fragments of a full-length insecticidal polypeptide, and some of the fragments, variants, and mutations of the polypeptide will exhibit enhanced pesticidal activity relative to that of the naturally occurring insecticidal polypeptide from which they are derived, particularly , if the naturally occurring insecticidal polypeptide is not activated by migo protease prior to screening for activity. Thus, truncated variants or fragments of sequences are encompassed by the present invention.

Mutations can be placed in any background sequence, including such truncated polypeptides, provided that the polypeptide retains pesticidal activity. One skilled in the art can readily compare two or more proteins for pesticidal activity using assays known in the art or described elsewhere herein. It should be understood that the polypeptides according to the variants of implementation can be obtained either by expression of the nucleic acid disclosed herein, or by the use of standard molecular biology techniques.

It is believed that pesticide bileus can be oligomeric and will differ in molecular weight, number of residues, constituent peptides, activity against certain pests and other characteristics. However, using the methods described herein, it is possible to isolate and characterize proteins active against a number of pests. Pesticidal proteins according to variants of implementation can be used in combination with other B-toxins or other insecticidal proteins to expand the spectrum of target insects. In addition, the use of pesticidal proteins according to the implementation options in combination with other Vitoxins or other insecticidal active components of excellent nature is particularly useful for preventing and/or controlling the development of resistance in insects. Other insecticides include inhibitors of proteases (both serine and cysteine types), α-amylase, and peroxidase.

Fragments and variants of nucleotide and amino acid sequences and polypeptides encoded by them are also covered by embodiments. As used herein, the term "fragment" refers to a portion of the nucleotide sequence of a polynucleotide or to a portion of the amino acid sequence of a polypeptide according to embodiments.

Nucleotide sequence fragments can encode protein fragments that store

Co) the biological activity of the native protein or the corresponding full-length protein and, therefore, have pesticidal activity. Thus, it is believed that some of the polynucleotide sequences and amino acid sequences according to the variants of implementation can be rightly called both fragments and mutants.

It should be understood that the term "fragment" as used with respect to nucleic acid sequences according to embodiments also includes sequences useful as hybridization probes. Nucleotide sequences from this class usually do not encode fragments of proteins that retain biological activity. Thus, fragments of a nucleotide sequence can range from at least about 20 nucleotides, about 50 nucleotides, about 100 nucleotides, and up to a full-length protein-encoding nucleotide sequence in accordance with embodiments.

A fragment of a nucleotide sequence according to embodiments that encodes a biologically active portion of a pesticide protein according to embodiments will encode at least 15, 25, 30, 50, 100, 200, 250, or 300 contiguous amino acids or up to the total number of amino acids present in the pesticide polypeptides according to variants of implementation (for example, 651 amino acids for 5EO IU MO: 3). Thus, it should be understood that embodiments also encompass polypeptides that are fragments of illustrative pesticidal proteins according to embodiments and are at least 15, 25, 30, 50, 100, 200, 250, or 300 contiguous amino acids or up to a total of , which are present in the pesticide polypeptide according to the variants of implementation (for example, 651 amino acids for 5EO IU MO: 3).

Nucleotide sequence fragments in embodiments that are useful as hybridization probes or PCR primers generally do not need to encode a biologically active portion of a pesticide protein. Thus, a nucleic acid fragment according to variants of implementation can encode a biologically active part of a pesticide protein, or it can be a fragment that can be used as a hybridization probe or PCR primer using the methods disclosed herein. A biologically active part of a pesticide protein can be obtained by isolating a part of one of the nucleotide sequences according to embodiments, expressing a part of the encoded pesticide protein (for example, by recombinant expression of ip myo), and evaluating the activity of a part of the encoded pesticide protein.

Nucleic acids, which are fragments of the nucleotide sequence according to the implementation options, contain at least 16, 20, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 850, 900 or 950 nucleotides or up to the number of nucleotides present in the nucleotide sequence disclosed herein (eg, 1953 nucleotides for

ZBEO IYUO MO: 4). Specific embodiments provide for fragments derived from (eg, derived from) the first nucleic acid according to embodiments wherein the fragment encodes a truncated toxin having pesticidal activity. Truncated polypeptides encoded by polynucleotide fragments according to embodiments have pesticidal activity that is either equivalent to or improved over that of the corresponding full-length polypeptide encoded by the first nucleic acid from which the fragment is derived. It is assumed that such nucleic acid fragments according to variants of implementation can be truncated at the 3'-end of the native coding sequence or the corresponding full-length coding sequence. Nucleic acid fragments can also be truncated at both the 5- and 3-end of the native coding sequence or the corresponding full-length coding sequence.

The term "variants" is used herein to refer to substantially similar sequences. For nucleotide sequences, conservative options include those sequences that, due to the degeneracy of the genetic code, encode the amino acid sequence of one of the pesticide polypeptides according to the implementation options. Those skilled in the art will readily appreciate that due to the degeneracy of the genetic code, there are many nucleotide sequences encoding the proteins of the present disclosure.

In some embodiments, the nucleic acid molecule encoding the polypeptide is a nucleic acid sequence different from the genomic one. As used herein, "non-genomic nucleic acid sequence" or "non-genomic nucleic acid molecule" or "non-genomic polynucleotide" refers to a nucleic acid molecule that has one or more changes in the nucleic acid sequence compared to the native or genomic nucleic acid sequence. In some embodiments, a change to a native or genomic nucleic acid molecule includes, without limitation: changes in the nucleic acid sequence due to the degeneracy of the genetic code; codon optimization of the nucleic acid sequence for expression in plants; changes in the nucleic acid sequence to introduce at least one amino acid substitution, insertion, deletion and/or addition compared to the native or genomic sequence; deletion of one or more introns associated with the genomic nucleic acid sequence; insertion of one or more heterologous introns; deletion of one or more regulatory sites, located above or below, associated with the genomic sequence of the nucleic acid; insertion of one or more heterologous regulatory sites located above or below; deletion of the 5'- and/or 3'-untranslated region associated with the nucleic acid genomic sequence; insertion of a heterologous 5'- and/or 3'-untranslated region and modification of the polyadenylation site. In some embodiments, the nucleic acid molecule, which differs from the genomic one, is cDNA. In some embodiments, the non-genomic nucleic acid molecule is a synthetic nucleic acid sequence.

If necessary, the nucleic acid can be optimized for increased expression in the host organism. Thus, if the host organism is a plant, synthetic nucleic acids using plant-preferred codons can be synthesized to enhance expression.

See, for example, Satrrbei! and Schom/li, (1990) Riapi Rnuzioi. 92:1-11 for consideration of host-preferred codon usage. For example, although the nucleic acid sequences of embodiments may be expressed in both monocot and dicot plant species, the sequences may be modified to account for specific codon preferences and preferences for monocot or dicot content, as these preferences have been shown to differ ( Mitau ei aI. (1989) Mysieis Asid5 Nev5. 17:477-498). Thus, the maize-preferred codon for a particular amino acid can be established from known maize gene sequences. Maize codon usage for 28 genes from maize plants is shown in Table 4 of Miggau, et al., above. From the state of the art, methods of synthesizing genes preferred for plants are available. See, for example, U.S. Patent Nos. 5,380,831 and 5,436,391 and Mitau, et al., (1989)

Mysivys Asia5 Nev. 17:477-498, and named after N. A. I. My Bio Ner 37:677-684, 2010, , are incorporated herein by reference. The table of 7ea taiga codon usage can also be found on the site Ka7iza.og.Ir/sodop/sdi-bip/5khpom'sodop.sdi?5resie5-4577, which can be accessed using the m/mlu prefix.

The table of codon usage of Siusiope tah is shown in the form of Table 3, and it can also be found on the site Ka7iza.og.|r/sodop/sdi-rbip/"5pomsodop.sdi?5resiez-38475aa-185ue-M, which can be accessed from using the prefix m/mliu.

In addition, one skilled in the art will understand that changes can be introduced by mutating nucleic acid sequences that cause changes in the amino acid sequence of the encoded polypeptide without changing the biological activity of the proteins. Thus, variant nucleic acid molecules can be created by introducing one or more nucleotide substitutions, additions, and/or deletions into a corresponding nucleic acid sequence disclosed herein, such that one or more amino acid substitutions, additions, or deletions are introduced into the encoded protein . Mutations can be introduced using standard techniques such as site-directed mutagenesis and PCR-mediated mutagenesis. Such variant nucleic acid sequences are also encompassed by the present disclosure.

Naturally occurring allelic variants such as these can be identified using well-known molecular biology techniques, such as, for example, polymerase chain reaction (PCR) and hybridization techniques, as described herein.

In some embodiments, the implementation of a polynucleotide encoding a polypeptide with a PEO IU MO: 3.5EO IU

MO: 5, 5EO AND MO: 7, 5EO IO MO: 9, 5EO IUO MO: 11, 5EO IO MO: 13, 5EO AND MO: 15, 5EO IU MO: 17, 5EO IO MO: 19, 5EO IUO MO: 23 5EO IUO MO: 39, 5EO IUO MO: 41, 5EO IUO MO: 43 or 5EO IUO MO: 45, is a nucleic acid sequence that differs from the genomic one.

Variant nucleotide sequences also include synthetically derived nucleotide sequences, such as those obtained, for example, by site-directed mutagenesis, but which still encode a pesticidal protein according to embodiments, such as a mutant toxin. In general, variants of a particular nucleotide sequence according to embodiments will have a sequence of at least about 7095, 7595, 8095, 8595, 8695, 87905, 8895, 8995, 9095, 9195, 9295, 9395, 9495, 9595, 9695, 9795, 9895, 9995 or more identical to a specific nucleotide sequence when determined by the sequence alignment programs described elsewhere in this document using default parameters. A variant nucleotide sequence according to variants of implementation may differ from the given sequence by only 1-15 nucleotides, only 1-10, such as 6-10, only 5, only 4, 3, 2, or even 1 nucleotide.

Variants of a particular nucleotide sequence according to embodiments (ie, an exemplary nucleotide sequence) can also be evaluated by comparing the percent sequence identity for the polypeptide encoded by the variant nucleotide sequence and the polypeptide encoded by the reference nucleotide sequence. So, for example, isolated nucleic acids encoding a polypeptide with the indicated percent sequence identity to polypeptides with HEO IU MO: 3.5EO IO MO: 5.5EO are disclosed

IO MO: 7.5EO IO MO: 9.5EO I MO: 11.5EO IO MO: 13.5EO I MO: 15.5EO IIU MO: 17.5EO I

MO: 19, 5EO IU MO: 21, 5EO IU MO: 23, 5EO IU MO: 25, 5EO IUO MO: 27, 5EO IU MO: 29, 5EO IU

MO: 31, 5EO IJU MO: 33, 5EO IJU MO: 35, 5EO IU MO: 37, 5EO IJU MO: 39, 5EO IJU MO: 41, 5EO IJU

MO: 43 or 5EO AND MO: 45. Percent sequence identity for any two polypeptides can be calculated using the sequence alignment programs described elsewhere herein, using default settings.

When evaluating any given pair of polynucleotides according to embodiments by comparing the percent sequence identity shared by the two polypeptides they encode, the sequences of the two encoded polypeptides are identical by at least about 4095, 4595, 5095, 5595, 6095, 6595, 70956, typically at least about 7595, 8095, 8595, at least about 9095, 9195, 9295, 9395, 9495, 9595, 96965, 9795 or at least about 98595, 9995 or more.

As used in this document, the expression "variant protein" covers polypeptides obtained from the native protein: by deletion (so-called truncation) or addition of one or more amino acids at the M-terminus and/or C-terminus of the native protein; deletion or addition of one or more amino acids at one or more sites in the native protein or replacement of one or more amino acids at one or more sites in the native protein. Accordingly, the expression "variant protein" covers biologically active fragments of the native protein that contain a sufficient number of contiguous amino acid residues to preserve the biological activity of the native protein, that is, for it to have pesticidal activity. Such pesticidal activity may be different or improved compared to the native protein, or it may be unchanged provided that pesticidal activity is retained.

The variant proteins covered by the variants of implementation are biologically active, that is, they continue to have the necessary biological activity of the native protein, that is, pesticidal activity, as described herein. Such variants can be the result, for example, of genetic polymorphism or manipulation carried out by a person. Biologically active variants of the native pesticide protein according to embodiments will have a sequence of at least about 6095, 6595, 7095, 7595, 8095, 8595, 8695, 8795, 8895, 8995, 9095, 9190, 9296, 9390, 9490, 9590, 9690 , 9790, 9895, 9995 or more identical to the amino acid sequence for the native protein when determined using the sequence alignment programs described elsewhere in this document using default settings. A biologically active variant of a protein according to embodiments can differ from a given protein by only 1-15 amino acid residues, only 1-10, such as, for example, 6-10, only 5, only 4, 3, 2, or even 1 amino acid residue.

In some embodiments, the insecticidal polypeptide has a sequence that is at least 6095, 6595, 7095, 7595, 8095, 8595, 8695, 8795, 8895, 8995, 9095, 9195, 9295, 93905, 9495, 9595, 9695, 97905 9995 or more identical to the amino acid sequence of ZEO IU MO:

Z, ZEO IU MO: 5, 5EO IU MO: 7, 5EO IU MO: 9, 5EO IU MO: 11, 5EO IU MO: 13, 5EO IU MO: 15,

ZEO IO MO: 17, 5EO IO MO: 19, 5EO IU MO: 21, 5EO IO MO: 23, 5EO I MO: 25, 5EO I MO: 27,

ZEO IU MO: 29, 5EO IU MO: 31, 5EO IU MO: 33, 5EO AND MO: 35, 5EO AND MO: 37, 5EO AND MO: 39,

ZEO IU MO: 41, 5EO IU MO: 43 or 5EO IU MO: 45..

In some embodiments, the polypeptide is characterized by a modified physical property. As used herein, the term "physical property" refers to any parameter that is suitable for describing the physicochemical characteristics of a protein.

As used herein, the terms "physical property of interest" and "property of interest" are used interchangeably to refer to the physical properties of the proteins being studied and/or modified. Examples of physical properties include, without limitation, total surface charge and charge distribution on the protein surface, total hydrophobicity and distribution of hydrophobic residues on the protein surface, surface charge density, surface hydrophobicity density, total number of ionizable surface groups, surface tension, protein size and distribution in solution, temperature

From melting, heat capacity and the second virial coefficient. Examples of physical properties also include, without limitation, solubility, folding, stability, and digestibility. In some embodiments, the polypeptide is characterized by increased digestibility of fragments obtained as a result of proteolytic cleavage in the intestine of an insect. In some embodiments, the polypeptide has increased stability in the insect gut. Models for digestion with the help of artificial gastric juice are known to a specialist in this field of technology (Rispv5, V.I. and U.O.

Biochemistry 14: 1269-1273, 1996; You are here! U. Adgis speth. 50: 7154-7160, 2002).

In addition, embodiments include a microorganism transformed with at least one nucleic acid according to embodiments, an expression cassette that contains a nucleic acid, or a vector that contains an expression cassette. In some embodiments, the microorganism is a microorganism that reproduces on plants. An embodiment of this disclosure relates to an encapsulated pesticide protein contained in a transformed microorganism capable of expressing at least one pesticide protein according to embodiments.

Variants of implementation provide for pesticide compositions containing a transformed microorganism according to the variants of implementation. In such embodiments, the transformed microorganism is typically present in the pesticidal composition in a pesticidally effective amount together with a suitable carrier. Embodiments also include pesticidal compositions comprising an isolated protein according to embodiments, alone or in combination with a transformed organism according to embodiments, and/or an encapsulated pesticidal protein according to embodiments in an insecticidally effective amount together with a suitable carrier.

Variants of implementation additionally provide for a method of expanding the spectrum of target insects by using a pesticidal protein according to the variants of implementation in combination with at least one other or "second" pesticidal protein. Any pesticidal protein known in the art can be used in the methods according to the embodiments. Such pesticidal proteins include, but are not limited to, B-toxins, inhibitors of proteases, α-amylases, and peroxidases.

Embodiments also include transformed or transgenic plants containing at least one nucleotide sequence according to the embodiments. In some embodiments, the plant is stably transformed with a nucleotide construct that contains at least one nucleotide sequence, according to the embodiments, operably linked to a promoter that drives expression in the plant cell.

As used herein, the terms "transformed plant" and "transgenic plant" refer to a plant that contains a heterologous polynucleotide in its genome.

In general, a heterologous polynucleotide is stably integrated into the genome of a transgenic or transformed plant in such a way that the polynucleotide is transmitted to subsequent generations.

A heterologous polynucleotide can be integrated into the genome alone or as part of a recombinant expression cassette.

As used herein, the term "transgenic" shall be understood to include any cell, cell line, callus, tissue, plant part, or plant whose genotype has been altered by the presence of a heterologous nucleic acid, including such transgenic entities, which were originally altered in this way, as well as such transgenic objects, which were created by sexual crosses or asexual reproduction from the original transgenic object. As used herein, the term "transgenic" does not include alteration of the genome (chromosomal or extrachromosomal) by conventional methods of plant breeding or naturally occurring transgenic objects, such as random cross-pollination, infection by a non-recombinant virus, transformation by non-recombinant bacteria, non-recombinant transposition or spontaneous mutation.

As used herein, the term "plant" includes whole plants, plant organs (eg, leaves, stems, roots, etc.), seeds, plant cells, and progeny thereof. Parts of transgenic plants are within the scope of embodiments and include, for example, plant cells, plant protoplasts, tissue cultures of plant cells from which plants can be regenerated, plant calli, clusters of plant cells, and plant cells that are intact in plants or parts of plants, such as embryos, pollen, cotyledons, seeds, leaves, flowers, branches, fruits, grains, spikelets, cobs, husks, stems, roots, root tips, anthers, etc., derived from transgenic plants or their progeny, previously transformed a DNA molecule according to variants of implementation and, thus, at least partially consist of transgenic cells. The class of plants that can be used in the methods according to the embodiments is generally as broad as the class of higher plants that are subject to transformation techniques, including both monocotyledonous and dicotyledonous plants.

Although the embodiments do not depend on a specific biological mechanism for increasing plant resistance to a plant pest, expression of the nucleotide sequences according to the embodiments in the plant may result in the production of pesticidal proteins according to the embodiments and increase the resistance of the plant to the plant pest. Plants, according to implementation options, are used in agriculture in ways of influencing insect pests. Certain embodiments provide for transformed cultivated plants, such as, for example, corn plants, which are used in methods of impacting insect pests of the plant, such as, for example, lepidopteran pests. A "study plant or plant cell" is a plant or plant cell in which a genetic change, such as transformation, has affected the gene of interest, or is a plant or plant cell that is derived from a plant or cell so altered, and which contain a change. A "control" or "control plant" or "control plant cell" provides a reference point for measuring changes in the phenotype of a test plant or plant cell.

The control plant or plant cell can be, for example: (a) a plant or plant cell of the wild type, that is, with the same genotype as that of the starting material for genetic change, with the help of which the tested plant or cell was obtained; (B) a plant or plant cell with the same genotype as the starting material but which has been transformed with a null construct (ie, a construct that has no known effect on the trait of interest, such as a construct containing a marker gene) ; (c) a plant or plant cell that is non-transformed segregants among the progeny of the plant or plant cell under study; (4) a plant or plant cell that is genetically identical to the test plant or plant cell, but which has not been exposed to conditions or stimuli that will induce expression of the gene of interest; or (is) the investigated plant or plant cell as such under conditions in which the gene of interest is not expressed.

One skilled in the art will readily appreciate that advances in molecular biology, such as site-specific and non-specific mutagenesis, polymerase chain reaction techniques, and protein engineering techniques, provide a rich array of tools and protocols,

suitable for use in altering or constructing both the amino acid sequence and gene sequences underlying proteins of agricultural interest.

Thus, proteins according to embodiments can be modified in a variety of ways, including amino acid substitutions, deletions, truncations, and insertions. Methods of performing such manipulations are, as a rule, known from the state of the art. For example, variants of the amino acid sequences of pesticide proteins can be obtained by introducing mutations into a synthetic nucleic acid (for example, a DNA molecule). Methods of mutagenesis and nucleic acid modification are well known in the art. For example, engineered changes can be introduced using oligonucleotide-mediated site-directed mutagenesis. See, for example, KipkKe! (1985) Rgos. Mai). Asad 5 BOTH 82:488-492; Hot dogs. (1987) Meishtoavs ip Epgutoi. 154:367-382; US patent Mo 4,873,192; UMMaiKeg and Saavziga, Edv. (1983)

Tesppidiez ip Moiiesciag Viodou (MasMiiyap Rybriiyippu Sotrapu, Mem/ Mogk) and the sources cited in this document.

Nucleotide sequences subjected to mutagenesis according to variants of implementation can be modified to change about 1, 2, 3, 4, 5, 6, 8, 10, 12 or more of the amino acids present in the primary sequence of the polypeptide being encoded. Alternatively, an even greater number of changes relative to the native sequence can be introduced such that the encoded protein has at least about 195 or 295, or about 395, 495, Bo, bo, 790, 890, 99o, 196, 1195, 1296, , or even about 1395, 1495, 1595, 169, 1790, 1895, 1995, or 2095, 2195, 2290, 239u, 249Uo, or 2590, 309", 3595, or 4095 or more codons could be changed or otherwise modified relatively with the corresponding wild-type protein. Similarly, the encoded protein may have at least about 195 or 295, or about 395, 4905, b0, b0, 790, ov, 9U00, 1090, 1190, 1295, , or even about 1395, 1495, 1595, 1690 , 1790, 1895, 1995, or 2095, 2195, 2290, 239, 2495, or 2595, 3095, 35Uy, or 4095 or more additional codons compared to the corresponding wild-type protein. It should be understood that mutagenic nucleotide sequences according to embodiments are expected to include biologically functional equivalent peptides that have pesticidal activity, such as improved pesticidal activity as determined by antifeedant properties against corn borer larvae. Such sequences may arise from codon redundancy and functional equivalence known to occur naturally in nucleic acid sequences and proteins encoded in such a manner.

One skilled in the art will appreciate that amino acid additions and/or amino acid substitutions are usually based on the relative similarity of the substituents on the amino acid side chain, eg, their hydrophobicity, charge, size, and the like. Illustrative groups of amino acid substitutions that take into account various of the above characteristics are well known to those skilled in the art and include: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; as well as valine, leucine and isoleucine.

A guide to appropriate amino acid substitutions that do not affect the biological activity of the protein of interest can be found in the model of the human body. (1978) Aisha5 oi Rgoivip

Zedyepse ap bigisishge (May. Viotei. Ne5. Roshpa., MMazpipdiop, O.S.), included in this document by reference. Conservative substitutions can be made, such as replacing one amino acid with another with similar properties.

Thus, genes and nucleotide sequences according to embodiments include both naturally occurring sequences and mutant forms. Likewise, proteins according to embodiments include both naturally occurring proteins and variants (eg, truncated polypeptides) and modified (eg, mutant) forms thereof.

Such options will retain the necessary pesticidal activity. Obviously, mutations to be made in the nucleotide sequence encoding the variant should not bring the sequence out of the reading frame and generally will not create complementary regions that can form the secondary structure of the mRNA. See publication of an application for a European patent

Mo75444.

It is expected that deletions, insertions and substitutions in the protein sequences covered by this document will not lead to radical changes in the characteristics of the protein. However, if it is difficult to predict the exact effect of a substitution, deletion or insertion before it is made, one skilled in the art will appreciate that the effect will be assessed using conventional screening assays, such as insect feeding assays. See, for example, Ma!tope ei ai. (1985) 9. Aesop.

Epyutoi 78: 290-293 and Slaria and I apd (1990) U. Esop. Epiotoi 83: 2480-2485, which is incorporated herein by reference.

Variant nucleotide sequences and proteins also encompass sequences and proteins produced by mutagenic and recombinogenic procedures such as DNA shuffling. In the case of such a procedure, one or more different coding sequences can be manipulated to create a new pesticidal protein having the required properties. Thus, libraries of recombinant polynucleotides are created from a population of sequence-related polynucleotides containing sections of sequences that are characterized by significant sequence identity and can be subjected to homologous recombination ip mei or ip mimo. For example, using this approach, full-length coding sequences, motifs in sequences that encode a domain of interest, or any fragment of a nucleotide sequence according to embodiments can be shuffled between nucleotide sequences according to embodiments and corresponding portions of other known nucleotide sequences Stu with obtaining a new gene that encodes a protein with an improved property of interest.

Properties of interest include, but are not limited to, pesticidal activity per unit of pesticidal protein, protein stability, and toxicity to non-target species, particularly humans, livestock, and plants and microbes expressing the pesticidal polypeptides according to embodiments. The embodiments are not limited to a specific shuffling strategy, it is only required that at least one nucleotide sequence according to the embodiments or a part thereof is involved in such a shuffling strategy. The shuffling may involve only the nucleotide sequences disclosed herein, or it may additionally involve the shuffling of other nucleotide sequences known in the art.

DNA shuffling strategies are known in the art. See, for example, Bietteg (1994) Rhos. Mai! Asad

All together. PERSON 91:10747-10751; bietteg (1994) Maishte 370:389-391; Strategies for her. (1997) Maishge

Viotes. 15:436-438; Mooge ey ai. (1997) U. Moi. Vioi 272:336-347; 7 her father is a. (1997) Rhos. Mai!).

Asai. All together. BOTH 94:4504-4509; Articles! (1998) Maitzge 391:288-291; and US Patent Nos. 5,605,793 and 5,837,458.

Nucleotide sequences according to variants of implementation can also be used to isolate the corresponding sequences from other organisms, in particular from other bacteria and more specifically from other strains of Vasiish5. Thus, such methods as PCR, hybridization, etc., are possible

To be used to identify such sequences, taking into account their sequence homology with the sequences presented in this document. Embodiments include sequences selected based on the identity of sequence 3 with the complete sequences set forth herein or fragments thereof. Such sequences include sequences that are orthologs of disclosed sequences. The term "orthologs" refers to genes derived from a common ancestral gene and found in different species as a result of speciation. Genes found in different species are considered orthologous if their nucleotide sequences and/or protein sequences encoded by them have a substantial degree of identity as defined elsewhere herein. The functions of orthologs are often highly conserved among species.

In the case of a PCR-based approach, oligonucleotide primers can be designed for use in PCR reactions to amplify the corresponding DNA sequences given cDNA or genomic DNA obtained from any organism of interest.

Methods of constructing PCR primers and PCR cloning are generally known in the art and are disclosed in the appendices. (1989) MoiIesshag Siopipd: A IGarogaiyugu Mapiai! (22 units, Soyd Zrhipa

Narog I aroghaigu Rgev5, Riaipmiiemu, Mem/ MoiKk), which is referred to as "zatrgook" further in this document. See also Ippi5 eyi ai!., edv. (1990). Ippi5 and SeiGapa, ed5. (1995) RSV 5igagediez (Asadetis Rgev5, Mem

UogK); and Ippi5 and SeiYiGapa, ed5. (1999) ROSA Meinpodeo Mapiai! (Asadetis Rgez5, Mem MogKk). Known PCR methods include, but are not limited to, methods using paired primers, nested primers, individual specific primers, degenerate primers, gene-specific primers, vector-specific primers, partially mismatched primers, and the like.

In the case of hybridization techniques, all or part of the known nucleotide sequence is used as a probe, which selectively hybridizes with other corresponding nucleotide sequences present in the population of cloned genomic DNA fragments or fragments

cDNA (ie, genomic libraries or cDNA libraries) from the selected organism. Hybridization probes can be genomic DNA fragments, cDNA fragments, RNA fragments, or other oligonucleotides, and can be labeled with a detectable group, such as C2P, or any other detectable marker. Thus, for example, probes for hybridization can be obtained by labeling synthetic oligonucleotides taking into account 60 sequences according to variants of implementation. Methods for obtaining probes for hybridization and for creating cDNA libraries and genomic libraries are generally known in the art and disclosed in the Art.

For example, the complete sequence disclosed herein, or one or more parts thereof, can be used as a probe capable of specifically hybridizing with corresponding sequences and template RNAs. To provide specific hybridization under different conditions, such probes include sequences that are unique to the sequences according to the variants of implementation and are usually at least about 10 or 20 nucleotides in length. Such probes can be used to amplify the corresponding Stg sequences from the selected organism by PCR. This technique can be used to isolate additional coding sequences from a desired organism or as a diagnostic assay to determine the presence of coding sequences in an organism.

Hybridization of such sequences can be carried out under harsh conditions. As used herein, the terms "stringent conditions" or "stringent hybridization conditions" refer to conditions under which a probe will hybridize to its target sequence to a markedly greater extent than to other sequences (eg, at least 2-fold, 5-fold, or 10-fold times more compared to the background). Hard conditions are sequence dependent and will vary in different circumstances. By controlling the stringency of the hybridization and/or washing conditions, it is possible to identify target sequences that are 10095 complementary to the probe (homology probing). Alternatively, the stringency conditions can be adjusted to allow some sequence mismatch in order to detect lower degrees of similarity (heterologous probing). Typically, the probe is less than about 1000 or 500 nucleotides in length.

Generally, harsh conditions will be those in which the salt concentration is less than about 1.5M Ma ions, typically the concentration of Ma ions (or other salts) is about 0.01-1.0M at pH 7.0-8, 3, and the temperature is at least about 30°C for short probes (eg, 10-50 nucleotides) and at least about 60°C for long probes (eg, greater than 50 nucleotides). Stringent conditions can also be achieved by adding destabilizing agents, such as formamide. Illustrative low stringency conditions include hybridization with buffer solution 30-3595 formamide, 1 M wt, 19 5O5 (sodium dodecyl sulfate) at 37 °C and washing 1X-2X 55(02 (20X 55(2 - 3.0 M

Mass/0.3 M trisodium citrate) at 50-55 °C. Illustrative conditions of moderate stringency include hybridization in 40-4595 formamide, 1.0 M Mass, 195 505 at 37 °C and washing in 0.5X-1X 550 at 55-60"C. Illustrative high stringency conditions include hybridization in 5095 formamide, 1 M Mass, 195 505 at 37"C and a final wash in 0.1X 55(C at 60-65" for at least about 20 minutes. Optional wash buffers may contain from about 0.195 to about 195 505. Hybridization times are generally less than about 24 hours, typically from about 4 to about 12 hours.

The following terms are used to describe sequence relatedness between two or more nucleic acids or polynucleotides: (a) "reference sequence", (b) "comparison window", (c) "sequence identity", (4) "percent sequence identity" and ( g) "substantial identity". (a) As used herein, a "reference sequence" is a given sequence used as a basis for comparing sequences. A reference sequence can be a shortened version or the full form of a certain sequence; for example, in the form of a full-length cDNA segment or gene sequence, or a complete cDNA or gene sequence. (b) As used herein, a "comparison window" refers to a contiguous and well-defined segment in a polynucleotide sequence, wherein the polynucleotide sequence in the comparison window may contain additions or deletions (i.e., gaps) compared to a reference sequence (which does not contain additions or deletions) for optimal alignment of two sequences. Typically, the length of the comparison window is at least 20 contiguous nucleotides and may optionally be 30, 40, 50, 100 or more. Those skilled in the art understand that to prevent high similarity to the reference sequence due to the inclusion of gaps in the polynucleotide sequence, a gap penalty is typically introduced and subtracted from the number of matches.

Methods of aligning sequences for comparison are well known in the art. Thus, determining the percent sequence identity between any two 60 sequences can be performed using a mathematical algorithm.

Non-limiting examples of such mathematical algorithms are the algorithm by Muyegz and Miisheg (1988) SAVIO5 4:11-17; the algorithm of local alignment according to btiiny ei a!. (1981) Hell. Arri. Property 2:482; global alignment algorithm according to Meedietap and M/ipvsp (1970) 9. Moi. Vioi 48:443-453; method of finding local alignment according to Reagzop and Iirtap (1988) Rgos. Mai! Asai. from 85:2444-2448; Algorithm from Kapyp and Aibspsha (1990) Ros. May Asad bsi OBA 872264, modified according to Kaiiip and Aiizsnyi (1993) Rgos. Mai! Asad si. BOTH 90:5873-5877.

To compare the sequences, you can use computer implementations of these mathematical algorithms to establish the identity of the sequences. Such implementations include without limitation SGYOBZTAI in the RS/Zepe program (available from

IpteiPdepeiiis5, Mountain View, California); AGISM program (version 2.0) and SAR, VE5TRIT, VI A5T,

EAZTA and TEA5TA in SSO Umi5sopvbip Sepeiiis5 5omage RaskKade, version 10 (available from Asseigu5

Ips., 9685 Zsgapiop Coai, San Diego, California, USA). Alignments using these programs can be performed using standard parameters. SI O5TAI program. well described in Niddipz ei a. (1988) Sep 73:237-244 (1988); Niddipv her a!. (1989) SAVIO5 5:151-153; Warm you! (1988) Mysieis Asiaz Ne. 16:10881-90; Nyapo evi a. (1992) SAVIO5 8:155-65; and

Reagzop you a!. (1994) Meiy. My. Cheers! 24:307-331. The AGISM program is based on the algorithm from Mueeg5 apa Mijek (1988) mentioned above. When comparing amino acid sequences in the AGI2M program, you can use the table of weight of substitutions of RAM120O residues, a penalty for the extension of gap 12 and a penalty for opening gap 4. (1990) 9. Mo).

Vioi 215:403 are based on the Kapip and Aivbspsh algorithm! (1990) mentioned above. Nucleotide sequence searches in VI AT can be performed using the VI ATM program with the parameters alignment weight - 100, word length - 12 with obtaining nucleotide sequences homologous to the nucleotide sequence that encodes the protein according to the implementation options. The search for protein sequences in VI A5T can be performed using the VI AZTH program with the parameters alignment weight - 50, word length - C with obtaining amino acid sequences, homologous to the protein or polypeptide according to the implementation options. To obtain an alignment with the introduction of heps for comparison, you can use the Sarrea VI A5T (in VI A5T 2.0), as described in the Ivsepy of this article!. (1997) Mysieis Asiai5

Transportation 25:3389. As an alternative, you can use RBI-VI AT (in VI AT 2.0) to perform an iterative search that reveals distant relationships between molecules. See, Ayvepii ei ai. (1997) above. When using VI A5T, Surrey VI A5T, RBI-VI A5T, standard parameters of the respective programs can be used (for example, VIABTM for nucleotide sequences, VIABTX for proteins). See website of the National Biotechnological Information Center on the Internet at pebi.pIt.pipy.dom. Alignment can also be done manually by inspection. (c) As used herein, "sequence identity" or "identity" in the context of two nucleic acid sequences or polypeptide sequences refers to residues in the two sequences that are the same when aligned for maximum correspondence within a specified comparison window. When percent sequence identity is used in relation to proteins, it is implied that positions of residues that are not identical are often distinguished by conservative amino acid substitutions, whereby the amino acid residues are replaced by other amino acid residues with similar chemical properties (e.g., charge or hydrophobicity) and, therefore, do not change the functional properties of the molecule. If the sequences differ by conservative substitutions, the percent identity of the sequences can be increased to adjust for the conservative nature of the substitution. Sequences that differ by such conservative substitutions are said to be characterized by "sequence similarity" or "similarity". Means for making such a correction are well known to specialists in this field of technology.

As a rule, it involves scoring a conservative substitution as a partial rather than a complete mismatch, thus increasing the percent sequence identity. Thus, for example, if an identical amino acid is assigned a score of 1, and a non-conservative substitution is assigned a score of zero, then a conservative substitution is assigned a score from zero to 1. The score of conservative substitutions in points is calculated, for example, as implemented in the program RS/ZEME , Ca ogpia) (4) As used herein, "percent sequence identity" means a value determined by comparing two optimally aligned sequences within a comparison window, where a portion of the polynucleotide sequence within the comparison window may contain additions or deletions (i.e., hepi ) compared to a reference sequence (which contains no additions or deletions) for optimal alignment of the two 60 sequences. The percentage is calculated by determining the number of positions in which the identical nucleic acid base or amino acid residue occurs in both sequences to obtain the number of overlapping positions, dividing the number of overlapping positions by the total number of positions in the comparison window, and multiplying the result by 100 to obtain percent sequence identity. (eX) The term "substantial identity" of polynucleotide sequences means that the polynucleotide contains a sequence that is at least 7095, 8095, 9095, or 9595 or more identical when compared to a reference sequence using one of the described alignment programs using standard parameters. One skilled in the art will appreciate that these values can be adjusted accordingly to determine the respective identity of the proteins encoded by the two nucleotide sequences, taking into account codon degeneracy, amino acid similarity, reading frame location, and the like. Substantial identity of amino acid sequences for these purposes usually means that the sequences are identical by at least 6095, 70905, 8095, 9095, or 9595 or more.

Another indication that the nucleotide sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions. Typically, rigid conditions are chosen to be about 5°C below Tt for a particular sequence at a given ionic strength and pH. However, rigid conditions range from about 1°C to about 20°C below Tt, depending on the degree of rigidity required. , which is otherwise specified herein. Nucleic acids that do not hybridize to each other under stringent conditions are still substantially identical if the polypeptides they encode are substantially identical. This may be the case, for example, if a copy of the nucleic acid an acid is created using the maximum codon degeneracy allowed by the genetic code. One indication that two nucleic acid sequences are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross-reactive with the polypeptide encoded by the second nucleic acid. ( eXii) The expression "substantial identity" in the context of a peptide indicates that the peptide contains a sequence that less than 7095, 8095, 8595, 9095, 9595 or more identical to the reference sequence within a given comparison window. Optimum alignment for these purposes can be done using the global alignment algorithm of Meea|Ietap apa umipzei (1970) above. An indication that two peptide sequences are substantially identical is that one peptide immunologically reacts with antibodies against the second peptide. Thus, a peptide is substantially identical to a second peptide, for example, where the two peptides differ only by a conservative substitution. Peptides that are "substantially similar" have common sequences as noted above, except that positions of residues that are not identical may differ by conservative amino acid changes.

The use of the term "nucleotide constructs" herein is not intended to limit embodiments to nucleotide constructs that comprise DNA. Those skilled in the art will appreciate that nucleotide constructs, particularly polynucleotides and oligonucleotides that consist of ribonucleotides and combinations of ribonucleotides and deoxyribonucleotides, can also be used in methods disclosed herein. Nucleotide constructs, nucleic acids, and nucleotide sequences, according to embodiments, further include all complementary forms of such constructs, molecules, and sequences. Furthermore, nucleotide constructs, nucleotide molecules, and nucleotide sequences, according to embodiments, include all nucleotide constructs , molecules and sequences that can be used in methods according to the embodiments for plant transformation, including without limitation that consist of deoxyribonucleotides, ribonucleotides and their k combinations Such deoxyribonucleotides and ribonucleotides include both naturally occurring molecules and synthetic analogues. Nucleotide constructs, nucleic acids, and nucleotide sequences according to embodiments also encompass all forms of nucleotide constructs, including without limitation single-stranded forms, double-stranded forms, hairpins, stem-and-loop structures, and the like.

An additional embodiment relates to a transformed organism, such as an organism selected from the group consisting of plant and insect cells, bacteria, yeast, baculovirus, protozoa, nematodes, and algae. The transformed organism contains a DNA molecule according to embodiments, an expression cassette that contains the specified DNA molecule, or a vector that contains the specified expression cassette, which can be stably integrated into the genome of the transformed organism.

The sequences according to the embodiments are provided as part of the DNA constructs for expression in the organism of interest. The constructs will include 5'- and 3'- regulatory 60 sequences operably linked to the sequence according to embodiments.

As used herein, the term "functionally linked" refers to a functional relationship between a promoter and a second sequence, where the promoter sequence initiates and mediates transcription of the DNA sequence corresponding to the second sequence. Generally, operably linked means that the linked nucleic acid sequences are contiguous and, where necessary to combine the two protein-coding regions, contiguous and in the same reading frame. The construct may additionally contain at least one additional gene to be introduced into the body by co-transformation. Alternatively, the additional gene(s) may be provided in multiple DNA constructs.

Such a DNA construct is provided with several restriction sites for sequence insertion

Stu-toxin, the transcription of which will be regulated by regulatory regions. The DNA construct may additionally contain selectable marker genes.

In the 5' - 3' direction of transcription, the DNA construct will include a transcription and translation initiation site (i.e., a promoter), a DNA sequence according to embodiments, and a transcription and translation termination site (i.e., a termination site) that are functional in the host organism. The transcription initiation site (ie, promoter) may be native, homologous, foreign, or heterologous to the host organism and/or sequence in accordance with embodiments. In addition, the promoter may be a natural sequence or alternatively a synthetic sequence. As used herein, the term "foreign" indicates that the promoter is not found in the native organism into which the promoter is introduced. If a promoter is "foreign" or "heterologous" to the sequence according to the embodiments, the promoter is considered not to be native or a naturally occurring promoter for the functionally related sequence according to the embodiments. The chimeric gene used herein contains a coding sequence functionally linked to a transcription initiation site that is heterologous to the coding sequence. If the promoter is a native or native sequence, the expression of the functionally related sequence is altered compared to wild-type expression, resulting in a change in phenotype.

The termination site may be native to the transcription initiation site, may be native to the functionally related DNA sequence of interest, may be

Z is native to the host plant or may be derived from another source (ie, foreign or heterologous to the promoter, the sequence of interest, the host plant, or any combination thereof).

Suitable termination sites are available from the Ti-plasmid A. Shtegiasiepv5, such as the termination sites of the octopine synthase and nopaline synthase genes. See also Sycehipeacm ei ai. (1991) Mine. Sept. Sepoys 262:141-144; Rgotsagooi (1991) Sei! 64:671-674; Zapiasop eyi ai. (1991) Sepe5 Yuem. 5:141-149;

Modep ey ey. (1990) Ryapi Sei! 2:1261-1272; Mypgoe ei ai. (1990) Sep 91:151-158; Vaiyaz ei ai. (1989) Mysieis Asia5 Nev. 17:7891-7903; and dovi her a. (1987) Mysieis Asia Ne. 15:9627-9639.

If necessary, the nucleic acid can be optimized for enhanced expression in the host organism. Thus, if the host organism is a plant, synthetic nucleic acids using plant-preferred codons can be synthesized to enhance expression.

See, for example, Satrrbei! and Som/gi (1990) Riapi Rnuzioi. 92:1-11 for consideration of host-preferred codon usage. For example, although the nucleic acid sequences of embodiments may be expressed in both monocot and dicot plant species, the sequences may be modified to account for specific codon preferences and preferences for Y4C content in monocots or dicots, as these preferences have been shown to differ ( Myitau ei A. (1989) Mysivis Acid5 Nev. 17:477-498). Thus, the maize-preferred codon for a particular amino acid can be established from known maize gene sequences. Maize codon frequency data for 28 genes from maize plants are shown in Table 4 in Miitau Yei ai, above. From the state of the art, methods of synthesizing genes preferred for plants are available. See, for example, US Patent Nos. 5,380,831 and 5,436,391, and Mitau et al. (1989) Mysivys Asia5 Nev. 17:477-498, incorporated herein by reference.

Additional sequence modifications are known to enhance gene expression in the cellular host. These include the elimination of sequences that encode false polyadenylation signals, exon and intron splice site signals, transposon-like repeats, and other well-studied sequences that may be detrimental to gene expression. The content of C in the sequence can be adjusted to levels average for a given cellular host, calculated taking into account known genes expressed in the host cell. As used herein, the term "host cell" refers to a cell that contains a vector and that supports the replication and/or expression of the intended expression vectors. Host cells can be either prokaryotic cells, such as E. soy, or eukaryotic cells, such as yeast, insect, amphibian, or mammalian cells, or cells of monocotyledonous or dicotyledonous plants.

An example of a host cell belonging to a monocot is the host cell of maize. If possible, the sequence is modified to prevent the formation of the predicted hairpin secondary structures of the mRNA.

Expression cassettes may additionally contain 5'-leader sequences. Such lead sequences can contribute to broadcast amplification. Translation leader sequences are known in the art and include: leader sequences of picornaviruses, for example the leader sequence (Encephalomyocarditis virus 5'-coding region) (EiIgou-5ivip eii a). (1989) Rgos. Mai). Asad

All together. OBA 86: 6126-6130); leader sequences of potyviruses, for example, the leader sequence

TEM (tobacco engraving virus) (Saye et al. (1995) Sepe 165(2): 233-238), the leader sequence

MOMU (maize dwarf mosaic virus), human immunoglobulin heavy chain binding protein (HIiR) (Maseak et al. (1991) Mate 353: 90-94); unbroadcast leader sequence from

Alfalfa mosaic virus envelope protein mRNA (AMM EMA 4) (Uobiipo sei a. (1987) Mayte 325: 622-625); the leader sequence of the tobacco mosaic virus (TMU) (Saie eyi a!. (1989) MoiIesshtiag Vioi (odu oi VMA, ed. Sessions (I izv5, Mem Mogk), pp. 237-256); and the leader sequence of the corn chlorosis mosaic virus ( MSMU) (I ottei ei ai. (1991) Migoiodu 81: 382-385). See also , OeiyiIia-Siorra ei ai!. (1987)

Riapi RNuzioi!. 84: 965-968.

When generating an expression cassette, the various DNA fragments can be manipulated to obtain DNA sequences in the proper orientation and, if necessary, in the proper reading frame. To do this, adapters or linkers can be used to combine DNA fragments, or other manipulations can be used to provide suitable restriction sites, remove excess DNA, remove restriction sites, etc. To do this, you can use mutagenesis, repair with primers, restriction, hybridization, repeated replacements, for example, transitions and transversions.

A number of promoters may be used in the practice of embodiments. Promoters can be chosen taking into account the desired result. Nucleic acids can be combined with constitutive, tissue-preferred, inducible, or other promoters for expression in a host. Suitable constitutive promoters for use in a plant host cell include, for example, the promoter core promoter

Zo K5zup7 and other constitutive promoters disclosed in document LO 99/43838 and US patent Mo 6072050; core promoter 355 Sammr (Bavey! ei A. (1985) Maishge 313: 810-812); rice actin promoter (MeEiYigou ei a!. (1990) Riapi Sei! 2: 163-171); ubiquitin promoter (SnNgiviepzep ei a. (1989) Riapi Moi. Vioi. 12: 619-632 and Spgiz(iepzep ei ai. (1992) Riapi Moi. Vioi. 18: 675-689);

REMY (Havi yei ai. (1991) Tieog. Arri. Sepei. 81: 581-588); МА5 (Meyep ei ai. (1984) EMVO 3. 3:2723-2730); AI 5 promoter (US patent Mo 5,659,026), etc. Other constitutive promoters include, for example, those disclosed in US patents MoMo 5,608,149; 5,608,144; 5,604,121; 5,569,597; 5,466,785; 5,399,680; 5,268,463; 5,608,142; and 6,177,611.

Depending on the desired result, it may be useful to express the gene using an inducible promoter. Wounding-induced promoters are of particular interest for regulation of the expression of nucleotide sequences according to variants of implementation in plants. Such wound-inducible promoters can respond to damage caused by insect feeding and include the promoter of the potato proteinase inhibitor (rip II) gene (Buap (1990) App. Nem. Rpuyuraij. 28: 425-449; Yutsap et al. ( 1996) Maishge Viotesppoiodu 14: 494-498); promoters of myp1 and ulip2 genes, US patent No. 5428148; promoters of m/ip1 and m/ip2 genes (Etaptoga ei ai. (1989) Moi. Sep. Sepei. 215: 200-208); promoter of the systemin gene (Mesy! ei ai. (1992) bsiepse 225: 1570-1573); the promoter of the UMIR1 gene (Voptvieg ei ai. (1993) Riapi Moi. Vioi. 22: 783-792; EsKeIKatr ei aI. (1993) RGEV5 I eige 323: 73-76); the MRI gene promoter (Sogaegok ei ai. (1994) Riapi 9. 6(2): 141-150), etc., are incorporated herein by reference.

In addition, pathogen-inducible promoters may be used in the methods and nucleotide constructs according to embodiments. Such pathogen-induced promoters include promoters from genes associated with the pathogenesis of proteins (PE proteins), which are induced after infection with a pathogen; for example, PE. proteins, ZAC proteins, beta-1,3-glucanase, chitinase, etc.

See, for example, Neodbi!yi ei ai. (1983) May. 9. Riapi Raipoi. 89: 245-254; Okpez ei ai. (1992) Riapi

Sow! 4: 645-656; and Map I oop (1985) by Riapi Moi. Migoi 4: 111-116. See also UUO 99/43819, incorporated herein by reference.

Of interest are promoters that are expressed locally at or near the site of pathogen infection. See, for example, Magipeai sei ai. (1987) Riapi Moi. Vio!. 9:335-342; Matsop ey a). (1989) Moiesshiag Riapi-Mistore Ipiegasiyup5 2:325-331; 5 gave her a!. (1986) Rgos. Mai! Asai. 5

IBA 83:2427-2430; botvivsp her ai. (1988) Mine. Sept. Sepoys 2:93-98; and Mapd (1996) Rgos. Mai! because Assad si. BOTH 93:14972-14977. See also, Spep ei ai. (1996) Riapi 9. 10:955-966; 7 Napo ei ai.

(1994) Rgos. Mai! Asad 5 OBA 91:2507-2511; Mateg her a!. (1993) Riapi U. 3:191-201; biweben? Hey! (1989) Riapi SciI 1:961-968; US Patent No. 5,750,386 (nematode-induced) and sources cited herein. Of special interest is the inducible promoter for the corn RAtv5 gene, the expression of which is initiated by the pathogen Eizagtt topiiogte (see, for example,

Sogaego evy a!. (1992) РНузиои!. My. Riapi Rai. 41:189-200).

Chemically regulated promoters can be used to modulate gene expression in a plant by introducing an exogenous chemical regulator. Depending on the purpose, the promoter can be a chemically inducible promoter, in which case application of the chemical induces gene expression, or a chemically repressed promoter, in which case application of the chemical inhibits gene expression.

Chemically induced promoters are known in the art and include, without limitation, the maize Ip2-2 promoter, which is activated by antidotes to benzenesulfonamide herbicides, the maize 51 promoter, which is activated by hydrophobic electrophilic compounds used as preemergence herbicides, and the tobacco PBA-ia promoter. which is activated by salicylic acid. Other chemically regulated promoters of interest include steroid-sensitive promoters (see, for example, the glucocorticoid-inducible promoter in 5sNepa evi ai. (1991) Rhos. Mai). Asad si. BOTH 88:10421-10425 and

MeMeiiyiv ei a. (1998) Riapi 9. 14(2):247-257) and tetracycline-inducible and repressible promoters (see, e.g., Sai et al. (1991) Moi. Sep. Sep. 227:229-237, and patents

US Patent Nos. 5,814,618 and 5,789,156) are incorporated herein by reference.

Tissue-preferred promoters can be used to target the expression of a pesticide protein within a specific plant tissue. Tissue-preferred promoters include the promoters discussed in Matatoyo et al. (1997) Riapi 9. 12(2)255-265;

Kamataia yei ai. (1997) Riapi Seiyi Rnuzio!. 38(7):792-803; Napzep ei ai. (1997) Mine. Sep Sepei. 254(3):337-343; Newbies! oh oh (1997) Ttapzdepis Nev. 6(2):157-168; Vipepap ey ai. (1996) Riapi

РНузиой 112(3):1331-1341; Map Satr ei a!. (1996) Riapi RNuzioi!. 112(2):525-535; Sapemavsipi ei ai. (1996) Riapi RNuvzioi. 112(2):513-524; Matatoi ei ai. (1994) Ryapi Sei! Ryuzioi!. 35(5):773-778; | at (1994) Veziyv Rgobi. Sow!! Oiyeg. 20:181-196; Ogo2so her a!. (1993) Riapi Moi Vioi. 23(6):1129-1138;

Maigioka evi ai. (1993) Rgos Mai!. Asad 5 OBA 90(20):9586-9590; and scemaga-Sagsia ei ai. (1993)

Zo Riapi U. 4(3):495-505. If necessary, such promoters can be modified to obtain weak expression.

Promoters active mainly in the leaf are known in the art. See, for example, HUatatoio ei a. (1997) Riapi 7. 12(2):255-265; Kuop ey ay. (1994) Riapi Rpuzioi. 105:357-67; Matatoyo ei ai. (1994) Ryapi Sei! Rnuzioi 35(5):773-778; Siyuiog yei ai. (1993) Riapi U. 3:509-18; Ogo2so ei ai. (1993)

Riapi Moi. Vioi 23(6):1129-1138; and MaiztsokKa ei a!. (1993) Rgos. Mai! Asad si. OBA 90(20):9586-9590.

Promoters active primarily in roots or root-specific promoters are known and can be selected from many available in the literature or isolated de pomo from a variety of compatible species. See, for example, Nige yei ai. (1992) Riapi Moi. Vioi 20(2):207-218 (soybean root-specific glutamine synthetase gene); KePeg and Vashtoagipeg (1991) Riapi Sei!

Z3(10):1051-1061 (root-specific regulatory element in the SVR 1.8 gene of beans); (1990) Riapi Moi. Vioi 14(3):433-443 (root-specific manopin-synthase (MA5B) gene promoter from Adgobasiegiit ystegasiepv); and Miao ei ai. (1991) Riapi Seii 3(1):11-22 (a full-length cDNA clone encoding a cytosolic glutamine synthetase (5) expressed in soybean roots and root nodules). See also Vodyv2 evi ai!. (1990) Ryapi Sei! 2(7):633-641, which describes two root-specific promoters isolated from hemoglobin genes from the nitrogen-fixing non-legume Ragazropia apaegsopia and the related non-legume Tgteta

Ttepiosis, which does not fix nitrogen. The promoters of these genes were linked to the reporter gene of VD-glucuronidase and introduced both into the non-legume Misoiapa jarasit and into the leguminous plant I oii5 sogpischatsv, and in both cases the activity of the promoter, specific for the root, was preserved. Yeasp and Asouadi (1991) describe their analysis of promoters that confer high levels of expression of the goiC and go100 genes of Adgobasiect gpigodepev, which induce root growth (see Journal of Epigenetics 79(1):69-76). They concluded that the enhancer and tissue-predominant DNA determinants are separated in these promoters.

Teveti her a). (1989) used a gene fusion with Ias/7 to show that the gene from T-DNA

Adgobasiegist, which encodes octopine synthase, is particularly active in the root tip epidermis and that the TK2 gene is root-specific in the intact plant and is stimulated during leaf tissue damage, a particularly desirable combination of properties for use with an insecticidal or larvicidal gene (see EMVO.). 8(2):343-350). The TACT gene, fused with pribo (neomycin phosphotransferase I!I), demonstrated similar characteristics. Additional root-preferred promoters include the promoter of the MEMO0B-SVARZ gene (Kivieg et al. (1995)

Riapi Moi. Vioi 29(4):759-772); and promoter of goIV (Sarapa evi a!. (1994) Riapi Moi. Vioi. 25(4):681-691.

See also US Patent MoMo 5,837,876; 5,750,386; 5,633,363; 5,459,252; 5,401,836; 5,110,732; and 5,023,179.

Promoters "predominantly active in seeds" include both "seed-specific" promoters (promoters that are active during seed development, such as seed storage protein promoters) and "seed germination" promoters (promoters that are active during germination seed). See Ppotr5op her ai. (1989) VioEzzauz 10:108, incorporated herein by reference. Such seed-preferred promoters include, without limitation, promoters of the Sit! (cytokinin-induced transcript); c21981 (19 kDa maize zein) and thiir5 (myo-inositol-1-phosphate synthase); (see US Pat. No. 6,225,529, incorporated herein by reference). The promoters of the gamma-zetnu and Sbiorb-1 genes are endosperm-specific promoters. In dicotyledonous plants, seed-specific promoters include, but are not limited to, gene promoters for bean B-phaseolin, napin, VD-conglycinin, soybean lectin, cruciferin, and the like. In monocots, seed-specific promoters include, but are not limited to, gene promoters for 15 kDa zein, 22 kDa zein, 27 kDa zein, d-zein, zahr, zpgypKep 1, 5pgypKep 2, maize globulin 1, and the like. See also included in this document by reference is document M/O 00/12733, which discloses promoters, active mainly in seeds, from genes epa!1 and epag2. A promoter that has "predominant" expression in a particular tissue is expressed in that tissue to a greater extent than in at least one other plant tissue. For some promoters active mainly in a certain tissue, expression is shown almost exclusively in a specific tissue.

If a low level of expression is required, weak promoters will be used. Generally, as used herein, the term "weak promoter" refers to a promoter that drives the expression of a coding sequence at a low level. Low expression levels are understood to be levels from about 1/1000 transcripts to about 1/100,000 transcripts, to about 1/500,000 transcripts. Alternatively, it is understood that the term "weak promoters" also covers promoters that drive expression in only a small number of cells and do not drive in others, while providing an overall low level of expression. If

Since the promoter drives expression at unacceptably high levels, parts of the promoter sequence can be deleted or modified to reduce expression levels.

Such weak constitutive promoters include, for example, the promoter core promoter

Vzup7 (MO 99/43838 and US patent Mo 6,072,050), core 355 Samm promoter, etc. Other constitutive promoters include, for example, those disclosed in US patents MoMo 5,608,149; 5,608,144; 5,604,121; 5,569,597; 5,466,785; 5,399,680; 5,268,463; 5,608,142; and 6,177,611;, incorporated by reference.

As a rule, the expression cassette will contain a selectable marker gene for selection of transformed cells. Selective marker genes are used to select transformed cells or tissues. Marker genes include genes responsible for antibiotic resistance, such as genes encoding neomycin phosphotransferase I! (MEO) and hygromycin phosphotransferase (HRT), as well as genes that confer resistance to herbicide compounds such as glufosinate ammonium, bromoxynil, imidazolinones, and 2,4-dichlorophenoxyacetate (2,4-0)0. Additional examples of suitable selectable marker genes include, without limitation, genes encoding resistance to chloramphenicol (Ne!tega EzigeiYia ei ai!. (1983) EMVO .. 2:987-992); of methotrexate (Neigtega EvigeiPa yei a!. (1983) Mashge 303:209-213; and Meieg yei a. (1991) Riapi Mo).

Vio!. 16:807-820); streptomycin (Chopez ei ai. (1987) Moi. Sep. Sepei. 210:86-91); spectinomycin (Vgeiadpe-Zadpaga ei ai. (1996) Tgtapzdepis Res. 5:131-137); bleomycin (NiMe yei ai. (1990) Riapi

My. Vioi 7:171-176); sulfonamide (Siegipeai ei a). (1990) Riapi Moi. Vioi 15:127-136); bromoxynil (EyayiKeg ei a. (1988) Zsiepse 242:419-423); of glyphosate (Nam eyi a. (1986) Zsiepse

BO 233:478-481; and US Patent No. 7,709,702; and 7,462,481); phosphinothricin (OevVioskK ei ai. (1987) EMVO 9. 6:2513-2518). See in general, Matapiop (1992) Sy. Orip. Vioyesn. Q: 506-511;

Spgivornegzop ei ai. (1992) Rgos. Mai). Asai. axis OBA 89: 6314-6318; Mao evy a!. (1992) Sei| 71: 63-72; Vegpikoi (1992) Mine. Mistgobio!. 6: 2419-2422; Vatkieu evi a. (1980) ip Te Oregop, pp. 177-220;

We are here. (1987) SeiI 48: 555-566; Vgoulp vii a)i. (1987) Sei! 49: 603-612; Ridde sei ai. (1988) Sei! 52: 713-722; YuOeizspie eyi a. (1989) Rgos. Mai)!. Asai. 5 BOTH 86: 5400-5404; Riegzi ei ai. (1989) Rgos.

May Asad 5 BA 86: 2549-2553; YueizsNie sei a. (1990) psiepse 248: 480-483; Sov5z5ep (1993) doctoral dissertation, and Maishge Opimeg5Pyu oi NeideIrego; Neipev5 ei ai. (1993) Rgos. Mai). Asad

All together. BOTH 90: 1917-1921; And the aroma of it. (1990) Mine. Seiya Vioi 10: 3343-3356; gatrgeni ei ai. (1992)

Rgos. Mai! Asad 5 OBA 89: 3952-3956; Wait yei ai. (1991) Rgos. May). Asad 5 BOTH 88: 5072- 60 5076; Murog»kKi eyi a. (1991) Mysiveis Acid5 Nev. 19: 4647-4653; Nipepapa-Mivvtap (1989) Toris5

Zo

My. Bigis. Vioi 10: 143-162; Oedepkoi ei ai. (1991) Apiitisgora. Adepi5 Spetoipeg. 35: 1591-1595;

Kivip5sypidchi ei ai. (1988) Viospetivmshu 27: 1094-1104; Vopip (1993) doctoral dissertation,

Opimegzyu oi NeideIregu; Sov55ep ei ai. (1992) Rgos. Mai! Asai. si. BOTH 89: 5547-5551; Oiima ei a. (1992) Apiitistor. Adepi5 SpetoiNeg. 36: 913-919; Niamka eh!. (1985) Napabrook oi Ehregitepiai!

Ripaptasoioadu, Moi. 78 (Zrgipdeg-Mepad, Vegpip); and SiIIi ei aI. (1988) Mayte 334: 721-724. Such disclosures are incorporated herein by reference.

The above list of selected marker genes is not intended to be limiting. Any selectable marker gene may be used in embodiments.

The methods according to the embodiments include the introduction of the polypeptide or polynucleotide into the plant. "Introduction" is understood to mean providing a plant with a polynucleotide or polypeptide in such a way that the sequence enters the plant's cell. The methods according to the variants of implementation do not depend on the specific method of introducing the polynucleotide or polypeptide into the plant, it is only necessary that the polynucleotide or polypeptides get inside at least one cell of the plant. Methods of introducing polynucleotides or polypeptides into plants are known in the art, including, but not limited to, stable transformation methods, transient transformation methods, and virus-mediated transformation methods.

"Stable transformation" is meant to mean that the nucleotide construct introduced into the plant integrates into the plant's genome and can be inherited by its progeny.

By "temporary transformation" it is meant that the polynucleotide is introduced into the plant and does not integrate into the genome of the plant or the polypeptide is introduced into the plant.

Transformation protocols, as well as protocols for introducing nucleotide sequences into plants, may vary depending on the type of plant or plant cell, i.e., monocotyledons or dicotyledons, to which the transformation is directed. Suitable methods of introduction of nucleotide sequences into plant cells and subsequent insertions into the plant genome include microinjection (Stozvulau eyi a!. (1986) Viojesppidnez 4: 320-334), electroporation (Vidd5 ei ai. (1986) Rgos. Mai). Asad si. OBA 83: 5602-5606), transformation mediated by Adgobasiegiit (US patents MoMo 5,563,055 and 5,981,840), direct gene transfer (Raz2Kom»kKi yei ai. (1984)

EMVO U. 3: 2717-2722) and ballistic acceleration of particles (see, for example, US patents Mo Mo 4,945,050; 5,879,918; 5,886,244; and 5,932,782; Totevs et al. (1995) and Riapi Seyi, Tizvie, apa Ogdap

Siyige: Ripdatepia! Meinod5, unit Satrogd and RpPyir5 (Zrgipdeg-Megiad, Vepgip); and MeSabe ei ai. (1988) Biochemistry 6: 923-926); and transformation of the Hesi gene (MO 00/28058). Regarding the transformation of potatoes, see Ty ei ai. (1998) Journal of Biochemistry 37: 829-838 and Supp. (2000) Tktapzdepis Nezeagsp 9: 71-78. Additional methods of transformation can be found in /MUviiizzipodeg eyi ai. (1988) App. Wow Sepoys 22: 421-477; It's a warning! (1987) Rapisshaie bsiepse apa

Thesppoiodu 5: 27-37 (onion); SNgizoyi her ai. (1988) Riapi RNuzioi!. 87: 671-674 (soybean); MeSabe 6th ai. (1988) Vio/Thesppoiodu 6: 923-926 (soybean); Ripeg and MemMyShep (1991) Yip Myo Sei! Omg Cheers! 27P: 175-182 (soy); BZipuop ei a. (1998) Theog. Arri. Sepoys 96: 319-324 (soybean); Oh, yes, yes. (1990)

Journal of Journal 8: 736-740 (fig); KiIvip ei ai!. (1988) Rhos. Mai! Asad si. OBA 85: 4305-4309 (May);

KIVIP her a. (1988) Journal of Biochemistry 6:559-563 (Maize); US patent MoMo 5,240,855; 5,322,783 and 5,324,646; Kiwip her a. (1988) Riapi Rpuzioi. 91: 440-444 (May); Egott ei ai. (1990) Viotesppoiodu 8: 833-839 (maize); Nosukaaz-Map 5iodiehep ei a!. (1984) Mashteye (I opdop) 311: 763-764; US patents

Mo 5,736,369 (cereals); Vuiebieg ei a. (1987) Rhos. May Asai. axis BOTH 84: 5345-5349 (Piaseae); Oye M/ei yei ai. (1985) ip Tne Ehregitepia! Mapirshtiayop oi Omshe Tizztsev, ex. Spartap eyi ai. (Hopdtap, Mem/Mo), 197-209 (pollen); Kaerrieg heri a. (1990) Ryapi Sei! Nerogiz 9: 415-418 and Kaerrieg et al. (1992) Tneog. Arri. Sepoys 84: 560-566 (transformation mediated by filamentous crystals); O'NaiIcip ei a!. (1992) Riapi Sei| 4: 1495-1505 (electroporation); Hey, hey! (1993) Riapi Sei! Verohiv 12: 250-255 and Spgivoyi and Roga (1995) Appai5 oi Voiapu 75: 407-413 (fig); Ov5ioda her a. (1996) Maize Biosciences 14: 745-750 (maize with Adgobasiept

Ishtegasiepv5); all of which are incorporated herein by reference.

In specific embodiments, the sequence according to the embodiments can be provided to the plant using a number of methods of temporary transformation. Such methods of temporary transformation include, without limitation, the introduction of the Stu-toxin protein or its variants and fragments directly into the plant or the introduction of the Stu-toxin transcript into the plant. Such methods include, for example, microinjection or particle bombardment.

See, for example, Stoz5mau ei ai. (1986) Mine! Sept. Sepoys 202: 179-185; Her hoe! (1986) Riapi zZsi. 44: 53-58; I don't care. (1994) Rgos. Mai). Asad 5 91: 2176-2180 and Nyvy ei ai. (1994) Tne

Thank you! Journal of Science 107: 775-784, all of which are incorporated herein by reference. Alternatively, the plant can be temporarily transformed with Stgutoxin polynucleotide using techniques known in the art. Such techniques include the use of a viral vector system and deposition of the polynucleotide in such a way that excludes further release of DNA. Thus, transcription of particle-bound DNA can occur, but the frequency with which it is released for integration into the genome is greatly reduced. Such methods include the use of particles coated with polyethyleneimine (REI; Mo according to Zidt's cat. RZ143).

Methods of targeted insertion of a polynucleotide into a specific location in the plant genome are known from the state of the art. In one embodiment, the insertion of a polynucleotide into the required location in the genome is performed using a site-specific recombination system. See, for example, U/099/25821, MO099/25854, M/099/25840, M/099/25855, and

M/099/25853, all of which are incorporated herein by reference. Briefly, a polynucleotide according to embodiments can be contained in a transfer cassette flanked by two non-identical recombination sites. The transfer cassette is introduced into a plant that has a stably integrated target site in its genome flanked by two non-identical recombination sites that correspond to the transfer cassette sites.

A suitable recombinase is provided and the transfer cassette is integrated into the target site.

The polynucleotide of interest is thus integrated into a specific chromosomal position in the plant genome.

From cells that have been transformed, plants can be grown according to traditional methods. See, for example, MeSoptiskK ei ai. (1986) Riapi Seyi Veropv 5: 81-84. These plants can then be grown and/or pollinated using the same transformed line or other lines and the resulting hybrid identified with constitutive or inducible expression of the desired phenotypic characteristic. Two or more generations can be grown to ensure that the expression of the desired phenotypic characteristic is stably maintained and inherited, and then the seeds harvested to ensure that the expression of the desired phenotypic characteristic has been achieved.

Nucleotide sequences according to embodiments can be provided in a plant by contacting the plant with a virus or viral nucleic acids. As a rule, such methods include the incorporation of a nucleotide structure of interest into a viral DNA or RNA molecule. It is clear that the recombinant proteins according to the variants

In practice, they can be pre-synthesized as part of a viral polyprotein, which can later be processed by proteolysis of mimo or mimo with the formation of the necessary pesticidal protein. It is also clear that such a viral polyprotein, which contains at least part of the amino acid sequence of a pesticide protein according to embodiments, may have the required pesticidal activity. Such viral polyproteins and the nucleotide sequences encoding them are encompassed by embodiments. Methods of obtaining plants with nucleotide constructs and production of encoded proteins in plants, which include viral DNA or RNA molecules, are known in the art. See, for example, US Patents MoMo 5,889,191; 5,889,190; 5,66,785; 5,589,367; and 5,316,931; incorporated herein by reference.

Embodiments additionally relate to material for propagating a transformed plant according to embodiments, including without limitation seeds, tubers, corms, bulbs, leaves, and root and shoot cuttings.

The implementation options can be used to transform any types of plants, including without limitation monocots and dicots. Examples of plants of interest include, but are not limited to, corn (7ea tauv), Vgazv5isa 5r. (for example, V. pariv, V. gara, V. |ppseea), in particular species of Vgazzis, suitable as sources of oil from the seeds of plants, alfalfa (Medisado zaeima), rice (Oguga zaeima), rye (ZesaIe segeaiIe), sorghum (Bogaiit bBisoYog, 5ogdpyt ucIdage), millet (for example, penisetum gray (Reppiezest diaisit), cultured millet (Rapisit tiiiacecyt), Italian mouse (Zeiagia maiiisa), finger millet (EiIeizipe sogasapa)), sunflower (Neiyiapipyv appiiv5), safflower (Sapypative (ipsiogiiv ), wheat (Tyysit ayeevziimit), soybean (Siusipe tah), tobacco (Misoyapa iabasit), potato (Boiapyt Shbego5it), varieties of peanuts (Agaspiv

Nurodaea), cotton (Sovzzurisht Bagradepziee, Soz5urisht PigzciShyt), sweet potato (Irotoea bBaiaishv), cassava (Mapinoi ezsciepia), coffee tree (Soyiyea 5yr.), coconut palm (Sosoz pisiyega), pineapple (Apapa5 sotovzyv), citrus trees (Syitiv5 yr .), chocolate tree (Tneobgota sasas), tea bush (Sateiia vipepvziz), banana (Myza 5rr.), avocado (Regzea ategisapa), fig (Risiv savisa), guava (Rzidisht dia|ama), mango (Mapodiiega ipais), olive (Oiea eshgoraea), papaya (Sagisa raraua), cashew (ApasagaiiSht ossidepiaie), macadamia (Masadatia ipieedgitiia), almond (Rhypyvb atudaa!nv5), sugar beet (Veia mpiYidagiv), sugar cane (Zasspagit 5rr.), varieties oats, barley, vegetables, ornamental plants and conifers.

Vegetables include tomatoes (I usoregzisop ezscepsht), lettuce (e.g. I asissa zayiima), green beans (Riazeoii5 miiYidagi5), lima beans (RNazeoii5 Itepviv), varieties of peas (I aitugiv 5rr.) and members of the genus Sisitis such as cucumber (C . Ornamental plants include azalea (ANPododepagop 5yr.), hydrangea (Mastgornuia Nuagapaovea), hibiscus (Nirizsy5 gozazapepviv), roses (Koza 5yr.), tulips (Tiiiira 5yr.), daffodils (Magsizbviv 5yr.), petunias (Reishpia Nugbida), carnation (Oiapipib5 saguorpuiiv), poinsettia (Enirpobia ryIspetita) and chrysanthemum. Coniferous trees that can be used in the practical application of the embodiments include, for example, pine species such as Scots pine (Ripe iaeda), Elliott pine (Ripe eiioii), Scots pine (Ripe5 ropadegosa), Scots pine (Ripe sopiopa), and Radiant pine (Ripie gadiaia); Pseudotsugu Menzies (Rzeidoizida tept?ievia); Canadian tsuga (T5uda sapadepviv); gray spruce (Risea diaysa); sequoia (bBedioia zetreguigepv); types of fir, such as sweet fir (Abbieh atariev) and balsam fir (Abieh raizatea); and cedars, such as giant thuja (TNzia riisaia;) and Nutkan cypress (Spatayesuragi5 pooikKaiepviz). Plants according to embodiments include crop plants, including but not limited to corn, alfalfa, sunflower,

Vgazzisa 5 years, soybeans, cotton, safflower, peanuts, soybeans, wheat, millet, tobacco, sugar cane, etc.

Varieties of lawn grass include, without limitation, annual sedge (Roa appia); one-year-old was resurrected (I ot tiy Piogit); thin leg compressed (Roa sotrgezza); red changed fescue (Eevishsa girga); thin whisk (Aagoziiv yepiiv); swamp broom (Adgovii5 raiYishivigv); desert ryegrass (Adgorugop dezepogyt); combed ryegrass (Adgorugop sgiviait); long-leaved fireweed (Reziisa Iopdiioia); bowhead (Roa rgaiepviv); mixed wheatgrass (Oasiuiiv5 diotegaia); perennial fenugreek (I oiisht regeppeye); red bonfire (Reziysa gibga); white panicle (Adgovii5 aiIba); ordinary thin leg (Roa igimiaiiv); sheep fire (EReziisa omipa); thornless stork (Vhgotiv ipegtiv); reed sedge (Reziisa agypaipasea); timothyivka luchna (Rnieit rgaiepze); dog's broom (Adgovii sapipa); poissinci placed (Rissipeiia aiviapv); couch grass

Smita (Adhorugop v5tiiii); swineherd (Supodop 5yr.); Augustine grass (5iepoiarpgit vesipaayt); zoysia (7 ovzia 5 years); noticeable buckwheat (Razraisht poiaisht); axonopus of Athens (Achoporib5 aiipiz); x eremochla snake tail (Egetospioa orPpiygoiide5); Kikuyu (Rappizest

From siapdezipit); vaginal paspalum (Razraiisht madipaisht); mosquito grass (Voseiotsa dgasiyiv); bison grass (Vysnioe dasiuioidv); butelua side (Woshieyotsa sipirepaschtia).

Plants of interest include cereal plants that produce seeds of interest, oil plants, and legumes. Seeds of interest include seeds of cereal crops such as corn, wheat, barley, rice, sorghum, rye, millet, etc.

Oil plants include cotton, soybean, safflower, sunflower, Vgazzisa, corn, alfalfa, palm, coconut, flax, castor, olive, etc. Legumes include varieties of beans and varieties of peas. Beans include guar, carob, chickpeas, soybeans, varieties of common beans, cowpeas, golden beans, lima beans, string beans, varieties of lentils, turkey peas, and more.

In certain embodiments, the nucleic acid sequences according to the embodiments can be packaged with any combination of polynucleotide sequences of interest to generate plants with the desired phenotype. For example, polynucleotides according to embodiments can be packaged with any other polynucleotides that encode polypeptides with pesticidal and/or insecticidal activity, such as other toxic B proteins (described in US Patents 5,366,892; 5,747,450; 5,736,514; 5,723,756; 5,593,881; and Seizeg (1986) Sepe 48:109), pentine (described in US Pat. No. 5,981,722), etc. The resulting combinations may also include multiple copies of any polynucleotide of interest. Polynucleotides, according to embodiments, can also be packaged with any other gene or combination of genes to produce plants with various combinations of desired traits, including without limitation traits desirable for animal feed use, such as genes that cause high oil content (eg, US patent Mo 6,232,529); balanced amino acid content (e.g., chordothionine (US Patents MoMo 5,990,389; 5,885,801; 5,885,802; and 5,703,049); high lysine barley (MMPShiatwop ei ai. (1987) Yeshig. U. Biospet. 165: 99-106; and MO 98/ 20122) and proteins with a high methionine content (Redegzep et al. (1986) y. Viol. Spet. 261: 6279;

Kiginaga her a. (1988) Sepe 71: 359; and Myzytiga her a!. (1989) Riapi Moi. Vioi 12: 123)); increased digestibility (eg, modified storage proteins (US patent Mo 6,858,778); and thioredoxin genes (US patent Me 7,009,087), the disclosures of which are incorporated herein by reference.

Polynucleotides, according to embodiments, can also be packaged with traits desired for disease or herbicide resistance (eg, fumonisin detoxification genes (US Pat. No. 5,792,931); avirulence and disease resistance genes (opev5ei a. (1994) Zsiepse 266:789; (1993) Physiology 262: 1432; and Mipahyposis Physiology (1994) Physiol. 78:1089); acetolactate synthase (AI5) mutants that confer herbicide resistance, such as mutations 54 and /or Nougat; resistance to glutamine synthase inhibitors such as phosphinothricin or bBavzia (eg, the bai gene); and those conferring resistance to glyphosate (the ERBRB gene and the SAT gene, which are disclosed in US Patent Nos. 7,709,702 and 7,462,481; and with traits desirable for processing or processing products, such as high oil content (eg, US Patent No. 6,232,529); modified oils (eg, fatty acid desaturase genes (US Patent No. 5,952,544; MO 94/11516)); modified starches ( example,

ArROS-pyrophosphorylases (ASTRase), starch synthases (55), starch-debranching enzymes (5BE) and starch-debranching enzymes (5OBE)); and with polymers or bioplastics (e.g., US Patent No. 5,602,321; beta-ketothiolase, polyhydroxybutyrate synthase, and acetoacetyl-CoA reductase (Zsp!Ibepy ei ai. (1988) 9. Vasiyo!. 170: 5837-5847), with features that facilitate the expression of polyhydroxyalkanoates (PA)), the disclosures of which are incorporated herein by reference. Polynucleotides of embodiments can also be combined with polynucleotides that confer agronomic traits such as male sterility (see generally US Patent No. 5,583,210), stem vigor, flowering time, or transformation technology traits such as cell cycle regulation or gene targeting (e.g. UUO 99/61619; MO 00/17364; MO 99/25821), disclosures of which are incorporated into this document by reference.

In another embodiment, the packaged feature may be a regulatory approved feature or facility well known to one skilled in the art and can be found on the Environmental Risk Assessment Center website (sega-dte.ogd/?asiop -dt page daiavraze, which can be accessed using the prefix mimlm) and on the website of the International Service for the Acquisition of Agrobiotechnological Applications (izaaa.oga/dtarrgomaIdagaraze/detashaszr, which can be accessed using the prefix m/mlm).

These packaged combinations can be created in any way, including without limitation cross-breeding of plants using any traditional method, or the TORSKO5529U method, or genetic transformation. If traits are packaged by genetic transformation of plants, the polynucleotide sequences of interest can be combined at any time and in any order. For example, a transgenic plant that contains one or more required traits can be used as a target for introducing additional traits through sequential transformation. Markers can be introduced simultaneously in a co-transformation protocol with polynucleotides of interest that are represented by any combination of transformation cassettes. For example, if two sequences are to be introduced, then these two sequences can be contained in separate cassettes for transformation (trans) or contained in one cassette for transformation (cis). The expression of these sequences can be controlled by the same promoter or by different promoters. In certain cases, it may be necessary to introduce a transformation cassette that will suppress the expression of the polynucleotide of interest. It can be combined with any combination of other suppression cassettes or overexpression cassettes to obtain the desired combination of traits in a plant. In addition, it is believed that polynucleotide sequences can be packaged in the desired location in the genome using a system for site-specific recombination. See, for example, UUO99/25821, UUO99/25854, UMO99/25840, UUO99/25855 and

УО99/25853, all of which are incorporated into this document by reference.

The compositions according to the implementation options find various applications in the protection of plants, seeds and plant products. For example, the compositions can be used in a method that involves placing an effective amount of the pesticidal composition in the habitat of the pest using a procedure selected from the group consisting of spraying, dusting, spreading, or seed coating.

Before selling plant propagation material (fruits, tubers, bulbs, corms, grains, seeds), especially seeds, as a commercial product, it is normally treated with a protective coating containing herbicides, insecticides, fungicides, bactericides, nematocides, molluscicides or mixtures of some of these preparations, optionally together with additional carriers, surfactants or application aids commonly used in the art of formulation 60 to provide protection against damage caused by bacteria,

fungal pests or animal pests. In order to treat the seeds, the protective coating can be applied to the seeds either by impregnating the tubers or grains with a liquid formulation or by applying a coating of a combined wet or dry formulation.

In addition, in special cases, other methods of application to plants are possible, for example, treatment aimed at buds or fruits.

A seed of a plant according to embodiments that contains a nucleotide sequence that encodes a pesticidal protein according to embodiments can be treated with a seed coating that contains a seed treatment compound such as, for example, captan, carboxin, thiram, metalaxyl, pirimiphos- methyl and others, which are usually used in seed treatment. In one embodiment, a protective coating for seeds containing a pesticide composition according to embodiments is used alone or in combination with one of the protective coatings for seeds commonly used in seed treatment.

It is believed that genes encoding pesticidal proteins can be used to transform organisms pathogenic to insects. Such organisms include baculovirus, fungi, protozoa, bacteria and nematodes.

A gene that encodes a pesticidal protein according to embodiments can be introduced using a suitable vector into a host microorganism, and the specified host can be applied to the environment, or plants, or animals. The term "introduced" in the context of inserting a nucleic acid into a cell means "transfection", or "transformation", or "transduction" and includes reference to the incorporation of a nucleic acid into a eukaryotic or prokaryotic cell, where the nucleic acid can be incorporated into the genome of the cell (eg, a chromosome , plasmid, plastid or mitochondrial DNA), be converted into an autonomous replicon or transiently expressed (eg, transfected mRNA).

Host microorganisms known to inhabit the "phytosphere" (phylloplane, phyllosphere, rhizosphere, and/or rhizoplane) of one or more crops of interest may be selected. These microorganisms are selected so that they can successfully compete in a specific environment with wild-type microorganisms, provide stable maintenance and expression of the gene that expresses the pesticide protein, and, preferably, provide improved protection of the pesticide from destruction and inactivation in the environment

From the environment.

Such microorganisms include bacteria, algae and fungi. Of special interest are microorganisms, such as bacteria, for example, Rzepdotopav, Egmipia, Zeitaia, Kiervsivia,

Hapitopaz, Zperiotuseb5, VNi2obisht, VNodorzeidotopah, MeiNuiyiv, Adgobasiegiit,

Aseiobasiveg, I asiorasiiv5, Apygobasieg, Agoiobasieg, I eisopovios, and AiIsaiiidepev, mushrooms, in particular yeasts, for example, Zasspagotusev, Sturiosossiv, Kipulhegotusev5, Zrogoroiotusev, Vpodoiogia, and Asheobavzidiit. Of special interest are such species of phytosphere bacteria as Rzendotopav zupipdae, Rheidotopavz Pyogevzsep5, Zeitaya tagsezsepv, Aseiobrasieg huipyt, Adgobasievgia,

APpPodorzepdotopab5 5rpegoiide5, Hapiyotopach satreviiv5, NAPigobisht teioii, AiIsaiidepev5 epitorpyv5, Siamirasieg huii and Agoiobrasieg mipeiapaii , as well as phytospheric yeast species such as

APpodoiogtsia gibga, A. dishipiv, A. tagip, V. atsygapiiasa, Sturiosossyv airidiv, S. aiiepv5, S.

Iatsepii, Zasspagotusev gozvi, 5. rgeiiugiepviv, 5. segemiviae, 5rogoroiotusev go5eiv, 5. odogiv,

Kisuuhegotusev megopaye, and Ashgeobravidiyt roiIshapyv. Pigmented microorganisms are of particular interest.

A number of methods are available for introducing a gene that expresses a pesticide protein into a host microorganism under conditions that create the possibility for stable preservation and expression of this gene. For example, expression cassettes can be constructed that contain the nucleotide constructs of interest, operably linked to transcriptional and translational regulatory signals for expression of the nucleotide constructs, and a nucleotide sequence homologous to the sequence in the host organism by which implementation will occur, and /or a replication system operating in the host through which deployment or stable maintenance will occur.

Transcription and translation regulation signals include, without exception, promoters, transcription initiation start sites, operators, activators, enhancers, other regulatory elements, ribosome binding sites, initiation codons, termination signals, etc. See, for example, patents

US MoMo 5,039,523 and 4,853,331; ERO 0480762A2; Zatrhook; Mapiaii5 eyi a!. (Soyd brgipa Natbog

And aroghaiogu Rgez5, Soy turnip Natbog, Mem mok); Ramiv eyi ai., ed5. (1980) Admapsaid Vasiegia!

Sepeiisv (Soyd brgipd Natog I arogayugu Rgevz5, Soyy 5rgipa Nagrog, Mem/ MoiKk) and the sources cited in these documents.

Suitable host cells where the cells containing the pesticidal protein will be processed to maintain the activity of the pesticidal proteins in the cell in the event that the treated cell is introduced into the habitat of the target pest(s) may include either prokaryotes or eukaryotes, however, they are usually restricted to those cells that do not produce substances toxic to higher organisms such as mammals. However, organisms that produce substances toxic to higher organisms may be used where the toxin is unstable or the level of application is low enough to avoid any possibility of toxicity to the mammalian host. As hosts, prokaryotes and lower eukaryotes such as fungi will be of particular interest. Illustrative prokaryotes, both Gram-negative and Gram-positive, include Epiegoraceae such as Eusnegisnia, Egmypia, ZpideiPa, ZaitopeiPa, and Rgoiei; Vasiyasyeae; VNi2oriaseae, such as VNigobiit; ZrigpPaseae, such as Rpoiobasievgiit, jutotopa5, Zeitaia, Aegotopa5, Mibgio, OYUOeziyomirgo, eripPit; IasiyuobasiPaseae;

Rzepdotopadaceae, such as Rhoendotopaves and Aceiobasieg; Ago1orasiegaseae and Mihorasiegaseae.

Eukaryotes include fungi such as Rpusotuseiez5 and Abzsotuseiez5, which include yeasts such as Zasspagotusez and Zspig2ozasspagotusez; and yeasts from the department Vasidiotusegii5, such as Kpodoiogia, Aigeobavzidiit, zrogoroiotusev, etc.

Characteristics of particular interest when selecting a host cell for pesticidal protein production include the ease of introducing the pesticidal protein gene into the host, the availability of expression systems, the efficiency of expression, the stability of the protein in the host, and the presence of associated genetic capabilities. Characteristics of interest for use as a pesticide microcapsule include protective properties for the pesticide, such as thick cell walls, pigmentation, and intracellular packaging or inclusion body formation; affinity for leaves; lack of toxicity for mammals; attractiveness for absorption by pests; ease of destruction and assimilation without damaging the toxin, etc. Other considerations include ease of assembly and rotation, cost effectiveness, stability during storage, etc.

Host organisms of particular interest include yeasts such as Vpoadoyogiia spp., Aipgeobravzidisht spp., Zasspagotusez spp. (such as 5. segemiviaye), ZBrogoboiiotusev yr., phylloplane organisms such as Roendotopavkh 5yr. (such as R. ayeegidipoza, R. Poogebsepv), Epmipia 5yr. and Riamobasietlit 5rr., and other such organisms, including VI, E. soii, Vasii5 5iYibiyiv5, etc.

Genes encoding pesticidal proteins according to embodiments can be introduced into

Microorganisms that multiply on plants (epiphytes) to deliver pesticide proteins to potential target pests. Epiphytes, for example, can be gram-positive or gram-negative bacteria.

Bacteria that colonize roots, for example, can be isolated from plants of interest using methods known in the art. Namely, the root-colonizing Vasiyya strain can be isolated from the roots of the plant (see, for example, Napaeiyetap eyi ai. (1991) Arry.

Epmigop. Mystorio! 56:713-718). Genes that encode pesticidal proteins according to embodiments can be introduced into root-colonizing Vasiyish5 segei5 using standard methods known in the art.

Genes encoding pesticidal proteins can be introduced, for example, into Vasiysh5, which colonizes roots, by means of electrotransformation. In particular, genes that encode pesticidal proteins can be cloned into a shuttle vector, for example, pRNTZ101 (Eleges 5 and a). (1989) GEM5

Misgorio!. Ieb. 60: 211-218. With the help of the shuttle vector rnHtTZ101, which contains the coding sequence of a specific gene for a pesticide protein, it is possible, for example, to transform root-colonizing Vasiy5 by electroporation (I.

EEM5 Mystobio!. And env. 60: 211-218).

Expression systems can be designed in such a way that pesticide proteins are secreted outside the cytoplasm of gram-negative bacteria, such as, for example, E. soii. The advantages of secreting pesticide proteins are as follows: (1) the possibility of avoiding the potential cytotoxic effects of the expressed protein and (2) improving the purification efficiency of the pesticide protein, including without limitation increasing the efficiency of protein isolation and purification per cell broth volume and reducing the time and /or extraction and purification costs per unit of protein.

Pesticide proteins can be engineered to be secreted into E. soybean, for example, by fusing a suitable E. soybean signal peptide to the amino terminus of a pesticide protein. Signal peptides recognized by EE. soybean, can be found in proteins that are already known to be secreted by E. soybean, for example, protein OtrA (Sipgaueb sei ai. (1984) EMVO /, 3:2437-2442). OtrA is the main protein of the outer membrane of E. soii, and, thus, it is believed that its signal peptide is effective in the process of translocation. Also, the OtrA signal peptide does not need to be modified before processing, as can be the case with other signal peptides, for example, the signal peptide of lipoproteins (YuMatss et al. (1987) Mei. Epgutoi. 153:

In embodiments, the pesticidal proteins can be fermented in a bacterial host and the resulting bacteria processed and used as microbial sprays in the same manner as Vi strains used in insecticidal sprays. In the case of the pesticidal protein(s) secreted from Vasiy5, the secretion signal is removed or mutated using techniques known in the art. Such mutations and/or deletions prevent the secretion of the pesticide protein(s) into the growth medium during the fermentation process. The pesticide bilium remains within the cell, and the cells are then processed to produce encapsulated pesticide proteins. Any suitable microorganism can be used for this purpose. Reendotopav5 was used for expression

Vi-toxins in the form of encapsulated proteins, and the obtained cells were subjected to processing and spraying as an insecticide (Saeegipeg evi a!. (1993), in: Admapseid Epdipeegtei Rezviisidev, ed. Kit).

Alternatively, pesticidal proteins are produced during the introduction of a heterologous gene into the cellular host. Expression of the heterologous gene results, directly or indirectly, in the production and storage of the pesticide within the cell. These cells are then treated under conditions that prolong the activity of the toxin produced in the cell when the cell is applied to the environment of the target pest(s). The resulting product preserves the toxicity of the toxin. These naturally encapsulated pesticidal proteins can then be formulated according to conventional techniques for application to target pest habitats such as soil, water and plant leaves. See, for example, document ERO192319 and sources cited therein.

In embodiments, the transformed microorganism (which includes whole organisms, cells, spore(s), pesticide protein(s), pesticide component(s), component(s) that affects the pest, mutant(s), live or dead cells and cellular components, including mixtures of living and dead cells and cellular components, and including destroyed cells and cellular components) or the isolated pesticide protein can be formulated with an acceptable carrier into a pesticide composition(s), which is, for example, a suspension, solution, emulsion, spray powder, dispersible granules or pellets, wettable powder and emulsifiable concentrate, aerosol or spray solution, impregnated granules, excipient, coating paste, colloid, and encapsulated forms, e.g. in polymeric substances . Such composite compositions can be obtained using conventional methods such as drying, lyophilization, homogenization, extraction, filtration, centrifugation, sedimentation, or concentration of a culture of cells that contain a polypeptide.

Such compositions disclosed above can be obtained by adding a surfactant, an inert carrier, a preservative, a humectant, an eating stimulant, an attractant, an encapsulating agent, a binder, an emulsifier, a colorant, a UV protectant, a buffer, an agent, which increases fluidity, or fertilizers, a donor of micronutrients or other drugs that affect plant growth. One or more agrochemicals, including but not limited to herbicides, insecticides, fungicides, bactericides, nematicides, molluscicides, acaricides, plant growth regulators, harvest aids and fertilizers, may be combined with carriers, surfactants or adjuvants conventionally applied in the field of formulation, or by other components to facilitate the handling of the product and its application against specific target pests. Suitable carriers and auxiliaries may be solid or liquid and correspond to substances commonly used in the formulation technology, such as natural or regenerated minerals, solvents, dispersants, wetting agents, tackifiers, binders or fertilizers. The active ingredients according to the embodiments are usually applied in the form of compositions, and they can be applied to the treated area, plant or seed to be treated. For example, the compositions according to the embodiments can be applied to grain during preparation for storage or during storage in a grain hopper or elevator, etc. The compositions can be used simultaneously or sequentially with other compounds. Methods of applying the active ingredient according to the embodiments or the agrochemical composition according to the embodiments, which contains at least one of the pesticidal proteins produced by the bacterial strains according to the embodiments, include without limitation foliar application, seed coating, and soil application. The number of applications and the application rate 60 depend on the intensity of damage by the relevant pest.

Suitable surfactants include, but are not limited to, anionic compounds such as a carboxylate of, for example, a metal; long-chain fatty acid carboxylate; /-M- acyl sarcosinate; complex mono- or diethers of phosphoric acid with ethoxylates of fatty alcohols or salts of such complex ethers; fatty alcohol sulfates such as sodium dodecyl sulfate, sodium octadecyl sulfate, or sodium cetyl sulfate; sulfates of ethoxylated fatty alcohols; ethoxylated alkylphenol sulfates; lignin sulfonates; petroleum sulfonates; alkylarylsulfonates such as alkylbenzenesulfonates or lower alkylnaphthalenesulfonates such as butyl naphthalenesulfonate; salts of sulfonated naphthalene-formaldehyde condensates; salts of sulfonated phenol-formaldehyde condensates; more complex sulfonates, such as amide sulfonates, for example, the sulfonated condensation product of oleic acid and M-methyltaurine; or dialkyl sulfosuccinates, such as sodium sulfonate or dioctyl succinate.

Nonionic agents include the condensation products of complex ethers of fatty acids, fatty alcohols, amides of fatty acids or fatty alkyl- or alkenyl-substituted phenols with ethylene oxide, fatty acid esters and ethers of polyhydric alcohols, such as sorbitol and fatty acid esters, condensation products of such esters with ethylene oxide, such as esters polyoxyethylene sorbitan and fatty acids, block copolymers of ethylene oxide and propylene oxide, acetylene glycols such as 2,4,7,9-tetraethyl-5-decyne-4,7-diol, or ethoxylated acetylene glycols. Examples of a cationic surfactant include, for example, an aliphatic mono-, di- or polyamine such as acetate, naphthenate or oleate; or an oxygenated amine such as polyoxyethylene alkylamine amine oxide; amines with amide bonds obtained by condensation of a carboxylic acid with a di- or polyamine; or quaternary ammonium salt.

Examples of inert materials include, without limitation, inorganic minerals such as kaolin, phyllosilicates, carbonates, sulfates, phosphates, or plant materials such as cork, powdered corncobs, peanut hulls, rice hulls, and walnut hulls.

The compositions according to the variants of implementation can be in a form suitable for direct use, or in the form of a concentrate of the primary composition, which requires dilution with a suitable amount of water or other diluent before use.

The concentration of the pesticide will vary depending on the nature of the particular formulation, particularly whether it is a concentrate or is to be applied directly. The composition contains 1-9895 solid or liquid inert carrier and 0-5095 or 0.1-5095 surface-active substance.

These compositions will be applied at the rate indicated for the commercial product, such as approximately 0.01 pounds to 5.0 pounds per acre when applied dry and at approximately 0.01 pints to 10 pints per acre when applied in liquid form.

In an additional embodiment, the compositions, as well as the transformed microorganisms and pesticidal proteins according to the embodiments, can be treated before formulation to prolong the pesticidal activity during application to the habitat of the target pest, provided that the pretreatment does not have a detrimental effect on the pesticidal activity. Such treatments can be carried out using chemical and/or physical means, provided that the treatment does not adversely affect the properties of the composition(s). Examples of chemical reagents include, without limitation, halogenating agents; aldehydes such as formaldehyde and glutaraldehyde; antimicrobial agents such as marshmallow chloride; alcohols such as isopropanol and ethanol; and fixatives for histological preparations, such as Buen's fixative and Halley's fixative (see, for example, Nytavzop (1967) Apitai!

Tivtse Tesppidnez (M.N. Egeetap apa So.).

In other embodiments, it will be advantageous to treat the Stu toxin polypeptides with a protease, such as trypsin, to activate the protein prior to application of the pesticidal protein composition according to the embodiments to the target pest habitat. Methods of serine protease activation of protoxin are well known in the art. See, for example, Sookveu (1968) Viospet. U. 6:445-454 and Sagtoi!Yi and ESHMPag (1989)

Viospet. 9. 261:99-105, the contents of which are incorporated herein by reference.

For example, a suitable activation protocol includes, without limitation, combining the polypeptide to be activated, such as a purified novel Cgu polypeptide (eg, having the amino acid sequence set forth in 5EO IU MO: 4 or 5EO IU MO: 8), and trypsin in a weight ratio protein/trypsin 1/100 in 20 nM Manso", at pH 8, and digestion of the sample at 36 "C for 3 hours.

The compositions (including transformed microorganisms and pesticidal proteins according to embodiments) can be applied to the habitat of the insect pest, 60 for example, by spraying, fine spraying, dusting,

spreading, coating or watering, applying in or to soil, applying in irrigation water, by seed treatment or general application or dusting at the time when the pest has started to appear or before the pest appears as a control measure.

For example, a pesticidal protein and/or transformed microorganisms according to embodiments can be mixed with the grain to protect the grain during storage. In general, it is important to provide good pest control during the early stages of plant growth, as this is when the plant can be most severely damaged. For convenience, the compositions according to the embodiments may contain another insecticide if deemed necessary. In one embodiment, the composition is applied directly to the soil, during planting, in the granular form of the composition of the carrier and dead cells of the Vasiinv5 strain or the transformed microorganism according to the embodiments. Another embodiment is a granular form of the composition, which contains an agrochemical, such as, for example, a herbicide, insecticide, fertilizer, an inert carrier and dead cells of the Vasiliy55 strain or a transformed microorganism according to the embodiments.

Those skilled in the art will appreciate that not all compounds are equally effective against all pests. The compounds, according to embodiments, are active against insect pests, which may include economically important agronomic, forest, greenhouse, nursery, ornamental, food and tissue, human and animal health, domestic and commercial infrastructure, household and produce pests , which are subject to storage. Insect pests include insects selected from the ranks

SoiIeoriega, Oiriegta, Nuteporiega, I eridoriega, MaPornada, Notoriega, Netiriega, OpNoriega,

Tpuzaporiega, Oegptariega, Isoriegta, Aporiiga, Zirpopariega, Tgisporiega, etc., in particular,

SoIeoriega and I eridoriega.

Insects of the order I eridoriega include, without limitation, scoops, nibbling scoops, midges, and scoops of the Mosicidae family: Adgoii5 irsiop Nyipade! (scoop-epsilon); A. opypodopia Moitisop (rectangular scoop); A. zedesht Yuepie 4 ZspSheptySheg (winter scoop); A. 5!rieitapea Rabgisii5 (grain scoop); AiIarata agoyasea Nabpeg (American cotton bollworm); Apiisagzia dettaiiiii5

Narpeg o (velvet bean caterpillar); AiNpeyiz tipdaga Vagtptez apa MeOippotsdy (rough scoop); Eagpiav ipotsshapa Voizdima! (Egyptian cotton scoop); E. myeya Rabgisiiye (scoop

Zo spotted); Ediga (Huiotudev) sigpiaii5 Stoie (citrus scoop); Eichoa tezzogia Naittiz (black-sided scoop caterpillar); Neiissomegra aptidega Nabpeg (brush-footed resedova scoop); N. 26a Voddaiye (corn scoop or cotton scoop); Neiioiiv migezsep5 Rabrgisiiz (tobacco leaf); Nurepa vsabga Rabgisiye5 (clover scoop); Mateziga sopiidigaia UMaiKeg (Bert's scoop); M. Bgazvisaye

Mppayeiz (cabbage scoop); Meiapsnga risia Naitiz (scoop); Rzhetsdaieia ipiripsia Nau (meadow scoop); Rzetsdoriivzia ipsindep5 U/aiKeg (soybean scoop); Visnpia aibisoviia Ztiy (larva of the western bean weevil); 5rodoriega hydiregda UE Ztyy (grass weevil); 5. echidna Nabpeg (small scoop); 5.

Iyiga Rabgisii5 (tobacco weevil, a caterpillar that eats inflorescences); Hisporiivia pi Narpeg (no scoop); fireflies, lacewings, web-building moths, cone moths and leaf-skeletizing pests from the families Rugaiidae and Statbridae, such as Aspgoia dgyseIPa Rabiisii5 (small wax moth); Atueviyoi5 igapziteYa UmaiKeg (caterpillar that damages citrus scars); Apadavzia KyeNpieiia 7eeg (wind-flowered bulb); Sadga sasheiia UaiKeg (dried fruit weevil); Stpiio rapePyiv5 bu/pNoye (corn stem weevil); S. zirrgezzaii MaiKeg (yellow rice fire); S. ietepeiiYPyv5

Radepziespeg (reed stem borer); Sogsuga serNnaIopisa biaipiop (rice borer);

Statrizh saiidipozeyi5 Sietepv (corn fire); S. иеиетеиІш5 7ipsKep (cereal fire);

Sparna!ostosiz5 tveeaipaiiye Sytsepeye (rice leafwort); Oeztia Gshpegaii Nobrpeg (grape leafwort); Oiarnapia Nuaiipaiia I ippaeiz (melon bonfire); Yu. (pickled cucumbers-piculi);

Oiaiiaea dgapaiozeiPa Ouag (southwestern corn firefly), O. sasspagaiv Rabgisiyb (reed firefly); EiIaztorairiv IdposePiv5 7ePeg (small corn butterfly); Eotgeita

Ioyipi YuOuag (Mexican rice fire); Erpevziia jeishSheya Nyarpeg (tobacco (chocolate) fire); SaiIepa teiPYopeMya Hippaeie (big wax moth); Neduieria asseria VshSheg (reed leaf-leaf); Negredgatta Iisagvzizaii5 MUUaiKeg (meadow butterfly); Notoeozota eiIesieiysht Niyvi (light-herb); And ohoviede bviiisiisaiy5 And ippaeib5 (meadow butterfly); Magis

Tezishai5 Seueg (acacia fire); OpNada INugizaiiz UaiKeg (tea moth); Ovinpia pibiiiaiii Narpeg (corn butterfly); Riodia ipietripsieia Noabpeg (Indian flour moth); Zsigrorpada ipsentiaz UmaiKeg (rice stem fire); dea hybidai Siepee (rusty-brown firefly); and leafhoppers, budworm leafhoppers, fruit eaters and fruit caterpillars from the Togigishichae family

Asiegiz diomegtapa U/aizipdpat (western black-headed leafhopper); A. mapapa Regttaiiy (eastern black-headed leafhopper); Adohorpuye5 ogapa Rizspeg mop Nbzwieg5iatt (reticulate leaf);

AgsPpir5 5yr., including A. agdugozriiauMmaiKeg (fruit tree leaf beetle) apa A. gozapa bo MPppaeiv (European leaf beetle); Agdugoyaepia 5yr.; Vopadoia zaYshriisoia MeutpisK (Brazilian apple leaf); Spogiviopetsga 5 years; Sospuii5 pozre5 UMaivipdapat (striped sunflower moth); Suadia Iayeteapa U/aizipdnat (hazel fruit eater); S. Rotopeiia I ippayei5 (apple fruit-eater); Epdorila miieapa Sietep5 (grape leaf-tree); Eiroesiiia atbrids0eia Nobpeg (cluster leaf-tree); And roigtapa monkeys

Oepiv 4 ZspiyeptyShSheg (European grape leaf); Riaiupoia Pamedapa Sietep5 (variable leaf); R. vishShapa U/aizipdnat (omnivorous leaf); 8

Zspineptiiyeg (leaf-leaved bud); apa 5yivita Neiiapinapa ViiIieu (sunflower leaf).

Other selected agricultural pests from the series I eridoriega are included without limitation

AIbvorpia roteagla Naitis (autumn fruitworm); Apagvzia IpeaiePya 7eiPeg (striped fruit moth); Apizoia zepaitia 9U.E. tii (orange-oak saturnia); Apipegaea regpui Sipyetp-

MepemyShe (Chinese oak silkworm); Votruh togi IHippaeie (mulberry silkworm);

Wyssshiaiikh Iitbetieia VyvzskK (curvy-whiskered cotton moth); Soiaz eshuiShete Voizamma! (alfalfa yolk); YuOaiapa ipiedetita St. 45 Vobripsop (nut-crested nut); Oepagoiitiv v5irikisy5

TespeimepyKom (Siberian silkworm), Eppotov 5!yrzidpaga Nabrpeg (elm worm); Aegapps

Shiaya Naptiz (linden tree); Egespiyiaz Pamiviyaya UUaizipayat (leafy reed bud); Eirgosiyev spguzotova and ippavikh5 (golden silkworm); Naigtizipa ategisapa Sspcetip-

Mepemye (American pyromorphid); Neiioiiiie zibPekha Spepee; Netieisa oiimiae SoskKgei) (caterpillar of the Saturnia butterfly); Nurpapiia sipea Ogygu (American white butterfly); Keiiietia

IusoregzisePa Maivipdpat (tomato moth); I atbraipa yizseiaga yizsePagia Nyivi (eastern hemlock moth; I. TizseMPagpa Ishdirgoza Nivi (western hemlock moth); I eisota zvzaisiv I ippaeivb (willow weevil); Iutapiia aibzrag Iippaeie (odd silkworm); Maiasozota 5yr.;

Mapadisa diipdietasiiaya Nazhopp (five-pointed brazilian, tomato brazilian); M. zehiiiia Nazhmopp (tomato rootstock, tobacco rootstock); Oreghorniega bBgitaiia I ippaeiz (winter gorse); Ohauia 5 years; Raieasiia »metaya Resk (spring horseradish); Rario stezrpopivye5e Stateg (cresfontes sailboat, "orange dog"); RIgudapidia saIyogpisa RasKagi (California ringed cocoon); RNIuPospivii sigeya biaipiop (citrus fly-miner); РНуПопогусиег риапсагаеия Рабиииив (mil-pistrinka fruit lower side); Riehiv rgazzisaye I ippaeiz (large white cabbage); R. garae Iippaei5 (small cabbage white); R. pari Iippaeiv (white rutabaga); Riaiuriya sagacidasiuia Vieu (artichoke fingertip); Richeia huiovziviia I ippaeiv5

Zo (cabbage mil); Resiiiporpoga dozzuriea Zaipdeg5 (pink boxworm); Ropiia rgoiiudise Voizaimai 8 I esopie (checkered blonde); zabiodez aedgoiaia Siepee (omnivorous eater);

Zspighiga sopsipp U.E. tiy (crest); Zyoigoda segeaievNa Oiiiimieg (Angumouz barley millet);

TnNashteiyuroea riuosatra 5spiyentiPeg (derivative pine silkworm); Tipeoia bBivzeiPeia

Nittei (room mil); Tsha arzoisha MeugiskK (tomato moth) and Mropotesha radeiia I ippaveiv5 (ermine fruit moth).

Of interest are larvae and adults from the order SoiIeoriega, including weevils from the families

Apiigirichae, Vgispidae and Sigsshiopidae, including without limitation: Apipopotiv of the Agapai

Vopetap (long-stemmed cotton); Suiipakgosoriigiye adereg5iv IeSopiv (long-nosed sunflower stalk); Oiargere5 arrhemiainv Iippaei5 (long-nosed barnyard); Nurega ripsiaia Rabgisii5 (long-nosed spotted); And Ivotporigiv ogugorpishiv5 Kivsepei! (long-nosed rice watercress); Meiatavziyye Petiriyye Petiriyye5 Iippayey5 (long-nosed West-Indian cane); M. Netiriegiv 5egiseiv Oimivg (long-nosed cane); 5yornishv dgapatlyvz I ippavi5 (barn longnose); 5. ogulaye I ippavy5 (rice weevil); Ztisgtopuh yShimiv I eSopie (red sunflower weevil); 5. 5ogaidiv IesSopiv (gray sunflower weevil);

Zrpeporpogiz taidiye Spiyepdep (long-nosed corn); NNaraozseyiny5 orzsygyv5 Voizamai (New Guinea long-nosed cane); earthworms, flea beetles, rootworms, leaf eaters, potato beetles and leaf miners of the family Spguzoteiae, including without limitation

SNnaeiyuspeta esiura Not (stem bread flea); S. riiisaya Mei5Neiteg (ground corn flea); Soybean bpippea Rabgisiiv (grape leafhopper); Oiabgoiisa ragregi Ztiy v

It eats amtepse (northern corn beetle); O. ipayesitripsiaia pozhagai Wateg (11-point flea

Howard); 0. migoaitega mikditega I eSopie (western corn beetle); And eriipoiagza desetiipeaia Zau (Colorado beetle); OshSheta teiaporivh I ippaei5 (red-breasted leech); RNuiYoigeia writes

Soe?e (stem bread); 7udodgatta ehsiataiyopiv Rabigisia5 (sunflower leaf-eater); beetles of the SossipePidae family, including but not limited to: Eriasnpa magimevzii5 Miiizapi (Mexican bean beetle); beetles and other beetles from the 5sagabaiidae family, including but not limited to: Apiigodiv ragutsiiv Vgiyop (larva of a beetle that eats sugar cane); Susiosernaia rogeaiiz Agtom/ (northern dupliak, khrushch); S. ittasciaia Oiimiei (southern double-breasted, khrushch);

Oeptoiierida airopiiyt UUaiegtpoise (grey-backed beetle that eats sugar cane); Eneipeoia

Ppytiyiv hydiser5 GeSophie (cane beetle); I eridioia itepsni ViasKbyt (larva of I eridioiga, which 60 eats sugar cane); Totagy5 dirbozyv YuOe Sieeg (carrot beetle); T. zibigorisiv Viaisnieu

(larva of a beetle that eats sugar cane); RpuPornada scipia Vypteiivieg (crush); R. Iashtope5

And eSophie (June Khrushch); Roriiiia iaropisa Memutap (Japanese crocus); VPigoitodiv taaiiv

VagoshtomeKu (Nekhrushch May); crustaceans from the Oyuegtevziiidae family; wiremen from the family

Eiaiegidae, EiIeodez v5yr., Meiapoishv vrr., including M. sottipiz StupPepna! (wireworm); Copodegiv 5 years; Gitopiib5 5yr.; Adiioie5z 5yr.; Siepisega 5 years; AeoYi5 5yr.; bark beetles from the family

Beetles from the Tepergiopidae family are also sooty. beetles from the Segatrusidae family, such as without limitation

Midaoiiv yuapiv UUezimosai (whisker); and beetles from the family Virgesiidae, including without limitation

ArNapiwiisiv sospipspipaye zetipisht ObBepbegdeg" (gold miner).

Of interest are adults and immatures of the Oiriega series, including leaf miners

Adgotula ragmisotiv I oem (corn leaf miner); Galician (including without limitation:

Sopiahipia zogopisoia Sodiyei (sorghum grass); Maueiyoia devigisiog Zau (Hessian fly);

Meoiavziorieta tipeiaapa Eeii, (sunflower gall); Zyoairiosis tozeYPapa Sepip (orange grain gall); fruit flies (Terpgiidae), Ozvsipeia iyi Iippaei5 (fruit flies); larvae, including but not limited to: Oeiiia 5yr., including Oeiiia riaishga Meidep (sprout fly); 0. soagsiaia Raiep (winter fly); Rappia sapisciativ5 I ippaeiv, E. Ttetogaiiv Zivip (small house flies);

Megotuga ategisapa Niisp (American meromiza); Mizza dotezviisa and ippaviz (houseflies);

Ziotohuv saiYsigap5 Iippaeiv (autumn lighters)); field flies, fireflies, meat flies, pguzotua 5 years; Rpottia 5 years; and other pest flies of the superfamily Myssoidea, gedzi Tabapiz 5yr.; nasopharyngeal mosquitoes Siavzigorpiy5 5yr.; Oeezipy 5 of 5 years; 5-year-old Nurodept bull worms; pistryakiSNguzorv v5yr.;

MeIorpadiz omipiv I ippaeiz (sheep woolen) and other Vgaspusega, mosquitoes Aedez 5yr.; Aporpeyev5 5yr.; Ssheh v5yr.; midges Rgovitiyt v5yr.; bBitiysht vrr.; woodlice, mosquitoes, sciarids and others

Metaiyosega.

Insects of interest include those of the order Neptiriega, such as, but not limited to, the following families: Aavie|Yididae, AiIeugodidae, Arpididae, AviegoIesapiidae, Segsoriidae, Sisaadei!|dae, Sisadidae, Sihiiddae, Sossididae, Sogeiidae, Oasiuioridae, Oe!irnasidae , Oiazriaidae, Eposossidae,

Kniaidade, Riidogidade, Izzidae, Judaeidade, Magodadodade, Metrgasidade, Migdae, OpNe?liidade,

Repiayutidaye, RPoepisosossidaye, RHnuiPohepdaye, Rzeidosossidade, Rbzuiidae, Ruttosogidaye and

Kindly

Important from the point of view of agriculture, representatives of the Neytiriega series include beech

From restrictions: Asgozietpyt Pniiage Zau (green shield bug); Asuppivirpop rizit Naits (pea aphid); AdeYides, 5 years old (Hermes); AdeIrposogiz haridiz Zau (alfalfa bug); Apavza Igivziyy YuOe

Seeg (pumpkin bug); Arpiv stassimoga Cosp (alfalfa aphid); A. Taraye 5soroii (beet aphid); A. dozzurii Siomeg (cotton aphid, melon aphid); A. taiiaigadisiv Eotbev (corn root aphid); A. roti Oe Seeg (apple aphid); A. z5rigaesoia Raisp (green citrus aphid); Ashiasavzrie edaiep5iz 7epipeg (reed shield);

Atsshasopnpyt 5oYapi Kayeprasi! (common potato aphid); Vetivia iabasi Seppadiyv (tobacco whitefly, cotton whitefly); V. agdepiyoii VeiPom5 5 Regpipa (magnolia whitefly); Vii55y5 Ieisoriyegi5 Ieisoriyegi5 zau (North American wheat bug); Vioviotaidaye 5yr.; Vhemisogupe Bgazbvisaeye Iippayeib5 (cabbage aphid); Sasorzuia rugisoia Roegwieg (copper pear); Saiosogiv poguyedisiv Stveiip (potato bug); SNaeyviznop gadayeiyiyiii SosKegei! (American strawberry aphid); Sitisidaye 5 years; Sogyeidaye from 5yr.; Soguipisa dozzuria Rabgisiiv (cotton bug); Todesia Rivtapi fungus (tomato bug); S. poiaishz Oiwiiapi (thrush); Oeoiv Pamoricia 58! (foam box); Oiaietsodev soyni

A5zpteady (citrus whitefly); Riarpposogiv sPiogiopis Zau (bug-pest of gledichy); Yuigarniv pohia Kygaiintom/Mogamiko (barley aphid); Yuiriaspiopazriz aimegdep5 Steep (shield);

Buzarnpis riapiadipea Raabzegpi (apple-plantain aphid); YuOuzaegsiv5 zshchygeiPyv

Neptsen-5snaneg (cotton red bug); YuBuztisossiv5 ropipziz Kymzhmapa (gray reed mealybug); Etroazsa iabaye Naitizh (potato leafhopper); Egpobzota Iapidegitus

Naivztapp (blood aphid); Eguipgopeotsga 5yr. (grape leafhoppers); Eiteioripa Pamire5

Myig (island reed cicada); Eigudavieg 5 years; Ei5spiviiv5 zegli5 Zau (shield brown);

E. magioiapyv Raiibvoi de Veaimoi5 (one-spotted bug); Stgariovivipy5 5yr. (complex of land bugs); apa Nuaioriyegye rgypi Seopygou (plum mealy aphid); Isegua rigsNavi

SmkKey! (Australian grooved worm); Iaroriadisoia aiyi Kpidni Ozhuk-pest. onion plants); And aodeirnach vigpaieiie5 Rayep (dark cicada); And eriodiozvy5 sogstii5 Zau (pine seed bug); Ieriodisitua iabida Negitisn-Zspaeyeg (cane bug); Girarniv eguviti

Kapepbvrasi (mustard leaf aphid); Hudosogi5 rariyipyv I ippayei5 (green stipe); Hudyv

Ipeoiagi Raiizoi de Veaimoye (meadow bug); Y. Nezregi5 Kpidnpi (western meadow bug); I. rgaieepvie IHippaieie (grass bug); !. Hydiireppie Rorriie (field bug); Masgovzirpyt eirpogbriaye Tpotav (large potato aphid); Masgovieiee5z diaadgiipeayshv5 Rogbez (cicada bo astrova); Madisisada zeriepaesit I ippaeiz (seventeen-year-old cicada); Manapagma yitgioiaia 5ia!

(cane foam); MeiIaparpi5 sassnaigi 7eppipeg (cane aphid); Meiapazvri5 diotegaia

Steep (June black); Meiorioorništ aiptodit U/aiKeg (rose-cereal aphid); Muiv regzisae 5tsiiI2eg (greenhouse aphid, peach green aphid); Mazopomia hibizpidgi Mozivu (chicory-currant aphid); Merpoienyikh sipiiser5 Opieg (green leafhopper); M. podhorisiib

Yay! (rice leafhopper); Melaga migidshtia I ippaei5 (green vegetable bug); Miiaraguaia Ishdepz 5Iia! (brown leafhopper); Muviib5 egisaye 5sPpiShpu (shrike nizius); Muziye harped Nouchag (Nizius);

Oeeeranz ridpah Rabgisiiv (rice shield bug); Opsoreiiz Tazsiatv OaiYiIa5 (milk bug);

Oporz satrezigs and ippaei5; Returned 5 years. (root aphids and head aphids); Regeagypiv taidiye AbzPpteay (corn leafhopper); ReikKipbvieia 5zasspagisida KizhZhaidu (delphacida reed); Rpuiohega demaviaiyih Regdapaye (phylloxera hickory); Riaposossiv sii Vizz5o (citrus mealybug); Riesiosogye hydisoyye ayep (apple bug); Roesiosarziv Iipeaiv5

Eabgisiiye (four-striped grass bug); Рзецдаїтозвзсеїїв 5егпайв5 Вецшієг (бавовниковий сліпнякРзейдососсив в5рр. (інші борошнисті червеці); Риїміпага єіопдаїа Мемузієай (червець пушицевий); Ругйа регризійа У/аІКег (цикадка тростинна); Руптосогідає 5рр.; Оцаайгазріаіовтв5 регпісіовив СотвіоскК (щитовка каліфорнійська); Недиміїдає 5рр.; АпораІовірпит таїйдів Eysi (sorghum aphid); V. radii I ippaei5 (common cherry aphid); basspagisossiv sasspNaii

SoskKeghey! (cane mealybug); Zspigarniv agatipit Vopaapi (common cereal aphid); birpa Pama Roibez (yellow sugarcane aphid); ZyobBiop ahepaye Rabgisiyv (cereal aphid); BodaieiYia iShgsitega Noguai! (white-backed cicada); Zodaydev5 oguhisoia Myig (delphacid rice); Z5rapadopisiv airoiazsiashe Wetsshieg (white-spotted thrush); Paegioarniv tasshiata VisKiop (spotted alfalfa aphid); TipiChaye 5 years; Tohoriega atsgapii Woueg de

EopzsoЯotre (orange aphid); and T. sigisida Kiikiaidu (citrus aphid); GpiaIetodev arishshyopeiv (white-winged white-winged white-winged bird) and T. marogagpogyt MUM/ezimooy (greenhouse white-winged white-winged bird);

Tiyoga aiiozrug Avzpteay (persimmon leaflet); and Turpiosura rotagia MsAiee (apple leafhopper).

Also included are the adults and larvae of the Asagi order (mites), such as Asegia iosispeYpa Keiieg (wheat head mite); Rapopuspy5 ti Cosp (red fruit mite); Reiobia Iaiep5 MySheg (Petrobia polyphagus); биепеоягеопетив bBapsgoyi Misnaye! (a mite that damages a sugarcane stem); spider mites and red mites of the Teigapuspidae family, Oiidopusnpyv5

Zo dguriz VaKeg 4 Riysnaga, O. ipaisivye Nigti (cane leaf mite), O. rgaiep5ziz Vapk5 (Banks grass mite), 0. viisKpeuii MseStedog (cane spider mite); Teigapusnyv writes

Kosi! (cane spider mite); T. tsdapieiii MeSstgedog (McDaniel's tick); T. sippavragipib

Voizatsma! (red spider mite); T. iShyKeviapi Odagom 2 Mikoi5Ki (Turkestan spider mite); flat ticks of the family Tepiir|Iridae, VgemiraIriv Iemivi Mestedog (orange tick); rusty and bud mites of the Egiorpuidae family and other mites that feed on leaves, and mites dangerous to human and animal health, i.e. dust mites of the Eridegtoriidae family, railway mites of the Oetodisidae family, grain mites of the Siusurpadidae family, ixod mites of the Ichoadiidae family. Ihode5 zsarshtiagie Zau (black-legged tick); I. Noiosusii Meitapp (Australian paralytic tick);

Reptasepog maiiabii5 Zau (ixod dog tick); Atriuotta ategisapith I ippaeiiv (Athbiuotta ixod tick) and horse and scabies ticks of the Rzohoriidae, Ruetoiidae and Zagsoriidae families.

Insect pests of interest from the TPpusapyga range are, for example, Ierizta zasespagipa and ippaeiz (scale insect); Pegtobia doteviisa RaskKaga (thermobia).

Additional arthropod pests covered include: Agapeae spiders such as

Y ohozseYe5 hesiiza Segpissp 8 Miiaik (brown recluse spider) and I aiigodesii5 tasiap5 Rabgisii5 (black widow), and centipedes from the order 5shidegotogria, such as 5sciedega soiIiorigada I ippaeyei5 (common flycatcher). Also of interest are insect pests of the order Isoriega, including those of the family Teptiidae, such as, but not limited to, SuiYipagoieptev pogaepzkKioviai NoiYitdgep and

Rzetsydasapipoiettez tiinagiye Nadep (cane termite). Insects from the series are also of interest

Tvpuzaporiega, including but not limited to thrips such as biepspavioiNhir5 tipshshchiv map YuOemepivg (cane thrips).

The pesticidal activity of the compositions according to the implementation options can be tested on insect pests at early stages of development, for example, in the form of larvae or other immature forms. Insects can be reared in complete darkness at a temperature of about 20°C to about 30°C and a relative humidity of about 3095 to about 7095. Bioassays can be performed as described in Sgaria et al. (1990) U. Esop. Epiotoi. 83 (6): 2480-2485. Methods of rearing insect larvae and conducting biological analyzes are well known to those skilled in the art.

A specialist in this field is familiar with a wide range of methods of biological analysis. Common procedures involve adding the test compound or organism to the food source in a closed container. Pesticide activity can be measured by, but not limited to, measurements of mortality, weight loss, attraction, deterrence, and other behavioral and physical changes following ingestion and exposure over an appropriate time period.

The bioassays described in this document can be used with any feeding insect pest, larval or adult.

The following examples are presented by way of illustration and not limitation.

EXPERIMENTAL PART

Example 1 - obtaining variants of Sgtu1B with an improved spectrum of insecticidal activity

The insecticidal protein Stu!Va, containing the amino acid BEO IU MO: 1 (005 8692065), has a high insecticidal activity (I/C50 - 1 ppt) against the larva of the corn moth (Ov5igipia pibiiaii5), but a low insecticidal activity (I-C50 » 1000 rrt and «- 400 rrt, respectively) against the cotton bollworm (Neiissomegra 7ea) and the grass bollworm (B5rodoriega tidiregaa). Stu!B insecticidal protein called MP258 (serial number PCT/O514/49923), containing an amino acid from

ZBO and MO: 47, has high insecticidal activity (C50 - 4 ppt) against the larva of the corn moth (Ozyhipia pibiiaiv5), but low insecticidal activity (I1/С50 24 ppt and 62 ppt, respectively) against the cotton bollworm (Neiisomegra 7ea) and grasses of a scoop (5rodoriega tidiregaa). A series of variant Stu1!B polypeptides derived from Stu!Va (ZEO IU MO: 1) and MP258 were designed for improved insecticidal activity against cotton bollworm (CEM) and/or grass bollworm (EAMM) compared to StuVa (ZEO IU MO : 1) talabo MP258 (ZEO IYUO MO: 47) with preservation, at the same time, of insecticidal activity against ESV. Variant Stu18B polypeptides with improved insecticidal activity that have been obtained include those listed in Table 1. The insecticidal activity of the Stu1B variants was determined as described in Example 4, and the insecticidal activity results are shown in Table 3. The amino acid sequence alignment of the Stu1B variant polypeptides is shown in figure 1.

Table 1

Amino acid sequence identity values of Stu!B variant polypeptides in percentages, calculated using the Needleman-Wunsch algorithm implemented in the program

Means (EMVO55 toolkit) are shown in Tables 2a - 20. The empty part of the matrix table is not shown.

Coo)

Table 2a ee i Tee tva Gaya Gaya Gaya

ВИ вВ21 в2гг2 в2г3 в24 в2г5 в2гб В27 в2гв8 в2гЗо о se5ОбО | - | 670 | because | 602 | 601 | 601 | 602 | because | 600 | 59.9 | bom iRIV-B1/ - | - | 834 | 826 | 845 834 | 834 | 832 | 829 | 829 | 829

RIV-B2!1y - | - | - | 9541 96.9 99.7 99.7 | 995 | 991 | 991 | 991

RIV-B2g2) - | - | - | - | 954 | 951 | 95 | 950 | 945 | 948 | 948

RIV-B23Y - | - | - | - | - 966 966 | 965) 960 | 96.0 | 965 pRIV-B24) - | - | - | - | - | - 994 | 992 | 988 988 | 988 pRIV-B25) - | - | - | - | - 1 - 1 - | 9981994 | 994 | 994 PRIV-V2EYI - | - | - | - | - 1 - 1 - | - | 9951 992 | 992 прив-В27Й - | - | - HER - | - 1-1 - 1-1 - 1994 994 PRIV-VAVI - | - | - HER - | - 1-1 - 1-1 - 1-1 998

Table 26 a ev ee ee vy ve ve tn

VZ31 | 832 | v33 | 834 | 840 |) B41 | B42 | B43 | 844 | B45 | 846 | B47 o s5obo | 66.6 66.9 | 66.3 | 65.5 | 59.8 5991 601| 601 | 601 60 | 59.9 | 59.9 | 59.9 pRIV-B21| 71617151 71.8| 7181991 9911992|9921992 9921992 | 99.2 | 96.9 pRIV-B23I| 72.5 | 72.3 | 72.6 | 72.3196.01960196219621962 9621962 | 96.2 | 96.0 pRIV-B24| 71.6 | 71.5 | 71.81 71.81 98.8 98.91 98.91 98.91 98.9 | 98.9 | 98.9 | 98.9 | 96.6 pRIV-B25| 71.81 71.61 71917191 99419941 99.5)|9951 99.5 99.51 99.5 | 99.5 | 96.6 pRIV-B27| 71.3|7121|71.5|71319921|989199.7|9951 99.5 9951992 | 99.2 | 96.0

RIV-VZI| - |994199119801|713|7161| 71517151 71.5 7151 71.51 71.51 692

RIV-B32| - | - 99219801) 7121/7151 71317131 71.3 7131 71.3 | 71.93 | 694

RIV-B33Y - | - | - GT9801|7051|7181|716|7161| 716 7161 71.6 | 71.6 | 694 pRIV-B34| - | - | - | - |75|718|75|7151| 715 7151) 7151 71.5 697 PRIV-V4OYI - | - | - | - | - ГТе971|991|9911991 9921992 )|994 | 962 PRIV-VAH| - | - | - | - | - | - GTe9luivol/|991 9921992 )|994 | 962 pRIV-B42| - | - | - | - | - | - | - 9981998 99719951 994 | 962 PRIV-VA3Y - | - | - | - | - |! - | - | - 7998 99819951 995)| 962

RIV-B44| - | - | - | - | - | - | - her - 1 - 19971997 1994 962 pRIV-B45| - | - | - | - | - HER - 7-1, - | - 1 - (9941997 962 пРИВ-В46Й - | - | - | - | - ИИ - 7-71 - | - 1 - | - 1997 9685 пРИВ-В47| - | - | - | - | - | - 1 - Й - 1-1 - 1-1 - 963

Example 2 - saturation mutagenesis in selected positions of MP258 and IR-18 of Stu1B variant polypeptides

Polynucleotides from 5EO IUO MO: 48, 5EBEO IUO MO: 6, 5EBEO IUO MO: 14, and 5EO IUO MO: 42, encoding MP258, IR18-B21, IR1B-B25 and IRIV-B45 (5EO IU MO: 47, 5ZEO IO MO: 5, 5EO IO MO: 13 and

ZBO IU MO: 41, respectively), were used as matrices for saturation mutagenesis in selected positions of amino acids. A reverse mutagenesis primer and a complementary forward mutagenesis primer were designed to produce the required amino acid substitution(s) at the site(s) of interest. Typically, the mutagenesis primer was 30 to 45 bases long, with two or more bases. by the number of bases, usually 10-15, on both sides of the site of interest. Degenerate primers covering all possible amino acid residues were used for saturation mutagenesis. Mutagenesis reactions were carried out using the Adyepig5 kit

OtsikSpapde "M | idpnepipd 5ie-Oigesied Miiadepezi5. The materials provided as part of the set are OtsikSpapde"m | Idnieepipud Eplute, 10X OtsikSpapde"m | Idniepipud Viyeg, mixture of amMtR, reagent OtsikzoiYi shop "m and restriction enzyme Bop, according to the manufacturer's instructions.

PCR amplifications were usually carried out using Ehrapa "m Nidp Ridesch RSK zuziet (Cospe, Switzerland) in 50 μl containing 50-100 ng of templates, 0.4-2 μM primer pair, 200 μm dDNTP and 2 units of DNA polymerase. The mutagenesis reaction was initiated by preheating the reaction mixture to 94 "C for 3 min., followed by 16 cycles of the following amplification program: 94 "C for 1 min., 52 "C for 1 min. and 68 "C for 8, 12, 16, or 24 min. depending on the length of the template. The mutagenesis reaction was completed by incubation at 68 C for 1 h. PCR amplification products were evaluated by agarose gel electrophoresis. PCR products were purified using the kit for PCR purification

OIAdnisktmM (Oiadep, Germany) and additionally treated with Orpi restriction enzyme.

An aliquot of 1 µl of the PCR product was routinely transformed into VI 21 (OEZ) cells and inoculated onto Petri dishes with Luria-Bertani (IV) medium containing 100 µg/ml ampicillin. Approximately 48 or more colonies were selected for saturation mutagenesis and plasmid DNA was isolated for sequencing. Two-step sequencing was used, first for the specific mutation site(s) using a single sequencing primer, followed by confirmation of the full-length sequence using multiple sequencing primers. After all 19 amino acid mutations were confirmed by sequencing, these mutant genes were refined for protein expression and purification.

In the case of mutations carried out to cover the entire PI domain of IRTIV-B825, spanning from

T495 to E655, 48 mutant clones were taken from each site and screened for activity

SEM as described in Example 4. To sequence these mutant clones, 103 sites were sequenced based on the number of mutations that increase activity and mutations that decrease activity, in order to determine the mutated amino acids 3-among the 151 amino acid residues subjected to mutagenesis. Sites containing mutants that did not show significant changes in activity were not sequenced.

Example C - purification of variant insecticidal proteins of sgu! IN

Genes of the variant insecticidal protein sgu!B were expressed in a modified pRMAI vector. (Mo cat. EVO00O5 from Mem/Epdiapa Vioiab5) in the form of a fusion with MVR (maltose-binding protein).

The rMAG vector was modified to attach a 6X Niz-tag to the M-M-end of MVR after methionine in position 1. The plasmid containing the insecticidal protein gene was cloned into E. soya VI 21 (OEZ).

VI21 cells were grown on MadisMeaia (I Zhe TesppoYodiech) or in 96-well plates or in flasks on a shaker operating at 250 rpm at 37°C for 8 h and then at 162°C for 64 hours During incubation at 162C, the MVR-toxin fusion protein accumulated in VI 21 cells in the form of a soluble protein.

To purify the fusion protein, E. soya cells were collected by centrifugation and treated with a lysozyme solution consisting of 2 mg/ml of lysozyme in 50 ml of sodium phosphate buffer at pH 8, which contained 300 mM Mass, 2 units/ml of endonuclease (Erisepige) and 5 mM Masig, for 3 hours. at 37 "C with gentle shaking. Then, the lysozyme-treated E. soybean cells were disrupted using 195 Tgtiop X100, and a clear lysate containing IR-18 proteins was obtained by centrifugation at 4000 rpm, 30 min (96- well plates) or 9000 rpm (samples obtained from the flask). Niz-labeled white MVR-toxin was isolated from the clear lysate by affinity chromatography using MiMTA agarose from Oiadep according to the standard method from the manufacturer. For these clear lysate samples obtained in 96b-well plates, plates from Paradise! Sogrogayop'm (25 Nagrog Ragk Ogime Rogi Washington, New York 11050) with 96 deep wells were used as columns for affinity chromatography.

Purified toxin proteins eluted from MiMTA agarose were passed through Zerpadek 025 with replacement of the phosphate buffer with 25 mM HERE5-Mmaon, pH 8, and used in a biological assay using insects to determine the insecticidal activity of MVR was split using 1/100 (weight/ wt) Basiog Ha (Mem Epdiapa Vioyar5) at 25 "C overnight and removed from IR-1Y8 proteins by column chromatography on Bbyregdeh 200 using the difference in size and weak affinity of MVR to Ziregaeh.

Protein concentrations were determined by capillary electrophoresis using an I arsSpir"m COHII device (Sairreg I Hebsiepse5). Protein analysis was repeated at least 3 times until the final concentrations were considered reliable within a predetermined deviation of less than 1095.

Example 4 - determination of insecticidal activity of IR-1 B variant proteins

The activity of Stgu!B polypeptide variants against the main pests of corn, the corn moth (ESV, Oz5igipia pibilia), the cotton bollworm (ESMU, Neiisomegra 7ea) and the grass bollworm (510) (GAMU, Zrodoriega pydiregda) was determined using the feeding assay described in

Sopod, V., ei a). Rgoseedipd5 oi She 4 Rasiiis Vit Sopiehepse5 op Vioiiespppoiodu oi Vasiiii5

Iyipdiepviv apa y5 epmigoptepia! itrasi, years 118-123, MK. 9. AKpig5i, SE Veaga and R. Nydnev, published in 2002, Sapbeita, A!zigaia. Briefly, the analyzes were carried out on an artificial diet containing insecticidal proteins. Insecticidal proteins were obtained as described in example 1, and μl of protein samples were mixed with 40 μl of molten artificial ration for insects (40-50 C), obtained on the basis of Zotschiiapa Rgetih, formulated for insects of the Lepidoptera series (Zoshpiiapa

Rgodisi5, Lake Village, AR), using low melting point agarose. The ration-insecticidal protein mixture was placed in each well of a 96b-well titration microplate. One or more newborn insect larvae were placed in 10 each well for feeding for 4 days for SEMU and EAMU and 5 days for ESV at 2826.

Alternatively, insect eggs or larvae were sorted by large particle flow cytometry using SORBZM (Sotrieh Obiesi Ragateiiigis Apaiu7eg apa 5ogieg) obtained from Opiope Wioteigis (Noyibiop, MA) by placing one egg or larva per well of a 96-well titration plate. microplate, which contained solidified artificial diet for insects. If eggs were used to place in plates for analysis, then after 16 hours only those wells containing hatched larvae were used to collect analysis data. Typically, as a result of efficient SORB5 sorting, output levels of 90-9595 were obtained. After certain periods of feeding, the response of insects to proteins was evaluated using a 0-3 scoring system, taking into account the size and mortality of larvae in each well. If no response (or normal growth) was observed, a score of 0 was assigned.

If the growth was slightly slowed down, then a score of 1 was assigned. A score of 2 meant that the growth of the larva was significantly slowed down (it was close to the size of a newborn). Score C meant the death of all larvae in the hole. The percentage response (response) for each treatment was calculated by dividing the total score, the sum of the parallel well scores for each treatment, by the maximum possible score. For example, if one treatment (one sample, one dose) had 6 parallel wells, then the total maximum possible score was C x 6 - 18.

To identify variant Stu1B polypeptides having increased levels of activity against given corn pests significantly higher than the activity of a reference protein, such as an unmutated wild-type reference protein (eg, MP258 with BEO IU MO: 47). Variant polypeptides in

Z at specific concentrations was assayed together with 4 doses of reference protein within one 96-well assay plate. Concentrations of insecticidal proteins were within the values of the concentration of the reference protein for the 4 doses, mostly near the midpoint of the concentration values for the 4 doses. Each sample plate contained the reference protein in a significant number of wells, eg 16 wells in 4 separate doses. Also, each tablet included up to 80 mutant proteins for activity comparison with the reference protein. From the sample plate, 10 μl of samples were taken from each well using a multichannel pipette and transferred to one assay plate containing 40 μl of molten ration in each well and mixed on a shaker. This process of tablet preparation for analysis was repeated 6 times or more to obtain the required number of tablets for analysis. After solidification of the ration and cooling to 4 "C, newborn insect larvae were placed in each well, closed with a perforated Muiag film, and incubated in a thermostat at a constant temperature of 2820. After a certain time of feeding, the response of the insects was evaluated under a magnifying glass. The value of the sigmoidal dose-response function (value responses) were transformed into values of a linear dose-response function constructed by the probit method using 5A5-UMRF), generalized linear model, binomial response distribution, probit). The response values for each protein in parallels were summed and compared with the dose-response curve constructed by the probit method, for the activity of the reference protein with a new number called the estimated EAE (rapid estimate of activity). For example, if the mutant protein showed a certain probit value at 40 ppt and the actual dose with the same probit value for the reference protein was 100 rrip; then the value of EAE was 2.5 (100/40). This means is that the mutant protein is 2.5 times more effective than the reference protein. This analysis was performed with 2 different doses of mutant proteins at a time and was repeated three times to obtain b measurement points of the calculated BEAE indicator for each mutant. The average calculated indicator of the BAE was called the BAE index. For each protein, the value of the two-sided I-criterion was calculated when comparing the calculated EAE indicators. Bonferroni correction was used to evaluate p-values (number of new proteins/"alpha) to determine the statistical significance of the EAE index.

Another screening method used in this patent application was the high-dose assay (NA, Niedchpi JuOze Awsau). In this method, the investigated proteins in high concentrations (higher than EC50) were placed in plates for the analysis of insects, as described above,

together with one or more reference proteins of known activity at a similar concentration. This NOSA has often been used in multi-level screenings to quickly identify proteins with low or no activity.

Another screening method used was a high-throughput functional assay (NEA, Nidp (hocdprii ERipsiope! Azzau). This assay was similar to EAE, but it used only one dose instead of 2 doses. In the rest of NEA, especially the method of calculating the index, was identical to ERAE So, the NEA index had the same value as the EAE index.

The predicted 5095 response point in the scoring scheme is called I/C50 because it represents a combination of growth inhibition or growth and lethal responses. To determine the values of II/C50, each treatment (one dose) was repeated 6 times or more, usually 24 times.

The insecticidal activity of Stu1B variants is shown in Table 3.

Table 4 shows the insecticidal activity against the cotton bollworm for amino acid substitutions that have increased activity (EBAE value 2 1.2) compared to the reference polypeptide MP258 (Z5EO and MO: 47), IRIV-B21 (ZEO and MO: 5), IRTV -B25 (5EO IO MO: 13), or

IRIV-B845 (5EO IYU MO: 41). Table 4 shows the position number and the amino acid that corresponds to positions 50-651 of MP258 (5EBO IYUO MO: 47); projected secondary structure and purpose; evaluation in points of solvent impact; amino acid sequence alignment

MR258 (5EO IU MO: 47); IRIV-B21 (ZEO IU MO: 5), IR1TIV-B25 (ZEO IU MO: 13), IRTV-B45 (5EO IU

MO: 41), IRIV-B21 (5EO IO MO: 5), StuiVa (5EO IO MO: 1), Stui Vi (ZEO IO MO: 52), and StuiVi (ZEO IO MO: 54); the backbone of the polypeptide from which the variant was obtained; variant of amino acid substitution (for example, I 50OK); and the value of insecticidal EAE against the cotton bollworm compared to the corresponding polypeptide skeleton (MP258 - BEO IUO MO: 47, IRIV-B21 - BEO IO MO: 5, IR1IV-

B25 - BEO IU MO: 13, or IRIV-B45 - BEO IU MO: 41).

Table Z about RIV-B2i | ZEOIU MO: | -:(6B | Shbbb-g24rrt | -:K( g o iRIV-B22 | ZEOIIUMO:7 | -:|:;ЙМН | shshchoBo-27rt| ( o iRIV-B23 | ZEOIIUMOH9 | -|:M;U(M .///// | shSHCHOBO-2gbarrt | -: (y o RIV-B24 | BEOIYU MOI | -( | Shcho5o-l1abrrt | -: o RIV-B25 | 5EOIYU MO:1Z3 | (B | SB -1191rrt|. Я -/:// RIV-В26 | 5EOIЮ MO:15 | (BE | shshcho5o-8Zbrrt | -:(/( o RIV-B27 | 5EOIЮ MO:17 | -:|(:// | shshchoBo-7berrt |: ( iRIV-B28 | 5EOIIU MO:19 | (6 | shShchoBo-74rrt | /:/:К«/О/////: SIS RIV-B29 | 5EOIIU MO:21 | (B | shshchoBo-845rrt | -: ( about RIV-VZI | 5EOIYU MO:23 | (:::: 17777771 obo -28ррт about RIV-В32 | 5EOIYU MO25 | (:::Г;.7|Й..7Ю777777171717/7/0/|Й obo - 29 ррт о RIV-В33 | 5EOIЮ МО27 | (::Й.ЮюЮюЮ/|Й..71717171717171/0/Й1Й obo -30 ррт о RIV-В34 | 5EOIЮ MO:29 | (:::777/71..771771707071717171710/| 1 obo -29rrt o RIV-B40 | 5EOIIU MO:31 | -( | shshcho5o-5YavVrrt | -:/ o RIV-B41 | 5EOIIU MO:33 | -(x | shSchoBo-45B4rrt | -: (y o iRIV-B42 | 5EOIIU MO:35 | (B | pSbOo-barrt | :/ (КХЖЕ( o iRIV-B43 | 5EOIIU MO:37 | -:(6B | pSboO-b/rrt | :/ 9: o iRIV-B44 | 5EOIIU MO:39 | -:(:КГЙ | poBo-borrt | :K. .С(EbS about RIV-B45 | 5EOIYU MO41 | -( | pSbo-57rrt |: /:; / and iRIV-B46 | 5EOIU MO:43 | -( | pSbo-8rrt o iRIV-B47 | 5EOIU MO:45 | -(x: K.K.K(/ | pSbO-birrt |: и"

Table 5 shows the insecticidal activity against the cotton bollworm for amino acid substitutions with a value of EAE x 1.2 compared to the polypeptide skeleton of MP258 (ZEO IO MO: 47), IR1B-

B21 (ZEO IO MO: 5), IRIV-B25 (ZEO IO MO: 13) or IRIV-B845 (5EO IO MO: 41). Table 5 shows the position number and the amino acid corresponding to positions 50-651 of MP258 (5EO IR

MO: 47); the backbone of the polypeptide from which the variant was obtained; amino acid substitution variant (for example, Y50A) and the value of insecticidal BAE against the cotton bollworm compared to the corresponding polypeptide skeleton (MP258 - 5EO and MO: 47, IR1IV-B21 - BEO and MO: 5, IRIV-

B25 - BEO IO MO: 13 or IRIV-8B45 - BEO I MO: 41.

Table 4

Po- Evaluation of lo: 20-|b l - alah - - - - - zhen- 20- pri. influence! MR | waya | vov | Ba5 You | in (Ske-IVariiyedeVarii Var Bari Ed Var de nya struct. | meaning dis- 258 let | ant ant ant ant ant

MR factor - 258 vo|soklezh! | og se ev i left in tv Av

V i NI PO PO PA NO NI NAH A A A NI EN Be s Ne V i She i 1111 51 |MiSpral| and! | 37 in | M M M |U U | | | her her her 1 1.1. (52 |5i|Spiralyuu| | 20 5 /5141515151515Ї | | Her Her | | | 7 7 1 vz|A spra | b A A|АЙ A АЯА АВ d ut kn va

ABZ ABZ ABZ ABZ ABZ

V i NI MI PO PA PON NI AK NI A A V BE ee No Z M No

V i i PA NI NK BUT NA NO NK NI NK BUT I NOM NOYA AK NA NA A NI o5e|v spraj| | 78 5|8| 8 in| in viveGr tk m ved vva nov

V i M MY PO MOH MON NI AH NYA AN NA NE S NI NI NA NO NA NAH NA MA (55 |T|Spralu| | 0 / 7 1177 711717" | | her | | | her 1 1 1 56|M| ISpralyal| | 5 M M M MM U I | | her 1 her 1 her.

And 057 057 057 057 057 o57|o|slvyal | z o o|o oo o o vegu mer i ee a vav

V i M MY PO MOH MON NI AH NI NN A BUT cm BU NI NI NA M NA NK NA M 58 |T|Spral| | with | t! 7/7 | 17177777" | | | | | her 59 |SiSpral| | 4 s si|siIsisisa/r|s| | | HER | | | 7 7 60 | |Spral| | Z / 1! 7 1 7 171 7 7 71 1717 1117 17 117,171717Ї1Ї11 61 |Mm(ISpral| | 27 | m m m mIiIm/ m/5! / | | | | 7 | ,7/ 7 7 62 | |Spral|, | Z / 1! 7 1 71 171 7 7/7 71 1717 011 17 1717 171717Ї17Ї111 63 |A|Spral| | 19 | | | | HER | | | 7 7 e5|in spray| | is I || I I led o t Az vm 66 | |Spral| | 4 / 1! / 1 7/1 7 7/7 71 1717 011 1 1717 Ї171717Ї17Ї11 67) spalo m vo ryvyanoyai osv|s sprya| pz s e|s/|sv v/s siv tini ee 69 |MiISprlyal| | 6 М М M MM MM! | ІІ Her | her her 1 1 1 70 | 1 | Source of her 1 vav) I 5417014 from |IO in the lake

E M N forest ivizh| |in se|s|sv s|s sivee and te|M|kuee |» m |U UM u uva | | And | 11 tz|eokuvy| |from Rv) ee viv jus t|eokuyei| of it is || ore efe ryu ven i yaz y ev

E74 I, TT carries 76 | with | spiral m5| a a) se s |si s | o |va5|E/bi2o11976I, 76|976I 3 in |9761 in 69761. 4

C Z M U in a76

V y I PI PO PA PON NI A NI A A NO BE B NI NAH NA NN NI NAH NA BA

Table 4

By- Evaluation in lo- 20- | balakh - and - - - women- 20- pri. influence! MR | waya | vov | Ba5 You | in (Ske-IVariiyedeVarii Var Bari Ed Var de nya struct. meaning| dis- 258 let | ant ant ant ant ant

MR factor 258

GT bomevttyo vv m pev

NO и BUT P M Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н Н | 8 1/1 171-77-71: 1 1 1 Her Her Her 1 1 1,1 fa slia

A79 A79 A79 A79

МНН ШО НН NO M NO NO BO NO V VN TE EE SE EN vo 5|spal | 8|8 8 8/5 8

GT bl st mo Maya

NO AND BUT PO KO A NI NA NA NA AK NI ss: KNIFE NA NAH NANU NA NA r z

V'I1eispali Gaia ETET ET ELE EE AA-AA- A A (LA A A A - 82 vah salt! | is xx xxx he || 1111 va|8slyut| | 85 5) 8/5|5|8 in veGEMel ryu se ek

NO NO PO KO A NI NA NA NA NK NI B konn s NN 84 |E|Spral| | 54 | EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE | Her Her Her 71 71 1 717717 85 |1|Sprali| | 5 |! / 1 7 1711 71с7 40111 71 1 171 017 17 7 17177111 86|MISprayali | 22 M M M UM UM i | 1 1 71 17 7171 1 11 87 ss li) s|s ss siv ve tm ona m nav

NO BUT PO KO OH NNI NA NA NA NK NI Bu ss: NOM NA NANU A NA

H 1 88 |E/Spralb| | 719 | ЕЕ ЕИ Е ЕЕ ЕЕ / | | /Her Her | Her 89 |c|Sprayal| | 2 | / s 1271-7171: 1 1 1 Her 1 1 1 111.1 90 |M|Klubok| | n | mm M mm mm mm | 1. her her her her 1 1 1.

РО1 РО1 РО1 РО1 vi|eikluy| | lo ev e|eI|e ev reun tia or

With M T r for | explanation | | 8 85) 8/5|5|8 k ver vevet u t t

NI i I PO PO KO OH NKY NA NO NA NK Neo sk: NN NA NA NANU NA NA NA 1.47 t 1 ve с|клюж| mo s|s s s s siv no rvav

OSI NI SS SYA S SYA S SYA S Elina calls out: NINI zvIoiklezh| | 5 oo o/o|o|o ovo re otu 96 |RISpiraliiia2g| 18 | R | R RIRIRI RIOYI | Her | | | She is 7! HER 97 |MISPRALI | 2 M | MM mm | | her 1 1 her 1 1 1. 98 |E|Spral| | 35 | E EE EE EEEEII | | Her | | 7 | | 7 99|I|Spral|i | 29 |! | 1/1 7 17 (11171 111 117 17 17 17 17 17 1771 11 00 |R|Spral| | 17 | EE EE EE TE! | Her 7 17 17 1 171 1711 01 |сISprayal| | 4 / m m/Im/ is Im! | Her | her her! 1 1 1 lo2|E|Spral| | 40 | ЕЙ EE EE ЕЕЙЕЙ / | | | Her | / loz |INISprayaly | 0 nn niIninI Nini Her | | her her 1 1 1. lo4 |MISpryaly | o M U M UM U | Her her 1 1 1 1 11 sov sprali LE DE EETE EL IES 5 6-5 ep --- - 10 10 10 10 ovo slya! 75 oo o|o|0|o ovo tuesday bI bA bE va 010 010 010 010 010

GG vnretvora vk u vv vn ov 010

Pov ID

Table 4

Rating

Po- in lo- 20- | balakh - and - - - women- 20- pri. influence! MR | waya | vov | Ba5 You | in (Ske-IVariiyedeVarii Var Bari Ed Var de nya struct. 258 years | ant ant ant ant ant

MR means) solvent 258 107 |s|Sprayal| | 0/1 7171-7171 -71с-:1 1 1 1 HER her 1 1 111,1 ost WE NOT KELLY I SSZ Essay: NOW WHAT IS в|ту) в || a yan a rve ov uovov 11 11 11 11 11 speo|klem| | o|o ooo o Mt rez oyu og orav on tia 11 11 11 11 11 spoeikeii | o|e vi ne| ov ee thorn 11 11 11

GG beet in pétanque | ray 11 11711

Tt11 Tt11 Tt11 t11 t11 spe|ticuezh| |v tt tt tt rz zu te zv i zmav zk tav - E11 E11 E11 E11 E11

Engraving 0 peokI|spral o pe| m)mo mo m/n) mine la 16|A|Spral| | n |A| AGA AITITIAI | | | | /Y | |! |! 117|A|Spral| | 18

M11 1.22

M I NI NO NOYA NO NO NO IT NO NO NOYA IT se NO NO NO NO PO PO VO VN - T11 Tt11 Tt11 t11 t11 pe t|spali v) t7|t t tt) t tva odoaz em av ov ev ak v zn Ev

Tt11 Tt11 Tt11 1.66 1.65 1.44

GG I take 120|A|Spraly | 5 | (А АГА АЙИА АЙАЙ | | | Her Her | / 121|сISpral| | 20 С 1 2717-2117 1 7121 1 171 1 17 17 1711111 expose! Ev

A12

Sn 1 sez|v|loyal| | k|y i|nk|v|ya yavezhryau 124|ISprayali | 6 7/1 s 11-11 1 1 Her 1 1 1 1 1 11 ov o|spray! 58/00 о о) е ов меня 126|С|Spralby |l03/|/|с|с8|с sisisi|сI | | | | her | 1 127 |Sprayal| | 9 / s -171-71s71-71:1 1 1 1 Her 1 1 1 1 11.1 128|SISpraly | 0 | s|s|s sisisi|isI | | | | Her Her Her 1 | 1 ge A|spraj | А|А A АН|аv вк ве од тео ву в ор за ву (naz 130|5/|Spiralui | 37 | 5 | 5/5 5|sa|sa|5| | | | | Her HER 7! her | |! 131 |R|Sprayal| | 2 | EE YE EM MIEYI | Her 717 1 1717 7171 11 132|A/ISpraly | 5 |V|V|n WINNY! | | | | 1 1 133|A|Spiral| | 49 | А | А A А|5/5I|IАЙ | | | | | /Й /Й 134 /М|sprаl|і 1 111 1хМ 1 1 1 111111 135|О|Sprayal| | 24 001010 9001010 |! Her her 1 1 1 zvo sla! |Spral| | 0 | / с 711-71-77 -71-1 71 17 7 177 017 177 7171711 139|E|Spralb| | 5 |E | ЕЕЕ ЕЕ ЕТЕЙ | | /Ж Her | And slo|o|slya | | oo o/o|t|t orverere 1 |M|Spral| | 6 | mm m mm mm mm | her 1 1 1 1 1 1 11 17

Table 4

By- Evaluation by- 20- | score - | balakh and - - - - women- 20- pri. influence! MR | waya | vov | Ba5 You | in (Ske-IVariiyedeVarii Var Bari Ed Var de nya struct. meaning oz- 258 years | ant ant ant ant ant

MR rank 258 nicks 142 | |Sprayed| | 67 | 7/7 1 s 7127 2711 1 17117111 - E14 E14 E14 E14 E14 ez e|slal | tz|e|e is er o vav zvov dv zuz gzma

E14 E14 E14 E14 E14

NIKY M PO OA KNIFE NO NK NI NI NA NA SE EE se BE

E14 E14

GO byutaya DOD

M14 M14 M14 sen Tsfklyu! ve) mm mo m)ku m miv med i d14 d14 d14 d14 d14 zovfkljuzh! || in vn a vva zm roar widow vun nya znaz r1i4 r1i4 r1i4 r1i4 szeoo|kluyu| || oh m mk eto vne vu

M14 M14 M14 M14 setio | zo) mo m)o)o ov det same tre - A14 A14 A14 A14 A14 - 14 d14 14 14 se v|spral vo v|y I yan a java su a widow vva yav 150|T|Spral| | 22 | t! 77175157 1 |! | | | 1 her 151|A|Spral| | 57 | | nn|vk|v|vk|vIVY | | | | | | 7 | 7 152|5|Spralku| | 93 | 5 | 5515/5155, | HER | Her Her 7 / 7 153|MISpralyal| | 656 | M M 7 171UI her 1 1 1 1 1 1 111 154. |Sprall| | 0/1 7717-1171 71:71 1 171 171 1 1 1 71 11.11 155|MISprayal| | 422 | m 1 In her 1 1 1 her 1 1 1 11 156|T|Sprali| | 7 | t | t 7/7 (EE ET | Her 1 1 1 71717171 1 157|O|Sprayal| | 3 | (00100909 |vk/vk/o | | | | her 1 1.1. zv x|sial with |U) U XX U Hv ve psiv! || room 11111 in A |syryal t |A|A A АЯА A Ame ul 161 | |Sprall| | 0/1 171-77-77 7 1 1 Her 1 1 1 1 11,17 162|ЕЙ Spral| | | 23 | p0|Ir0ro,1o0190|0,1 | | her her 1 1 11.11 165|IR|Sprayal| | 2 | EE is, is EP 7 71 T1EI TOI 1 1 01 1 01 17171 1 - 16 16 16 16 16 ev s|spralyi ve | s)t tova ru et ves vo i vi av t av - M16 M16 M16 M16 M16 eto kC|slrali vv) m) mom m)t) t o mivav to mi tot lav where 168|A |Spral| | 16 | А А|А|АА АИТАЙ | | | | | | | |/ 169|M/ISpral| | 0 |m|m/ m/m/ 11 1/mI | Her | / her her 1 170|RISPral| | 7 | RIRIRIRIRIRIRIRI /I HER | | | / | ,7/ | 7 171|7|Sprloi | with |. 71-71 717-71-71 7 1 1 1 1 1 1 1 11. 172|is|vVytok| | 4 | there is EE 6 EE there is! GI 7171 171 7 71717171 tziA|klezh| with A|A A AN A Av et 174! |KklyuukYi! | 55 | I / 1/1 GP 1 11011717 71171 717 1701717 01717171 11 175|M| Scream | |p8v| mm |mchmM|mm|km|Iv/vIvVY | | | | her. 176|mM| The leak | p2| MI mm mm mm/i/mchim/ mmIEI HER Her 1 1 1 1 1 1.1.1 017 017 017 017 stoo|kuyuyu| | 230

RIV RIV RIV RIV

Ezsansst ny sia KZ sia sia sia Sas in Ks seleise WHAT AND 817 |vitokY | from 7/7 171-71-71 1 1 her 1 1.1 1.1. 182g||Spraliaz: | 0/1: 71-171-71 7-71: 7 7 7171 1 1 1 71 1 1117

Table 4

According to the estimate of lov- in zhen- 20. m. inflow of MR watt | wow you | in (Ske-IVariiyedeVarii Var Bari Ed Var de nya struct. vach roz 258 years old | ant ant ant ant ant

MR chin- 258 83 |MiISprayal| | 1! mm m/Im/im/m/im! | 7 / | / Her 7 Her 184 |M|Sprlly | 1! / U M U (U UM | her 1 her her 1 1 1 11.1 l85|MISpraly | 6 M || MM MM | her her 1 1 1 1 1 1. 186 |А|Spral| | 0 | А|А А АГА АЙАЙ | | | | | / 187|О|Sprayali | 2 01010 991090! | her | 1 188 |А|Spral| | 17 | АГА АГА АЙАЙ | | | | | /Ї 189 |А|Spral| | 0 | А|А A АГА АЙАЙ | | | | | /Й |! l90|MISpraly | 1 mm mm mm /m/ mimimimi | / Her her 1 1 191 |s|Sprayal| | 5 / s 71 271-717 4711 01 17 7177 17 177 7171111 l192|NISpraly | 0 nni n ninininI | | her her 1 her 1 1 1. 193 | |Sprayal| | 1! /-/ s 7 4271-4717 4711 017 171717 17 177111 194! |Sprayal| | 5/с 71 271-471 с 4711 017 1717177 17 1771711 195 1 1 1 1 11,1 197|A|Spral| | 7 |n|n|k|n|Nn|v|In| | | | | /Y | 7! |! 198 |O|Sprayali | 0 r/ р р0оир,ои0,1 | | | her her 1 1 1 199|А|Spraly | 2 | |(А| АГА АЙА АЙАЙ | | | | Her | / 2г00|5|Spiralku| | t | 5 | 5 51/ 1/515151Ц151 | 7 /Ї | | Her 7! / so|s|slya| | | ss re everurat | | 11111 202|Р|Spral| | 9 | EE EE EE EIMY | Her 71 | 1 1 7 71717171 1 2g o3|c)| Viok| | 0 с|с|с sai|sisai|сI | | | | her | its 204|5З| The leak |7101/5/|5/5/51/515И18Й | 1 | | ! |. 205|E| Viok| | 66 | EE ET EE EETEI | Her / | | Her HER! oh |vizh|) | with | Efe Jew Tue Ev 2h07|s| Whoop! | 88 |с|с|с saisisai|сI | | | | her 1 2y08| with |Klubok| | 12. s 71 2172 mm ts 1 1717 1 17 1 1711111 t20 t20 t20 t20 t20 soe|tiklezh| |v tt tt rArA your ev vity vra vv| om t t20

GSyutyu 1IGST - 521 521 521 521 lo|v spiral) av) 126 5) 8 5|5| 8 5 goals plowed - О21 О21 О21 О21 О21 spas | 5191918 18515 to build net yapEr

AND AND BUT PO KO OH HORSES NA NA NA NK NI ss: KNIVES NA NA NANU A NA 212|E|Spral| | 4 || EE EE OO! O(HERE | her | (I 1 71 1 1 1 - I2g13 I2g13 I2g13 I2g13 I2g13 stz|islya'! | r vedy ev va m va o te

И2г13 И2г13 райо пе о|слай 5/0) о ок) m ому 215|А|Spraly | 82 || v/n but o|kI | | | | her 216|M|Sprayal| | 1 m | mm mm mm MI | her her her her 1 1 11 1 217|MISpraly | 7 M M MM MM | her Her 1 1 1 1 11 - E2I Eg1 Eg1 Eg1 Eg1 pe is|spral! in | is o o wav tu tv vd teo vn ng vv ob vi |v

Eg1 Eg1 Eg1 Eg1

ГГ buru etyoroi ste|n|sloya| | let me know

I2g2g0|O|Sprayali| | 6 | 0|0109/109|019|(0| | / | her her 1 1 1

Table 4

According to the evaluation of women (20-20 points) Mr. Ske-IVari Vari Vari Vari Vari under the influence of Vag1 | B25 | B45 you EAE EAE EAE EAE EAE nya struct. meaning 258 years old ant ant ant ant ant

MR factor - 258 of society! |v A|A A ALI t Mvt rotu mu rea tt tr ey

Ag2 Ag2 Ag2 Ag2 Ag2

GT boumeomenmo then I ov

Ag2

NO и и PO PO KO OH NKY BUT BUT NA HOW Not se: KI NK NA NI NA KA

NI OPO PO KO OH NKY NA NO NA NK NI seo ses NN NK NA NI A NA 223|KiISpral|i | 16 |k|k/|k km MV | | Her | her 1 1 1 224| T|ISpral| | 33 | | 7 71711777 017 1 1 1 HER 1 1 1 1 1.1 sov slia! |in k|k I|ni|e I ve/surnev volya zma cat all

GG bornu ev vo va vm lm

ZP sov sla! | | is || about vv/frit import vovg| in TV

M i PI po NO MN NAH NI NI KA NI NA NI EE SE che NI NN NA NA NA 227|M|Sprayals | with M /x|mx MM | | her Her 1 1 1 1 1 1 228|From|Spiralow| | n | 5|5/|/5/51/515/|51 | | Her | | Her | | 7 229|O|Spraly | 1 010110 ohm mm/io1I | HER 1 1 her 1 1 1. so|X spa! | |U U hninunive od v ovra 231|SISpraly | 1! |s|s|s sisIs|ISI | | Her 71 1 71 7 177171 232|A|Spral| | 27 | A| And A| AIM MIIMMY HER Her her | | She is 7! 1 1 svz|ni|loyal| |v kny i|n|o|o o vera zov z zve zr g g y PO PO M OA NI NA NA NA NK NS S MKU NI IN NA A SCHO som spol! | zom rim rvav dm vm ev i (ov| det dB mg3 mg3 mg3 mg3

WE AND NO NO M NA NI NA NO NA A NAU SE ya re a 235|MISpraly | 12 xx MM MM | her Her 1 1 1 1 1 1 sze|k spa! | yo k|ko mi muk mk ve|a vkoet vv ra vt won 237| TISpral|i | 50 | 7/7 7 77 7/7" | her her 1 1 1 1 11 238|с|Spral| | 8 | с|с| с8/|с|с1с29|с0| | | | HER 1 1 239|II|Spral 19 s 171-71-11 1 1 Her 1 1 1 1 11 mo|mospal!

Mg4 Mg4 Mg4 Mg4 Mg4

GG ooumerokrmv oye ov in the story of comrade

Mg4 Mg4

GG mes si|hi|slul| |in km flour coker m term met sq

Mg4 Mg4 Mg4 Mg4

GT bird me|sf|slyal| | with | ||| osv rerotourni ha ha ha ha ha ha smz|niklezh| | t kv i|nin| I'm in the middle of the night

GO bvvrevrotya

I244|c|Kluok| | 6 | с|с|с/|с|с1с29|0| | 7 7 | | Her 7 1 171 7 7

Table 4

Po- Evaluation lo" 20- | point - | points y y y - - zhen- 20- pri. |influence! MR | vaya | vov | Va5 Vy | vy (Ske-IVariyedeVariy Var Bari Ed Var de nya strukt. sign| age 258 | ant ant ant ant ant

MR factor 258

T24 T24 T24 T24 T24 meotfklezh! or) tt then t)t| t tva vdlovu lyavk ayu vo iz doz

T24 T24 T24 T24 T24

HT beyaviduv vne vv vvi vm tey

T24 T24 T24 T24 T24

GG bvreevkt vu mv vd vo r toya

Mg4 Mg4 Mg4 Mg4 meomfklezh! 57 mm mm. | in | is || is vom vmv eto vno gu tv

Eg4 Eg4 Eg4

GG baenryaayeya 249| From |Spirral| | 58 | 5 | 5 51/1/515151Ц|51 | | | | | She is 7! / 250|M/ISpraly | 1 m m | M mm | her her 1 1 her 1 11 251|I|Spral| | from 1 s 71 27121 STMIMI 1 171 17 1171 свг|нслай| |in books I|niv|in I am already 253|M|Spral| | 20 | xx M MM | her her her 1 1 1 11 1 254|MISpraly | 0 | mm mm |m/ mimimuimMmiI | / / her her 255|O|Spral| | 37 (00101 09109(019(0,Y | /Г | I Her 7! 1 71 7 256|Р|Spral| | 0 | EE EE EE EEEETEI | Her 71 | 1 1 1717 7171 1 257|NA|Spral| / 23|n|n|k|n|N|IvV|INn! | | 7 259|O|Sprayali | 7 0101101 o|0|10/|0I |! | her her 1 1 1 260! |Sprayali| | 0/1 271-77-71 1 1 1 Her 1 1 1 1 11 ,1 261| TISPral| | 20 | tt 7117/7777 1 1 her 1 1 1 1 11,1 262! ISprayali | 2 /- 1-7 -1-1-71-Ї 1 1 Her Her 1 1 1 1 11 263|С|Sprali| | из |( 6| с св/|сиИ|с1с29|с0| | /Г /Й | | Her Her HER 1 264|MI Vytok!Ў | 0 M U M UM UM | Her her 1 1 1 1 11 265. 4/7 1-1 2471-1717 17 17 17171711 11 268 | | Her Her | / 7 2/0 | Leak! | 95/71 71-77 -71-71 1 1 1 Her 1 1 1 1 11,1 2gl|is|, leak! | 0 EE EE EE! 7 1 1 7 17 17171717 171 272|RISprali| | 29 | RR RIRIRI RIRYI | Her / | | Her 7! / 273| Z |Sprali| | 2 | 5 | 5 5/51|515151 | | | | | She is 7! HER 7 274|MISprayali | 0 M || MM UM | her her 1 1 1 1 1 1. 275|О0|Kluyuk| | 22 yr ro,1o00019/|0,Y | | her her 1 11 1 2g/v|t| Whoop! | zo, 7/7 t 7717171 1 1 1 1 1 11 11 Sat|Tue! 278|1|Shout out! | 4 | 1! 7 / 171! 171

Р2В8 Р2В8 Р2В8 svo|explanation| | | e|eI|k in eeeoseya o

I2g81 I2g81 I2g81 I2g81 I2g81 evil Terror believed

GPa | IDD 282|MIKlubok! | 42 | M mm! M mMimi mimi her | / / 7 | her 2g83|t| lit | | 0 7/7 71707777 1 1 her 1 1 1 1 1 1. 284|51| letter | | 722 |5|5/|5/51515/|5Й | | | Her Her Her 7! 1 285|1A|Kluok| | 8 |(А|А A АГА АЙАЙ | | | | | / 2г86|О|Kluyuk| | 6 0101 109109/И019И0,Й | | и! her her 1 287||klbok! | 95 7/1, 1-1 -71-1 1 1 her her 1 1 1 1 1 1. 2g88|Т|Kluok| | 2 | t| t 7117/7777 1 1 her her 1 her 1 1 1. i2g89|й|Kluyuk|, | 8 | || k|n|n|k! | | | | 7 | And 7

Table 4

According to the score of 20 points for women, 20 points. influence! MR | waya | vov | Ba5 You | in (Ske-IVariiyedeVarii Var Bari Ed Var de nya struct. meaning| dis- 258 let | ant ant ant ant ant

Mechanism 258 290|Her letter || n | EE EE EE EITEI | Her | | ІІ І 1 211 1| lit | | 1 / 1! / 1 7 171 7117 7 1MI 1 17 717 17 717 71771111 292|M| lit | | 7 mm MM UM | her her 1 1 1 1 1 1 293|Tt|Kluok| | 8 | 7/7 7117/7777 1 her her 1 1 1 1 1 294|O|Kluyuk| | 24 010.0 1 o|0190|0I | HER | 1 1 her 1 1 1. 295|RIClubok| | 4 | R RI RIRIRI ATAI | Her | | | /І ІІ |! 296! 1 |Kluok| | with / 1! 7/1 7 17101171 01171 71 1 1 her her her her 1 1,11 297|сИ|Klubok! | i5 | с|с|с sai|sisai|si / | | | Her Her 7! her 298|A|Klubok| | 16 (y |k| k|In|IVTIAI | Her | | | Her HER |! 299|T|Kluok! | 48 | t 7/7 7171 1/7" | her 1 1 1 1 11 z00|MI|Kluok | | 59 | MM mi mim nose!Y | Her /Y | | Her HER /

Z01|A|Klubok| |109| A A A AHA RIMY | | | | | /І |! z02|RIKlubok! | 63 | RI RI R R|RI5|MI / | | HER Her | / soz|explanation| | o 8|8 8/|85Щ5|o0 0 - university" 304|с|Klubok| | 67 || with || 1 АЙ-Й | | | ! her |. z05|R|Kluok| | 758 | E (EE is ET, HIM! | Her 71 ЖИ 1 1 1717 717171 1 owl with a beak| |with А|А АЯАИА|А lovi 307|5|Klubok! | "| 55/58/5551 5/|5И / | | HER Her | 7! 1 | |! z08|T|Klubok| | 29 | t t 717177 t7/ImI | her | Her her 1 1.11 z09|M|Kluok| | go | MM mm/i/mim/ tim! , / Her her | / her z10|MISpraly | 5 mm mm mi mi | | |! her | her 1 1 1

With |RI|Spral| | 8 | EEE IS EEE THEM! | Her 71 1 17 171 171 1 z12|M/ISpraly | 48 | M M | M mMimi mimi her | / Her her ziz3|MI|Klubok| | 60 || ММ ММ/и/мчим/мимМИ | Her / | Her 1 her. from 14 | MIKluok! | 96 | MM mmm mimimimMmi i | Her Her Her 1 1 1 1

ZI5IA|Kluok| | 0 | А|А А|АА АЙАЙ | | | | | /

Z6|RIKluok| | 33 | RR РИРИРИРИРИ | Her / | | Her Her 317|5|Klubok! | 65 /5/5/551|5|5/|5Y / | | HER HER HER 7! her | |! z8|R|Spraliuab| 6 | EE EE EE EETEI | Her 71 7 1 1 7 17/71 171 1 319|5/|Spirals | 96 | 5|5/|5/51|515/|5I / | | HER Her | 7! her | |! z2g0|A|Spiral| | 58 | А А А ГА АЙАЙ | | | | | /І |! 321! 1 |Sprayali| | 4 / 1! / 71 7 7/7 771 01171 111 17 171 17 17 177 171111 3z22|E|Spral| | 3 | E | ЕЕИЕЕ ЕЕЕЕЕИЕИ / | | /Her Her | / 7

Z23|A|Spralu| | 998 || A A A AHA AITI | | | | | /І |! 324|A|Spral|i | 52 | A A A АЙИА АИИАЙ | | | | Her | / 7 3Z25|MISpral| | 18 |In 1 1 7 71 17 IMI 1 17 71 17 71 1711711 326| 1 |Klubok| | 24 | AND! | EE ET ETEI 1 111 7 17 71 17 17 17117711 32g7|VIKluok! | p" |vV|v8|vn he vn/iv! / | | | Her | /

Z28|RiIKlubok| | 77 | RR RIRIR RIZI | Her / | | She is 7! / 329|RIKlubok! | 5 | RIRIR/ RIRIRIRI HER | | /Her Her | / 330 |Nicluok| | g | nn niIninI Nini 71 her | her her her 1 1.11 z31|sIKludok! | 77 1-17 117-71-41 1 1 17 17 177 17171 11 332g s |Kkluok| | from Is 471-717 -71s:1 1 1 1 Her 1 1 1 1 11,11 333Y0| lit | | 2: | rIrrioiro|0s,1 | her | her Her 71717 7 71 1.1 334|is! lit | | 6 ||| EEE EEE! 7 | HER I 1 1 her 1 1 1 335|RI Letter | | ride | RI RI RIRIR RII |/ Her / | | She is 7! ! 336|Hey! Kluok! | 19 | EE EE EE EEITEI / | | /Her Her | / 7 3371О| letter |(y2g| 448 (00101 0919(1019(0,Ї | | (| HER 1 1 11 1 33814 | lit | | 7/1 171-77-71: 1 1 her her 1 1 1 1 1 339|t | lit | | from | t 7/7 717 t7ikI | ! her 1 1 1717 71 1 1 from 1 1| lit | | 0/1 7 71 7 171 71171 (11711 1117 17 17 1 17 17 17717111 ill| lit | | zo is | MM ME! y | ! her 1 1 1 1 11 3z42g|Z| Letter | | 5 | 5|5151/1/515151Ц151 | 7 HER | | Her 7! / 343|M| lit | | 23 | MI A A AGA TIAI | | | | | /Ї |! 3441) letter | | 88515555 | ІІ 1 | her 345|5| Letter | | 39 | 5 | 5 5/51/5151Ц|51 | | /І | Her 7! 11.1 of 48|5) Flow | l| m | 5/5 | 5/51515/15 | | | |І Her 7 Her 7 0 | 1

Table 4

By- Evaluation of lov- in women- 20- 20- | balakh MR Ske-|Vari Vari Vari Vari Vari under- |influence of Vag1 | B25 | B45 you EAE EAE EAE EAE EAE nya struct. meaning 258 years old ant ant ant ant ant

Mechanism 258 349|M| The leak || Mm/|5/ 5/5/514|MY | | its 350 tons | 7 | t | t 71/17/7777 1 her her her her 1 1 1.

ZMO) letter |v3| 36 0100 9|9|oi|kI | | | Her Her 7! from 52g|MU| lit | | 45 | nni Nn(in EN I Her 71 1 01 7 17171711 353|MI lit | | 0 mm Im mimiIm/imI / | | Her Her | / 354|M| lit | | 19 || mm / mm/mchiIm/ mit ,/ /i | / 1 her 1 |. 355|U| lit | | 4 MM mm MM 111 | her her her 1 1 1 1 1 356|MI lit | | 1 | mm mm mm mm mm mm | | her 1 1 her 1 1 1. 357|M|Kkluyuok| | 9 MM M MM ANI | HER | And her! her her z58|s)| lit | | 0 |с|с|с saisisisI / | | | Her HER her 359|Н| lit | | 0 nn niIninIninI Her her | her her her 1 1 1

Зб Зб Зб Зб зю|н| le) | equating theory by og ou av om tav 3611 p| lit | | her / 4-7 s 71 2717-41 s1 411. 11711711 17 1111111

MZ6 MZ6 MZ6 MZ6 MZ6 ee) la) | 20 e|k o mrkmim|e o mre nivi rt zey

MZ6 MZ6 MZ6 MZ6 MZ6

GO uv doyu polov jun 1111 363|5| lit | | 8 |5| ЕЕ ЕЕ 5 |5Й | | | | | 1 364|in| lit | | 04 | k|vV horse! | | | / ! 3657) letter | | 0 | t | RIR' RIRRIRIRY HER | | HER Her | / 1

Shout out! BLIND A I "1 R LIA | .O- zt|v|vizh|) | ks o siv|A I vm rmy Tue Tet Lu Lei 36 36 36 36

GB of herbs from 68|s|Klubok| | 2 | с0|с с/|сис1са|с,| | / | | HER HER 1 369|5|Klubok| | 7165 | t 777 5IIАЙ | Her / | | She is 7! І 370|c) letter || 37 s 21211111 37|5z| lit | | 17 with mm mi mim m, | her | her her her 1 |. 372|Tt| lit | | 293 | 71/77 77 7/7" 1 her her 1 1 1 1 1 1. 373|5| Letter | | 45 | 5 | 5 51/51/5151Ц151 | | HER | | Her 7! / 374|t| lit | | 63 | tt 71777717 1 1 1 Her her 1 1 1 11,1 375|In| lit | | 23 | nInIn no |oinI her | | | 1 1 her 1 1 1. 376|c| lit | | 23 || с с/|сис1са|с| | / | | HER 7! 71 7 377|MI|Kluok! | 60 | M A | A AS 5 |MI Her | | | her | 1 1 1 1 378|T|Klubok| | 24 | ТТ т т 71777171 1 1 1 Her her 1 1 1 11.1 379|MIKluok! -1ch1-1-7Y 1 1 her 1 1 1 111.1 z80|T|Klubok| | 74 | | t 71777717 1 1 Her 1 1 1 1 11.1 z81|5|Klubok! /|124|5|5/| 551|515/|5Y | | HER Her HER 7! 1 | |! z8vg| 1 | Kluok| | go 1 11 7 1 71 011717 01171 1 1 1 17 17 17 17 1 1,1 z83|MI letter | 551 76 |mM| m mmm mimimimMmi y | Y HER 1 her 111 384|RI Letter | | 66 | Р R RIRIR RIRY | Her / | | Her 7! |! 3851U| lit | | 42 М M m MU UM | her her her her 1 1 11 1 z86|Tt)| lit | | 99 | 777 77 7/7" | her her 1 1 1 1 1 1. 3871 | lit | | 5 s -171-71s7-7ЕЙ 71 Her 17 01 17 7 17717171 1 z88|О| lit | |109/1,010/|0 1 09|09109|0I |! | | 1 | her from 89|R|Kluyuk| | with (EE EE EE EETEII | Her 1 | Her 1 1 1.11 z90|t| Vyok| |66|7| 7 7 77" t7|РІ | ! Her | her 1 1 1. 391|5| Flow| | 56 | 5 | 5 5/51/5151Ц|51 | 1 | HER HER ! 392|А|Kluok| | 288 || equestrian! | / | | | Her HER HER 3930)! lit | | from 010 1or/1 ooo! | ! | Her |! her her 1 1. z94thM| lit | | 1 U M U MU 1 1MY 7 her 171 1 01 71771711 1 395|M|Kluyuk! | 8 M || MM MM | her her 1 her 1 1 1 396|v| list (66 z | k|v kynni vniv! | / / | | Her HER HER 397|t| lit | | 6 | 7/7 7117/7777 1 1 her 1 1 1 1 1 1 z98|еЎ lit | | 55 | ЕЙ ЕЙ E EE ЕТЕЙ / | | /Й Her | / 7 i399|5| list | | z | 5/|5/51/515,515Й | 7 7 | Her Her 7 1 11 1 7

Table 4

By- Evaluation lo- In women- 20- 20- | balakh MR Ske-|Vari Vari Vari Vari Vari under- |influence of Vag1 | B25 | B45 you EAE EAE EAE EAE EAE nya struct. meaning 258 years old ant ant ant ant ant

MR factor 258 400|M| lit | | 5 | hmm with MI | 1 | her 1 her 1 1 1. 401|А| lit | | ! (А А А|АА АИТАЙ 402|с| lit | | 0 | s|s/s/Isivisai|s| | | | Her 7 71 71 1 403! 1 | lit | | 0 | 171011 1177-41 her 1 1 her 1 her 1 1 1. 404|mM| lit | | 0 | mm|mM/ mm/mim/ m/s: ,/ / her 1 her her 1 1. 40511 | lit | | with |! / 171111 1717- 71 1 1 1 her 1 her 1. my 111111 -1-7770101 1-71 -,1-1-1 1-1 s 1 1 1 1 1 111. -1-Г 71701171 -1-1-1- 11-p71 11711111 11.17 otos|kuek| tp) era 1 408|T|Klubok| |107| t | 7 71777711 1 1 1 her 1 1 111.17 409|Tt|Kluok|, | 50 | 1/7 7771 oEeeEEI HER | | | | 1 1 11. mo|RIY lit | | 1! | RIRIRIRIRIRIRIRI | Her / | | She is 7! / I1IM lit | | 2 | m mM U UM pi her 1 11 1 1 1 1,11 4l2g|m|I lit | | with |(h|mMIm|mim/muniI 1 1 | 1 1 her. 43|s| lit | | 0 | s|s/s/iIsivisi|s| | | | Her 71 7 71 1 la|MIklok, | 0 m mM U U U her her her 1 1 1 1 117 415|RI|Kluyuk| | 6 | РИИР RIRIRI RIRY | Her / | | Her 7! / 416|M| list || 2 | mm Im mm m t her 1 her her 1 1 1.117 m7HA| lit | | ! | (A AG A|ААЙ MIU! ІІ | | | | | | 7 | 7 sviv| le e|v|v v yan v viv m9|e| lit | | 2 || EE EE EE TE! 7 7 71 1 1717177 71711 4go|iM| lit | | 177 | hm |mM|mim/mMu/mMi her Her | / | / 1 her. 421|M| lit | | 4 (mm M g ME! her | | | | 1 her 1 1 1. 422|v| lit | | 77 (y |V kvi an! | | | her 1. 423|M| lit | | 138 | im μm! mm/ mmiI Y | / | / her 424|Р| Flow| | 23 | РИРРИРИРИРИРИ | Her / | | Her 7! / zvi |vizh)| ||: || som tu 426|M| Viok| | 50 || mm mm /i/mchim/mimmI | 7 her HER 1 her 1.1 tiv|tu) | v|v v viv tm 42811 | letter || 104 | 1 1 2 CM IEE 117 17 14 1714 17171771 ze v| ly || a vk a I -1-G7701 1 1-1 -,1--|8kЯve 1 1 1 1 1 1111 430|с| lit | | 7 | s|s|1s|sivisi|s| | | | Her 71 1 171 7 conspiracies | | Her 71 1 01 71771711 1 433! | lit | | zz |. 7/7 s 177 7mMiI 7 Her | | | | | her 1. 434|ЮУ| lit | | 4 | xxx her 1 Her her 1 1 1 1 17 zt|le| || t t|tv|t|v em street avitikvzh i MI tora pe Shk s "21 o 43 43 43 43 43 ztos|kluyuje| /75|0/ 6 ev | sr vm t l t zh tya zvo hfkuyeyu 5 |U U U UM battle IDD ze tfkyeu! vo) t7|t t tro) t e|vmiom leno 440|Сси|ballok| | 7 |s|si|si|si|s|Is|5| | | | | | 7 Her 7 441|M|kKluyuk| | iz / IN MM MM MM DREAMS AND HER 71 1 7 1 77171 1711 442|с| letter || 67 | s|s|s|si|s|suis| | | | | | Her Her 7 443|Tt| lit | / 37 | pp. 7117771 1 1 17 17 17 17717111 444|ЙО| lit | | z3 (00190, 09|19|01909I | | | | her 1 her 1. i445|Y- | letter | | 87 | 71-71 1717-07-71 17 1 171 1 7171 1 71 1 1

Table 4

According to the assessment log 20-|b l - alah - .: - - - zhen- 20- pri. influence! MR | waya | vov | Ba5 You | in (Ske-IVariiyedeVarii Var Bari Ed Var de nya struct. meaning oz- 258 years | ant ant ant ant ant

MR rank 258 nicknames

I446|Р|І Letter | | 1 | EE there is, there is TE ОЙкК! | HER | | 7 7 her rai rai rai rai rai zpfo| Feb | y lo o|o oo oo know l dit tv laz rai rai rai

GG takes (448|Z|Spralu| | 2 /5/|5141515151451К15Ї | | Her Her | | 7 7 7 7

И449|ЕЙ|Sprali| | 31 || E EE EE TE ETEEEI | | | | Her Her Her (450| T|Spralu| | 7 | t | 7/7 71717177 | her her her her her 1 1 1

И451|ЕЙ|Sprali| | 15 | EI EI E EE TE ETEI | | | | Her Her Her 452! |Kludok| | 2/1 - 1-17 1-7-Y 1 her her 1 her 1 1 1

I453|RIKlubok! | 14 | R (RI RIRIRIRIRIRI | HER HER Her | | | 7 7 7

I454|RiKlubok| | 2 | RI RI RIIRIRI RIRII | HER | | / her / |/ 455|ЭИ|Klubok! | 38 EE EE EE EE TIEEEII | HER Her Her | | | 7 7 7 (456! t|Klubok|Y | 5 | t | t/ 7/7 1717177 1 HER 1 1 her her 1 1 1 457| Т|ИКlubok! |119/ 717177, 7 17/77 her her her 1.1 1 1

I458|E|Kluok| | 955 | EI EI EE EE EETEI | HER | | / Her / 459|A|Kluok| | 5 | || VINNI |в|В|Й | | | | HER Her /Her 460|RIKlubok|! | 32 | R IRR RIRIR RIRRY | HER HER Her | | | 7And 7 7

I461|MiISprali| | 34 | M M/ M! MM/MM and MMMMM! 7 7 7 | / 7 her 462|M|Spraly | 4 mm |M|M! | | Her |! | |! her 1 1 1

I463|E|Spirals| | 57 | E EE EE TE ETEII | | | | HER Her Her (464|5|Sprali| | 2 | 5|/5151/515154K15,Ї | | | HER 7 7 7! 465|M|Kludok|Ї | with mm mm m х|mM|M! | HER Her Her 1 1

I466|5|Kluok| | 0 /515151515154K15,Y | | | | Her 1 her

I467|N| letter (my 1 / nInIninuiIninu|InI | | Her | | Her. 1 1

I468|in| Lyt | | with (and /|В|nВ/InВnIV|в|ВЇ | | | | | Her HER 46911 | Letter | | her. / 71 /-i- 1-74 7-1 HER 1 her her her her 1 1 1 470 |5|Kluok| | 1! | 515151515154К15,Й | | | | 1 her 47l|IMI lit | | 2 | mm|mMiimiImuininiInI her HER HER | / her | her 472! 1 | lit | | 7 / 1! 7 1711 11101 17 1 1 her 1 her 1 1

B47 B47 B47 B47 B47 and|n| Feb | | |in I|in|introduced| I called him for a visa (my wife 847 847 847 847 847 under the XX NN Ach i Ya chZ 474! | lit | | 1 7-71 71- 1-71 101171 1 1 1 her her her 1 1 1 47511 | Lit | | 20.1 171 7 17 717171 01171 71 1 1 1 1 1 1 1 11 476 I476 pt|z|viz| vom ve 478 | M | Leak from mm! mi moe mi vo) t va MLl ov| M. oz va vk te|t|klezh |z t t|t tt nya 480! |Kludok| | 16 47 471 ONE HUNDRED MISSIONS 1 17 1 1 7 17 71717 717171 1 1 481|A|Kluok!Y | 22 | | Vk|v|nVn|IV|IV|IMI | | Her Her | | | 7 7 7

I482|A| Letter |(p1| 4 | А А| А | АГА АИМИ ЖИ | | | | her / |/

I483|RI Lyt | | 0 | RIRIRIRIRI UTRYI | HER 7 | / Her / |/ 484|MI lit | | with m mm mm mm mm mm |МЇ | Her Her Eat Her! Her 1 1 1

I485IIU| Lyt | | 1! MM mm M MM! | And | her 1 her 1 1 1 486|5| Letter | | 0 /5151415151514515Ї | | Her Her Her | 7 7 7 7

I487|M| Letter | | 1! | mm mm mm MI | | | | her 1 her 1 1 1

I488|t| Lyt | | 1! 7/7 7 1777177" her her 1 her 1 1 1 489|NI lit | | 8 /nInIninininin|niI | ІІ Her /І | | 1 1 vo|v| vyh |z I I|y |v yap vioyuve

I491|5| Viok| | 2 /5154151515/I54K15,| | | ,7І Her 7 7 7! (I492|А|Kluok| | 0 | А|А|А| АГА АЙАЙ | | | | | 7 / |/

I493|O|Kludk|Y | with оо |о0о0|0/0|1|0|0|Y | Her Her Her | | 7 0 7 1

Table 4

By- Evaluation of lov- in women- 20- 20- | balakh MR Ske-|Vari Vari Vari Vari Vari under the influence of Libra B25 | B45 you EAE EAE EAE EAE EAE nya struct. meaning 258 years old ant ant ant ant ant

MR chin- 258 494|K|Kluok| | th Kk | Vk kin Vn|IVY | / | | | She is 7! HER ев|тиклеж| | yayu tt t|ti|t|t te | | | 111 496|M|Kluok| | 5 | MM mm/mim/mimMI ,/ Her / | / / her |. 497|t| lit | | 6 | t | 71777717 1 1 Her Her 1 1 1 11.1 in February. 8 GI PVI--kdv k kvi 49 49 49 49 49 ve|aklezh| |в и А|А Ас) o it ov v oo tag em 15 9b c

ГГ с рамовивюрой 500|тТ|Clubs! | m | 7/7 t t|RIRIRI HER | Her | Her | 1 1 1 1 501|MI|Klubok| || M mM mi mim/ mimMI | her her HER 1 her 111

IBOg IBOg IBO2 IBO2 IBO2 ohiiiiklezh! || uvr i ov vek me u vav det tr rev m theses

IBOg IBOg IBO2 IBO2 IBO2

GT Hera odnetv rev dttvya

GG byu 5031) letter |bi3| 0 1 171117 7 1 (1011 1,1 11 17171717 17177111 504|t| lit | | 5 | 7/7 7117/7777 1 1 her her 1 1 1 1 1 505|О|І lit | | 8 101010 991090! | Her 1 1 5061 1 lit | 1 508 | A | /kik!I | Her | her her her 1 1 51 |s|Kluyuk| | 0 s|s/ s/|siv,sa(|s,!I | | | ! 1 1

М51 М51 М51 М51 М51 е|kiklju| |z m)|ko muk koor riv ov om o yak tya

M51 M51 M51 M51

M NI NO NN NO M V VO BO NY V NO ESE se ENN for weight and av et art tv sy

GG

54 | cI lit | | 3/1 s 71 11-11 1 17 17 17717111 11

BE ssU NNNE I NYA SYA SYA NS SYA SIS Z s NN NI NO NO NI NA 51i6|MIKluok! | i25| mm mm mimimimMmi i | HER 1 her 111 51 51 51 ts kuezh| |with essay ss s siv rt ty 51 51 51 51 51 te|in|kluyu| from 5) 8/|5|5| 8 5 widows and widowers, high school, high school University of Ost 51 51 51 51 51

GG ron widows vno koe vn el

GG eyebrow 5Ma|M| lit | | 7 M M m MM MI 1 1 1 Her 1 1 1 1 1.1

ИБ2о0 ИБ2о0 ИБ20 ИБ20 ИБ20 volya) Those three leads to the riv in the aov o rivi kv

IB2o0 IB2o0 IB20 IB20 IB20

MN NO NO NO NO NO VO B NIA V VO ti EN;

Fri zve zve zve zve zve zve 5) 855)

Hm 522|s|Kluok| | 2 | с0|с с/|сис1са/|с,| | | | HER Her i52ghz|RIKluok| | 4 | RI RIRIRIRIRIRIRI | 7 7 | | Her 7 1 1 1

Table 4

By- Evaluation lo- 20- | balakh - and - - - women- 20- pri. influence! MR | waya | vov | Ba5 You | vi (Ske-IVariiyedeVarii Var Bari Ed Var de

Me struct. meaning 258 years old ant ant ant ant ant chin- 258 524|p8|Klubok| | 46 | in с 1 0|с|с1с9|с0| | /Г / | | Her Her Her 71 525|R|Klubok| | n | EE EE EE THEE! Her 71 7 1 17 1717 171 1 | o tt t|t|t|t tva 527|с8|Klubok| | with |/(6| s 1 s0|s|s01s9|s0| | / / | | HER HER 71 528|СсИКлуок| | 2 | с|с|с saisisisI | | | | Her HER Her her | |! 529| O0|Kluyuok| | 7 | riIrrioiroirb,! | her | | her her 1 1.11 5301) letter |5| 8 11 s cm MI 1 1 1 1 1 1 11 11 51IM| lei | | 2 M M HU MM MI 1 her 1 1 1 17117171 1 ini la) | April, September, November from your

GG bmnrtvya 5334 | lit | | 6-1 171-77-71: 1 1 1 Her her 1 1 1 1 1. mikiklezh| | 5 μm/min mo mag zu ev te div av vv

GG is being repatriated

GO ormv vdrmvvdo vovi tu

NO i NO PO KO OH NKY NA NO KAN NK NI s NK NA NA NANI KA NA 536|5|Klubok| | 50 | 5 | 5 5/51/|Mm|5|Y | Her her | | 7! her 1 kyu tyu otr kila) | m|k m/nis|e language g vv vu relay o

GT Port vna vo mor rr vra

GT Tyrelvm TV gate 111111 ethers) 539|MIKluok! | 4 | MM |m/ mimimimimiI i | / HER her Her 1 5401 1| letter оо о|о|о|ро о юбуреув 52|М| lit | | 23 | mm mm/i/mim/mimMI ,/ Her her | / / her 543|j)| lit | | with5 || y/n pinni! | | | Her | / 544|s| lit | | 33 |I(6| с 1 св/|сис1с9|с0| | /Г / | | Her 7! 7! 71 7 ех! ла) | xx xxx hyukryu | | 11111 546! | lit | | 8 1 171 17110117 17-:71 1 1 th her Her her 1 1 1 ifv klem! | is|is is || is eru tel lav m taya

M i i NO P O M NA NI NA NO NA A NAU ss KNIVES NA NAH NANA KA NA 548|M|Kkliyuok| | 4 M M U U UM | her 1 her her her 1 1 11.11 549|RIKlubok! | 50 | RIRIR/ RIRIRIRI HER | | / Eat her | / 5501 1|Kluok| | 7 1! 7/1 7 17101171 01171 71 1 1 1 1 Her 1 1 1.1 p o/clezh| | o o o/ o o ||| | ee is ev sttiue bo

Table 4

By- Evaluation lo- 20- | balakh - and - - - women- 20- pri. influence! MR | waya | vov | Ba5 You | vi (Ske-IVariiyedeVarii Var Bari Ed Var de

Me struct. meaning 258 years old ant ant ant ant ant factor 258

WE HELP YOU ON ON ON ON A NE es NK NN ON ON ON ON ve|incl. po) 8|8 8 858 Ivo kovu again to v d a dm nov i po PO M A NI NA NA NA AK NI ss: NOM NK NAH NI A NA vevtiklezh| 790 tt trop ura by the skill of grains 81815151 in rve ee re rya

Xia 1 tu|tiklju! | tt tr sidewalk to ev

HH meter det ven) lyutC|mti vv kw i niv| I, I, drove, drove, drove vm tv

MIN Sho M NO NO VO VO BO NO VO VNS IEE io Va 55 55 55 55 55

GG berelev et vu vm rovi that ve |u| la) | t xx xxx hervnre | | 111 560|in| lit | | 33 ! | | | | her 1 1 | 7 kr vrkov| i i vm zvo moz dog dk et 1111 sv with |x| la) | 5 xx xxx chemical | | 1 111 566|ЯА)| lit | | 5 | АГ АГА АИИА АИИАИ | | | | Her | / 567|5| letter | | 2 | 5|5151/515151Ц151 | Her HER | | 7 Her ee uiklezh! | |U U M | I was a widower vn lion

WE i A PI NO NO NN NA A NAAN NA NA Ne TE SECHI ee tikluezhyu| | 50 tt tr tt t otv rivemelav yav to|viklezh| | in | e|RIv|v is ove|omryuvov in otv gio| lah! z v vk yes we don't know orav oo ev ev 057 057 057 057 057

GT be od vu zvod to i PO P O MOH N NA NO NA NK NOT NYM NIC NA NA NA NA sisile) | 7 | fer ov dme zt miv| le /m/|8|8 8 ek) m |v

I575IM| lit | | "m U M M UM 1 1 1 1 1 1 17 1,1.

Table 4

By- Evaluation lo- 20- | balakh - and - - - women- 20- pri. influence! MR | waya | vov | Ba5 You | vi (Ske-IVariiyedeVarii Var Bari Ed Var de

Me struct. meaning 258 years old ant ant ant ant ant factor 258 576|M| lit | | 26 | MM mi mim/mimmMI | 7 / | | her 1 1 578|s)| Viok| |109/|c8|c8|c sai|csi|cI 579|M| Viok| |7120| | mm mm mm/mim/mimMI | Her her | Her her 1.1 580|5|Klubok! | 66 | 5/|5/|551|515/51Й| | HER Her | 7! 1 | |! vbm|club! v/m) mo mo m)5) 8 had a nickname e|iikuyuya! | my |! yr ee | 1111 m|v| li) | вв в|85|т|т vedy i po po M NA WE NA NA NA A NOT I Ese Be BLACK

NI и и PO PO KO OH NKY NA NA NA NK NI ss; OUR NA NN ANA KA NA iii le) 1 yr you tue vera ret viteya 1 terte i PO PO M NA we NA na na a na na what YOUR es ii im! la| | we hu eve press toivov yam net tv rev lo tv

GT ram lm rt uv

TS yayu yayu ryuryaya 588|RIKlubok! | 7 | RI RI R RIRIRIRIRY HER | | / Eat her | / 1 589 |A|Klubok| | 38 | A ІА A АГА АЙАЙ | | | | | /Y | | ,|/ otiklezh| | et tt otveodrte odn ov uneya ov te | to tav setfaklezh| | A|A AAIA|A A ovvnireg tu vovi tm et t ev to tv

GT bi i kro reve na i po po po M NA NI NA NA NA A NI B el o Ya et SET i PO PO MOH NI NA NA NA NK NI BU NIM NA NA NI CA NA seg tiklej| |v tt t|t|A|A loveizo|le omiyev od ogru all om te 1 kv vro re yan y po po M A NI NK NA A NA KE ES KU o Ty So ez|v vy) me 5) 855 ) can 594 | The leak /|130/ p 171-77-71 1 1 1 Her 1 Her 1 1 1,1 evo/clezh| |v oo o/o|0|o o will die vit vot vig vm y

GT ben vena tu tv vu ta

Gen vm about the widow vv ro

Table 4

By- Evaluation lo- 20- | balakh - and - - - women- 20- pri. influence! MR | waya | vov | Ba5 You | vi (Ske-IVariiyedeVarii Var Bari Ed Var de

Me struct. meaning 258 years old ant ant ant ant ant chin- 258 nyka ev mfkluzh! po) mm mo m/n) m o speech language at tu vy ryv| vv en vo ot

Grea vu o vn ter to

M y NO PI M OH NI NA NO NA AK NSS: NOM NA NA NANA A NA 5971 |Klubok| | 64 | p 171-717 -71-:1 1 1 1 HER Her 1 1 11.1 eeo/klezh| | 5 o|o0 o/|o|0|o omu led her|lecture| 35 85) 85/59) 8 in vosti 111 vapetovroya 6b00|yI|Kluok! | 55 || v/n knysisivnI | | | Her | /! 1 zol et v ee oo te ev bi a taya

MEN Sho NO No MO KO V NO I NO V ss: SHY NO VI NNYA BNO NOYA BA M

Eb6o 602| EE | Letter 55 E E E E TE ER | g B25 2M 2.53 soz|s| lui| | ss o|s|v|s o ve zmrig zdi zu ov zy ev 5 tv

GO bOrelzmryavyuztra0 604|U|Kluyuk| | 4 MM mm MM MM | 1 her her her her 1 1 1 sok klezh| | | Er | is veYiv|a vd vne vm ev zd tez

NI PI A PI NO NO NK NA NA NAAN NA NA BE o u ee

ГГ боров в вм з з з в со то и PO P O M NA NA NA NA NA A NI Ks ks NI NO NO NK KA SCHO ov klezh| | is) is || there are vm zvni vkst vkryv vo a 1110 vmvvotvvurtvvm i treya

GG bretvretvyayurav sot|viklezh| | 8|8 8/5) 5 led two le lion then tv

GG ore sovit| do! m/t|t a aku m trevnz vva vu loven ve | pp

GG vvreeouvryat widow vk sgid to and PO P O MOH NI NA NA NA NK NO ss: KOSHI NK NA NI KA KA vek! la) | mk m/nim| m mee|zoireg orav sv an 225 vv 11111 died Yurakluya| | o A|A AAIA|A A vodo ov ov ev orav epikiklezh| || yer ek kv rik measure nya u tik) tt ||, t tva orrrag| he ato |v ozh ev zm

SP ii | ADD

Table 4

According to the estimate of lov- in zhen- 20. m. inflow of MR watt | wow you | vi (Ske-IVariiyedeVarii Var Bari Ed Var de nya struct. vach M 258 years | ant ant ant ant ant

The factor z61 z61 z61 z61 z61 is included ve 8|8 8 8/5 8 in zmoz zu te in zuen zm 15. z61 z61 z61

GG relzurrrya

Ab1 Ab1 Ab1 Ab1 Ab1

Ab1 Ab1 Ab1 Ab1 Ab1

GG bienaa chu ovdv to id ivya 615|Tt)| lit | | 4 7/7 7 77" 7/7" | her Her 1 1 1 1 1 1. 6bi6|s| lit | | 0 | s|s s/|siv,sai|s,!I | / / | | HER HER 1

М61 М61 М61 М61 М61 flow la) |for kuki kum| mok lav tv to nev same tv|/ lm tel

M61 M61 M61

GG are digging 61 61 61 61 61 sem! la) | mir liu evoYvmrmeei vn t vid tnya vn tvo pe

GG prison 69|M)! lit | | 0 M U M UM UM | Her Her 1 1 1 1 11 bho0|s| lit | | 2 | 6|s/s/|Isisvisai|s|I | / / | | She is 7! 7! 71 7 BG|MI lit | | 4 M U M UA UT i | HER Her 1 1 171 1 1 1 6b22|c| lit | | 6 | k|vV horse! | | | / ! b2gz|MI|Klubok! | 89 || mm mm mm/i/mim/mimMI | Her / | Her 1 her. tet ee 1117 6b25|5|Club! |123|/ 51/85/5551 5/51Y | | HER Her |! ! 1

Eb2 Eb2 Eb2 Eb2 Eb2 g is|club! in | there is

Eb2 Eb2 Eb2 Eb2 Eb2

ГТ рытв вра ву ма во й дкви я опр о b2g7|M|Kluok| | 98 || mm mm mm/i/mim/mimMI ,/ Her / | Her 1 her

Ab2 Ab2 Ab2 Ab2 Ab2 owl cl) | t A|A AAIA|A A v/v vro ak vo et vm tey

Ab2 Ab2 Ab2 Ab2 Ab2

ГГ оре в ню ма ту

Ab2

S yu 11 sob2 sob2 sob2 sob2 sob2 ege|sikleyu| | in the village I mistletoe ov tya ev zvod tey sob2 sob2 sob2

GG bBrevogrevoetya terte 111 631 11| lit | | 2! 1 71 17101171 01171 71 1 171 1 1 1 1 1 1.11 6321 1| lit | | 8 11171 17111171 171 7 her her her her 1 1 1 633|O0|Kluyuok| | 4 010. |or/ ooo! | | | Her HER 7 her her 634|in| lit | | 23 | Her | (And HER Y 1 637|is! lit | | 5 || is, Е ET! 7/1 HER 17 17171717 171 63811| lit | | і2 | 1! 1 7 1 7171 01171 11717 17 1717 177 17 17 17171711 639|RI Lyt | | 6 | RI RI RIRIR RIRY | Her /y | | Her 7! / 6b40|M| Flow!Y | z M M UM UM | Her Her 1 1 1 1 11 t64 t64 t64 t64 t64 siit |vtoei pa t|t t tt t your tro tnoyav td torn on that rt t64 t64 t64 t64 t64

MIN Sho o No NO VO V BO NO VO VO VO LANGUAGE EE os t64 t64 oyu, TT

Table 4

According to women's rating, 20- | 20-ballah MR Ske-IVari Vari Vari Vari Vari nya struct. under |influence| o58 Vag1 | B25 | B45 you pet | ant EAE ant EAE ant EAE ant EAE ant EAE

MR values 258 solver (6b42|A|Klubok| |

IAE! 000 HER TAKES, I ny them PY PO PO NOYA VO PN VE VOYA sh

Eb4 Eb4 Eb4 Eb4 64 blows! | | |eree|ee is ervevt lov measure chv| Good luck

Eb4 Eb4 Eb4 Eb4 Eb4

NO i I PI Pi PO NO NI A NI AN BA NA ETYA E et Me o reli EN o

Eb4 Eb4 1111111 barefoot | | 111

AbA AbA AbA AbA AbA vei| 1 | FATAIAIAIA A AV v v su nev v otv| VE nev Met

AbA AbA AbA AbA AbA

BUT WE BUT IT B BANYA B IN BUT BA NN ZE SSC

1111111 erase || | 1 6B7ИЙЕЙ | | |E EE EE KIYEI | | | | | | 7,648! Her her 11 xxx |MI | her her her her 1 1 1 1 pgt 69І0Ї | / |ro,1o,|o1o|roo | | | | her 1 1.1. at 7 Her 71471291 -41-471-41292714У1 1 1 17 1717111 p

Ив1|1ЙЕЙ | / | Eeieiiaeie Eyeia | HER HER | | |! | 1 1 1

Table 5

By- A. by- . NO NO NO NO NO NO wabi- wabizheni m Ske|Vari- | EA | Vary EAE Vary EAE Vary EAE Vary EAE Vary EAe Varied Vary

НЯ ro|let| ant E | ant ant ant ant ant ant ant

MR

ABOUT?

BOM BOM I5OE Bo Ii5oai073|. | Г ГГ her

ABZM ABZI ABZ ABZI. ABZM A5351055|. And | HER 554M 554U 554H 5541. 554U 554M | 0.99 | 554E 5547

And | 550 instead of I|057| ІІ І 7 1 1 her her 1 1 57 ГО Ц|845| 0570 O57E O575 OBLLU o5gIbya| | HER HER G (65 | В | 845| NOM AB herBK VbBI. | 0.99 | Vb65M AbBE AbBE AbBR 1 Inv | | | 7 | her her her 1

I67R 670 vl I67A I67E 677 678

AND HER Gb5 670 670 67 Ib7a1044Ї... | Her 1 68 | and | 845| 0680 Ob8K IS OB8I-. OB8M | 0.60 | 0685 OBVI E

And Her GTAveR sb8mu1037Ї | / 1 1 1 1 1 her 705 I70T 1700 I 70A 70 1700 G7oM | 0.96 | 700

AND HER TUOM G70M IG70R 10.90 | І708 і7oribv5|І | HER 1 became) OE OE 71 7 ak | 0.96 | STA a

And HER slo 71s 7 7. lu 71 sltiIb22

M725 M728 Mt. М72Е У72У 7 М72М М72Н 1 0.66 1 |М72гАвв| UM MTS TK M72E mtgРИО2гв|, | | her (73 | R TV45I| R7ZE R7ZA R7ZM RUZA!0.33|Y... | ,G Her her

E7AM E74tT E7AMI ET. E74H E7A4K E74A 74

AND HER RAS gtamI037Й. Her GG 7111117171й11711711 11 1

А75О А?7BE А75В | 0.90 | ABU ATB. А75Т А7Ба А7ТБИ с76К 76 2760 76 276с а76М 761. О76Е 77 GO 1845| 077 O77E 077 o7vIib096Йи | /! 7 HH HER her

ATZE ATO AToYagI057y GG 7G7g717s1717g17y17 17 1 80 |51845| 5VOY zvotI054| HER 7 1 GH 1 g 1 g her 583T 5ВЗ3М 1/0.60| 5831 |/0.60 | 583R zv3mm10.53| | / Y y y yy

O87U 0875 O87E 871. O87U O87T | 0.69 | 0870 87 91 | R IV45| ROTI ROTO ROTMU ROTA ROTE RYATM ROTI. MOUTH

Table 5

According to A. married m Ske|Vari-| EA | Vary EAE Vary EAE Vary EAE Vary EAE Vary EAE Vary EAE Vary EAE

НЯ ro|let| ant E | ant ant ant ant ant ant ant

MR

258|79

HER RC is 54| RIS |053|ROINIOBZ|RYAA 0501... HER 1 | | | her 92|8Ц|845|892К103| 892 |0.851|5928Ц0.76|592М10.70| 892А 039|592РИОЗ2А|... 1111111 93 Ha Ts|845| C93E |0.93| C93M (0.90 | c93M G0.86 | C93!. | 0.86 | C9ZA | 0.83 | C293T | 0.82 | 6935 | 0.80 | C9ZK | 0.75

ИЙ |893М/0.74Й с93с |072|Is93n|069|1093410531Й.ЙДЙ|. | 1 | 1 | 1 94 | k|v45| ne4E |0.99| nejak |0.95| nezM 0.95 | dog | 0.92 | nodA 0.88 | US 0.88 | NAYAM 10.77 | NOVEMBER 10.71.

HER (y | | | 7! her 1 1 1 1 1 1 95 |0(845|1r95M/ lo reb5t Г0,94| 095I. 10,87| 0958 0,831 095К 0,80 | 0955 | 0,64 | О95Е | 0.50 | O95A | 0.28 obH |va5IstobRY ov stobi|1,o8|sno6Mio,v|again bevIstovto5a|.. 11717171 lo8|M(v45IMtoven l4| tok |14|U1o85|1,06|M108С1,04| U108E 0.95MT08UL 083.11. 109 p 258 |y109К|07| НТОА | 1.05 |НТ090) 1.02 |НТО9УМ 0.97 |НТО9Н 0.92 | Н1О91-/ 0.91 |НТО9Е) 0.91 IN10921 0.86

ITS udnto9tI0.85) ntovi 0.84 |Н1090| 0.83 |НТО9Р 0.79 INTO9M 0.74 |Н109С 0.73 |Н109МУ 0.49 |Н109Р 10.07 110 ГО 258 |(OT1loK|І 19 О1100 | 1.18 ГС1101 | 1.18 |О11ОМ| 1 ,14 |С11ОМ) 1,13 |С11ОЕ 1,09 (011051 1,09 (О1101-1 0,89 фопосива| ооо о,изИсосоиоиоІстоРИОЛЙ. 11171711 111 ГО Г2г58 (Ола от Му | 1,08 |О111М| 1, 01 (ОЛЯ 1.01 |(О111Р 0.85 |О111т 0.79 |С111С 0.77 |СМ111У 0.50 1 | dovoi І Her Her Her 1 Her 1 1 1 1 1 1121 Tv45 lek (0.93) 12 (0.84 Pt112M 0.64 P1t12s 10.57 | 127 0.57 12E 0.39 | M12M 10.28 ПИ12M 0.28 1 | fnl25Ibe7| barks 027 |pl2groov|plavibga Mig og. her 1111 ll1z|ti|v45IlI1zUlLoov | tliese(082|t113sr0,75|t1zRI 0, FROM THESE 061.71 1117111 14 fE258IEL1i4OM 15|ETl4MU 13 IE114Сr0,79|E114v b41IE114Р and 009|..ЮЮ 111 1151 m 845) mm1,01|m0,915|m1,9161 |M115M/ 0.91 |M11551| 0.88 |M115M 0.87 |M11501 0.82 |M1151-/ 0.69 IM115С1 0.61

ОЙ 1 смов мкм 5нИбз5ИМ5нНИОгя|и 1 717171 1 1. 8 MmivabimiivUmiov| miv (0.9|Mmii8U 0.2|Mmi8vIova MM ovoY. 71711111 122 | А ГВ45|AT22EN 1 AT. | 1.06 |IAT225| 1.06 IAT22MU 1.04 IAT220 1.01 GAT22M 1.00 GAT22K 0, 96 (А122С | 0.96 123 p /v45|В123НИО,73| Нт2ЗА | 0.73 |В123У 0.72 |Н123Р| 0.63 |Н1237 | 0.61 |Н123М 0.61 | В1231-| 0.61 |H123E 0.57 7177 dvl2zoiI0.55| nt23M (0.49 |H12351 0.49 |HT123MI 0.46 |H123С 0.43 |H123M/ 0.42 |H12301 0.32 |H123E | 0.28 11 Iv23TsogyaY | HER HER her 1 111 1 1 1 1 1 1 1 1 Л25ИО(|В45ИОТ25УИ4| 125 |096|0125КИ0,63|Й../ 17717111 11111111 11111 129 А /В45ГА129Е|,О8| АТ2оУАТ | 29НИ,08 Г (1290) 1.06 GAT29S 1.05 |A129M 0.91 |AT29011 0.90 (GAT29MI 0.87

HER fAt2gogibv3|At29|1083Y. | HER 1 1 1 HER 1 1 1 1 1 132 | вк (в45|nt32М|0.98| VISA (0.96 |Н1З2М 0.96 |Н1З2МИ 0.89 | Н1321- 0.86 |Н1320 0.80 | Н13251 0.72 |Н1З2Е | 0.70 1 | | Visgae | Niz2O | 066 | Niz2O D 065 | Niz2M 059 | No32C 059 | Vis2ri 03611111 1 | Fat33336 0.92І0136У 0.059 | | 0.36 |0140K 0.30 1 | |riyaovibga|ri0A|Og22g|ritsi022| 0.67 11420 0.67 1142 0.66 098|E143M1095|.Y.YSHOS:(( L|.7ЮС71.ЮЮЙ1.Ю.Ю1.Ю 11 1 1 1 144 | m va |Mt44E 1 3| mi44r |1.09|M1445I|1.07|Mi44u| 0.94|Mi44E 0.86|M1440 0.04|M144010.52| Л.Д17ЮЮЮЯЙ| 1.14 014651 1.11 (01468) 1.05 |О146М| 1.05 | 01461. | 1.01 |p1460) 0.95 1 | |riabgire5|rievo|083|ri46mMIi08voY. HER 71171717 1711711 147 GO (в45|Мм147Т 1.02) Мм147. | 1.01 | M147U 0.63 | M147K 0.62 | M147P 0.61 | M1471 | 0.59 |M147R | 0.57 |M147MI 0.55 1 | мя7ою49|Мма7а|045|. HER 1 HER 1 1 1 1 1 1 1 148 A (B45|ATa480Н 18 AT480 | 1.00 IAT48M| 0.95 IА148Н 0.90 IAT48U 0.87 ГАТ48t | 0.85 | АТ14851 0.84 ЯАТ4801 0.83

ОЙ 1 фАт8ЕЙУЙЕЙ | HER | her 1 g 1 1 1 1 1 1 1 149 p /v45|yt149E11.00| n1490 | 0.99 | Н149НИ 0.94 | НТ49УМ 0.94 | Н149У 0.87 | Н149Р. 0.84 | Н14901 0.82 (Н149С1 0.24. 151 в (в45|Нт5151.06| В151М Г0.90 | ВИ51К 0.72 | НТ51МИ 0.69 | Н1511-| 0.68 | НТ512 0.63 | 1517 | 0.56 | НТ510 0.52 1777 dvt5tАИБоИ воЛи Г042 | НТ151MG 0.42 | ВТ51Х 0.39 | НТ51УМ 0.39 | НТ51Е 0.38 | В151Р 0.92 (15101 0.92

ОЙ 1 zfniereyai | HER | 1 1 1 1 1 1 11 1 1 1 152| 8 (845|5152К1.07| 8152М (0.98 I83152С | 0.95 51520 0.89 | 51521 0.83 | 81521 | 0.76 | 8152Н| 0.61 | 515201 0.60 1 | | 5152РЙОЯ47| 5152М |044|5152Р|041|5152М/0.37|51520 0.32|5152М 025|иЙ Й: 159 1 Гв45 1590 |0.92| 11590 Г0.78 1595 10.59 | 11597 | 0.32 | p598 0 .32 P159U | 0.29 P159M | 0.28 PI59M | 0.28 1 | fi5eRIbe7| Be (02659026 |I5eE026|I5901025|y59-1025|..YDTSY/.| C 1 160 A (B45|ATbOR 12) ATbOE (0.92 |AT6ORI0.89|ATbOSI0.85IATbOK 0.82 ATO 0.81 |ATbOG10.75| Y Shsh 163 1. /v45 163 |0.80| 11630 Г0.72 П-163М Г0.60 Г-163М / 0.56 P-163C | 0.28 YH163A 0.28 1163KI 0.27 P163R | 0.26.

PE Il63a|024 63502463 02411630 023 l63Mi023|. 11111 164 o (v45|p164A|0.90| 01645 | 0.88 016491 0.81 |Ir164M| 0.81 (p164Н8 0.72 |p164M 0.71 Gr1bai- 0.63 |0164M 1 0.56 1 | ribaMo5a|mercury | 0.51|ri6411049|0164C1049|p1641 042|rIb4E 030|rib4RI025|1 1 (166| - (845 i166011.07| 11660 | 1.01 |i166M| 0.98 |Г166Р | 0.98 | 166H 0.98 |! 1660, 0.97 166A | 0.96 | 1166K | 0.96

Table 5

According to A. married m Ske|Vari-| EA | Vary EAE Vary EAE Vary EAE Vary EAE Vary EAE Vary EAE Vary EAE

НЯ ro|let| ant E | ant ant ant ant ant ant ant

MR

258|79

Pleb5Ibo5iil66mMi092 166 0, iz iv 0621668 095|..Yu 11111111 167 | m v45 | M167AN 15) M1670 | 1.13 | M16751 1.04 | M167C 0.98 | M167P 0.92 | M167E | 0.90 |M16701 0.87 |M167P 0.83 1 Im6luvei!i | | 7! HER her 1 her 1 1 1 1 1 173 (|В45ИАТ7ЗМИ 12|ATIZRI097|ATIZa|0.92|АТ73М 0.88|АТ7350.77|АТ73Е 0.56|..ЮЮ/| 11.) 174 | 1 Tv45 174M |0.91| 11740 G0.89 P174H G0.77 P174K | 0.73 P1746 0.72 P174M 0.72 1174E 10.63 | 174M 10.59

HER fmavib5v and 033|Й7401032|...ДЙ her 111 1 1 1 1 177 Го 84501771 10 О177М | 1.06 |0177Н| 1.05 |0177U 1.01 G0177 | 1.00 |01778| 0.96 |0177М| 0.95 |O177M 0.93 1 | 0177Чо89|01770|078|01775|0.74|с177кИоМ0Й.1 11111111 11111 178 ГО (845|0178Е|0.98| О178Н (0.92 178 0.83 (01780 0.78 1017851 0.75 |0.17 74 |О178Р 0.67 ГО1781 | 0.54 1 | meadows o1ivU|050|0178И10.37|с178010.31|..ЮЮЮ.1.1 17717111 1 1 | Maniv MUt79e|044М175UL041|М179010,037|Й...ЙЙ 1 . | her 1 1 1 180 R GV45|RIVOSI,05| RITVOK | 1.00 |RI80T 0.94 |RI8OM 0.88 |RT8OSI 0.83 | RIVOR 0.62 | RIVONI 0.60 |RT8VOMI 0.56 f |RIVOM5Z|IRIVOM OZ8IRIVO0I028|Y. 1717 17717111 11111111 201 1 Tv45Г201с|0.79| 1201m Г0.67 П-201АГ0.64 | 2018 | 0.64 (12010 0.62 (12010 0.201061 |-UM PI-201X 10.60

HER GPeonivigotn| this 17 Her 11111111 11 206| is /va5GEgovM | ,00| g2obs | 0.86 | Р2ОбЕ 0.76 | R2OBA | 0.75 | R2OBU | . 11111111 208| 1 (84512082 |0.91| 12081 G0.79 P208U 10.71 PI20851 0.71 PI208E 0.67 |I208M 0.66 |! 208M| 0.56 |I-208NI| 0.50

HER 7 Pppgovova44|1208Uu/ 10.44 | 208C10.39 | 20801 0.37 12087 0.35 |! 208А 0.35 | 1208Р 1 0.34 20881 0.30

Her leader | | HER her 1 1 HER 1 HER 1 1 1 2lo|8(|va5IZaosNiZY HER HER 1 1 1 HER 1 1 1 1 1 211 Go gv45ИО211 уп 17Гогк | 115 |О211НИ 1.10 |О211Е 1.08 Yugt1m 1.03 (Ог1т1те 1.01 |O211u 1.01 |O211s 1.00 1 |Ogl5IroOhir|054|.HER 1 71171111 111

Е22ЦОб4|Е2и2О|063|Е212КИО61|Е2Т25|1059|Е2Т2Н 056.71 1111111 2131 1 TV45 Пгт3с 11 12135 (0.98 ПгтзН (0.94 Пгт3Е 0.91 PetZUu 0.74 2130 Г 0.67, 631 Pet 62

HER | Mgt3RIYUBOIigizn 058 IgIZATO49 |. | 11171111. 1043|O2146 040|O214K 028|Og14ni027|.. 1111 215| p /va5|Ng15M|0.95| H215A | 0.94 | H215I 10.85 |H215M| 0.63 |H215U 0.77 |H215E 0, 75 |Н2150 0.73 |ИН2И15КИ 0.72 (|на158067|Нна15о(|066|нг15т1066|Нг15Р b5о|Н2И5О 056|На15Е 054|. 218 Е |В45ЙЕгт8О 18) Е218И | 1.10|Е2Т82СИВИ1КИ1,Е8| E2I8H 0.93|EgIVE 0.92|E2T8RI0, 55.1 215 in GV21 |H219u 15) NO | 1.13 |H219UM 1.08 |H2190 0.71 |H2T9K. 0.63 |H21901 0.53 |Nat9R | 0 ,23 |H219NI 0.07 ng19ti0o5Ingt9mu0oz|ngt9 |001|ngt9A 0bo1|ngteM 0o1| 2191001 |n2g19сI000| sh 221 А|Va5IAggiZ NI v|Agats|103|A221E 01 |Ag21 MI 02|Аg1 О1 0b В45|Egg2S 13 Eggov | 1.11 ГЕ222и | 1.10 |E222Р | 1.10 (Ega2A 0.98 |Eg22M 0.98 | Ega2M | 0.94 |Eg22MU 0.90 1 | fE2ggNIvaE222РИ0О5У|. | | | ИИ 1 HER 1 1 1 1 1 225| 8 (B45|Ng25UMY 19| Ngg55 |117|N225E|14|N225А 102|Neg25Р 0.87|Ng25КИ0.85|Neg5Т077| 1

І fesebNIOobIEgovbO|І096І. | | / / / Her Her Her 1 1 1 1 | |M2gzoovz|M2zom|0.57|M23oRI053|Y. | Y1717171 11111111 233| Kk (B45|H2ZZEN 191 Ngz3ZU | 1.10 |n2gzZE| 1.09 |H233M 1.05 | H233I- | 1.03 |H23ZMI 1.01 |ng3351 0.87 |H233С 0.78 1 | Ivgznyuvoi HER Her 1 11 11 1 1 1 234 PMG 845 M/g34011.06 | Uu2ZaK | 0.93 M/2341 | 0.63 M/234E 0.60 M/2340 0.59 M/234Р 0.46 M/23403045 1 | Mmezbmio5a|Mmazbs|053IMaz3vM042|. | | | | HER her her 240|MmiVa5| Mega 18|М2400|1.17|Ме4оМ|16|Ме40е 0.57|Ме0Р И 044|../О/ 17711 1 241 | M va5 Mate 7| mate | 1.16 |Mg410) 1.15 |M2at1E| 1.13 |Mha1t 1.12 |Mg410) 1.07 |MeatNI 0.90 (Mae4t1RI 0.50

Her melnyooeeayee! | | | HER her 1 HER 1 1 11 1 242 | And GV45| And 242M|0.95| 12421 G0.93 P-242S 10.83 P-2428 0.75 12428 0.70 | 24203 0.68 |1242A | 0.66 |! 242M 0.58

Pie2go49 I242n|046|M 24210401 24201039 1242 03311 242К032|... 111111 243| vk (в45|Нг43И-|0.98| NgazA | 0.86 |НгаЗУ 0.82 |Н2аЗР 0.76 |Н24ЗН 0.73 |Н243М/ 0.71 |Н2430 0.67 |Н24301 0.57 1 | вгазРУЯЕ6 ! | | !/! HER her 1 her 1 1 1 1 1 /244| с |845|с244С|0.94| Garden! | 0.72 |2244А| 0.71 |82440) 0.60 |с2445 0, 58 |с2440) 0.56 |2244K 0.54 |с244Н| 0.54

HER 7 |6244M0.53| guess what 0.53 |ог44НИ 0.47 |б244М| 0.47 |s244M 0.46 |s244t 0.37 |s244M| 0.28 (C244RI 0.28.

Her ogo | | | / her Her 1 her 1 1 1 1 11 1 245|1Ц|845|Т245РИ0О6| t245i |082|t245C10,I1Y.1 11111111 11g1 1 246 | M | va5|Mg46A|O,85| Mac | 0.84 |M246P 0.79 |M246E| 0.78 | MgA6M 0.77 | M246H 0.76 | MgabR 0.66 | Mg461-1 0.61.

And | | mg4burvo| mega |06o|Mmebi1058|Y.. | | | Eat! | / | | her

Table 5

According to A. married m Ske|Vari-| EA | Vary EAE Vary EAE Vary EAE Vary EAE Vary EAE Vary EAE Vary EAE

НЯ ro|let| ant E | ant ant ant ant ant ant ant

MR 58 258

HER фА247ю0з0|А247Ми|02в|IAgaikIOgvIAagYatNOg| 11111111 1 248 E | B45| E2avi 11 EgavMu | 1.06 |E248NI 1.01 |E248С10.82|E2480 0.76|E248M 0.74 E2ЯАВКИ0501.Й.ЮУОС1 252 | K (В45|Н2г52-Н,09| Neba | 1,06 |Н252К| 1,06 |Н25201 1,05 ИН252М 1,05 | Не5251 0,99 |Н2520) 0,98 |Н252NI 0,96 01 | |н252Мибо2|на52го|080|Н252Е0,79|Н2а52|10,76|НаБаР О66|ИН2Б2т 048|.. 11111 277 | in (v45|H277NN 13 ng77M | 1.07 |H277C| 0.95 |H277E 0.88 |H2g77MM 0.87 |H2g7751 0.87 | H2g77P | 0.86 | H2771 | 0.85

HER |na77yu082|ng/70|070|n277А|069|Н2Й b55IN27IRIOMU|. 1 | 71 | 1 280 R /B45|P28ОО|18| Ditch | 1.08 | P28OM 0.98 |P280Н| 0.90 | R2VOE | 0.90 |P2VOMU 0.87 | P2VOE 0.86 IR2VOK | 0.64.

RovosИОб2|РОВОА|058|РОВО5И0.54|Р2ВОЙ 0.50|Р2ВОЙ 0.47|РОВОГ1046|. .-ЦС-/ 281 1 Tva5 Pgwtt 5) 12gwtm 1.14 Pgwtm | 1.14 P2v1s | 1.07 Pgwts | 1.00 PI281E 0.94 PgV1MU 1 0.82 2810 10.72 303 | 5 /258 |5303A,09| 8303M | 0.95 | 5303I- | 0.70 |5303U | 0.66 53032 0.64 | 83031 | 0.61 | 53037 | 0.57 |53OZNI 0.57 7 53032|0.56| 53030 | 0.43 |530301 0.39 |5303М | 0.37 |ZZ3OZUM 0.29 |53030 0.15 |5303K 0.13 I5303E| 0.07 1 rI5zoznoi | | |! her her her 1 HER 1 1 1 11 1 2 ez04E)0.01| sz040 0.01 |оз04КГ 0.01 (а304Р| 0.01 (ez04Н 0.01 |з04Н. 0.01 |(хЗ04УМ 0.01 (6304М1 0.01. ozo4ribotoso4mI0ooIszo4MI000Y. 17171777 11111111 111131 1Мо1017) езо5К 0.01 (ЕЗО5Е 0.00 | Е30501 0.00 (РЕЗ05С 0.00 | РЗО5МУ 0.00 | 3057 | 0.00 | Е30551 0.00 фЕЗо5НИОО0| еЗО5РИОО0О| ЕЗО5МИ000Й. 17171171 1111 306 ГАЗО | 25| 14| AZOBK | 0.96 (AZOBM 0.93 GAZ0651| 0.87 |AZOEM 0.78 (NITROGEN 0.52 (AZOBNI 0.50 (AZOBNI 0.48 2 AzobUMO4| AZOV. 0.33 |AZOBE 0.30 | AZOBI | 0.30 IAZOBM 0.26 | AZOBR 0.22 GAZOBOI 0.09 GAZO6S 0.07

HER PHASE HER 1 HER 1 1 1 1 1 tzo8МмИ0.01| tzovE 0.01 Yitzo8A 0.01 730801 0.01 | T3O8I- 0.01 | tzovi 0.01 | T308R | 0.01 YIT3O8M 0.01 1 | tzovmirottzovm ooi|tzovnobooY. | HER her HER her 11 1 /z6o| A (Vg1 |nZBOK|0.97| NZbOA (0.94|nZbOsI0.66|NZbON 0.63|nZ600 0.44 |nZbOE 0.41|nZBOgI028|..171 z62|E|B21|MZ62O M 2go| mzvam|t1y6|Mz3v2gs0.5|M3b2tI088|../ 17 17171777 17111 z64|n(|Vg1|nzb4sY Ог| 3645 |0.89|НnZvaА039|nZvaK 0.38InZ64М 025|..ШД//1 7171171 z67| /|В2г1|03675М,09|0367МИ0,97|8367с10,53|036710,38| ! 406R (0.01 fmbEYUyuT HER HER her 1 her 1 her 1 1 1 1 407 | | (258 |1407E 1.13) 14070 | 1.00 П1.407М 0.66 11407 0.56 П1407Р | 0.46 |1407А | 0.41 |! 4078 0.34 | 14077 | 0.34

HER T407sh020 407mM 017 Pao7nHot 40751 0.10 (14076 0.06 P.407K 0.04 1140701 0.02 11407Р 10.01. 408 t (258 |t408A|0.96| T408U | 0.54 | T0.85 48 | T408M | 0.47 | T408I- | 0.36 |T408M| 0.32 |T40801 0.30 |YIT408M 0.27 taovnibovy tao8nNu025I|t408KI|0.25I|tT408E 0.24 |T408Р 0.22 YT408M/ 0.20 | T408I | 0.17 | T408С 10.11 1 | tovoov|taovEЇ002|.

HER 7 Ttaoenioltu| taoemu Go |t409ЕГо10|t4098| 0.10 |T409U | 0.08 | T409M 0.08 | T409E | 0.05 (T409C1 0.02

HER mind ta09RIOOTIT40901001|Й..ЙДЙЙLY 17717711 111111 777 manner of small ol DMattATolo |MattE 0,09 |(Ма115 0,08 |Ма112 0,06 |Ма11К 0,03 |МА1ТЕ (0,02 of small oo iulРІООТІ 17111117171711171717 /v2g1 |nat85 1 13| natvA | 1.11 | nat8 | 1.09 |NaT8NI 0.91 |na180) 0.89 | NAt81 | 0.83 |NaT8M 0.78 (NAT8MI 0.76 dna 8muv|natvmMu0, 69 | НА18Е 0.63 | НА180 0.58 | Н4180 0.58 | НАТ8М/ 0.54 | НАТВЕ | 0.43 | НА18С 0.36 1 | vieRYULIA HER HER her 1 1 1 1 1 1 1 420 | M ГВ21 |ma2gob 11) magou | 1.10 |Ma42OE| 1.04 |Ma4hORI 1.00 |m420s 0.98 | ma2o1- | 0.91 | Magog | 0.90 |MA2OMU 0.89 17 7 magoMUUvl| magomM (0 .74 | MagoKI 0.71 | Magot 0.68 | Ma2OH 0.68 | MagONI 0.68 | Ma200) 0.65 | M42051 0.63 1 | | magoovo| magos| o5o| MmagoAT0O47!. HER 71117111 1111111 422 | K (Vg21 | Н42201 13) nagoz | 1.13 | Н422u | 1.06 | Н422А | 1.01 | Na22t 0.92 | Н422К 0.91 | nag21- | 0.87 | Na22M 0.84 17177 zwag2gMIO,79 | nago 0.77 | nagg um 0.74 | na22M| 0.72 | na220 0.67 | Н422НИ 0.66 | Н422С1 0.63 ИН422ЕЙ 0.60. 1 f|nagagib59| nagai |b51|InagaRI003|Й. .LL/ 17171717 17 71111 11111111 425| | ГВ2111425М 119) 1425А | 1.16 |G425U | 1.15 P.425M 1.15 PI.425E | 1.08 | 14258) 1.04 | 142581 1.00 |1-425K | 0.96 7177 Ppl250|0.93| 14251 G0.93 | 425M/ 0.93 | 425M| 0.92 |1425Н 0.89 | 14257 | 0.684 |1425E | 0.83 1425С 10.67.

Her pair | HER | 1 1 g 1 HER 1 1 1 1 1 (426| M | vg1 |Ma26M|Y17| ma265 | 1.09 |M42601 1.05 |Ma26U| 1.01 |Ma26A 0.99 |Ma26U 0.91 |M426E| 0.83 | Ma261-| 0.83. 1 7 7 u|ma26010.83| magbn (0.80 |M426t 0.77 |M4262 0.68 |M426R 0.59 |M426K 0.59 | M426I | 0, 53 |M426NI 0.51 1 | megvsibza|Mmaobmu ozi|mavRI029|. | HER 1 HER 71 11 1 1 717 (54272 |0.87| 54271 (0.84 |5427E| 0.83 |5427M 0.78 |5427K 0.74 | 5427А 0.73 | 8427С 0.68 542701 0.55 1 | | 5427М055| 5427ни1048|... | HER | HER 1 HER 1 her 1 1 1 (428| - (Вг1 | с428MC115) 14280 | 1 .08 | I-42805 | 1.07 | and 428P | 0.96 | 14287 | 0.92 |! 428M| 0.85 | 1428H | 0.83 |! 4288 | 0.852

Table 5

According to A. married m Ske|Vari-| EA | Vary EAE Vary EAE Vary EAE Vary EAE Vary EAE Vary EAE Vary EAE

НЯ ro|let| ant E | ant ant ant ant ant ant ant

MR 58 258 7 Pa28510.82|1428М/10.76 1 428А0.74 1 428М 0.73 1 428Е 0.72 | 142801 0.65 |1428U | 0.63 | I.4281 | 0.60

Pa28kib52rIi428E|042Й428С1028|..YDYUL 17171711 11 1111111 (429| p /v2g1 nago 1 13| nagen | 1.09 |nag9M| 1.09 |na29MI| 1.08 |Nag9K 1.00 |Na29M. 0.99 | Na 0.91 |Н429А1 0.89 7 у|наг9у0.88| na290 (0.86 |nakot 0.83 |Н4290 0.79 |Н429М 0.73 | Н429Р 0.72 | Н429Е | 0.65 |Н42901 0, 63 1 | |nago5Iov5a|nyagosI036Й. HER HER 71717171 111 431| 8 (Вг1 |5431К 15) 8431М | 1.00 54311 0.90 1543171 0.87 | 5431Е 0.87 | 5431 0.86 БАЗЕ 0.5861 | 0.82 p5azinibv|5aziMiI081|5431110.73|5431М/0.71|5431Р 0.61|5431010.60|5431С10.32| Y Sh 435 t | vg1 |ta35M|13| tazBmu | 1.01 | TAZ5E | 1.00 | T435I | 0.90 | TA35K | 0.88 | T4350 0.62 | TAZ5M | 0.79 | T43551 0.58 1 (t435М10.57| t4350 10.55 | T435E| 0.52 | T435A 0 .52 | TAZ5H 0.47 | T435S | 0.24 | T43505 | 0.20 | TAZ5R | 0.04 s437I075|0437E|067|0437010,62|0437R 0.36I0437s026| t439511.20| tazee | 1.16 | T439M| 1.16 | T4Z9A | 1.15 | T439NI 1.08 | TA439M. 0.99 | TA39U | 0.92 | TAZ9I | 0.89. taz9kI083| taz9n (0 .80 |t4391- 0.79 |t4390 0.67 |T43901 0.64 | TAZO E | 0.58 PELVIS 0.54 | T439C 10.17

HER TAZERS | | | HER her her 1 1 1 1 1 11 1 (444 GO | в21 |О444Е|0.91| О444М | 0.89 |О444АГ 0.62 |О444НИ 0.58 (0444 0.53 04441. 0.48 (044451 0 .48 (0444М| 0.47. 717 уо44420.34| 04440 | 0.31 |О444М| 0.28 |О444К 0.28 (О444У 0.26 |Ю444Му 0.24 | 04441 0.18 |0444010.12 1 | axes loOl44v|bovIm44RIOUTI | HER 71717177 1117117 1111 (447 | 0 ГВг1 | ра4701 17) rad7u | 1.16 | О447К| 1.01 | р4470 0.94 | О447Р 0.94 | р447Н 0.94 | 047 88 |ra44 LM 0.78 fraaunivs|ra47RI|052IrietsIiobva|.. | Her 7177717 17717 1 1 1 1 473|in|Vg1|na7znNIO7|nazs|1.07|na73i|1.02|Ina7301102|..YD. 1 HER 111 1 1 1 476| 8 (B21 476К 13) 1476t |1.12 1 1476M|1.07|1476010.84 114768 0.59 |11476010.40|1476А1029| Shshch 477 | a | v21 64747|081 , с477т | 1.01 |с47701 0.80 |3477К| 0.53 |2477NI 0.42 |Б477М| 0.41 |2477Е| 0.33 (0477Р| 0.25 0477MO24|с477с|0l13Iz47lMOoYAI. 11711111 1 |11111 11111 me7vryuzi had 02v6imauvsiol3| HER 711 71711 1 1 479| t (Vg1|t479611.00| t4791 (0.93 | T4791-| 0.81 747951 0.75 | T479A 0 0.66 | T479М 0.50 | T4790 0, 44 | TA79U | 0.40 1 | (ta79РИО 4О|та79н(|030479МИ023|та79гИ0л9|т479У018|.7 11111111 481 | Kk G(B21 |nav1Kk|O.65| nav. (0.48 |NaWtUM 0.30 |NA81U 0.23 IN481M 0.18 | nav1t 0.18 |Na48101 0.15 | NAV1E 0.14 1 | vav manure |ol3|navisg007|vnavTEЙО04|../Л/ || 77177717 1771771 492|А|В25|А4925|0.93|АЯ92С|0.70|А492М|10.69|АМЯ2а 0.38|.Y.YUS| ЖІ11171117ІІ1111 1171 498| I ГВ25 I498M 1.02) 1498E (0.93 | I498!- | 0.90 114980 | 0.65 PI498MU 0.47 P498M | 0.43 | I498U | 0.37 | I498A | 0.28

HER Fiznyurg! | | |! Her | HER 1 HER her 1 1 1 499|1А|В25ИА990109Й..ЮЮЮЮЮЮІІ HER | /! / Her Her Her Her 1 Her 1 5031 1|825|1503С|0.63| И5ОзИ (0.59 15031044 |...ДЙДЦС | |! | | ІІ her 504|Т|В25|т504510,78| t5045|0,66|т504А|0,63|Т1504С10,60115040,0,52|. YC-: 505|10|В25|О505С|0.34|0505|0.28|0505Е|026|050551020|.ChSYK A! ,94 Bob Iole and BobAIOLII. 17717 Her 11717171 507|RIVa5|РБО7А44|РБОЛО|0,34|IR5O51029|..YYAYUO-:y: 1/1 71777171 1 1 1 1 508 |В25IABOVU|0,1|ABOVM|0, 64|АБОоВ5|0.48|АБОВИЙ023|. 17711111 1 | Morozu У5о9ЕИЙЮЯ|. | Her | Her her HER her 1 1 511|с|В25|свяАЮвВВ| с51151062|.. | / / Г her HER HER HER HER 1 1 l512| M (258 | M5128H 13| MolaS | 1lo| MmethaneIt, v| Me12i 1.05| M512t 1.04| M5l2g and 0.96| Me12AT082|..| 17I 53 GE | v25| e5IzA | RBIZA| 1, 02|Р513у г 0.1|Р513МИ075|.ЙДЙДГ/| Her her 1 1 11 541-І ГГ 1 1 1 сг 11111111 11 515Г Е /в25|Е515УУЙ,О4| g5150 | 0.60 |ГР5158Г 0.56 | Р515М | 0.53 (Р5150 0.51 | RB15K 0.50 | 51571 0.45 | (RB15AG 0.44. 1 fe51551043|RBI5E beg|igbi5O|0l9Y..7D7L/ 17177177 17717 11 1 1 517|с|В25ИсЙ.7м039 | HER | HH her her 1 HER 1 1 1 11 1 5201825 |i52gos og i5goM 093! HER 1 1 HER 1 1 1 1 1 525| EC|B25|P525t|0.82| 5255 |0.79|E525М|0.77|Р525МУ 0.72|Р525С 0.60 |Е525А 040|Р525с10.39| and 526|t|B25|t526A|0.79| t52651Ц0.70|t526М10.69|152601024|. | | / | her her 527|с|В25|а5271О45|052751023|...Й | / her 1 1 HER 1 HER 1 1 1

HER Пп5зокюеІ | Her Her Her 1 Her 1 1 1 1 1 1 531|М(В25|У5зИров|М531сЩ0.75|У531АИ021Й. 1 17111711 Г1й1171с111 11 5331 1|825|15331|0.86|1533М|0.62|1533М10.54| М531АЙ021 |. 11711111 1 534|М|В2б5|Ммозани 17| М534М (12 |МозаМ|1,04|М5заА 086|М534т 08! 11717171 535|М|В25|М5з5en | Mez5s(0,2|Ме35МИ091|1 Й11 11 1 /536| 8 (258 |5536U 11.03) 55361 | 1.02 |5536A | 0.85 |Z536M| 0.83 55360) 0.66 8536 0.62 |5536M| 0.60 |5536NI 0.56 1 7 (5536R|0.55| 559360 | 0.49 IZ536M/| 0.47 35360 0.35 |5536E 0.30 | 5536Р | 0.27 | 55ZBK | 0.21 |8536M | 0.20 1 | Iz5zeviume| 5536 |ol1|553601009Ї... | | / | ІІ her 1

И537|с8|258|0537, M 18|с0537М|1.17|с537|1.06|0537сИ10.95|0537РИ0.57|..Ц | | | | her

Table 5

According to A. married m Ske|Vari-| EA | Vary EAE Vary EAE Vary EAE Vary EAE Vary EAE Vary EAE Vary EAE

НЯ ro|let| ant E | ant ant ant ant ant ant ant

MR

258|79 538|M(258|MosaKY 17| M538U|098|MZyanI080Y.17177111111 11111111 539 | M /B25 |M539010.95| M5Z9A | 0.92 |M53951 0.88 |M5Z9H 0.79 |M5Z79E | M5391- | 0.72 | M5Z9A | 0.60 | M539E | 0.57 1 | | M5397| 0.57 | M539M 0.56 | M53961 0.51 | M539SI 0.49 | M5Z9M 0.43 | M539U 0 0.39 | M5Z9NI 0.18 | IM539K1 0.17 540 | 1 GV25 540M | 0.90 | I540N. G0.86 | I5405 | 0.84 | I540R | 0.84 | I5401- 0.82 15400 | 0. 51 | I540C | 0.50 PI54OH (0.17 541 GO | 258 | О541Н| 0.92| О5410 | 0.71 | OBATAG 0.62 | О54151| 0.54 | OBATE 0.39 | О541С 0.37 ( 0541 0.30 (О5А11- 1 0.30

Her fo5ykirgooBayniIiomeY | Her her HER 1 HER 1 1 1 17, м5425ИЮ5о|Мм542а|041|М542М 031 |М542и1б24|М5Я2РИ0О5|.. 1717117 177171 sao eve|eyuot r neon Rot nok bijalekom) ov kom, nesi recrt ren ka

TO TREKKY TVO ROT FIRE AGE RONENVO ROVA ECT R REVIER

Her rm5a5KOl9| U5abA Goal |U5450Г 0.10 ЮУ5450 0.08 | 5451 | 0.07 ЮУ54501 0.07 | U545E | 0.06 |YU545R | 0.04 546 | And 18251 1546М 1.04) 15461 |1.02|1546М|1.01 | 1546ШЩ|0.80|1546510,32|154601023|.YЦ-Ц/ 1 fEB47си053|Е547ММ|028|Е54701028|EB4/ИЕ027|.ДЧО-1 ИЙ 71 1 1 1 1 5481 М|В25|У548С1,О2|М5485Ц0 ,58|У548АГ0,57|У5480|1045|М548У026|..ЮОС1777171111111 549 R /В25|РБ49У |0,52| P549M (0.38 | P5497 | 0.50 | P54951 0.75 | P549H. 1.03 | P549MI 0.55 | P5491- | 0.86 | P5490 1.73 1 | | RBa9rIov| RBIi9SI089Y...YDL | | | / | | her her 1 550|1Ш|825|І550М|0.96| 5501. (0.95|1550А|061 1550 045|.7 17111111 1171 551 GO (В25|О551М 1 12| О551ЕЕ (1, 09 |0551М|1.05|0551011.0110551Е 0.93|О551М 0.87 |0551110.85 552| |.../ 1771711 5531 |В25и553МИлг,// HER GG SG 71171717 11 11 1 1 554|5|В25И5554Ми0о3|Й | HER Her! HER her 1 1 1 1 1 1 555|Т|В25|т5Б5НИ 13 Т555С|1и13 |1555510,85|7555010,78|155511027|.ХС-:(/ | | | | и 557| 1 |В25|т557.иvit55ИМИto5|Й. ЖИ 1 Her 1 1 71 1 1 1 г 558|в(|Ва5 |INOBVANITY HER 1 SG 1 sg 1 g 11111 1 | |meBeMilo|у559РИ007|у55901005Й..ЙДЙУДС | Й! / | Жи her her 563|М|В25|У563аЙ o5| У56351|0,69|У563С10,68|У56310, 54|U563E 005|7YH:/(UU! 564|n(|B25InobaM and O4| n |0.78|n5vaI024|n5baРИ02ОЙ. 1777 ІІ 1771717 1711 568|M|Va5Іu5bvРІIT 1 ІІ 1 SGS 11І111111 | 112 507 РАРР0571 507 15) Р57OK | 1.07 | Р57001 | 1.07 | Р57ОХ | 1.07 | Р57ОМ | 1.06 | P57 THEY 1.05 | P570 NO 1.03 | RB7OI | 1.03

R57o5I089|RB70O|0.79|RBUOMI0.79|RBOSI 07085700 b,52|RBOSI047|..Y.-/DCG/ 01 ІИ 1 |. 5711 1|825i5llE OZ I5LLA 0860... HER HER 1 HER 1 HER 1 1 1 1 1 572 GO (258 |О57208116| 0572 | 1.07 |О572У|1.07|0572М10,8710572Е 0.75|0572010,752010 |0572210.57 574| 5 (258|5574М|0.82| 55741 | 0.76 |5574М| 0.69 |Z574UM| 0.64 55740 0.64 | 5574 0.56 |5574У | 0.56 15574А| 0.53. 0 1 |5574М048| 55741 |038|5574Е|0.32|5574Р 029|5574С 029|857401026|. -:: 1577 MT 258 M/577ЦИ 18| M/577М | 1.16 Mu577С| 1, 08 Му5775/1.04 Му577Р 0.97 М/577010.92 МУ577Е 0.81| .86 | M581NI 0.70 | M581X 0.64 (M581MI 0.63 1777 M581РЙЮОбЗ| M5V1MU/ 0.58 | M58TE 0.57 | M5810 0.46 | M58TA 0.42 | MBVTI- | 0.32 | M58101 0 ,29 |М5В1С 0,13 1 | min! HER her her 1 her 1 1 11 1 584| 8 |Vg1 |5584К 141 55840 | 1.11 55844 1.00 55840 0.90 5584 0.81 |8584С 0.78 |З584М 0.67 8584 | 0.66 g|858440.66| 5584Н 10.65|55841|10.64|5584Р 0.59 55841 0.54 |5584М| 0.41 |ЙЗ5В4М/ 0.38 558401 0. 91 1 | |5584EUSTIZ58ari0la|. HER 1 HER 1 HER 1 1 1 1 1 585 5 (258 |5585EN 11) 5585 | 1.09 55850 0.93 |5585 P1 0.79 | 5585A. 0.74 858501 0.67 858531 0.60 Y8585M | 0.47 591 |А(258|OR 7 OR |1І17ІА5І1МИ094|І...Д/| 7 177і17177І17і117І17 1711 592| ТС|258|т592ЕН 04 T592С1066|І.. | ІІ 71717171 1 11111|591515А15|593 В93 ,10| 5593 | 1.07 | 55931. | 1.06 I55930)| 1.06 | 85931 | 1.00 | I5593M. 0.96 |5593НИ 0.92 (859301 0.89 559310.87,|5593УУ10.84|5593Е|0.80|5593К10.79|5593М 0.75|5593Р10.75|8593С10.659| ХШ 59510821 |р595 1 9|О595УМ|1.18|О595011.13|р595с10.91|р595Е 0.09|Й Й. | 1 1 Her 596 | M ГВг1 |м5о6Е and 14| M596с | 1.10 |М5960|1.06|М5о6М . .92 |О598Е 0.89 Ю598У 0.88 (05981 0.83. (о598РЙЮ82|О598М|0.80|О598А10.76|0598110.6010598К 0.5810598510.58|0598210.55| YЩщ- 595| 8 |В |З59951,09| 559901|1,07|5599110,85|8599УМ 0,81 |5599Е 0,61| |NbOOA| 0.74 |NBOOE 0.70 |NbOOT 0.69 |NbOOKI 0.69 (NOR 0.66 2 sh in|neoomI0v5| nvoso (0.60 | neob | 0.57 |NBOON 0.56 |NBOOS . MvOtAu 0.96 | Mb0151 0.81 | MbOtNu 0.79 | mbOt | 0.78 | MBOTK 0.76

Table 5

Pod, husband of M Ske|Vari- | EA | Vari- EAE Vari- EAE Vari- EAE Vari- EAE Vari- EAE Vari- EAE Vari- EAE

НЯ ro|let| ant E | ant ant ant ant ant ant ant

MR

258|79 r|mbotviizIMmeoi1s(0,iz|Meopi|ova|MbotO10581...7 17717171 7171. bo2|e|B25|Rbogi 5 RbO2M|0,75|EbO2U|0,70|E602КИ0,591Ї..Й71777 11711111 1 bo5|Е|258|гбо5НИ 2| vot |0.96|Р6бо5и10.63Й...ЙХС | ЖИ|ЖЖ her her 1 bob|Е|В21|EbОбСИ 15|EBOBM|1,03|EbО6510,97|EbО6О . ... 7) 6121 |1.09|t612К|0.97|t612У 086612 0.84|tТ612110.53|.YDC-:: 613|5|В25|5613ЕН,От| Z613I|0.98|5613АГ097|.YDTSG | | / ЖІ / І her her 614|А|В25ІАбИ4УМ 5 АбИ4РИ1Л4|АбИ401098|..YДЧС:(КМ ІІ. 7171 1. 617|Мм|В25|Мб17ЕНв|Мб175|14|Мби7РИ0,96Ї. ІІ 11Ї11111111111 м6иС069|М85807|8507 |M618010,67|..GO her 1 HER 1 HER 1 1 1 zbgoumMostsvgon|bho|svgomiolЯ. her 77 17771717 1 1 1 1. b22|n(|В25|nbganИОev|nvggu 020 |nbggsiole|nv22ЕІ0,09|. | 7117171 11

HER |Mmbe3Tso5i | HER | HER 1 g 1 HER 1 1 1 1 1 (Rbgatyuz! | Her | Her her g 1 HER 1 1 1 1 1 1 626|E|258|Eb26OI 8 Eb2bI |110|Eb2bR|1.09|Eb26СИ066IEb26M 0.08| Y..YTS// | | / her b2g8|A|B25IAb2VEN 5 AbayaTITIYA|Y. HER 17717111 11111111 1111 1 | osbgogiyuvo|svgou|dvi! HER 1 HER 1 1 1 1 1 1 1 630 | M ГВ25| M6Z0I 12) Mbzot |1.08|M6301|0.82|M630s 0.76 |U63ov 0.66|M630010.64|M630510.55 ba1|tvo5itvatmM In v| tvats(|098|t6yКкИ097Й. | Her | HER her 1 1 1 baz|t|В2б5|tvazu i l4| tbazР098|т64зЕ|093|Т6а3Е 0701. 17111711 645|1Е|В25ИЕбЯА5НН 6 ЕбАБЕ|1И3|Е645010,75|. |

Example 5 - transient expression in maize leaves and bioassay with insects

Polynucleotides encoding variant Stu!B polypeptides were cloned into vectors for transient expression under the control of the maize ubiquitin promoter (SnHgiviepzep and Opai!, (1996)

Tgtapzdepis Vezeagsi 5:213-218) and a duplicated variant of the promoter from mosaic virus mirabilis (OMMM RVAO; Oeu and Maii, (1999) Riapi Moi. Vioi!., 40:771-82). From the state of the art, the agroinfiltration method of introducing a cell suspension of Adhorasiegisht into plant cells of intact tissues is well known in order to measure or investigate reproducible infections and subsequent expression of a transgene obtained from a plant (Kariia, ei. ai!., (1997) Riapi bsiepse 122 :101-108). Briefly, infiltration of young corn seedlings with agrobacteria was carried out using normalized cultures of bacterial cells of test and control strains. Leaf discs were obtained from each seedling and infected with UUSEKMU ( Oiargoiisa migditega ) along with the respective controls. The degree of consumption of green leaf tissues was assessed 2 days after infection.

Example 6 - transient expression in broad bean leaves and bioassay with insects

Optimized coding sequences can be constructed for soybean expression. From the state of the art, the agroinfiltration method of introducing a cell suspension of Adgobasiegit into plant cells of intact tissues is well known in order to measure or investigate reproducible infections and subsequent expression of a transgene obtained from a plant (Kariia, ei. a!., (1997) Riapi Zsiepse 122 :101-108). Briefly, infiltration of cut leaf discs of bush beans with agrobacteria was carried out, using normalized cultures of bacterial cells of test and control strains. After 4 days, the leaf disks were infected separately with 2 newborn individuals of the soybean bollworm (ZVI) (Snguzodeikhiv ipsindep5), the cotton bollworm (SEM) (Neiissomegra 7ea), the velvet bean caterpillar (UVS) (Apiisagzia dettaiaii) or the grass bollworm (Brodoriega hyadiregaa). . Control leaf discs were obtained from Adgorasietisht, containing only the expression vector with the fluorescent marker O5Kea2 (Siopiesp mm, 1290 Teita VeyPa Ame.

Mountain View, CA 94043). Leaf discs from non-infiltrated plants were included as a second control. Consumption of green leaf tissue was assessed three days after infection and scored from 0 to 9.

Example 7. Adgobasieegisht-mediated transformation of maize and regeneration of transgenic plants

For the transformation of corn, mediated by Adhorasiegisht, using the polynucleotide sequence according to this disclosure, the method according to 7pao was used (US patent Mo 5981840 and PCT publication of patent application UUMO98/32326; the contents of which are incorporated herein by reference). Briefly, immature embryos were isolated from maize and the embryos were brought into contact with a suspension of Adgobasiegist under conditions in which the bacteria were able to transfer the nucleotide sequence of the toxin into at least one cell of at least one of the immature embryos (stage 1: infection stage). At this stage, immature embryos can be immersed in Adgobasiegsht suspension to initiate inoculation. Embryos were cultured together with Adgobasiegisht for a certain time (stage 2: co-cultivation stage).

Immature embryos can be cultured on solid medium after the infection stage. After the period of co-cultivation, an optional stage of "rest" was assumed. At this resting stage, the embryos were incubated in the presence of at least one antibiotic known to inhibit the growth of Adhorasiegisht, without the addition of a selection agent to the plant transformants (stage 3: resting stage). Immature embryos can be cultured on solid medium with an antibiotic, but without a selection agent, to exclude Adgorasiehichsht and during the resting phase for infected cells. The inoculated embryos were then cultured on a medium containing a selection agent, and the transformed growing callus was isolated (stage 4: selection stage). Immature embryos were cultured on a solid medium with a means for selection, resulting in the selective growth of transformed cells. Callus regeneration was then induced to produce plants (stage 5: regeneration stage) and calli grown on selective medium were cultured on solid medium for plant regeneration.

Example 8. Transformation of soybean embryos

Soybean embryos were bombarded with a plasmid containing the nucleotide sequence of the toxin operably linked to a suitable promoter as indicated below. For the induction of somatic embryos, cotyledons 3-5 mm long, cut from surface-sterilized, immature

From the seeds of the corresponding soybean variety, cultured in the light or in the dark at 26 "C on the appropriate agar medium for six to ten weeks. The somatic embryos that give rise to the secondary embryos were then excised and placed in a suitable liquid medium. After re-selection for clusters of somatic embryos , in which cell division had already resulted in embryos at the globule stage, suspensions were maintained as described below.

Soybean germ suspension cultures can be maintained in 35 mL of liquid medium on a rotary shaker at 150 rpm. at 26"C with fluorescent light sources according to a 16:8 hour day/night schedule. Cultures were subcultured every two weeks by inoculating approximately 35 mg of tissue in 35 ml of liquid medium.

Soybean seed suspension cultures can then be transformed using the gene bombardment method (Kiewip, et al., (1987) Mayte (Hopaop) 327:70-73, US Patent Me 4,945,050). For these transformations, you can use the Vioisis ROBTO00O/NE ot bi device

Ropi (helium modification).

A selectable marker gene that can be used to facilitate soybean transformation includes, but is not limited to, the following: the 355 promoter from Cauliflower mosaic virus (Oabei, et al., (1985) Maishte 313:810-812), the hygromycin phosphotransferase gene from a plasmid ruk225 (from E. soybean; Si", ei ai., (1983) Sepe 25:179-188) and the 3'-section from the nopaline synthase gene from the T-DNA of Ti-plasmid Adgobasiegiit ishptetasiep5. An expression cassette that contains a toxin nucleotide sequence (eg, 5EO IU MO:1, ZEBEO IU MO:3 or an optimized maize sequence) functionally linked to a suitable promoter can be isolated as a restriction fragment. This fragment can then be inserted into the unique restriction site of the vector that carries the marker gene.

5 μl of DNA (1 μg/μl), 20 μl of spermidine (0.1 M) and 50 μl of Sac2 (2.5 M) were added to 50 μl of a suspension of 1 μm gold particles at a concentration of 60 mg/ml. The particle preparation was then mixed for three minutes, centrifuged using a microcentrifuge for 10 seconds, and the supernatant was removed. The DNA-coated particles were then washed once in 400 μl of 70 95 ethanol and resuspended in 40 μl of anhydrous ethanol. Suspension

DNA/particles can be sonicated three times within one second. Five microliters of DNA-coated gold particles were then loaded onto each macrocarrier disc.

About 300-400 mg of the two-week-old suspension culture was placed in an empty 60 x 15 mm Petri dish and the residual liquid was removed from the tissue using a pipette. For each transformation experiment, approximately 5-10 tissue dies were usually bombarded. The membrane rupture pressure was set at 1100 lb/sq. in., and a vacuum was created in the chamber with a decrease in pressure to 28 inches of mercury. The fabric was placed approximately 3.5 inches from the retention screen and bombarded three times. After bombardment, the tissue can be split in half and placed back into the liquid and cultured as described above.

Five to seven days after bombardment, the liquid medium can be replaced with fresh medium, and eleven to twelve days after bombardment, replaced with fresh medium containing 50 mg/ml hygromycin. This selective medium can be renewed weekly. Seven to eight weeks after bombardment, green transformed tissue can be observed growing from untransformed, necrotic germ clusters.

The isolated green tissue was selected and inoculated into separate flasks to obtain new, clonally propagated, transformed germ suspension cultures. Each new line can be considered as an independent transformation object. These suspensions can then be reseeded and maintained as clusters of immature embryos or regenerated into whole plants by maturation and germination of individual somatic embryos.

All publications, patents, and patent applications referred to in this specification are intended for those skilled in the art to which this disclosure relates. All publications, patents, and patent applications are incorporated herein by reference to the same extent as if each individual publication, patent, or patent application were specifically and individually incorporated by reference.

Although the above disclosure has been described in sufficient detail by way of illustration and examples for clarity of understanding, it will be apparent that certain changes and modifications may be made in practice within the scope of the embodiments.

LIST OF SEQUENCES

"1105 Pionir Hi-Bred International, INC.

Willcoxon, Michie

Yamamoto, Takashi "1205 INSECTICIDAL PROTEINS WITH ENHANCED SPECTRUM OF ACTIVITY AND THEIR

APPLICATION

"1305 5409-ШЧО-РСТ "1505 2 62/064877 "1515 2014-10-16 "1605 51 "1705 RabepsIpPp version 3.5 "2105 1 "2115 657 "212" Protein "213" Vasii1its5 Epihipdieepviv "4005 1

Has TPg Bek Avp Agud pub Avp obi Avp obits I1e I1e ABp Aza Iets 5eg 1 in; 10 15

IT1e Rgo Aia Uaii bek AvBp o Niv Bek Aia bip Mee Avr Gay back Gay Avr 20 25 30

A1a Agud I1ie bij Avr bek Gay Suv Iie Aia bij sb1u Avp Ap I1e Avp 35 40 45

Rkgo Gets Uai bek Aza bek TPg Uai bip TPg sb1u I1ie ABp I1e Aia 0Щ1У 0) zo (216)

Akud I1e Ggets siu Uaiii Iets b1u Uai Rgo Rpe Aza s1u sip Gay Aia 5eg 60 65 70 75 80

Rpe Tuk bek Ripe Iets Uai si1u bis Ietsy Tegr Rgo Bek b1u Agd Avr Rgo

85 90 95

Ter bish Iie Rbe Gets bitz Ni Ua1i! sitz bip yeets I1e Akd sbip sip Uai 100 105 110

TPgE bis Avp o TBg Agud ABp Ts Aza I1e Aza Agd iep siy s1u Hey SHU 115 120 125

Akud s1u Tug Agd bek Tuk beep beep Aia Iiets bij TPg Ter Gay Avr Avp 130 135 140

Ak Avp o Avr Aza Agud bek Agud bBeg I1e I1e ieyp siy Agud Tugk Ua1 Ai1a 145 150 155 160

Tem bij Ggetsp Avr I1ie TPg TPg Aza I1e Rgo Gay Rpe Akud I1e Agd Avp 165 170 175 bis bij Mai Rkgo Gay Gay Mee Uai Tug Aza sip Aia Aia ABp Ietsy Niv 180 185 190

Tets Getsp Gay Gay Agud Avr Aza bek Gay Rpe siu bek bets Tgr s1u Mee 195 200 205

Aza bek bek Avr Uai AvBp o beep Tug Tu beep bij sbip I1e Agd Tuk TEG 210 215 220 bi bij Tuk Bek Avp Niv Suv Uai sbip Ter Tug Avp TPg s1u Gay Avp 225 230 235 240

Avp o Gay Akud b1iu TEG AvBp Aia biy bek Tkgr Gay Agud Tuk Avp bip Rie 245 250 255

Akud Agud Avr o Gets TBPg o Iets b1i1u Uaiii Iets Avr Gay Uai Aia Gay Robe Rgo 260 265 270 zek Tug Avr TPg Agud TP Tug Rgo I1e ABp TPg bBeg Aza sbip Gay TEG 275 280 285

Akud bij I1e Tug TBg Avr Rgo I1e s1u Agd TPg ABp Aza Rgo Beh 0Щ1U 290 295 300

Rpe Aia bek TPg Avp o Tegr Rpe Avp AvBp ABp Aza Rgo Bek Rppe beg Ai1a 305 310 315 320

Zo Iie bij Aza Aza I1e Rpe Agu Rgo Rgo Niv ITetsy Gay Avr Rope Rgo s1ts 325 330 335 beep Gay TPg I1ie Tug Bek Aia Bek Bek Agud Ter bek bek TPg beep Niv 340 345 350

Mee Avp Tug Ter Ua1 si1u No Agd Gay Avp Do Agd Rgo I1e S1u Shchu

З5 355 360 365

TPE Gay Avp o TBPg back TPg bip s1iu Gay TBg AvBp AvBp Ts bek I1e AvBp 370 375 380

Rkgo Uai TPg Iiets bip Rpe TPg o bBeg Agd Avr Uai Tug Agud TPg siy b5eg 385 390 395 400

AvBp o Aia s1iu TPg ABp o I1e Hey Rpe TPg TBg Rgo Uai Avp s1iu Ua1i! Rgo 405 410 415

Ter Aia Akud Robe AvBp Robe I1e Av5p Rgo bip ABp I1e Tugye bij Agd Sh1U 420 425 430

Aza TPg TBg Tuk back beep Rgo Tug beep sb1u Uaii s1u I1e sbip Gay Rie 435 440 445

Avr Bek bet TPg bet Tets Rgo Rgo bets TPg Tpg bij Agud Rgo Avp o Tug 450 455 460 bet bek Tuk Bek Niv Agd Gay bek Niv Iie siu Gay I1e I1e S1Uu Avp 465 470 475 480

TPE Ggetsp Agud Aza Rgo Uai! Tuk bek Tgr TPg Niv Agud bBeg Aza Avr Ag4d 485 490 495

TPE Ap o TPg Iie s1iu Rgo ABp Agud I1e TBPg o bip I1e Rgo Aza Ua1i Guv 500 505 510 b1u Akd Rpe Hey Rpe Ap siu Bek Uai Iie bek s1iu Rgo b1u Roe TEPg 515 520 525 sbi1u b1u Avr Uai Uai Agd Avud Gayp Agd Ap s1u AvBp o T11e bip AvBp 530 535 540

Akud s1u Tuk I1e bitz Mai Rgo I1e bip Rre TPg bek TPg bBeg TPg Agd 545 550 555 560 (516) TUukg Agud Uai Akud UMai Agud Tuk Aza bek Ua1i TPg bek Iie siy Gay Avp 565 570 575

Uai Avp Ggesh s1i1u Up back back Iie Rbe TPg Avp TPg Iets Rgo Aia TPg 580 585 590

Aza Aza bek Ggets Avr AvBp Gay bip bek b1u Avr Rpe siu Tuk Uai siy 595 (51048) 605

I1e Avp Avp Aza Rre TPg bek Aia TPg s1iu ABp I1e Uai s1u Aia Agd 610 615 620

Avp o Rpe bBeg Aza ABp Ai1a bij Uaii I1e I1e AvBr Agud Rpe bis Rpbe I1e 625 630 635 640

Rgo Uaii TPg Aza TPg Rpe siy Aia bicp Tuk Avr Gay biy Agud Aza sip 645 650 655

Tuv "2105 2 "2115 1971 "2125 DNA "213" Vasii1ts5 Epigipdiepviv "4005 2 asdssssaa aeyaddaaava Sdadaasdaa assasaaasud sseEvayeschaye essadssdnga (216)

Esdaayesaeee ssdsasaaaae ddayessayesdd ssadassss dsassdadda SSSEsSsoayesae 120 ayeadssdadud ddaaeaasaye saayessasss dssadsdsaye saasadsssa aasdddadbsayegsa 180 aasayeadsed deadaavaee doddsoabayesa doasdsssYaae ssdssddasa assadssads 240

HEsravadeEee ЕЕЕССЧЕвод9Ud ddaаесаеda sssadeEddsa dadаесаеу ddaаасеЕсес Zoo sEddaasasud Sadaaassas basaadasaa saadeaasad aaaaassassad daasasodse 3Z6o ayeedseEsdaye badaadChdeyese addaaadds basadaeses assadsadds Yesesdaaass 420

BEddeEsadayea assdaaaeda Yedsaadayesa adaadsayesa SsSsSeEsdadsu ssasdessedse 480

Ebadaaseeed asayesastas edsvasasssd sEssssadaa Sasdaaaesda adaadesssa 540

Ebaeyesaayedua bagayedsesa adsedsaaasye Ssasasssaye sassassdad adasdsayess 60

Зо сСЕЄЕСсСеоддса дсддаасодоад дчасдодсаєсьі єссдасдеЕса ассаасаєсса ссаадаасаа 6бо аєсадаєаєа сададдааса єЄсЕаассає сдсдсасаає ддсасаасас адддссааає 720 аасеєЕсаадад ддасаааєдс єдааадессдда сСсдсоддсаса ассааєссссд сСададасста 78о0 асдЕсаддда баєсадаєєє адесадссста ЕсСсссаадсс асдасбасссдд сасесаєсса 840 аєсааєасда деЕдсЕеЕСадеє аасаададаа асссасасад асссааєссдда дадаасааає 900 дсассссєсад чассєдсаад Сасддаасєсодд СЕсЄааєсааса асСдсассаєс чдЕСЕЕССдсс 960 асададдсвед ссарсессад дссеЕссудсає срасесеєдаєе сеЕсСсадааса асегасаась 1020 басадедсає саадссдєсд дадсадсассі саасаєгаєда аєстаєєдоадЕ ддадасаєадд 1080 сЕсаасеЕвсс дсссааєсадуа адддасаєса аагассєсаа сасааддасе басеєааєаає 1140 асЕєсааєта аєсссдсаас астасадеЕес асдєсеЕсуєд асдеЕсєваврад аасадааєса 1200 ааєдсаддда сааасасасеЕ асеєсасвтасеі сссдсдааєд дадсассеєсда ддссадасеє 1260 ааєеєєвсаєсаа асссссадаа баєсєсаєдаа ададдсдсса срассврасад Есаассдває 1320 садададеЕсєд ддасеЕсааєе асеєсдаєеса дааасєдаає гассассада аасаасадаа 1380 сдассаа асе асдааєсава бадессасада сСваєсеєсаса гаддассаає сагаддааас 1440 асЕеєєдадад сассадессса ЕссЕсддасд саєсдбрадед садаєсдрас даасасчаєе 1500 ддассаааса дааєсасеса ааєєсссвдса дЕдаадддаа дасєсссвсе єаасодеЕЄєся 1560 чЧдЕааєєєсад дассаддаєє гасєддеЕдда дасуєбадеЕса даєєдааєад дааєсааєсоде 1620 аасаєєсааа агададдуєа баєсєдаадьс ссааєсеєсаає Есасдесдас асссассада 1680 баєсдадеєеєс дадеасдеєса ЕдсЕЕсСЕдна ассеЕсдаєсд адсеєсааєдЕ ЕааєсеЕсодддс 1740 ааєєсаєсаа ЄЕсСЕсСасуудаа сасаєсасса дсаасадсвд саєсаєсада гааєсссасаа 1800

Єсаддддаєє сеЕддеваєдеЕ Єдаааєсаас аардссеєсвта саєсссдсаас аддеаасаєса 1860 чЧЕаддеЕдсва дааасеєсвадд єдсаааєдса даадсааєсаа бадасадасе гЕдааєстаєс 1920 ссадевассуд саассєссда ддсадаасає даєсєсадааа дадсасаааа 4д 1971 «2105 З «2115» 651 «212» Білок «2135 Штучна послідовність «220» (516) «223» Варіант Сгу1В

"4005 Z

Me Rgo Bek Avp Agkud pub Avp obi Avp obits I1e I1e ABp A1ia Uai 5eg 1 5 10 15

Avp oNiv bek Aza bip Mee Avr iets beg Ietsy Avr Aza Agud I1i1e bij Avr 20 25 30 zek Gets Suv Uai Aia bij Uai Avp AvBp I1e Avr Rgo Rpe Uai1i bBeg Ai1a 35 40 45 zek TPg Uai bip TPg sb1u Iie bek s1i Aza Ague Iie Hey Siu Uai 50 55 bo

Tem biu Maii Rgo Rpe Aia siu bip Gay A1ia bek Rpe Tugk bek Rre Gay 65 70 75 80

Uuai s1u bij hei Ter Rgo bek s1iu Agud Avr Rgo Tgr b1p I1e Rpe Mee 85 90 95 bi Niv Uai soi sbip I1ie Uai1 Agud sbip bip I1e TBbg Avr bek Uai Agd 100 105 110

Avr TPg Aia I1i1e Ai1a Agd Iietsp bis s1u Iets b1u Akud s1u Tug Agd bBeg 115 120 125

Tuk bip bip Aia Gets bitz TBg Ter Gay Avr AvBp Agd ABp Avr Aia Agd 130 135 140 zek Agkd bek I1e I1e Agd siy Agud Tug Iie Aia Getssch siy Gay AvBr Pe 145 150 155 160

TPg TpPg ATa Iie Rgo Gets Robe beg I1i1e Agd ABp bip bits Uai Rgo Ietsy 165 170 175

Tecp Mee Uai Tug Aza bip Aia Aza AvBp Gay Niv Gay Gay Gay Ietsp Agd 180 185 190

Avr Aia bek Gets Rre b1i1u bek bets Tgr bi1u Mee bek Bek Bek Avr Uai 195 200 205

Avp obip Tuk Tug bip b1its bi1ip I1e Agud Tuye TP bij bij Tuk bek Avp 210 215 220

Zo Niv Suv Uaii sip Ter Tug AvBp TPg b1iu Gay Avp AvBp Te Agd s1Uu Tig 225 230 235 240

Avp Aia soi bek Tgr Tets Agud Tut Avp o bip Rpe Agud Agud Avr Gay TEG 245 250 255

Tets b1u Mai Gay Avr Gesh Uai Aza Gay Rpe Rgo bek Tug Avr TPg Agd

Z5 260 265 270

Uai Tuk Rgo Mee Avp TPg bek Aia sbip Gay TBPg Agud bij I1e Tuk TEG 275 280 285

Avr Rgo I1e bi1u Agd TPg ABp Aza Rgo bek bi1u Rpe Aia Bek TPg Avp 290 295 300

Ter Rpe Avp Avzp Avp ATia Rgo bek Rre beg Aia Iie siy Aza Aia I1e 305 310 315 320

Rpe Agud Rgo Rgo No Ietsyp Gay Avr Robe Rgo bij Sip Gay TPg I1e Tug 325 330 335 zek Aia bBekg bek Agud Tgr bek bek TPg bip Niv Mee Avp Tug Tgr Uai 340 345 350 bi1u Niv Akd Gay Avp Rpe Agud Rgo Iie siu siu TPkg Hey Avp TPg beg 355 3Z6o 365

TPE Niv s1iu Aza TPg Avp o TBg bBeg I1e ABp Rgo Uai TPg Gay sip Rie 370 375 380

TPg Bek Agud Avr Ua! Tug Agd TPg fight back Robe Aia s1u TPg Ap I1e 385 390 395 400

Tecp Rpe TPg TPg Rgo Uai Aup siu Uaiii Rgo Tgr A1i1a Agud Rpe Aup Rie 405 410 415

I1e Avp Rgo bip ABp o I1e Tug bets Agud b1u Aia TPg TP Tuk bek sip 420 425 430

Rgo Tut bip siu Uai b1u I1e sip Hey Rpe Avr bek bij TPg siy Iey 435 440 445

Rgo Rgo bis TPg TB bij Agud Rgo AvBp o Tuk bij bBeg Tug Bek Niv Agd 450 455 460 (516) Pen bek No Iie s1u Hey Iie I1e s1u Avp TBPg Tecy Agud Aza Rgo Uai1! 465 470 475 480

Tuk Bek Ter TPg Niv Agd bek Aza Avr Agud TPg ABp o TPg I1e sS1u Rgo 485 490 495

Ap Agud ch1I1e TBg o bip I1e Rgo Aza Uai Guz b1u Akd Rpe Gay Rpe Avp 500 505 510 siu bek Maiii Iie bek s1u Rgo b1i1u Rbe TPg siu s1u Avr Uai Uaiii Agd 515 520 525

Tets Avp Agud Avp Avp b1u Avp o h11e bip A5p Agud s1iu Tug I1e sats Uai 530 535 540

Rgo I1ie beep Rore TPg bek TPg obBeg TPg Agud Tug Agud Uai Agud Ua1 Agd 545 550 555 560

Tugk Aia bek Ua! ТПг бек И1е бий Hey Avp Uai! Avp Tets b1u Avp 5eg 565 570 575 zek Iie Robe TPg AvBp o TPg Gay Rgo Aia TPg Aza Aia 5eg Gay Avr Avp 580 585 590

Tem bip bek b1u Avr Ribe siu Tugk Uai bits Iie Avp Avp Aia Rre Tig 595 (51048) 605 zek Aia TPg biu ABp I1e Uai s1u A1i1a Agud ABp Rpe bBeg Aia Ap Ai1a 610 615 620 bii Mai I1e I1e Avr Rpe Agud I Rpe siy Rgo Ua1! TBPg Aza TPg RBre 625 630 635 640 bi Aza biy Tug Avr geish bish Agud Aza sip Guv 645 650 "2105 4 "2115 1953 "2125 DNA "2135 Artificial sequence "220"

Зо «223» Кодувальна послідовність варіанту Сгу1В «4005 4 аєдссЕєсаа аєаддааааа єЄдадаасдаа ассасаааєсд ссдсаєссдаа Ссаєссссдса (216) сааасддаєс бассдссада Сдсссдтаєє даадасадсеє єДдЕдеЕдсадс сдадаєдаас 120 аасаєсдаєс сасстєдссадд сдсаєсєсааса дсссааасад дсаєсадває адссддасада 180 агаєєддаддсда бастаддеЕдЕ дссуєсвдсе ддасаастад срадеЕеЕсеса радсеЕсесьс 240

ЧееЧдоддаае баеддстад содсададе ssasdddaaa SESssasdda asayesdsszchad Zoo saaassdsaa dasaaaaas aasddasade deEsaddoadavta ssdssassds ssЯаесессадаа 3З6о

ЧдаЕСсаддаа дадоддеаєсад аєсеєсассад саддсесссссд ааасссддсЕс адасаассда 420 ааєчасдсаа чассаадаач саєсаєссучє дачадаєаса ЄсСосеЕсстада асссдасавєєе 480 асрасеєдсса бассдсЕсеє садсасасда аассаададд Ссссаєсаєсєс аасодсаєсає 540 дсЕСаадсед саааєєтсаса ссраєсаєса ссддададасду сасрсссєсесс содсадесдаа 60

ЕдводдодаєдеЕ саєсєєссда єдДдеЕсаассаа бассассаад аасаааєссад асбсасасадад 6бо чаасаєєста ассаєєдсуає асааєддсає аасасадддс Сааасаасосс аададддаса 720 ааєдссдааа чЧЕСсСоЯЧЕСЯдсо деасааєссаа ЄСссоосадад аєссаасЯяєє адчвадтаєса 78о0 чаєсвтадедуд сасвтаєєссс аадстаєдас асдсдсдссс асссаасдаа Сассадесдсе 840 саассаасаа дадааассса сСасадаєсса ассдддадаа сааардсасс Ессаддаєтссес 900 чдсаадеасда аєєддеЕєсаа єааєааєдса ссассдсссс седссасада ддседссасєєс 960 бЕсаддссес соддсаєссасе Едаєєсеєсса даасаасеса сааєєсвасад Едсаєсаадс 1020 сдєєддадса дсасеєсааса баєдааєтає єдодЕдддас асаддсеЕсаа сеЕєсссдссса 1080 асаддаддда сасрааасас сєсаасудсає доддудстасса абасеЕєеєстає Еааєсссьдка 1140 асаєсасаде Єсасаєсьєсу адасдєеєває аддассдаає саєсеєсдсадда дасаааєсаєса 1200 сраєєвасса сессЕдЕдаа єддадеасся Едддсвєадає єсаарсесає ааасссесад 1260 аасаєєваєд ааададдсдс сасвбасссас адссаассудє аєсаддададеі Еддддаєсесаа 1320 сгаєсєдаєс садаааседа ассассасса дааасаасад аасдассааа Єсаєдааєса 1380 басадесава даєсвтаєсь са гасаддасвта аєсасаддаа асасеєеєсдад адсассадес 1440 баєєсевєдда содсассдрад Едсадаєсує асдаасасда Еєддассааа гадааєстасе 1500 саааєєсссуд садсдааддд аадаєеєсссе ЕсеЕааєдаєе седсааєсес аддассадда 1560 гЕсаседоадед дадасуєбадеі гадаєєдаає аддааєааєд деаасаєєса ааасадад9ад 1620 (516) басаєєдаад СЕССсСааєєса асеєсасудєсу асаєстасса дасаєсдадеі Есдадсасде 1680 баєдсееєсьдд ЄаассеЕсдає Едадсеєсаає деЕсСааєстьду дсааєеєсаєс ааєсеЕстас 1740 аасасаєсас садсаасадс Едсаєсаєвта даєсааєсссас аассаддодада ЄЕЕсЕДЯДЧЯЕває 1800

ЧдЕєЄдаааєса асаасудсесеЕ басаєссдса асаддеааса гадеаддеЕдс гадаааєсве 1860 адеЕдсаааєд садаадсаає аагсадасада СЕсСддааєсеса Есссадевас гЕдсаасстєс 1920 чаддсадаає аєдаєсеєсада аададсасаа аад 1953 «2105 Мм5 «2115 655 «212» Білок «2135 Штучна послідовність «220» «223» Варіант Сгу1В «4005 5

Mee Rgo Bek Avp Akud Guv ABp obi ABp obits Iie I1ie ABp Aza Gay 5eg 1 5 10 15

IT1e Rgo Aia Uaii bek AvBp o Niv Bek Aza bip Mee Avr Gets beg Ietsy Avr

Aza Agkud ch11e bets Avr bek ITep Suv I1e Ai1a bij s1u AvBp Ap I1e Avp 20 35 40 45

Rkgo Gets Uai bek Aza bek TPg Uai sip TP sb1u I1e ABp I1e Aia 0Щ1U 50 55 bo

Akud I1e Ggets siu Uaiii Iets b1u Uai Rgo Rpe Aza s1u sip Gay Aia 5eg 65 70 75 80 25 Rpe Tuk bek Rrpe I1e Uai siu bij Gay Ter Rgo bek s1u Agd AvBr Rgo 85 90 95

Ter bish Iie Rbe Mesye sitz Ni Ua1! sitz bip Iiets Uai Akd sb1ip sip She 100 105 110

TP bets Avp Aza Agud ABp Ts Aza Gets Aza Agd Te sip s1u Gesh SHU

From 115 120 125

Aza bek Ripe Agud Aia Tuk bip bip bek ITec fight Avr Tgr Gay fight Avp 130 135 140

Ak Avr Avp Aza Agud TPg Agud bBeg Uaii Ietsy Tug TPg sbip Tug Ii1e Ai1a 145 150 155 160 em bij Gets Avr Rpe Gay AvBp Aza Mes Rgo Gay Rpe Aza I1e ABp Avp 165 170 175 beep beep Uai Rgo Gay Gay Mee Uai Tug Aza sip Aia Aia ABp Ietsi Niv 180 185 190

Tets IGecp Gay Gay Agud Avr Aza bek Gay Rpe siu bek siy Ribe SsS1Uu Iey 195 200 205

TPg Back beep siy I1ie beep Agd Tug Tug bis Agd beep Asia1a b1py Guv Ts 210 215 220

Akud bij Tuk bek Avr Tuk Suv Aia Agd Tgr Tug ABp TpPg o1u Gay Avp 225 230 235 240

Avp o Gay Akud b1iu TEG AvBp Aia biy bek Tkgr Gay Agud Tuk Avp bip Rie 245 250 255

Akud Agud Avr o Gets TBPg o Iets b1i1u Uaiii Iets Avr Gay Uai Aia Gay Robe Rgo 260 265 270 zek Tug Avr TPg Agud I1e Tug Rgo I1e ABp TPg bek Aza sbip Gay TEG 275 280 285

Akud bij I1e Tug TBg Avr Rgo I1e s1u Agd TPg ABp Aza Rgo Beh 0Щ1U 290 295 300

Rpe Aia bek TPg Avp o Tegr Rpe Avp AvBp ABp Aza Rgo Bek Rppe beg Ai1a 305 310 315 320

Iie bij Aza Aza I1e Rpe Agu Rgo Rgo Niv ITetsy Gay Avr Rope Rgo s1ts 325 330 335 beep Gay TPg I1ie Tug Bek Aia Bek Bek Agud Ter bek bek TPg beep Niv 340 345 350

Mee Avp Tug Ter Ua1 si1u No Agd Gay Avp Do Agd Rgo I1e S1u Shchu 60 355 360 365

TPE gay Avp o TBbg bek TPg Ni siu Aia TPg AvBp oTPg bek I1e ABp Rgo

370 375 380

Uai TpPg ge bip Rbe TPg bek Agud Avr Ua1i Tut Agd TPg bii bek Tug 385 390 395 400

Aza si1u I1e AvBp I1e Iietsy Gay TPg TBPg Rkgo Uai Avp s1iu Ua1 Rgo Tgr 405 410 415

Aza Akud Rpe Avp o Tgr Agud ABp oRgo Tets AvBp bek Gay Agud siu Bek Iets 420 425 430

Tecp Tuk TPpg I1ie s1u Tuk TPg siu Uai s1u TpPkg sip Gay Ribe Avr 5eg 435 440 445 bij Tk bi Gay Rgo Rgo bij TBg TBg bi Agud Rgo Avp Tugk bij 5eg 450 455 460

Tuk Bek Niv Agd Gets beg AvBp I1e Agd Gets I1e I1e sb1u ABp TPg Ietsy 465 470 475 480

Akud Aza Rgo Ua1! Tuk bek Tgr TPg No Agud bek Aza Avr Agd TPg Avp 485 490 495

TPgE Iie Aza TPg Ap I1e I1e TPg sip I1e Rgo Ai1a Uai Gguv S1u Avp 500 505 510

Rpe Gay Ribe Avp o biu bek Uai I1e bek b1u Rgo s1u Rpe TPgE s1u schu 515 520 525

Avr Gechp Uai Akud Gay Avp Avp bek s1u Avp ABp o I1e bip Avp Akd b1Uu 530 535 540

Tuk Iie bij Ua1i Rgo I1e bip Rbe I1ie bek TPg bek TPg Agud Tug Agd 545 550 555 560

Uai Akud Uai Agu Tug ATia bek Ua1i TPg Rgo I1e bip Iets bek Uaiii Avp 565 570 575

Ter b1u Avp Bek Up I1e RiPe bek beg I1e Ua! Rgo Ai1a TPg Asia TPg 580 585 590 zek Gay Avr AvBp o Tets bip bek Agd AvBp Rpe b1i1u Tuk Rpe bij bek TEG 595 (51048) 605

Zo Avp o AZia Rpe TPg bek Aza TPK s1iu Avp Uai! Uai siu Maiii Ag9d Avp Rire 610 615 620 zek bis AvBp Aia bi1u Maiii Iie I1e ABr Akd Rpe siy Rpe Iie Rgo Uai 625 630 635 640

TPgE Aia TPg Rbe bets Aza betssh Tug Avr Gets bets Agd Aza sip si

З5 645 650 655 «2105 6 «2115» 1965 «2125 ДНК «2135 Штучна послідовність «2205 «223» Кодувальна послідовність варіанту Сгу1В «4005 Б аєдссдадса аєсдєаадаа Єдаааасдаа ассаєссаасуд сассдсссає ссседсадед (216) адсааєсаса дсдсдсадає ддаєссдадс ссддаєсдсдс дсассдадда садссодсдео 120 аєєдссдадд дсаасаасає сааєссдєссд дссадсдсда dsassdsdsa aassddssayeses 180 aasaeedssu dESYadraessye doaodeEdsssda ddadsYaasssYaae Yesdsodddesa dsgddsdads 240

ЕЕЕСасадсеес сваесоееда ЕДадесоеод ссоессудддеЕСсС deEdaссевd ddoаачдаесеес Zoo aeddadsasud Yesdadsaase ddyedsdssaa sadasesasdud adaasdsdsd saasassddse 3Z6o seddsdsss dddsdsaads EsssdsudsEs assadsades ssgddaadae 420

БЕдвЧдЕсддааа ассдєдаєаа Єдсодсдсасо сдссссдссс сбдсасасдса дсасаєсдсд 480 сгддадссдд ассссссдаа сдсдаєдссд сЕдеЕссдсаа ссаасаасса дсаадесдссд 540 сЕдссдасдуа сстасдссса адссоуусдаає ссдсасстдс гдссдссдсуа сдасдсаєсе 60 сЕдеЕссоддса дсдаасссдда сссдассадс саддадаєсс адсдстаста єдадсдессад 6бо чдссдадаааа содсдєдааса сеЕссдастас гєдсудсЕсЧдеЕЕ ддрасаасас доадеЕСтєДдаас 720 ааєсєдсдеєд дсассаасоадс ддадеЕсСссддд ссдсдеєсаса ассадеЕсссу Єсдасдчаєсстд 78о0 асссЕдоаЧчеЕд єЕЄесоЧодЧчаєєє доадєєдсодссд Єссссодадсо асдасасссуд саєстаєссд 840 ( 516) ассаасасса дсдсдсаасе дасссуєдаа аєссасасду асссдаєєдуа ссодсастеаає 900 чдсассдєссд дЕсЄссодсаад сассаассдуд СсСсаасааса асдсассдад сеЕссадсдасд 960 аєсдаддссд счдавсьсесу Ессдссудсас сеЕдеЕсдддасе Есссддадса дсеЕдассаєс 1020 басеЕсвдсає сеадссдєсд дадсадсасуд садсасаєда аєсаседаддЕ Еддссаєсде 1080 сЕдаасеєесс дсссудаєсдда єддсасудсьд аасасврадса сдсасддбдс сасеаасасд 1140 адсаєсаасс соддЕдасусЕ дсааєссасс адссдєдаєд ЕЄвассдрас сдадеЕсссас 1200 дссд дсаєса асаєсссдсеЕ дассассссу дЕсСаасддсуд ЄсссеЕрддадде єсЯасЕЄссСа8ає 1260 бдадсдбаасс сасеЕдаасад ссЕдсдЕдуЧє ссЕЕсдсвдЕ асассаєсддд сгагассоддс 1320 чЧдЕсддбасудс аасеЕдеЕседа сссддааассі дадссдссас сдуддааасврас сдадсдессд 1380 аасрасдаає сеЕсасадсса ссуєстЕдеЕсс аасаєссуєс Едаєсаєсд саасассстьд 1440 сдєЕдсдссдд Єдсасадссд дасссаєсудс адсдссдаєс дсасдаасас даєсдссасс 1500 аасаєсаєса сссадаєссс ддсадедааа доасаассеєсс єдЕсєсаасда садсаєдаєс 1560 адсддЕссад дЕСсЕсСассду сддеєдассьд деЕдсдссеєда асаасадсдд саасаатаєс 1620 саааассуєд деЕвагаєсда адеЕсссдаєсе сааєєсаєса дсасудадсас ссдеЕсассдс 1680 дЕССЯєдДЕЕсС дссасуусаєс судєвбасдссу асссаасєда дсудєєЕаасьд ддадсааєєссс 1740 аасаєєесєса дсадсаседеЕ сссеєдсвасуд дсдассєсеєс Еддасааєсе дсададссде 1800 аасЕєсддсє аєсесдааад сассаасудсс СЕСсСассадсу сеасдддсаа ЕДЕЯДЯОЄЕЧЧЕ 1860

ChdEesdsaayes ssadsudaadaa EdsodddsdEsS ayesaeedass dESEsdadee gayesssodved 1920 assdsdasseee Yesdaadsuda deasdaesd dadsdeEdsds addaa 1965 "2105 7 "2115 655 "212" Protein "2135 Artificial sequence "220" "223" Variant Sgu051B 70 "4

Me Rgo Bek Ap Agkud pub Avp obi Avp o siu I1e I1e ABp Aza Iets 5eg 1 5 10 15

Zo I1ie Rgo Aia Uai bek Avp Niv bek Aia bip Mes Avr Gay bek Rgo Avr 20 25 30

Aza Agkud ch11e bis Avr bek ITecp Suv Uai Azi1a bij Uaiii Avp Ap I1e Avr

Rkgo RiPe Uai bek Aza bek TPg Uai bip TPg sb1u I1ie ABp I1e Aia 0Щ1U

Z5 50 z9 bo

Agud chI1e Ggets siu Uaii Iets b1u UMaii Rkgo Rpbe Asia1a s1u sip Gay Aia 5eg 65 70 75 80

Rpe Tuk bek Rrpe I1e Uai s1u bitz Ietsy Tegr Rgo Bek b1u Agd Avr Rgo 85 90 95 40 TEr bitz Iie Rbe Iiey sitz Ni Uaiyi bi sbip Hey Ua1i! Agud sip sip I1e 100 105 110

TP bets Avp Aza Agud ABp Ts Aza Gets Aza Agd Te sip s1u Gesh SHU 115 120 125

Aza bek Rpe Agud Aia Tuk bip bip bek Te b1p Avr Ter Gay bitz Avp 45 130 135 140

Ak Avr Avr Aza Agud TPg Agud bBeg Uaii Ietsy Tug TPg sbip Tug Ii1e Ai1a 145 150 155 160

Tets b1ip Gay Avr Rpe Gay Avp Aza Mee Rgo Gay Rore Az1a I1e ABp ABp 165 170 175 sip Akud Mai Rgo Gay Gay Mes Uai! Tug Aza sbip Aia Aza ABp Gay Niv 180 185 190

Tets Getsp Gay Gay Agud Avr Aza bek Gay Rpe siu bek bicp Rpe sS1Uu Gay 195 200 205

TPg Back beep siy I1ie beep Agd Tug Tug bis Agd beep Asia1a b1py Guv Ts 210 215 220

Akud bij Tuk bek Avr Tuk Suv Aia Agd Tgr Tug Up TPg s1u Gets Avp 225 230 235 240

Ap oh hey Agud biu TBg ABp Aza bis bek Tegr Hey Agud Tug Avp bip Re 245 250 255 (516) Agud Agud Art tey TPg Hey s1iu Maii Hey Avr Getsp Uai Aia Tey Rore Rgo 260 265 270 zek Tut Avr TPg Agd Uai Tug Rgo I1e ABp TPg back Aza sbip Gay TEG 275 280 285

Akud fight I1e Tug TBgE AvBr Rgo I1e s1u Agud TPg Ap Aza Rgo beg 01U 290 295 300

Rpe Aia bek TPg ABp o Ter Rpe Ap Azp Avp Aza Rgo bek Rope beg A1a 305 310 315 320

Iie sbits Aza Aza Uaii I1e Agud Rgo Rgo Niv Gay Gay Avr Robe Rgo bij 325 330 335 beep Gay TPg I1ie Rpe bek Ua1i Gay Bek Agud Ter bek bek TPg beep Niv 340 345 350

Me Avp Tug Ter Ua1 s1u No Agd Iiets bit back Agud TPg I1e Agd Sh1U 355 360 365 zek Hey back TPg back TP Niv b1u Avp TPg ABp o TPg bBeg Iie Avp Rgo 370 375 380

Uai TpE Ggetsp sbip Rbe TBPg bBeg Agud Avr Uai Tug Akd TPg bii bek Tug 385 390 395 400

Aza si1u I1e AvBp I1e Iietsy Gay TPg TBPg Rkgo Uai Avp s1iu Ua1 Rgo Tgr 405 410 415

Aza Akud Rpe Avp o Tgr Agud ABp oRgo Gay AvBp o bek Gay Agud siu Bek Iets 420 425 430

Tecp Tuk TPpg I1iee s1u Tuk TPg siu Uai s1u TpPkg sip Gay Ribe Avr 5eg 435 440 445 bi TpK bij Gay Rgo Rgo bij Tbg TP bij Agud Rgo Avp Tug bis beg 450 455 460

Tuk Bek Niv Akud ITetsy bek Niv I1ie siu Gay I1ie I1e s1u Avp TPkg Iets 465 470 475 480

Akud Aza Rgo Ua1! Tuk bek Tgr TPg No Agud bek Aza Avr Agd TPg Avp 485 490 495

TPg TpPkE s1u Rgo AvBp Agud TI1e TPg sbip I1e Rgo Aia Uai Gguv S1u Avp

From 500 505 510

Rpe Gay Ribe Avp o biu bek Uai I1e bek b1u Rgo s1u Rpe TPgE s1u schu 515 520 525

Avr Gay Uai Agd Tets Avp AvBp o beg biu AvBp ABp I1e sip ABp Agd 1U 530 535 540

Tuk hep siy Uai Rgo I1e sbip Rpbe I1ie bek TPg bek TPg Agd Tuk Agd 545 550 555 560

Uai Akud Uai Agu Tug ATia bek Ua1i TPg Rgo I1e bip Iets bek Uaiii Avp 565 570 575

Ter b1u Avp Bek Up I1e RiPe bek beg I1e Ua! Rgo Ai1a TPg Asia TPg 580 585 590 zek Gay Avr AvBp o Tets bip bek Agd Avr Rpe s1i1u Tuk Rpe bij bek TEG 595 (51048) 605

Ap Aza Ripe TPg bek Aza TPg biu AvBp Uai Uai siu Uai Agd Avp Re 610 615 620 zek bi Avp Aia s1u UMai Iie chI1e Avr Akud Rpbe bij Rpe I1e Rgo Uai 625 630 635 640

TPgE Aia TPg Rbe bitz Aza bitzsh Tug Avr Getz bitz Agd Aza sip si 645 650 655 "2105 8 "211" 1965 "212" DNA "2135 Artificial sequence "2205 "223" Coding sequence of Sgu1B variant "4005 8 ayedssdadsa ayesdeaadaa aessa ssudaaasad (216)

ChdESYadssdadd baaaaayesae edayessdsss dssadsdsa dsassdsdsa aassddsasyeses 180 aasaeedssu dESChdraysseE dodeEdESSStd dodsdEEeessUYaE Egyedsodddeyesa dseddsdads 240 gEsvasadse Egayesueedu EdadeEsdeyedda ssdeyesudduayes deEdassseyesu ZoodaseEssaye

Eyeddadsasud Yesdadsaase ddyedsdssaa sadasesasdd adaasdsdsd saasassddse 3Z6o seddsdsss bdsaaddsss dddsdsaads EEssdsudsEs assadsades sssddaadae 420

ЕддЕєддааа ассдєчаєда Сдсдсдсасе судссссуєссс сдерасасодса деасаєсдсд 480 сгддадссдд ассссссдаа сдсдаєдссд сЕдеЕссдсаа ссаасаасса дсдадсдссд 540 седссдаєсдда сСссасдссса адссдсдаає седсасеєсдс гдсеЕдссдсд сдасдсаєсе 60 сЕдеЕссоддса дсдааєсссдда сссдассадс саддадаєсс адсдстаста єдадсдессад 6бо чдссдадаааа содсдєдааса сеЕссдасстас сдсдсссЯдсс ддсасаасас дддЕссдаас 720 ааєсеєдсудєд дсассаасудс ддадсссстдуа сеЕдсдЕсаса ассадесеєсєся єсдсдчаєстд 78о0 асссеЕддЧаєд баєєддчавєєе осдеЕсдсодссЯя сссссодадсе аєдасасссу сдрєдтаєссд 840 аєсаасасса dsdsdsaase daseesdsdaa asssasasdd asssdassdd ssdsastsaaes 900 chdsassdessd dEsYessodsaad sassaassdud SsSsaasasa asdsassdad seEssadsdasd 960 aesdaddsdd seEdESsSayessu Essdssudsas seEdeEsdddase Esssddadsa dseEdassaes 1020

СЕСЕСЕУЧЄЧЄ соссссуєсд дадсадсасу садсасаєда аєсаседадеЕ єддссаєсде 1080 сгддааадсс дсассасссду сддсадссгд адсассрадса сдсасуддсаа гбасгаасасд 1140 адсаєсаасс соддЕдасусЕ дсааєссасс адссдєдаєд ЕЄвассдрас сдадеЕсссас 1200 дссддсаєса асарсссдсеЕ дассассссу дЕгаасудсд ЄсссеЕєдддс ЄЕсдЯдЕсЕсаає 1260 бдадасдбаасс саседаасад ссеЕдсдЕдЧєЕ СссСЕЕсудседЕеЕ асассаєвдуд Есасассддас 1320 дЕСЯддсасдс аасеЕдеЕсеєда сссудааассі дадссдссас суддааастас сдадсдЕссд 1380 аасрасдаає сеЕсасадсса ссудєсСсдЕсс саваєєсдудеЕс Єдаєсаєсда саасасссьд 1440 сдєдсассдд Єдсасадссд дасссаєсудс адсдссдаєс дсасдаасас дастрддессд 1500 аассдбаєса сссадаєссс ддсадедааа ддсаасесесєс єдеЕєсаасду садсуєдаєс 1560 адсддЕссад дЕСсЕсСассду сддеєдассьд деЕдсдссеєда асаасадсдд саасаатаєс 1620 саааассодєд дсгаєсєдчда адесссдаєс сааєссаєса дсасдадсас ссдЕсассдс 1680 дЕССЯєдДЕЕсС дссасуусаєс сдєсасоудссдуд аєссааседа дсдЕсаасвд дддсааєссс 1740 аасаєєесєса дсадсаседеЕ сссеєдсвасуд дсдассєсеєс Еддасааєсе дсададссде 1800 часеЕєсддсеЕ аєсе Esudaaad sassaasdss SESassassud sbasdddsaa EEoChdESSsOdvE 1860

ChdEeEsdsaayes Yesadsudaaa EdsddddsdEsS ayesayesedass dYAEEEEedadee gayesssoded 1920

Zo assdsdasse Yesdaadsooda dsaschdayesd dadsdeEdsds addaa 1965 "2105 13 "2115 6550 "212" Protein "2135 Artificial sequence "220" "223" Variant Sgu1B "4005 13

Me Rgo Bek Avp Agkud pub Avp obi Avp obits I1e I1e ABp A1ia Uai 5eg 1 c) 10 15

Avp oNiv bek Aza bip Mee Avr Gets besg Rgo Avr Aza Agud I1i1e bij Avr 20 25 30 zek Hey Suv Uaii Ai1a bij Uaii Avp Avzp I1e Avr Rgo Rpe Uai bek A1a 35 40 45 zek TPg Uai bip TPg sb1u Iie ABp I1e Aza s1u Agu Iye Gay siu Uai z9 (210)

Tets b1u Mai Rgo Rpe Aia siu sip Gesh Aia bek Rpe Tuk bek Rpe Iey 50 65 70 75 80

Uuai s1u bij hei Ter Rgo bek s1iu Agud Avr Rgo Tgr b1p I1e Rpe Mee 85 90 95 bi Niv Uai siy sbip I1ie Uai1 Agud sip sbip I1e TBbg siy AvBp Aza Agd 100 105 110

Avp oTPg ATia ITeits A1ia Agd Gay sbip siu iep sb1u A1i1a bek Rpe Agud A1a 115 120 125

Tuk beep beep back Gets bit Avr Ter gay bit ABp Agd Avr ABr Aia Ag4d 130 135 140

TPg Agud Bek Uai Gets Tug TPg sip Tug I1i1e Aia Iiets bij Gay Avr RBIGe (516) 145 150 155 160

Tem AvBp Aia Mee Rgo Gay Ribe Aia I1e ABp Avp sbip bip Uai Rgo Gay

165 170 175

Tecp Mee Uai Tug Aza beep Aza Aza Avp Gay Niv Gay Gay Gay Ietsy Agd 180 185 190

Avr Aia bek Gets Rre bi1iu bek bis Rre b1u Hey TPg Bek bib bij I1e 195 200 205 bip Agkud Tug Tuk bij Agud bip Aia biy puv TBg Agud bis Tug bek Avr 210 215 220

Tuk Suv Aza Agud Tgr Tut AvBp o TPg s1iu Gets AvBp ABp Tetsy Agd s1u TPg 225 230 235 240

Avp o Aia siy bek Tgr Gay Agud Tuk Avp o bip Rbe Agud Agd Avr TIep TEPg 245 250 255

Tets b1u Mai Gay Avr Gesh Uai Aza Gay Rpe Rgo bek Tug Avr TPg Agd 260 265 270

ITIe Tuk Rgo I1e AvBp TPg bek Aia bip Tietsy TPg Agud bij I1e Tuk TEG 275 280 285

Avr Rgo I1e bi1u Agd TPg ABp Aza Rgo bek bi1u Rpe Aia Bek TPg Avp 290 295 300

Ter Rpe Avp Avp Avp Aza Rgo bek RiPe beg Aia I1e b1p Aza Aza Uai 305 310 315 320

I1e Agud Rkgo Rgo Niv Gay Gay Avr Rpe Rgo bij sip Gay TPg I1e Tug 325 330 335 zek Aia bek bek Agud Tgr bek bek TPg bip Niv Mee Avp Tuk Ter Uai 340 345 350 bi1u Niv Akd Gay Avp Rpe Agud Rgo Iie siu siu TPkg Hey Avp TPg beg 355 3Z6o 365

TPE Niv s1iu Aza TBPg Avp o TBg bBeg I1e Avp Rgo Ua! TPg Iep sbip Rie 370 375 380

TPg Bek Agud Avr Uai Tug Agd TPg siy beg Tug Ai1a b1u I1e ABp She 385 390 395 400

Zo Pes Gay TPg TP Rgo Uai AvBp siu Mai Rgo Tgr Aiia Akud Robe Avp Tkgr 405 410 415

Akud Avp oRgo Gets AvBp o beg ITetsy Agud biu bek IGetsyp Gay Tugye TPg Ishe Sh1U 420 425 430

Tuk TP siu Ua1 s1u I1e bip Gay Robe Avr bek bis TPg bij Gay Rgo

Z5 435 440 445

Rgo bis TPg TB bis Agud Rgo AvBp oTuk bij bek Tugk Bek Niv Ag9d Iets 450 455 460 zek Avp I1e Agd Iietsy I1e bek biu AvBp TPg ITep Agud Aza Rgo Ua1i! Longing 465 470 475 480

Bek Ter TPg Niv Agud Bek Aza Avr Agud TiPg ABop TPg chI1e Aza TBg Avp 485 490 495

Iie I1ie TBPg bip I1e Rgo Ai1a Uai Guz b1u AvBp Rpe Gay Robe Ap 01Uu 500 505 510 zek Uaii TiPg bek bi1u Rkgo sb1u Rpe TPg bi1u sb1u Avr Gay Uai1 Ag9d Iets 515 520 525

Avp o Avp obek biu AvBp ABp o I1e bip ABp Agud sbiu Tuk Gay bis Uai Rkgo 530 535 540

I1e sbip Rre I1e back TPg back TPg Agud Tug Agud Uai Agud Ua1i Agd Tug 545 550 555 560

A1ia bek Uaii TBg Rgo Iie sip Gay back Uai Avp Ter s1u Avp bek Avp 565 570 575

I1e Ribe back back I1e Uaii Rgo Aia TPg Aza TPg back Gay Avr Avp Gay 580 585 590 beep back Agud Avr Rpe siu Tuk Rpe sitz bekg TPg AvBp Asia1a Rpe TpPg 5eg 5eg 595 (51048) 605

Aza TPg s1u Avp Uaii Ua1i b1u Uai Agd Avp Rpe bek bij ABp Aia s0Щ1U 610 615 620

Uuai Iie Iie Avr Akud Rpe sitz Rbe I1e Rgo Ua! TPg Aza TPg Rpe sat 625 630 635 640 (516) A1a siy Tug Avr tey bij Agud Aza sip sich 645 650

«2105 10 «2115 1950 «2125 ДНК «2135 Штучна послідовність «2205 «223» Кодувальна послідовність варіанту Сгу1В «4005 10 аєдссдадса аєсдєаадаа Єдаааасдаа ассассаасуд садсдадсаа Ссасадсдс4д (216) сачаєсддаєсс сСдадсссдда Сдсдсдтраєс даддасадсс гДдЕдЕдЕсдс сдаддасааас 120 аасаєєдаєс саєсєсадєсад содсдадсасс дсдсааассу дсаєсєсаасає Єдссоадессає 180 аєссеЕдоадЧдеєд ЄссЕдддсЯєЄ ЕссЯессдсоа ddssadssdud szadseesssa sadseseseesn 240

Чесо9Ядстаде едсдодссояес додссоаеједас sсеЕсСдоддчада ЕСееСсСаедда dсасчесзад Зоо сааассдсдс дссаасадасе сСасддаае дсдсдсааса ssdseEstsdds dsdEstgdsaa 3З6о

ChdaESEdoddeEd saadseyesessd sodseEsbassad sadssssoduda aachdzassddEs ddaaaaassdo 420 chaechayedsds dsaseEsdseEs sadessssdsas asdsadsasa Ssdssssdda dseddaseess 480

ЕЕєдаасодсда ЄдссодсЕдЕеЕЄ Єдсаассаас аассадсаад СдссдссдсЕ дасддеЕстас 540 дсссаадссуд сааєссдса сЕгдседсвуЯ седсдсдасду сассеЕссдеє содсадсддаа 60 бЕєдодссеєда ссадссадда даєссадсдс бассасдадс діссаддссда даааасдадсдаі 6бо чааєсасеєссу ассасєдсдс єсдЕєддсас аасасдддеіс сдаасааєссо дсдесддсасс 720 аасдсоддадеЕ ссЕддсЕдсЯ Єсасаассад ЄСсСсСЯєссояасу ассеєдасссєс доадсасессд 78о0 часєєєсдуЧєєд сосЕдЕсєеєсс дадстаєдас асссдсаєсєст асссдаєсаа сассадсдсд 840 саассдассс дсдаааєсста гасддасссду аєсдодссдса стаасдсасс дессодеЕвес 900 дсаадсасса асеєддеєсєсаа бЄаасаасдса ссдадсссса дсдсдаєсда ддсдоддседЕс 960 аєссудєссдс соусассєдсе ддасеесссу дадсадсєда ссаєссасес сдсаєсвадс 1020 сдЕєЕддадса дсасусадса саєдааєтас ЕдоддЕєддсс ассдеЕстдаа сЕсссдсссд 1080 аєєсддєддва содсЕдаасас гадсасдсас дудєдссасса асасдадсає саасссоддед 1140

Зо асдсєдсаає Ссассадссу ЕдаєдеЕєсас сосассдаде ссбасдссда даєсаасаєсе 1200 сЕдсєдасса ссссудеЕсаа сддсдЕсссЕ ЕдуддсЕсСувЄЕ Есааєсддсд Саасссасьд 1260 аасадссеЕдс дЕДдЧЕЕСсСЕСЕ дседсасасс аєсоддеЕсаєса ссддсудєсду гаєссаасьд 1320 гЕєдасесудд ааассдадсеЕ дссассудаа ассассдадс дЕСсСдаасса сдааєсеває 1380 адссассдЕєс Єдесссаарає ссудєсеєдаєс адсудсааса сссеЕдсдЕдс дссдоддедсас 1440 адседдассс ассдградсудс сдаєссоддсасу аасасчассуд ссассаасає гассасссад 1500 аєсссддсад Єдаааддсаа СЕЕЕЄСЕЧЧСЄес аасоуддсадсу Єдассадсдуд ЕссаддЕєее 1560 ассддсддеЕд ассеЕддсдсуд ссеЕдаасаас адсудсааса агаєссаааа ссдрддеЕває 1620 сЕддаадесс сдаєсеЕсааєс саєсадсасу адсасссуєЕ ассдсдеєссд єдДдЕєсдастас 1680 чдсаєссудєва содссдаєсса асеЕдадсдес ааседдддса аєєссаасає ЕсЕСадсадес 1740 аєЕєсєдеЕсссвуд срасддсдас сесєссодддас аасеЕсодсада дссуєдасеє сдддстаєсес 1800 чааадсасса асдссЕссас садсдсвасуд додасааєдеЕдч ЕЄоддДЕдДЕЕсСуЯ сааєсессадес 1860 чадааєдсдд дсдеЕсСаєсає ЕдассЯєесес дадеЕстаєсс суддеЕдассдс дассеЕєссда a 1920 chdsddadsasd ayeseEddadsu Edsdsaddaa 1950 "2105 11 "2115 655 "212" Protein "2135 Artificial sequence "2205 "223" Sgu1V variant "4005 11

Me Rgo Bek Ap Agkud pub Avp obi Avp obits I1e I1e ABp Aza Iets 5eg 1 c) 10 15

IT1e Rgo Aia Uaii bek AvBp o Niv bek Aza bip Mee Avr Gay 5Beg Ietsy Avr 20 25 30

Aza Agkud ch11e bis Avr bek ITep Suv I1e Ai1a bij s1u AvBp Ap I1e Avp 35 40 45 (516) Rgo Ppep Uai bek A1ia bek TPg Uai sip Tbg s1u I1e ABp I1e Ai1a sh1U 50 z9 (210)

Akud I1e Ggets siu Uaiii Iets b1u Uai Rgo Rpe Aza s1u sip Gay Aia 5eg 65 70 75 80

Rpe Tuk bek Rrpe I1e Uai s1u bis Ietsy Tegr Rgo Bek S1u Agd ABr Rgo 85 90 95

Ter bis Iie Rpe Mee sits No Uaiyi bi sbip Gay Uai Agud sbip sip I1e 100 105 110

TP bets Avp Aza Agud ABp Ts Aza Gets Aza Agud Hey sip s1iu Gets s1Uu 115 120 125

Aza bek Ripe Agud Aia Tuk bip bip bek ITec fight Avr Tgr Gay fight Avp 130 135 140

Ak Avr Avp Aza Agud TPg Agud bBeg Uai Iiiey Tug TPg sip Tug I1e A1a 145 150 155 160

Tets b1ip Hey Avr Rpe Hey Avp Aza Mee Rgo Hey Robe Aza I1e ABpP AvBp 165 170 175 sip beep Mai Rgo Hey Hey Mes Ua! Tug Aia sbip Aia Aza Avp Gets Niv 180 185 190

Tets IGecp Gay Gay Agud Avr Aza bek Gay Rpe siu bek siy Ribe SsS1Uu Iey 195 200 205

TPg Bek beep sbits I1e beep Agud Tug Tuk bij Agud beep Aia sbits puv Ts 210 215 220

Akud bij Tuk bek Avr Tuk Suv Aia Agd Tgr Tug ABp TpPg o1u Gay Avp 225 230 235 240

Ap o hey Agud biu TBg ABp Asia1a biy bek Ter Hey Agud Tut AvBp o bip RBe 245 250 255

Agud Agud Art tey TPg Gay s1iu Uaiii Gay Avr Tets Uai Aia Gay Robe Rgo 260 265 270 zek Tug Avr TPg Agud I1e Tug Rgo Iie Ap TPg bek Aza bip Gay TEPg 275 280 285

Akud battle I1e Tug TBg Avr Rgo I1e s1u Agd TPg ABp Aza Rgo Beh 0Щ1U

From 290,295,300

Rpe Aia bek TPg Avp Ter Rpe Avp Up Up Aza Rgo bek Rie beg A1a 305 310 315 320

Iie sbits Aza Aza I1e Rpe Agud Rgo Rgo No IYetsp Gay Avr Rpe Rgo sats 325 330 335 sip Gay TPg Iie Tuk bek Aza bek bek Agud Tgr bek bek TPg sbip Niv 340 345 350

Mee Avp Tug Ter Ua1 si1u No Agd Gay Avp Do Agd Rgo I1e S1u Shchu 355 3Z6o 365

TPE gay Avp oTBbg back TPg Ni b1u Aia TBPg AvBp oTPg back I1e ABp Rgo 370 375 380

Uai TpPg ge bip Rbe TPg bek Agud Avr Ua1i Tut Agd TPg bii bek Tug 385 390 395 400

Aza si1u I1e AvBp I1e Iietsy Gay TPg TBPg Rkgo Uai Avp s1iu Ua1 Rgo Tgr 405 410 415

A1a Agud Rpe Avp o Tgr Agud Avp o Rgo Getsp Up bek Gay Agud s1iu bek Ietsy 420 425 430

Tecp Tuk TPpg I1ie s1u Tuk TPkg siu Uai s1u TpPkg sip Gay Ribe Avr 5eg 435 440 445 bi TpK bij Gay Rgo Rgo bij TPg Tpg bij Agud Rgo Avp Tug bis beg 450 455 460

Tuk Bek Niv Agd Gets beg AvBp I1e Agd Gets I1e I1e sb1u ABp TPg Ietsy 465 470 475 480

Akud Aza Rgo Ua1! Tuk bek Tgr TPg No Agud bek Aza Avr Agd TPg Avp 485 490 495

TE Iie Aia TPg ABp I1e Iie TPg sbip chI1e Rgo Aia Uai Ppuv s1U Avp 500 505 510

Rpe Gay Ribe Avp o biu bek Uai I1e bek b1u Rgo s1u Rpe TPgE s1u schu 515 520 525

Avr Gay Uai Agd Tets Avp AvBp o beg biu AvBp ABp I1e sip ABp Agd 1U (516) 530 535 540

Tuk Iie bij Ua1i Rgo I1e bip Rbe I1ie bek TPg bek TPg Agud Tug Agd

545 550 555 560

Uai Akud Uai Agu Tug ATia bek Ua1i TPg Rgo I1e bip Iets bek Uaiii Avp 565 570 575

Ter b1u Avp Bek Avp I1e RibPe beg Agud I1e Uai! Rgo Ai1a TPg Aza Tug 580 585 590 zek Gay Avr AvBp o Tets bip bek Agd AvBp Rpe b1i1u Tuk Rpe bij bek TEG 595 (51048) 605

Ap Aza Ripe TPg bek Aza TPg biu AvBp Uai Uai siu Uai Agd Avp Re 610 615 620 zek bi Avp Aia s1u UMai Iie chI1e Avr Akud Rpbe bij Rpe I1e Rgo Uai 625 630 635 640

TPgE Aia TPg Rbe bitz Aza bitzsh Tug Avr Getz bitz Agd Aza sip si 645 650 655 "2105 12 "2115" 1965 "2125 DNA "2135 Artificial sequence "2205 "223" Coding sequence of the Sgu1B variant "4005 12 (216) адсаассаса дсдсдсадає дчассєдадс седдаєсдсодс деаєсєсддадчда садсседеЕде 120 аєєдссдадд дсаасаасає сааєссдєссд дссадсдсда дсассдсдса аассддсаєсєс 180 аасаєєдссу дЕСЯдраєссє доаодеЕдссссда ддадсЯассссЯає Єсдсодддеса дсгддсдадс 240 гЕсвасадсе Егаєсуєєду ЕдадеЕсдеєдда ссдеєсуддуаєс деЕдасссеєсу ддадасеЕсес Зоо аєддадсасуд Єсдадсаасе ддєдсдссаа садасєсасдуд адаасдсдсд саасассддсе 3З6о

Zo sEddsdsudayeEyes sSdsaaddEss doddeEdsaads EsSssoosudsEs assadsades sseEddaadae 420

БЕдвЧдЕсддааа ассдєдаєаа Єдсодсдсасо сдссссдссс сбдсасасдса дсасаєсдсд 480 сгддадссдд ассссссдаа сдсдаєсдссу ссдесссдсаа Ссаасаасса дсаадсдссд 540 седссдаєсдда сСссасдссса адссдсдаає седсасеєсдс гдсеЕдссдсд сдасдсаєсе 60 сЕдеЕссоддса дсдаасссдда сссдассадс саддадаєсс адсдстаста єдадсдессад 6бо чдссдадааага содсдЕЧдааса сеЕСсдасстас ЄдсдсЕсСуДсЕ ддегасаасас доаодсстьдаас 720 ааєсєдсдеєд дсассаасоадс ддадеЕсСссддд ссдсдеєсаса ассадеЕсссу Єсдасдчаєсстд 78о0 асссЕдоаЧчеЕд єЕЄесоЧодЧчаєєє доадєєдсодссд Єссссодадсо асдасасссуд саєстаєссд 840 аєсаасасса дсдсдсаасе дасеєсдсдаа асссасасдд асссдассдд ссдсастсааєс 900 чдсассдєссд дЕсссодсаад сассаасєдуд СсСсаасааса асдсассдад сеЕссадсдасд 960 аєсдаддссуд сдаєсеЕсесу Ессдссдсас сеЕдеЕсоодасе Есссддадса дседассаєс 1020 басеЕсвдсає сеадссдєсд дадсадсасуд садсасаєда аєсаседаддЕ Еддссаєсде 1080 сЕдаасеєесс дсссудаєсдда єддбасдсесд аасассадса сдсасуддедс сассаасасд 1140 адсаєсаасс соддЕдасусЕ дсааєссасс адссдєдаєд ЕЄвассдрас сдадеЕсссас 1200 дссддсаєса асарсссдсеЕ дассассссуд дЕсСаасддсуд ЕсссеЕБдудде Ессе єссаає 1260 бддсдєаасс сасеєдаасад ссеЕдсдеЕдає СссСсЕсооседЕ асассаєвєдда єсасассддес 1320 чЧдЕсддбасудс аасеЕдеЕседа сссддааассі дадссдссас сдуддааасврас сдадсдессд 1380 аасрасдаає сеЕсасадсса ссуєстЕдеЕсс аасаєссуєс Едаєсаєсд саасассстьд 1440 сдєЕдсдссдд Єдсасадссд дасссаєсудс адсдссдаєс дсасдаасас даєсдссасс 1500 аасаєсаєса сссадаєссс ддсадесдааа ддсаасеЕсєеєс єдЕсЕаасуд садсдедаєс 1560 адсддЕссад ЯДЕСЕсСассду сддєдассвуд дедсдсессеєда асаасадсудд саасаатаєс 1620 саааассуєд деЕвагаєсда адеЕсссдаєсе сааєєсаєса дсасудадсас ссдеЕсассдс 1680 дЕССЯєдДЕЕсС дссасуусаєс судєвасудссу аєссаасеєда дсдЕсаассд дддсааєєссс 1740 аасаєєесєса дссудсасвдеЕ сссеєдсвасуд дсдбасєсеєс Єддасааєсе дсададссде 1800 аасеЕєсддсеЕ аєсеЕсудааад сассаасдсесс СЕСассадсуд сеасдддсаа ЕДЕЯЯЄтЧЧЕ 1860 дЕєЄСсСдсааєє Єсадсдадаа ЕдсдддсудЕсС аєсасєдасс ЯЕЕссдадее гаєсссодед 1920 ассдсдассеє Єсдаадсуда деасчдаєсьсд дадсдеЕдсдс аддаа 1965 «2105 13 «2115 655 60 «212»Protein "2135 Artificial sequence

"223" Variant Sgu1B "4005 13

Me Rgo Bek Ap Agkud pub Avp obi Avp obits I1e I1e ABp Aza Iets 5eg 1 5 10 15

IT1e Rgo Aia Uaii bek AvBp o Niv Bek Aia bip Mee Avr Gay back Gay Avr 20 25 30

A1a Agud I1ie bij Avr bek Gay Suv Iie Aia bij sb1u Avp Ap I1e Avp 35 40 45

Rkgo Gets Uai bek Aza bek TPg Uai bip TPg sb1u I1ie ABp I1e Aia 0Щ1U 50 55 bo

Akud I1e Ggets siu Uaiii Iets b1u Uai Rgo Rpe Aza s1u sip Gay Aia 5eg 65 70 75 80

Rpe Tuk bek Rrpe I1e Uai s1u bis Ietsy Tegr Rgo Bek b1u Agd Avr Rgo 85 90 95

Ter bish Iie Rbe Mesye sitz Ni Ua1! sitz bip Iiets Uai Akd sb1ip sip She 100 105 110

TE bts Avp Aza Agud ABp o TPg Aza Gay Aza Agud Iyetsy sbip s1u Iech s1Uu 115 120 125

Aza bek Ripe Agud Aia Tuk bip bip bek ITec fight Avr Tgr Gay fight Avp 130 135 140

Ak Avr Avp Aza Agud TPg Agud bBeg Uaii Ietsy Tug TPg sbip Tug Ii1e Ai1a 145 150 155 160

Tets b1ip Gay Avr Rpe Gay Avp Aza Mee Rgo Gay Robe Aza I1e ABpP AvBp 165 170 175 beep beep Uai Rgo Gay Gay Mee Uai Tug Aza sip Aia Aia ABp Ietsy Niv 180 185 190

Zo Pes Gay Gets Getsp Agud Awr Aza bek Tey Rpe siu bek bi Rore s1u Gay 195 200 205

TPg Back beep siy I1ie beep Agd Tug Tug bis Agd beep Asia1a b1py Guv Ts 210 215 220

Akud bij Tuk bek Avr Tuk Suv Aia Agd Tgr Tug ABp TpPg o1u Gay Avp 225 230 235 240

Ap oh hey Agud biu TBg ABp Aza bitz bek Tegr Hey Agud Tug Avp bip Re 245 250 255

Akud Agud Avr o Gets TBPg Iets b1i1u Uai Ietsyts Avr Iep Uai Aia Gay Rpe Rgo 260 265 270

Zzek Tuk Avr TPg Agud I1ie Tuk Rgo I1ie Avp TPg bek Aia sip Temp TPg 275 280 285

Akud bij I1e Tug TBg Avr Rgo I1e s1u Agd TPg ABp Aza Rgo bBeg 01U 290 295 300

Rpe Aia bek TPg Avp o Tegr Rpe Avp AvBp ABp Aza Rgo Bek Rppe beg Ai1a 305 310 315 320

Iie sbits Aza Aza I1e Rpe Agud Rgo Rgo No Ietsp Gay Avr Rope Rgo bij 325 330 335 bip Gay TPg I1ie Tug Bek Aia Bek Bek Agud Ter bek bek TPg beep Niv 340 345 350

Mee Avp o Tuk Ter Uai siu Niv Agud Gay Avp Rpe Agkud Rgo I1e sS1iu s1Uu 355 3Z6o 365

TPE gay Avp o TBbg bek TPg Ni siu Aia TPg AvBp oTPg bek I1e ABp Rgo 370 375 380

Uai TpPg ge bip Rpe TPg bek Agud Avr Ua1! Tut Agud TPg fight back Tug 385 390 395 400

Aza si1u I1e AvBp I1e Iietsy Gay TPg TBPg Rkgo Uai Avp s1iu Ua1 Rgo Tgr 405 410 415

Aza Akud Rpe Avp o Tgr Agud ABp oRgo Tets AvBp bek Gay Agud siu bek Iey 420 425 430 (516) Tem Tug TPkgE Iiee s1iu Tuk TPg siu Uai sb1u TPkg sbip Gay Robe Ar 5eg 435 440 445 bi TpK biy Gay Rgo Rgo bii TPg TPg bid Agud Rgo ABp Tuye bij 5beg 450 455 460

Tuk Bek Niv Agd Gets beg AvBp I1e Agd Gets I1e I1e sb1u ABp TPg Ietsy 465 470 475 480

Agud Aza Rkgo UMa1 Tug Bek Ter TPg Niv Agud Bek Aza Avr Agud TiK Avp 485 490 495

TPgE Iie Aza TPg Ap I1e I1e TPg sip I1e Rgo Ai1a Uai Gguv S1u Avp 500 505 510

Rpe Gay Ribe Avp o biu bek Uai I1e Bek s1i1u Rgo siu Rbe TPg s1u 01U 515 520 525

Avr Gay Uai Agd Tets Avp AvBp o beg biu AvBp ABp I1e sip ABp Agd 1U 530 535 540

Tuk Iie soi Mai Rgo I1e bip Rpe Iie bek TPg bek TPg Agud Tug Agd 545 550 555 560

Ua1 Akud Mai Akud Tug Aza bek Uai TPg Rgo I1ie Akd Gay Bek Uai1i Avp 565 570 575

Ter b1u Avp bek Avp o I1e RiPe bek bek Iie Uai Rgo Aia TPg Aia TEPg 580 585 590 zek Hey Avr AvBp o Tets bip bek Agd AvBp Rpe b1i1u Tugk Rpe bij bBeg Ag4d 595 (51048) 605

Ap Aza Ripe TPg bek Aza TPg s1iu Avp Uai Uai1i siu UMai Agd Avp RiPe 610 615 620 zek bis AvBp Aia bi1u Maiii Iie I1e ABr Akd Rpe siy Rpe Iie Rgo Uai 625 630 635 640

TPE Aza TPg Rbe siy Aia biy Tug Avr Gay biy Agud Aza sip Jan 645 650 655 "2105 14 "2115" 1965 "2125" DNA "2135 Artificial sequence "2205 "223" Coding sequence of variant Sgu1B

З5 «4005 14 аєдссдадса аєсдєаадаа Єдааааєдаа ассаєсаасу саседессає сссрдсадед (216) адсааєсаса дсдсдсадає ддаєєсдадс ссддаєсдсдоадс дсаєссдадда садсссдсдео 120 аєєдссдадд дсаасаасає сааєссдєссд дссадсдсда дсассдсдса аассддсаєсєс 180 аасаєсдссду дЕСЯгГасссе додсдЕССтУ досдсЕсСсЯєЄ ссосоддодеєса дсеЕддсдадс 240 гЕсвасадсе Егаєсуєєду ЕдадеЕсдеєдда ссдеєсуддуаєс деЕдасссеєсу ддадасеЕсес Зоо аєддадсасуд Єсдадсаасе ддєдсдссаа садасєсасдуд адаасдсдсд саасассддсе 3З6о седдсдсдсс сСдсааддссс dddsdsaads EsssdsudsEs assadsades ssgddaaade 420

БЕдЧдЕсддааа ассдєдаєаа Єдсодсодсасс сдссссдссс сбдсасасдса дсасаєсдсд 480 сЕддадссду асеЕеєссеєддаа соосдаєсдссду сЕдеЕссЄдсаа Ссаасаасса дсаадсдссд 540 седссдаєсдда сСссасдссса адссдсдаає седсасеєсдс гдсеЕдссдсд сдасдсаєсе 60 сЕдеЕссодса дсдааєсссдда сссдассадс саддадчассс адсдссасста Єдадсдессад 6бо чдссдадаааа содсдєдааса сеЕссдасстас сдсдсссЯдсс ддсасаасас дддЕссдаас 720 ааєсєдсдеєд дсассаасоадс ддадеЕсСссддд ссдсдеєсаса ассадеЕсссу Єсдасдчаєсстд 78о0 ассседдоаєд ЕЄСсодасьєє доаоєсодсоста сЕєсСсодадсе асдасасссдуд саєстаєссо 840 аєсаасасса дсдсдсаасе дасеєсдсдаа асссасасдд асссдассдд ссдсастсааєс 900 чдсассдєссд дЕсЄссодсаад сассаассдуд СсСсаасааса асдсассдад сеЕссадсдасд 960 аєсдаддссд счдавсьсесу Ессдссудсас сеЕдеЕсдддасе Есссддадса дсеЕдассаєс 1020 басеЕсрдсає сеадссдеєсд дадсадсасу садсасаєда аєсаседдЧдє ЄддссаєсдЧе 1080 сеЕдаасеєсс дсссдаєсда єддсасудсесд аасассадса сдсасуддєдс сасеєаасасд 1140 адсаєсаасс соддЕдасусЕ дсааєссасс адссдєдаєд ЕЄвассдрас сдадеЕсссас 1200 дссддсаєс а асарсссдсеЕ дассассссуд дЕсСаасдудсуд ЕсссеЕБдудде ЕсСЯдвЕЕСсСаає 1260 бдадасдбаасс саседаасад ссеЕдсдЕдЧєЕ СссСЕЕсудседЕеЕ асассаєвдуд Есасассддас 1320 чЧдЕсддбасудс аасеЕдеЕседа сссддааассі дадссдссас сдуддааасврас сдадсдессд 1380 (516) аассасдаає сеЕсасадсса ссуєссдессс аасаєсссуєс Єдаєсаєсдда саасассстд 1440 сдєдсдссдд Єдсасадссд дасссассдс адсдссдаєс дсасдаасас даєсдссасс 1500 аасаєстаєса сссадаєссс ддсадедааа ддсаасесесєс єдеЕєсаасду садсуєдаєс 1560 адсддЕссад дЕСсЕсСассду сддеєдассьд деЕдсдссеєда асаасадсдд саасаатаєс 1620 саааассуєд десЕвагаєсда адеЕсссдаєсе сааєсеєсаєса дсасдадсас ссуєстгассдс 1680 дЕССЯєдДЕЕсС дссасуусаєс сдєсасоудссду аєссдсседа дсдЕєсаасвд дддсааєссс 1740 аасаєєєсса дсадсасеєдЕ сссеєдсвасу дсдассєсєс Єддасааєсеє дсададссде 1800 аасеЕєсддсеЕ аєсеЕсудааад ссдсаасдсс СЕСассадсуд сеасдддсаа ЕДЕЯЯЄтЯЧЕ 1860

ChdEeEsdsaayes Yesadsudaaa EdsddddsdEsS ayesayesedass dYAEEEedadee gayesssoded 1920 assdsdasseee Yesdaadsuda deasdayesd dadsdeEdsds addaa 1965 "2105 15 "2115 655 "212" Protein "2135 Artificial sequence "220" "223" Variant Cgu 1 "40

Me Rgo Bek Avp Agkud pub Avp bij Avp obits I1e I1e ABp Aza Iets 5eg 1 c) 10 15

IT1e Rgo Aia Uaii bek AvBp o Niv Bek Aia bip Mee Avr Gay back Gay Avr 20 25 30

Aza Agkud ch11e bis Avr bek ITep Suv I1e Ai1a bij s1u AvBp Ap I1e Avp 35 40 45

Rgo Ppep Uaii bek A1ia bek TPg Uai sip TBg s1u I1e ABp I1e Aia 01Uu 50 55 bo

Akud I1e Ggets siu Uaiii Iets b1u Uai Rgo Rpe Aza s1u sip Gay Aia 5eg 65 70 75 80

Rpe Tuk bek Rrpe I1e Uai s1u bis Ietsy Tegr Rgo Bek b1u Agd Avr Rgo

From 85 90 95

Ter bish Iie Rbe Mesye sitz Ni Ua1! sitz bip Iiets Uai Akd sb1ip sip She 100 105 110

TP bets Avp Aza Agud ABp Ts Aza Gets Aza Agd Te sip s1u Gesh SHU 115 120 125

A1a back Rpe Akud A1ia Tuk sbip beep back Hey fight Avr Ter Hey fight Avp 130 135 140

Ak Avr Avp Aza Agud TPg Agud bBeg Uaii Ietsy Tug TPg sbip Tug Ii1e Ai1a 145 150 155 160

Tets b1ip Gay Avr Rpe Gay Avp Aza Mee Rgo Gay Robe Aza I1e ABpP AvBp 165 170 175 beep beep Uai Rgo Gay Gay Mee Uai Tug Aza sip Aia Aia ABp Ietsy Niv 180 185 190

Tets IGecp Gay Gay Agud Avr Aza bek Gay Rpe siu bek siy Ribe SsS1Uu Iey 195 200 205

TPg Bek beep bii Iie sbip Agud Tug Tuk bii Akud beep Aza bi Buv TBbg 210 215 220

Akud bij Tuk bek Avr Tuk Suv Aia Agd Tgr Tug ABp TpPg o1u Gay Avp 225 230 235 240

Ap oh hey Agud biu TBg ABp Aza bitz bek Tegr Hey Agud Tug Avp bip Re 245 250 255

Akud Agud Avr o Gets TBPg o Iets b1i1u Uaiii Iets Avr Gay Uai Aia Gay Robe Rgo 260 265 270 zek Tug Avr TPg Agud I1e Tug Rgo I1e ABp TPg bek Aza sbip Gay TEG 275 280 285

Agud bij Iie Tug TPg Avr Rgo Iie s1u Akud TBg ABp Aza Rgo bek 01Uu 290 295 300

Rpe Aia bek TPg Avp o Tegr Rpe Avp AvBp ABp Aza Rgo Bek Rppe beg Ai1a 305 310 315 320

Iie sbits Aza Aza I1e Rpe Agud Rgo Rgo No IYetsp Gay Avr Rpe Rgo sats 60 325 330 335 bip Gay TPg I1ie Tug Bek Aia Bek Bek Agud Ter bek bek TPg beep Niv

340 345 350

Mee Avp Tug Ter Ua1 si1u No Agd Gay Avp Do Agd Rgo I1e S1u Shchu 355 360 365

TPE gay Avp o TBbg bek TPg Ni siu Aia TPg AvBp oTPg bek I1e ABp Rgo 370 375 380

Uai TpPg ge bip Rbe TPg bek Agud Avr Ua1i Tut Agd TPg bii bek Tug 385 390 395 400

Aza si1u I1e AvBp I1e Iietsy Gay TPg TBPg Rkgo Uai Avp s1iu Ua1 Rgo Tgr 405 410 415

A1a Agud Rpe Avp o Tgr Agud Avp o Rgo Getsp Up bek Gay Agud s1iu bek Ietsy 420 425 430

Tecp Tuk TPpg I1ie s1u Tuk TPg siu Uai s1u TpPkg sip Gay Ribe Avr 5eg 435 440 445 bi TpK bij Gay Rgo Rgo bij TPg Tpg bij Agud Rgo Avp Tug bis beg 450 455 460

Tuk Bek Niv Agd Gets beg AvBp I1e Agd Gets I1e I1e Bek AvBp TPg Ietsy 465 470 475 480

Akud Aza Rgo Ua1! Tuk bek Tgr TPg No Agud bek Aza Avr Agd TPg Avp 485 490 495

TE Iie Aia TPg ABp I1e Iie TPg sbip chI1e Rgo Aia Uai Ppuv s1U Avp 500 505 510

Rpe Gay Ribe Avp o biu bek Uai I1e bek b1u Rgo s1u Rpe TPgE s1u schu 515 520 525

Avr Gay Uai Agd Tets Avp AvBp o beg biu AvBp ABp I1e sip ABp Agd 1U 530 535 540

Tuk Iie bij Ua1i Rgo I1e bip Rbe I1ie bek TPg bek TPg Agud Tug Agd 545 550 555 560

Uai Akud Uai Agu Tug Aia bek Ua1i TPg Rgo I1e Agd Iets bek Uai Avp 565 570 575

Zo TEr b1u Avp bek Avp o I1e Rire bek bek I1ie Uai Rgo Ai1a TPg Aia TEG 580 585 590 zek Gay Avr AvBp o Tets bip bek Agd AvBp Rpe b1u Tuk Rpe bij bBeg Agd 595 (51048) 605

Ap Aza Ripe TPg bek Aza TPg biu AvBp Uai Uai siu Uai Agd Avp Re 610 615 620 zek bis AvBp Aia biu Maiii I1i1e I1e ABr Akd Rpe siy Rpe Iie Rgo Uai 625 630 635 640

TPgE Aia TPg Rbe bitz Aza bitzsh Tug Avr Gets bitz Agd Aza sip si 645 650 655 "2105 16 "2115" 1965 "2125 DNA "2135 Artificial sequence "2205 "223" Coding sequence of Sgu1B variant "4005 16 asssdadsa ayesaeessa sedasasadaa Sdaasa (216) адсааєсаса дсдсдсадає ддаєєсдадс ссддаєсдсдоадс дсаєссдадда садсссдсдео 120 аєєдссдадд дсаасаасає сааєссдєссд дссадсодсда дсассадєсЄдса аассадсаєсе 180 аасаєєдссу дЕСЯдраєссє доаодеЕдссссда ддадсЯассссЯає Єсдсодддеса дсгддсдадс 240 гЕсвасадсе Егаєсуєєду ЕдадеЕсдеєдда ссдеєсуддуаєс деЕдасссеєсу ддадасеЕсес Зоо асддадсасд ЕсдадсаасеЕ додєдсодссаа сачасстасду адааєдсоддсуд саасассдсе 3З6о седдсдсдсс сСдсааддссс дддсдсаадс ЕсссдсудсЕс ассадсадес ссгддаадає 420

БЕдвЧдЕсддааа ассдєдаєаа Єдсодсдсасо сдссссдссс сбдсасасдса дсасаєсдсд 480 сгддадссдд ассссссдаа сдсдаєдссд сЕдеЕссдсаа ссаасаасса дсаадесдссд 540 седссдаєсдда Сссасдссса адссдсдаає ссдсасссдс сдссдссдсда сддасдсаєссе 60 (516) сЕЧДссСсоодса дсдаасссодд сссдассадс саддадаєсс адсдстасса Єдадсдесад 6бо чдссдадаааа содсдєдааса сеЕссдасстас сдсдсссЯдсс ддсасаасас дддЕссдаас 720 ааєсєдсудед дсассаасдс ддадеЕсссдд ссдсдєсаса ассадесссся єсдсдаєстд 78о0 асссЕдоаЧчеЕд єЕЄесоЧодЧчаєєє доадєєдсодссд Єссссодадсо асдасасссуд саєстаєссд 840 аєсаасасса дсдсдсаасе дасеєсдсдаа асссасасдд асссдассдд ссдсастсааєс 900 чдсассдєссд дЕсЄссодсаад сассаассдуд СсСсаасааса асдсассдад сеЕссадсдасд 960 аєсдаддссуд сдаєсеЕсесу Ессдссдсас сеЕдеЕсоодасе Есссддадса дседассаєс 1020 басеЕсвдсає сеадссдєсд дадсадсасуд садсасаєда аєсаседаддЕ Еддссаєсде 1080 сЕдаасеєесс дсссудаєсдда єддбасдссд аасасврадса сдсасддєдс сасеаасасд 1140 адсаєсаасс судЕдасусеЕ дсааєссасс адссудєдаєд Есвассубас сдадеЕсстас 1200 дссддсаєса асарссс дсеЕ дассассссуд дЕсСаасддсуд ЕсссеЕБдудде Ессе єссаає 1260 бддсдєаасс сасеєдаасад ссеЕдсдеЕдає СссСсЕсооседЕ асассаєвєдда єсасассддес 1320 чЧдЕсддбасудс аасеЕдеЕседа сссддааассі дадссдссас сдуддааасврас сдадсдессд 1380 аасрасдаає сеЕсасадсса ссуєстЕдеЕсс аасаєссуєс Едаєсаєсад саасассстьд 1440 сдєЕдсдссдд Єдсасадссд дасссаєсудс адсдссдаєс дсасдаасас даєсдссасс 1500 аасаєстаєса сссадаєссс ддсадедааа ддсаасесесєс єдеЕєсаасду садсуєдаєс 1560 адсддЕссад ДдЕСЕсСассудуд сддеєдасстд дсдсодссєда асаасадсдд саасаасаєс 1620 саааассуєд деЕвагаєсда адеЕсссдаєсе сааєєсаєса дсасудадсас ссдеЕсассдс 1680 дЕССЯєдДЕЕсС дссасуусаєс сдєсасоудссду аєссдсседа дсдЕєсаасвд дддсааєссс 1740 аасаєєеєсєса дсадсаседеЕ сссеєдсвасуд дсдассєсєс Еддасааєсе дсададссде 1800 аасеЕєсддсеЕ аєсеЕсудааад ссдсаасдсс СЕСассадсуд сеасдддсаа ЕДЕЯЯЄтЯЧЕ 1860 дЕєЄСсСдсааєє Єсадсдадаа ЕдсдддсудЕсС аєсасєдасс ЯЕЕссдадее гаєсссодед 1920 ассдсдассеє Єсдаадсуда деасдаєсьд дадсдеЕдсдс аддаа 1965 «2105 17 «2115 655 «212» Білок "2135 Pieces to the sequence "220" "223" Option Sgu1B

From "4005 17

Me Rgo Bek Ap Agkud pub Avp obi Avp obits I1e I1e ABp Aza Iets 5eg 1 c) 10 15

IT1e Rgo Aia Uaii bek AvBp o Niv bek Aia bip Mee Avr Gets beg Ietsy Avr

C5 20 25 30

Aza Agkud ch11e bis Avr bek ITep Suv I1e Ai1a bij s1u AvBp Ap I1e Avp

Rkgo Gets Uai bek Aza bek TPg Uai bip TPg s1u I1ie Avhp I1e Aza 01Uu z9 (210) 40 Agud chI1e Hey siu Uaii Geip siu Maiii Rgo Rbe Aia siu sbip Gay Aia 5eg 65 70 75 80

Rpe Tuk bek Rrpe I1e Uai s1u bets Gay Ter Rgo bek S1u Agd ABr Rgo 85 90 95

Ter bish Iie Rbe Mesye sitz Ni Ua1! sitz bip Iiets Uai Akd sbi1ip Aza She 45 100 105 110

TPg gay Avp Aza Agud ABp o TPg Aza iep Aza Agud Gay sip s1iu Gets s1Uu 115 120 125

Aza bek Ripe Agud Aia Tuk bip bip bek ITets bij Avr Tgr Gay bij Avp 130 135 140 50 Agud Avr Azp Aza Agud TOg Agu bek Uai tey Tuk TPg sip Tug I1e A1ia 145 150 155 160

Tets b1ip Hey Avr Rpe Hey Avp Aza Mee Rgo Hey Robe Aza I1e ABpP AvBp 165 170 175 beep beep Uai Rkgo Hey Ggesh Mee Ua! Tug Asia beep Aza Aza ABp Gay Niv 180 185 190

Tets IGecp Gay Gay Agud Avr Aza bek Gay Rpe siu bek siy Ribe SsS1Uu Iey 195 200 205

TPg Bek bip siy I1e bip Agud Tug Tu bis Agd bip Asia1a b1y Guv Ts 210 215 220 (516) Agd bij Tugk bek Avr Tuk Suv Aza Agud Tkgr Tug ABp TPg s1u Iech Avp 225 230 235 240

Ap oh hey Agud biu TBg ABp Aza biy bek Tgr Hey Agud Tug Avp bip Re 245 250 255

Akud Agud Avr o Gets TBPg o Iets b1i1u Uaiii Iets Avr Gay Uai Aia Gay Robe Rgo 260 265 270

Zzek Tuk Avr TPg Agud I1ie Tuk Rgo I1ie Avp TPg bek Aia sip Temp TPg 275 280 285

Akud bij I1e Tug TBg Avr Rgo I1e s1u Agd TPg ABp Aza Rgo Beh 0Щ1U 290 295 300

Rpe Aza bek TPg Avp Ter Rpe Avp AvBp ABp Aza Rgo Bek Rppe beg Ai1a 305 310 315 320

Iie sbits Aza Aza I1e Rpe Agud Rgo Rgo No IYetsp Gay Avr Rpe Rgo sats 325 330 335 bip Gay TPg I1ie Tug Bek Aia Bek Bek Agud Ter bek bek TPg beep Niv 340 345 350

Mee Avp o Tuk Ter Ua1i siu Niv Agud Gay Avp Rpe Agkd Rgo I1e s1u SHU 355 3Z6o 365

TPE gay Avp o TBbg bek TPg Ni siu Aia TPg AvBp oTPg bek I1e ABp Rgo 370 375 380

Uai TpPg ge bip Rbe TPg bek Agud Avr Ua1i Tut Agd TPg bii bek Tug 385 390 395 400

Aza si1u I1e AvBp I1e Iietsy Gay TPg TBPg Rkgo Uai Avp s1iu Ua1 Rgo Tgr 405 410 415

Aza Akud Rpe Avp o Tgr Agud ABp oRgo Tets AvBp bek Gay Agud siu Bek Iets 420 425 430

Tem Tug TPkgE Iie s1iu Tuk TPg siu Uai sb1u TPkg sbip Gay Robe Ar 5eg 435 440 445 bi TpK bij Gay Rgo Rgo bij TPg Tpg bij Agud Rgo Avp Tug bis beg 450 455 460

Tuk Bek Niv Agd Gets beg AvBp I1e Agd Gets I1e I1e bek b1u TPg Iets

From 465 470 475 480

Akud Aza Rgo Ua1! Tuk bek Tgr TPg No Agud bek Aza Avr Agd TPg Avp 485 490 495

TPgE Iie Aza TPg Ap I1e I1e TPg sip I1e Rgo Ai1a Uai Gguv S1u Avp 500 505 510

Rpe Hey Ribe Avp o siu bek Uai Iie bek sbiu Rgo sb1u Rpe TPg s1iu 01Uu 515 520 525

Avr Gay Uai Agd Tets Avp AvBp o beg biu AvBp ABp I1e sip ABp Agd 1U 530 535 540

Tuk Iie bij Ua1i Rgo I1e bip Rbe I1ie bek TPg bek TPg Agud Tug Agd 545 550 555 560

Uai Akud Uai Agu Tug Aia bek Ua1i TPg Rgo I1e Agd Iets bek Uaiii Avp 565 570 575

Ter b1u Avp Bek Up I1e RiPe bek beg I1e Ua! Rgo Ai1a TPg Asia TPg 580 585 590 zek Gay Avr AvBp Gay bip bek Agud Avp Rbe siu Tuk Rpe siy bek Agd 595 bo 605

Ap Aza Ripe TPg bek Aza TPg biu AvBp Uai Uai siu Uai Agd Avp Re 610 615 620 zek bis AvBp Aia bi1u Maiii Iie I1e ABr Akd Rpe siy Rpe Iie Rgo Uai 625 630 635 640

TPgE Aia TPg Rbe bitz Aza bitzsh Tug Avr Gets bitz Agd Aza sip si 645 650 655 "2105 18 "211" 1965 "212" DNA "2135 Artificial sequence "220" (516) "223" Coding sequence of variant Sgu1B

«4005 18 аєдссдадса аєсдєаадаа Єдаааасдаа ассаєссаасуд сассдсссає ссседсадед (216) адсааєсаса дсдсдсадає ддаєєсєдадс седдаєдсоас дсаєсдаддада садсседедае 120 аєєдссдадд дсаасаасає сааєссдєссд дссадсдсда дсассдсдса аассддсаєсєс 180 аасаєсдссду дЕСЯгГассся додсдЕССтУ доаосудсЕСсСсСЯЄ ЄсСосодддесСа дссдодсддадс 240

EEEevasadse svaesueedu edadesudedoa ssdayesoddadeEsS deEDassseesd ddadayeves Zoo aeddadsasud Yesdadsaase ddyedsdssaa dsdayessasds sSdaasdsdsd saasassddse 3Z6o seddsdsss sSdsaaddsss dddsdsaads EsssdsudsEs assadsades ssgddaadae 420

БЕдвЧдЕсддааа ассдєдаєаа Єдсодсдсасо сдссссдссс сбдсасасдса дсасаєсдсд 480 сЕддадссду асеЕєссеєддаа соосдаєдссд сЕдЕссдсаа Ссаасаасса дсаадсдссд 540 седссдаєсдда сСссасдссса адссдсдаає седсасеєсдс гдсеЕдссдсд сдасдсаєсе 60 сЕдеЕссоддса дсдаасссдда сссдассадс саддадаєсс адсдстаста єдадсдессад 6бо чдссдадаааа содсдєдааса сеЕссдассас СдсодсссУЯвєЕеЕ ддрасаасас дододеЕСтєДдаас 720 ааєсєдсдеєд дсассаасоадс ддадеЕсСссддд ссдсдеєсаса ассадеЕсссу Єсдасдчаєсстд 78о0 ассседдоаєд ЕЄСсодасьєє доаоєсодсоста сЕєсСсодадсе асдасасссдуд саєстаєссо 840 аєсаасасса дсдсдсаасе дасеєсдсдаа асссасасдд асссдассдд ссдсастсааєс 900 чдсассдєссд дЕсЄссодсаад сассаассдуд СсСсаасааса асдсассдад сеЕссадсдасд 960 аєсдаддссд счдавсьсесу Ессдссудсас сеЕдеЕсдддасе Есссддадса дсеЕдассаєс 1020 басеЕсвдсає сеадссдєсд дадсадсасуд садсасаєда аєсаседаддЕ Еддссаєсде 1080 сеЕдаасеєсс дсссдаєсда єддсасодсьуд аасастадса сдсасддедс сассаасасду 1140 адсаєсаасс соддЕдасусЕ дсааєссасс адссдєдаєд ЕЄвассдрас сдадеЕсссас 1200 дссддсаєса асарсссдсеЕ дассассссуд дЕсСаасддсуд ЕсссеЕБдудде Ессе єссаає 1260 бдадасдбаасс сасеЕдаасад ссЕдсдЕдуЧє ссЕЕвсдседЕ асассаєєду Есагассоддс 1320 чЧдЕсддбасудс аасеЕдеЕседа сссддааассі дадссдссас сдуддааасврас сдадсдессд 1380 аассасдаає сеЕсасадсса ссуєссдессс аасаєсссуєс Єдаєсаєсад сддасассстд 1440 сдєЕдсдссдд Єдсасадссд дасссаєсудс адсдссдаєс дсасдаасас даєсдссасс 1500 аасаєстаєса сссадаєссс ддсадеЕдааа ддсаасесесєс єдеЕєсаасду садсуєдаєс 1560 адсддЕссад дЕСсЕсСассду сддеєдассьд деЕдсдссеєда асаасадсдд саасаатаєс 1620 саааассуєд deEvagayesda adeEsssdayese saaeesayesa dsasudadsas ssdeEssssds 1680

Зо дессяеддееессс дсасодсаес садесааесосу аесудсаеда дсодетеаасд доадсааесесс 1740 аасаееееса дсадсаседеE сааеееесеса dsadsasedeE sсеедсвасуд дсадасесеес Eddasaаесе dsadadssde 1800 aaseЕесddseE аесеEsudaaad ssdsaasdss SESassadsud seasdddsaa ЕДЭЕЯЕ10ЧЕЯЕ16

ChdEeeEsdsaayes Yesadsudaaa EdsdddsdEsS ayesayesedass dYAEEEedadee gayesssoded 1920 assdsdassee Yesdaadsuda deaschdayesd dadsdeEdsds addaa 1965

C5 "2105 19 "2115 655 "212" Protein "2135 Artificial sequence "220" "223" Sgu1B variant "4005 19

Mee Rgo Bek Avp Akud Guv ABp obi ABp obits Iie I1ie ABp Aza Gay 5eg 1 c) 10 15

IT1e Rgo Aia Uaii bek AvBp o Niv Bek Aia bip Mee Avr Gay back Gay Avr 20 25 30

Aza Agkud ch11e bis Avr bek ITep Suv I1e Ai1a bij s1u AvBp Ap I1e Avp 35 40 45

Rkgo Gets Uai bek Aza bek TPg Uai bip TPg sb1u I1ie ABp I1e Aia 0Щ1U 50 z9 (210)

Akud I1e Ggets siu Uaiii Iets b1u Uai Rgo Rpe Aza s1u sip Gay Aia 5eg 65 70 75 80

Rpe Tuk back Rrpe I1e Uaii siu bii Gay Ter Rgo bek s1u Agd AvBr Rgo 85 90 95

Ter bish Iie Rbe Mesye sitz Ni Ua1! sitz bip Iiets Uai Akd sbi1ip Aza She 100 105 110

TPg Geish Avp Aza Agud ABp o TPg Aza Gets Aza Agd Te sip s1u Gesh SHU 60 115 120 125

Aza bek Ripe Agud Aia Tuk bip bip bek ITets bij Avr Tgr Gay bij Avp

130 135 140

Ak Avr Avp Aza Agud TPg Agud bBeg Uaii Ietsy Tug TPg sbip Tug Ii1e Ai1a 145 150 155 160

Te b1ip Gay Avr Rpe Gay Avp Aza Mee Rgo Gay Rpe Aza I1e ABp AvBp 165 170 175 beep beep Uai Rgo Gay Gay Mee Uai Tug Aza sip Aia Aia ABp Ietsy Niv 180 185 190

Tets Getsp Gay Gay Agud Avr Aza bek Gay Rpe siu bek siy Ribe sS1Uu Gay 195 200 205

TPg Bek beep bii Iie sbip Agud Tug Tuk bii Akud beep Aza bi Buv TBbg 210 215 220

Akud bij Tuk bek Avr Tuk Suv Aza Agd Tgr Tug ABp TPg s1u Gets Avp 225 230 235 240

Ap oh hey Agud biu TBg ABp Aza bitz bek Tegr Hey Agud Tug Avp bip Re 245 250 255

Akud Agud Avr o Gets TBPg Iets b1i1u Uai Ietsyts Avr Iiep Uai Aia Gets Robe Rgo 260 265 270 zek Tug Avr TPg Agud I1e Tug Rgo I1e ABp TPg bek Aza sbip Gay TEG 275 280 285

Agud bij Iie Tug TPg Avr Rgo Iie s1u Akud TBg AvBp Aza Rgo bek 1U 290 295 300

Rpe Aia bek TPg Avp o Tegr Rpe Avp AvBp ABp Aza Rgo Bek Rppe beg Ai1a 305 310 315 320

Iie sbits Aza Aza I1e Rpe Agud Rgo Rgo No Gay Gay Avr Robe Rgo bij 325 330 335 bip Gay TPg I1ie Tug Bek Aia Bek Bek Agud Ter bek bek TPg beep Niv 340 345 350

Mee Avp Tug Ter Ua1 si1u Niv Agud Gay Tug Rpe Agud Rgo Iie Ap 1U 355 3Z6o 365

From TPE Gecp Avp TPg o bek TPE Ni s1u Aia TPg Avp TBPg bBeg I1e AvBp Rgo 370 375 380

Uai TpPg ge bip Rpe TPg bek Agud Avr Ua! Tug Agud TPg battle Bek Tug 385 390 395 400

Aza si1u I1e AvBp I1e Iietsy Gay TPg TBPg Rkgo Uai Avp s1iu Ua1 Rgo Tgr

Z5 405 410 415

Aza Akud Rpe Avp o Tgr Agud ABp oRgo Gay Avp bek Gay Agud siu bek Iey 420 425 430

Tecp Tuk TPpg I1iee s1u Tuk TPg siu Uai s1u TpPkg sip Hey Ribe Avr 5eg 435 440 445 siy Tk bi Hey Rgo Rgo bij TPg TPg bij Agud Rgo ABp Tuk bij beg 450 455 460

Tuk Bek Niv Agd Gets beg AvBp I1e Agd Gets I1e I1e sb1u ABp TPg Ietsy 465 470 475 480

Akud Aza Rgo Uai Tuk bek Ter TPg Niv Agud Bek Aza Avr Agd TBg Avp 485 490 495

TPgE Iie Aza TPg Ap I1e I1e TPg sip I1e Rgo Ai1a Uai Gguv S1u Avp 500 505 510

Rpe Hey Ribe Avp o biu bek Uai Iie bek s1u Rgo s1u Rpe TPgE s1u schu 515 520 525

Avr Gechp Uai Akud Gay Avp Avp bek s1u Avp ABp o I1e bip Avp Akd b1Uu 530 535 540

Tuk Iie bij Ua1i Rgo I1e bip Rore I1e bek TPg bek TPg Agud Tug Agd 545 550 555 560

Uai Akud Uai Agu Tug Aia bek Ua1i TPg Rgo I1e Agd Iets bek Uaiii Avp 565 570 575

Ter b1u Avp Bek Ap I1e RiPe bek bBekg I1e Ua! Rgo Ai1a TPg Asia TPg 580 585 590 zek Gay Avr AvBp o Tets bip bek Agd AvBp Rpe b1i1u Tugk Rpe bij bBeg Ag4d 595 bo 605 (516) Avp o AZia Rpe TPg bek Aza TpPg s1iu Avp Uai! Uai siu Maiii Ag9d Avp Rire 610 615 620 zek bis AvBp Aia bi1u Maiii Iie I1e ABr Akd Rpe siy Rpe Iie Rgo Uai 625 630 635 640

TPgE Aia TPg Rbe bitz Aza bitzsh Tug Avr Gets bitz Agd Aza sip si 645 650 655 "2105 20 "2115" 1965 "2125 DNA "2135 Artificial sequence "2205 "223" Coding sequence of Sgu1B variant "4005 20 (216) адсааєсаса дсдсдсадає ддаєєсдадс ссддаєсдсдоадс дсаєссдадда садсссдсдео 120 аєєдссдадд дсаасаасає сааєссдєссд дссадсдсда дсассдсдса аассддсаєсєс 180 аасаєєдссу дЕСЧЯдраєссе додеЕдссссд дадсЯдсЕСсСУЯЄ Егєдсоддудеєса дседдсдадс 240 гЕсвасадсе Егаєсуєєду ЕдадеЕсдеєдда ссдеєсуддуаєс деЕдасссеєсу ддадасеЕсес Зоо асдчдадсасд ЕсдадсаасеЕ додєдсодссаа дсчдастасдс Єдааєдсодсд саасассдсе 3З6о седдсдсдсс сСдсааддссс дддсдсаадс ЕсссдсудсЕс ассадсадес ссгддаадає 420

БЕдвЧдЕсддааа ассдєдаєаа Єдсодсдсасо сдссссдссс сбдсасасдса дсасаєсдсд 480 сгддадссдд ассссссдаа сдсдаєдссд сЕдеЕссдсаа ссаасаасса дсаадесдссд 540 седссдаєсдда сСссасдссса адссдсдаає седсасеєсдс гдсеЕдссдсд сдасдсаєсе 60 сЕЧДЕсСсодса дсдаасесвсдд сссдассадс саддачассс адсодссасса єдадсодєсад 6бо чдссдадаааа содсдєдааса сеЕссдасстас сдсдсссЯдсс ддсасаасас дддЕссдаас 720 ааєсєдсдеєд дсассаасоадс ддадеЕсСссддд ссдсдеєсаса ассадеЕсссу Єсдасдчаєсстд 78о0 асссЕдодЧчєд єЕЕЕєЧО дае одЧдєЕдсодоссЯя СсСсссодадсо асдасасссу саєстаєссд 840 ayesaasassa dsdsdsaase daseyesdsdaa asssasasdd asssdassdd ssdsastsaayes 900

Зо чдсассдЕссуд дЕсСссоуусаад сассаассду СЕсаасааса асдсассдад сеЕсСсадсдасд 960 аєсдаддссд счдавсьсесу Ессдссудсас сеЕдеЕсдддасе Есссддадса дсеЕдассаєс 1020 басеЕсвдсає сеадссдєсд дадсадсасу садсасаєда аєсаседаддЕ Еддссаєсде 1080 сЕдвавєсєвесс дсссудаєсаа сддбасдссд аасасврадса сдсасддбдс сасеаасасд 1140 адсаєсаасс соддЕдасусЕ дсааєссасс адссдєдаєд ЕЄвассдрас сдадеЕсссас 1200 дссддсаєса асаєсссдсеЕ дассассссу дЕсСаасддсу ЄсссеЕбддде Єсдресесаає 1260 бдадасдбаасс саседаасад ссеЕдсдЕдЧєЕ СссСЕЕсудседЕеЕ асассаєвдуд Есасассддас 1320 чЧдЕсддбасудс аасеЕдеЕседа сссддааассі дадссдссас сдуддааасврас сдадсдессд 1380 аасрасдаає сеЕсасадсса ссуєстЕдеЕсс аасаєссуєс Едаєсаєсд саасассстьд 1440 сдєЕдсдссдд Єдсасадссд дасссаєсудс адсдссдаєс дсасдаасас даєсдссасс 1500 аасаєсаєса сссадаєссс ддсадедааа доасаассеєсс єдЕсєсаасда садсаєдаєс 1560 адсддЕссад дЕСсЕсСассду сддеєдассьд деЕдсдссеєда асаасадсдд саасаатаєс 1620 саааассуєд десЕвагаєсда адеЕсссдарс сааєссаєса дсасдадсас ссуєсгассдс 1680 дЕССЯєдДЕЕс S dssasuusayes sdesassoudssdu ayessdsseda dsdEesaasvd dddsaaesss 1740 aasaeeesesa dsadsasedeE ssseedsvasud dsdasseseyes Eddasaayese dsadadssde 1800 aasEesddse ayesesdaaad ssdsaasudss SESSsSassadsu sbasdddsaa EYADEDYADYAOESOdE 1860

ChdEeEsdsaayes Yesadsudaaa EdsddddsdEsS ayesayesedass dYAEEEEedadee gayesssoded 1920 assdsdasseee Yesdaadsuda deasdayesd dadsdeEdsds addaa 1965 "2105 21 "2115 655 "212" Protein "2135 Artificial sequence "2205 "223" Variant Cgu2 "4

Me Rgo Bek Ap Agkud pub Avp obi Avp obits I1e I1e ABp Aza Iets 5eg 1 c) 10 15 (516) I1ie Rgo Aia Uai bek Avp Niv bek Aia bip Mes Avr Gay bek Ietsy Avr 20 25 30

Aza Agkud ch11e bis Avr bek ITep Suv I1e Ai1a bij s1u AvBp Ap I1e Avp 35 40 45

Rkgo Gets Uai bek Aza bek TPg Uai bip TPg sb1u I1ie ABp I1e Aia 0Щ1U 50 55 bo

Agud chI1e Gay siu Uaii Geip siu Maii Rgo Rbe Aia siu sbip Gay Aia 5eg 65 70 75 80

Rpe Tuk bek Rrpe I1e Uai s1u bis Ietsy Tegr Rgo Bek b1u Agd Avr Rgo 85 90 95

Ter bish Iie Rbe Mesye sitz Ni Ua1! sitz bip Iiets Uai Akd sbi1ip Aza She 100 105 110

TPg Geish Avp Aza Agud ABp o TPg Aza Gets Aza Agd Te sip s1u Gesh SHU 115 120 125

Aza bek Ripe Agud Aia Tuk bip bip bek ITec fight Avr Tgr Gay fight Avp 130 135 140

Agud Avr Avp Aza Agud Tbg Agu bek Uai Gay Tug TPg sbip Tug I1ie A1a 145 150 155 160

Tets b1ip Gay Avr Rpe Gay Avp Aza Mee Rgo Gay Robe Aza I1e ABpP AvBp 165 170 175 beep beep Uai Rgo Gay Gay Mee Uai Tug Aza sip Aia Aia ABp Ietsy Niv 180 185 190

Tets IGecp Gay Gay Agud Avr Aza bek Gay Rpe siu bek siy Ribe SsS1Uu Iey 195 200 205

TPg Back beep siy I1ie beep Agd Tug Tug bis Agd beep Asia1a b1py Guv Ts 210 215 220

Agd bij Tugk bek Avr Tuk Suv Aza Agud Tkgr Tug ABp TPg s1u Iech Avp 225 230 235 240

Ap oh hey Agud biu TBg ABp Aza bitz bek Tegr Hey Agud Tug Avp bip Re 245 250 255

Akud Agud Avr o Gets TBPg o Iets b1i1u Uaiii Iets Avr Gay Uai Aia Gay Robe Rgo

Zo 260 265 270 zek Tug Avr TPg Agud I1e Tug Rgo I1e ABp TPg bek Aza sbip Gay TEG 275 280 285

Akud bij I1e Tug TBg Avr Rgo I1e s1u Agd TPg ABp Aza Rgo Beh 0Щ1U 290 295 300

Rpe Aia bek TPg ABp o Ter Rpe Ap Azp Avp Aza Rgo bek Rope beg A1a 305 310 315 320

Iie sbits Aza Aza I1e Rpe Agud Rgo Rgo No IYetsp Gay Avr Rpe Rgo sats 325 330 335 bip Gay TPg I1ie Tug Bek Aia Bek Bek Agud Ter bek bek TPg beep Niv 340 345 350

Mee Avp Tug Ter Ua1 siu Niv Agd Gay Tug Robe Agd Rgo I1e sb1p Sh1U 355 3Z6o 365

TPE gay Avp o TBbg bek TPg Ni siu Aia TPg AvBp oTPg bek I1e ABp Rgo 370 375 380

Ua1i TpE Ggetsp sbip Rbe TPg bBeg Agud Avr Ua! Tug Akd TPg battle back Tug 385 390 395 400

Aza si1u I1e AvBp I1e Iietsy Gay TPg TBPg Rkgo Uai Avp s1iu Ua1 Rgo Tgr 405 410 415

Aza Akud Rpe Avp o Tgr Agud ABp oRgo Tets AvBp bek Gay Agud siu Bek Iets 420 425 430

Tecp Tuk TPpg I1ie s1u Tuk TPg siu Uai s1u TpPkg sip Gay Ribe Avr 5eg 435 440 445 bi TpK bij Gay Rgo Rgo bij TPg Tpg bij Agud Rgo Avp Tug bis beg 450 455 460

Tuk Back Niv Akud Gay back Avp I1ie Agud Gay Ii1e I1e s1u Up TPg Gay 465 470 475 480

Akud Aza Rgo Ua1! Tuk bek Tgr TPg No Agud bek Aza Avr Agd TPg Avp 485 490 495

TPgE Iie Aza TBPg Ap I1e I1e TPg bip I1e Rgo Ai1a Uai Ppuv S1u Avp 60 500 505 510

Rpe Hey Ribe Avp o biu bek Uai I1e bek b1u Rgo s1u Rpe TPgE s1u schu

515 520 525

Avr Gay Uai Agd Tets Avp AvBp o beg biu AvBp ABp I1e sip AvBp Agd b1Uu 530 535 540

Tuk Iie bij Ua1i Rgo I1e bip Rbe I1ie bek TPg bek TPg Agud Tug Agd 545 550 555 560

Uai Akud Uai Agu Tug Aia bek Ua1i TPg Rgo I1e Agd Gay Bek Ua1i Avp 565 570 575

Ter b1u Avp Bek Up I1e RiPe bek beg I1e Ua! Rgo Ai1a TPg Asia TPg 580 585 590 zek Gay Avr AvBp Gay bip bek Agud Avp Rbe siu Tuk Ribe bij bBeg Agd 595 (51048) 605

Ap Aza Ripe TPg bek Aza TPg biu AvBp Uai Uai siu Uai Agd Avp Re 610 615 620 zek bis AvBp Aia biu Maiii I1i1e I1e ABr Akd Rpe sitc Rbe I1e Rgo Uai 625 630 635 640

TPgE Aia TPg Rbe bitz Aza bitzsh Tug Avr Gets bitz Agd Aza sip si 645 650 655 "2105 122 "2115" 1965 "2125 DNA "2135 Artificial sequence "220" "223" Coding sequence of variant Sgu1B "4005 D 22 sssdsssaye sssedsaded (216) adsayessasa dsssdsadae ddaeyesdads ssddayesdsdoads dsayessdadda sadsssdsdeo 120

Зо ассдссдадд дсаасаасає сааєсссуєсд дссадсдсда дсассуєсєдса аассддсасе 180 аасаєєдссу дЕСЯдраєссє доаодеЕдссссда ддадсЯассссЯає Єсдсодддеса дсгддсдадс 240 гЕсвасадсе Егаєсуєєду ЕдадеЕсдеєдда ссдеєсуддуаєс деЕдасссеєсу ддадасеЕсес Зоо аєддадсасуд Єсдадсаасе доадєдсдссаа дсдаєссасдс бСдаасдсдсд саасассасе 3З6о седдсдсдсс сСдсааддссс дддсдсаадс ЕсссдсудсЕс ассадсадес ссгддаадає 420

ЕддЕсєддааа ассдеєдЧчасаа Сдсдсдсасе соуссссуссс сдерасасодса деасаєсдсд 480 сгддадссдд ассссссдаа сдсдаєдссд сЕдеЕссдсаа ссаасаасса дсаадесдссд 540 седссдаєсдда сСссасдссса адссдсдааєс срдсасеєсдс гдсрдссдсд сдасдсаєсе 60 сЕдеЕссоддса дсдаасссдда сссдассадс саддадаєсс адсдстаста єдадсдессад 6бо чдссдадаааа содсдєдааса сеЕссдасстас сдсдсссЯдсс ддсасаасас дддЕссдаас 720 ааєсеєдсудєд дсассаасуус ддадссстдуа сеЕдсдеЕсаса ассадеЕсСссу Єсоосддаєссд 78о0 асссЕдоаЧчеЕд єЕЄесоЧодЧчаєєє доадєєдсодссд Єссссодадсо асдасасссуд саєстаєссд 840 аєсаасасса дсдсдсаасе дасеєсдсдаа асссасасдд асссдассдд ссдсастсааєс 900 чдсассдєссд дЕсЄссодсаад сассаассдуд СсСсаасааса асдсассдад сеЕссадсдасд 960 аєсдаддссд счдавсьсесу Ессдссудсас сеЕдеЕсдддасе Есссддадса дсеЕдассаєс 1020 басеЕСєдсає серадссудЕсд дадсадсасу садсасаєда аєсаседадЕ єддссаєсде 1080 сЕдвавєсеєвесс дсссдаєєсса дддбасдссд аасасврадса сдсасддбдс сасеаасасд 1140 адсаєсаасс судЕдасусеЕ дсааєссасс адссуєдаєд Есвассубас сдадеЕсстас 1200 дссддсаєса ас арсссдсеЕ дассассссуд дЕсСаасддсуд ЕсссеЕБдудде Ессе єссаає 1260 бдадасдбаасс саседаасад ссеЕдсдЕдЧєЕ СссСЕЕсудседЕеЕ асассаєвдуд Есасассддас 1320 дЕСЧддсасдс аасеЕдЕсеєда сесуддааассі дадсєдссас содааастас сдадсдєссд 1380 аасрасдаає сеЕсасадсса ссуєстЕдеЕсс аасаєссуєс Едаєсаєсд саасассстьд 1440 сдєЕдсдссдд Єдсасадссд дасссаєсудс адсдссдаєс дсасдаасас даєсдссасс 1500 аасаєстаєса сссадаєссс ддсадедааа ддсаасесесєс єдеЕєсаасду садсуєдаєс 1560 адсддЕссад дЕСЕсСассодуд сддеєдассвд деЕдсдссеєда асаасадсдд саасаатаєс 1620 саааассодєд дсбагсаєсда адесссдасеЕ сааєсєсаєса дсасдадсас ссдЕсассдс 1680 дЕССЯєдДЕЕсС дссасуусаєс сдєсасоудссду аєссдсседа дсдЕєсаасвд дддсааєссс 1740 аасаєєеєсєса дсадсаседеЕ сссеєдсвасуд дсдассєсєс Еддасааєеє дсададссде 1800 аасеЕєсддсеЕ аєсеЕсудааад ссдсаасдсс СЕСассадсуд сеасдддсаа ЕДЕЯЯЄтЯЧЕ 1860

ChdEeEsdsaayes Yesadsudaaa EdsdddsdEsS ayesayesedass dYAEEEedadee gayesssoded 1920 (516) assdsdasse Yesdaadsooda dsasschdayesd dadsdeEdsds addaa 1965

"2105 23 "211" 663 "212" Protein "2135 Artificial sequence "220" "223" Sgu1B variant "4005 23

Mee Rgo Bek Avp Akud Guv ABp obi ABp obits Iie I1ie ABp Aza Ua1i 5eg 1 5 10 15

Avp oNiv bek Aza bip Mee Avr Gay bek Gay Avr Aza Agud I1e bij Avr 20 25 30 zek Gets Suv Uai Aia bij Uai Avp AvBp I1e Avr Rgo Rpe Uai1i bBeg Ai1a 35 40 45 zek TPg Uai bip Ts b1u I1і1e Bek Iie Aia siu Agud I1e Gets SsS1i1u Uai 50 55 bo

Tets b1u Mai Rgo Rpe Aia siu sip Gesh Aia bek Rpe Tuk bek Rpe Iey 65 70 75 80

Uai b1u bis Hey Ter Rgo bek b1u Agd Avr Rgo Tgr bij I1e Ribe Mes 85 90 95 bi Niv Uai soi sbip I1ie Uai1 Agud sbip bip I1e TBbg Avr bek Uai Agd 100 105 110

Avr TPg Aza I1e Ai1a Agd Iiep bij s1u Iiets b1u Agud s1u Tug Agd 5eg 115 120 125

Tuk bip bip Aia Gets bitz TBg Ter Gay Avr AvBp Agd ABp Avr Aia Agd 130 135 140 zek Agd Beh I1e I1e Agd siy Agud Tu I1e Aza Gay bij Gay Ar Te 145 150 155 160

Zo TP TrPg Aia I1ie Rgo Gets Rre bBeg Iie Agd Avp bip sbits UMai Rgo GIets 165 170 175

Tecp Mee Uai Tug Aza beep Aza Aza Avp Gay Niv Gay Gay Gay Ietsy Agd 180 185 190

Avr Aia bek Gets Rre b1i1u bek bets Tgr bi1u Mee bek Bek Bek Avr Uai

Z5 195 200 205

Avp obip Tuk Tug bip b1its bi1ip I1e Agud Tuye TP bii bi Tuk Bek Avp 210 215 220

Niv Suv Ua1 sbip Ter Tug Avp o TPg s1iu Gets AvBp AvBp Tetsy Agd s1u TPg 225 230 235 240

Avp o Aia siy bek Tgr Gay Agud Tuk Avp o bip Rbe Agud Agd Avr TIep TEPg 245 250 255

Tets b1u Mai Gay Avr Gesh Uai Aza Gay Rpe Rgo bek Tug Avr TPg Agd 260 265 270

Uai Tuk Rgo Mee Avp TPg bek Aia sip Gay TPg Agud b1itsp I1e Tugye TPg 275 280 285

Avr Rgo I1e bi1u Agd TPg ABp Aza Rgo bek bi1u Rpe Aia Bek TPg Avp 290 295 300

Ter Rpe Avp Avp Avp Aza Rgo bek Ripe beg Aia I1e b1p Azi1a Aza She 305 310 315 320

Rpe Ag Rgo Rgo Niv Gay Gay Avr Rpe Rgo bij sip Gay TPg I1e Tug 325 330 335 zek Aia bek bek Agud Tgr bek bek TPg bip Niv Mee Avp Tuk Ter Uai 340 345 350 bi1u Niv Akd Gay Avp Rpe Agud Rgo Iie siu siu TPkg Hey Avp TPg beg 355 3Z6o 365

TP beep s1u Hey TBg Avp AvBp o Tbg beg I1e AvBp Rgo Ua! TPg Iecch sip 370 375 380

Rpe TPg back Agd Avr Ua1! Tug Agd TPg fight back ABp Aza s1u TPg Avp 385 390 395 400 (516) I1ie Hey Robe TPg TPg Rgo Uai Avp siu Ua1i! Rgo Tgr Aiia Agk9d Rie Avp 405 410 415

Rpe I1ie AvBp Rgo bip ABp I1e Tug bitsh Agkud sb1u Aza TPg TPg Tuk b5eg 420 425 430 bip Rkgo Tuk sbip siu Ua1 s1u Iie sip Hey Rpe Avr bek bits TPg bij 435 440 445

Tem Rgo Rgo fight TPg TBg fight Agud Rgo ABp o Tuk fight back Tug back Niv 450 455 460

Akd Gay back Niv I1e s1u Iiep I1e I1e sb1u ABp TPg Gay Agud Aza Rgo 465 470 475 480

Uai Tuk Bek Ter TPkg Niv Agd Bek Aza TPg Gets TPg ABp o TPg I1e Avr 485 490 495

Rgo bets Agd I1e ABp o bip I1e Rgo Iiets UMaii Gpuv s1u Rpe Agud Ua1i1 Tgr 500 505 510 sbi1u b1u TPg bek Uai Iie TPkg siu Rgo s1iu Rpe TPg siu s1u AvBr I1e 515 520 525

Tem Agud Agud Awp oTPs Rbe siu Avr Ribe Uai! back Hey beep Uaii ABp Pe 530 535 540

AvpobBek Rgo I1e TPg bip Agud Tug Agd Tetsy Agud Rpe Agud Tug Aia 5eg 5eg 545 550 555 560 zek Agud Avr Aia Agud Uaii I1ie Uaii Ieshp TPg sb1u Aza Aza bBeg TPgE schu 565 570 575

Whoa si1u s1u beep Ua1! bek Uaii Avp Mee Rgo Gets bip uv TPpg Mee si1tsi 580 585 590

I1e s1u bets Avp o Tets TPg bek Agd TP Rre Agud Tug TPg Avr Rope 5eg 595 (51048) 605

Avp oRgo Rpe bek Rpe Agud Aia ABp Rgo Avr Ii1e I1e s1u I1e bek s1its 610 615 620 bip Rkgo Hey Rpe siu Aia siu Bek Iie Bek bek siu bets Gets Tug I1e 625 630 635 640

Avr puv Ii1e sbits I1e I1e ieshp Aza ABr Ai1a TPg Rpe si Aia siy 5eg

From 645 650 655

Avr gay biy Agud Aza bip Gu bo «2105 24

З5 «2115» 1989 «2125 ДНК «2135 Штучна послідовність «2205 «223» Кодувальна послідовність варіанту Сгу1В «4005 24 аєдссЕєсаа аєаддааааа Єдадааєдаа асєсаєсаааєд седсаєсдаа Єсаєсссоаса (216) сааасддаєс бассдссада Сдсссдтаєє даадасадсеє єДдЕдеЕдсадс сдадаєдаас 120 аасаєсдаєс сасстєдссадд сдсаєссааса дЕСсСсааасад дсаєсадтає адссддасада 180 агаєєдддсд бастаддеЕдЕ дссуєсвдсе ddasaasastad sradeEveeva hadesessse 240

ЧееЧдоддаае баеддстад содсададае ssasdddaaa СЕСssадда асаесдссзчад Зоо сааассдсаа дасаааас аасддасаде деесадододаста сасдстаеесда есяаеегсадаа 3З6о

ЧдаЕСсаддаа дадоддеаєсад аєсеєсассад саддсесссссд ааасссддсЕс адасаассда 420 ааєчасдсаа чассаадаач саєсаєссучє дачадаєаса ЄсСосеЕсстада асссдасавєєе 480 асрасеєдсса бассдсЕсеє садсасасда аассаададд Ссссаєсаєсєс аасодсаєсає 540 дсЕСаадсед саааєєтсаса ссраєсаєса ссддададасу сасрсссєсесс содсадесдаа 60

ЕдвододаєдеЕ саєсеЕєссда єдеЕсаассаа Саєсассаад аасаааєсад асагсасадад 6бо чаасаєєста ассаєєдсуає асааєддсає аасасадддс Сааасаасосс аададддаса 720 ааєдссдааа чЧЕСсСоЯЧЕСддсо дЕасаасєсаа СЕССЯгадад ассеаасУчєс аддадеаєта 78о0 чаєсвтадедуд сасвтаєєссс аадстаєдас асдсдсдссс асссааєсдаа Сасчзадесдсе 840 садссаасаа дадааассса сСасадаєсса ассдддадаа сааардсасс Ессаддаєтссес 900 чдсаадеасда аєєддеЕєсаа єааєааєсдса ссассЯєсссс ссдссасада ддседссасєсєс 960 бЕсаддссес соддсаєссасе Едаєєсеєсса даасаасеса сааєєсвасад Едсаєсаадс 1020 ( 516) сдєєддадса дсасеєсааса баєдааєсає содоасоддас асаддссваа сеЕсСсдссса 1080 асаддаддда сасрааасрас сєсаасасаа ддасестасса аєвгасасесс ааєсааєсся 1140 дЕаасаєсас адсеЕсасуєс Есдєдасдес сасадаасад ааєссаааєдс адддасааає 1200 асасваєєсвта срасесссьдЕ дааєддадна ссеЕгдддсса дасєсаарсє сасааасссь 1260 садааргаєсе асддааададд сдссассасс басадеЕсаас сдеаєсаддад адеЕєдддаєс 1320 сааєсаєєсу асеєсадааас Єдааєсасса ссадааасаа садаасудасс аааєсаєдаа 1380

Єсаєаєсадес агадаєсаєс єсасасадда сеааєссаєбад дааасасесе дададсасса 1440 дЕСвавеєсьс ддасдсаєсу бадедсаасс сЕсСасаааєа сааєєдаєсс адададааєсяе 1500 ааєсааасас сЕсСЕадсдаа аддаєстада дЕсСЕдоддоада дсассеЕсьдЕ саєсасадда 1560 ссаддаєєса саддадддда баєссеЕссда адаааєсассе ЕсоодЕЧасеЕєс єдесаєсесва 1620 саадесааса Есааєссасс ааєсасссаа адасассуєе Еаадаєсесу Есасусеєссс 1680 адсадддаєд сасдадесває адбаєсааса ддадсдудсає ссасаддаде дддаддссаа 1740

ЧдЕсадеЕдєаа агаєдссесе Есадаааасс аєддаааєсад доададаасесї аасаєстада 1800 асаєєсадає агассуаєвєєсе гадеаарссє СЕсСЕСаєєса дадссааєсс адасаєааєяс 1860 чадаєаадед аасаассесеЕ аєєсддеЕдса дуасЕСТтТаєса деадсоддеЕда асеЕстатваєва 1920 чаєааааєєд аааєсасеєсеЕ адсадаєдса асаєсєдаад садааєсьєда Есгадааада 1980 дсасаааад 19589 «2105 25 «211» 663 «212» Білок «2135 Штучна послідовність «220» «223 » Option Sgu1V "4005 25

Me Rgo Bek Avp Agkud pub Avp obi Avp obits I1e I1e ABp A1ia Uai 5eg 1 5 10 15

Avp oniv bek Aza bip Mee Avr Gets beg ITec Avr Aza Agud I1e b1its Avr 20 25 30

Zo zek Gay Suv Uaii Ai1a bij Uaii Avp Avzp I1e Avr Rgo Rpe Uai bek A1a zek TPg Uai bip Ts b1u I1i1e bek I1e Ai1a s1u Agud I1i1e Gets Ss1u Uai bo

Tets b1u Mai Rgo Rpe Aia siu sip Gesh Aia bek Rpe Tuk bek Rpe Iey 35 65 70 75 80

Uuai s1u bi gay Ter Rgo bek s1u Agud Avr Rgo Tgr bij Iie Rpe Mee 85 90 95 bi Niv Uai siy sbip I1ie Uai1 Agud sbip bip I1e TBbg Avr bek Uai Agd 100 105 110 40 Avr gTP Aza I1e A1i1a Agd Gay bits s1u yeshp Akud s1u Tug Agd 5eg 115 120 125

Tuk bip bip Aia Gets bitz TBg Ter Gay Avr AvBp Agd ABp Avr Aia Agd 130 135 140 zek Agd Beh I1e I1e Agd bij Agud Tugye Iie Aia Gay sats Gets ABr I1e 45 145 150 155 160

TPg TpPg ATa Iie Rgo Gets Robe beg I1i1e Agd ABp bip bits Uai Rgo Ietsy 165 170 175

Tecp Mee Uai Tug Aza bip Aia Aza Ap Gets Nibv Iets Ietsy Ietsp Ietsp Ag4d 180 185 190 50 Avr Aia bek ITey Rpe siu bek bij Ter sbiu Mes Bek bek bek Avr Uai 195 200 205

Avp obip Tuk Tuk bip b1ish bi1ip I1e Agud Tuye TPgE bij bij Tuk bek Avp 210 215 220

Niv Suv Ua1 sbip Ter Tug Avp o TPg s1iu Gets AvBp AvBp Tetsy Agd s1u TPg 55 225 230 235 240

Avp Aza siy bek Tgr Tets Agud Tug Avp bip Rpe Agud Agud Avr Gay TEG 245 250 255

Tets b1u Mai Gay Avr Gesh Uai Aza Gay Rpe Rgo bek Tug Avr TPg Agd 260 265 270 (516) TPE Tuk Rgo I1ie AvBp TPg bek Aia bip Gay TPg Agud bij I1e Tuye Tig 275 280 285

Avr Rgo I1e bi1u Agd TPg ABp Aza Rgo bek bi1u Rpe Aia Bek TPg Avp 290 295 300

Ter Rpe Avp Avp Avp Aza Rgo bek Rpe bBeg Aia I1e b1p Azi1a Aza She 305 310 315 320

Rpe Ag Rgo Rgo Niv Gay Gay Avr Rpe Rgo bij sip Gay TPg I1e Tug 325 330 335 zek Aia bek bek Agud Tgr bek Bek TPg bip Niv Mee Avp Tuk Ter Uai 340 345 350 bi1u Niv Akd Gay Avp Rpe Agud Rgo Iie siu siu TPkg Hey Avp TPg beg 355 360 365

TP beep s1u Hey TBg Avp AvBp o TBbg beg I1e AvBp Rgo Ua! TPg Iecch sip 370 375 380

Rpe TPg back Agd Avr Ua1! Tug Agd TPg fight back ABp Aza s1u TPg Avp 385 390 395 400

I1ie Hey Do TPg TPg Rgo Uai Avp siu Ua1! Rgo Tgr Aiia Agk9d Rie Avp 405 410 415

Rpe I1ie AvBp Rgo bip ABp I1e Tug bitsh Agkud sb1u Aza TPg TPg Tuk b5eg 420 425 430 bip Rkgo Tuk sbip siu Ua1 s1u Iie sip Hey Rpe Avr bek bits TPg bij 435 440 445

Tecp Rkgo Rgo battle TPg Tpg battle Agud Rgo Up o Tug bis back Tug back Niv 450 455 460

Akd Gay back Niv I1e s1u Iiep I1e I1e sb1u ABp TPg Gay Agud Aza Rgo 465 470 475 480

Ua1i1 Tuk Bek Ter TPg Niv Agud bek Aza TPkg Gay TiPg ABp o TPg I1e Avr 485 490 495

Rgo bits Agd I1e ABp o bip I1e Rgo Iiets UMaii Gpuv s1u Rpe Agud Ua1i1 Tgr 500 505 510 sbi1u b1u TPg bek Uai Iie TPkg siu Rgo s1iu Rpe TPg siu s1u AvBr I1e

From 515 520 525

Tets Agud Agkud Avp o TpPg Rpe siu Avr Rpe Ua1i bek Gay sip Uai ABp I1e 530 535 540

AvpobBek Rgo I1e TPg bip Agud Tug Agd Tetsy Agud Rpe Agud Tug Aia 5eg 5eg 545 550 555 560 vek Ag Avr Aia Agud Uai Iie Uaiyi Hey TBg s1u Azi1a Aza bek Tbg 01Uu 565 570 575

Whoa si1u s1u beep Ua1! bek Uaii Avp Mee Rgo Gets bip uv TPpg Mee si1tsi 580 585 590

I1e s1u bets Avp o Tets TPg bek Agd TP Rre Agud Tug TPg Avr Rope 5eg 595 (51048) 605

Avp oRgo RiPe bBeg Rore Agud A1i1a ABp Rgo ABr I1e I1e s1u Iie bek sitz 610 615 620 bip Rkgo Hey Rpe siu Aia siu Bek Iie Bek bek siu bets Gets Tug I1e 625 630 635 640

Avr puv Iie bij I1e I1ie Hey Aza AvBr Aia TPg Rpbe bij Aza bij 5beg 645 650 655

Avr gay sitc s1u Aia Agd Gu bo "2105 26 "211" 1989 "212" DNA "2135 Artificial sequence "2205 "223" Coding sequence of Sgu1B variant "4005 26 aedssEesaa aeaddaaaa Yedadaasdaa assasaaasdd sedsaesdaa Yesaessaessaae (216) (516) ddaadayeadse YedEdsdEads sdaddayedaas 120 aasaeedayes saeeevedeEsad sodsayesaasa dsssaaasad dsassadsae adssddsada 180 agaeeeddaddsda bastaddeEdE dssuyesvdse ddasaasastad sradeEeeEsesa radseEsesyss 240

ЧееЧдоддаае баеддстад содсададае ssasdddaaa СЕСssадда асаесдссзчад Зоо сааассдсаа дасаааас аасддасаде деесадододаста сасдстаеесда есяаеегсадаа 3З6о

ЧдаЕСсаддаа дадоддеаєсад аєсеєсассад саддсесссссд ааасссддсЕс адасаассда 420 ааєчаєсдсаа чассаадаач саєсаєссдє дададчасбсасба ЕЄдсеЕєсада асеЕсдасасєсяе 480 асрасеєдсса бассдсЕсеє садсасасда аассаададд Ссссаєсаєсєс аасодсаєсає 540 дсЕСаадсед саааєєтсаса ссраєсаєса ссддададасу сасрсссєсесс содсадесдаа 60

ЕдвододаєдеЕ саєсеЕєссда єдеЕсаассаа Сассассаад аасааассад асасасадад 6бо чаасаєєста ассаєєдсуає асааєддсає аасасадддс Сааасаасосс аададддаса 720 ааєдссдааа чЧЕСсСоЯЧЕСддсо дЕасаасєсаа СЕССЯгадад ассеаасУчєс аддадеаєта 78о0 чаєсвтадедуд сасвтаєєссс аадстаєдас асссдсасес асссааєссаа Сасчзадесдсе 840 садссаасаа дадааассса сСасадаєсса ассдддадаа сааардсасс Ессаддаєтссес 900 чдсаадеасда аєєддеЕєсаа єааєааєсдса ссассЯєсссс ссдссасада ддседссасєсєс 960 бЕсаддссес соддсаєссасе Едаєєсеєсса даасаасеса сааєєсвасад Едсаєсаадс 1020 сдєєддадса дсасеєсааса баєдааєтає єдодЕдддас асаддссваа сеЕсСсдссса 1080 асаддаддда сасрааасрас сєсаасасаа ддасестасса аєвгасасесс ааєсааєсся 1140 дЕаасаєсас адсеЕсасуєс Есдєдасдес сасадаасад ааєссаааєдс адддасааає 1200 асасваєєсвта срасесссьдЕ дааєддадна ссеЕгдддсва дасеєсаарс гагааассся 1260 садааргаєсе асддааададд сдссассасс басадеЕсаас сдеаєсаддад адеЕєдддаєс 1320 сааєсаєєсд асеєсадааас єЄдааєсасса ссадааасаа садаасдасс аааєсаєдаа 1380

Єсагаєсадес агадаєсаєс єсаєаєсадда сегааєссаєбад дааасасеьсе дададсасса 1440 дЕСТвавеєсьс ддасдсаєсу гадедсаасс сеЕгасаааса сааєєдаєсс адададаасье 1500 ааєсааасас сЕсСЕадсдаа аддаєстада дЕсСЕдоддоада дсассеЕсьдЕ саєсасадда 1560 ссаддаєєса саддадддда баєссеЕссда адаааєсассе ЕсоодЕЧасеЕєс єдесаєсесва 1620 саадессааса єсааєссасс ааєсасссаа адасассууєє єаадасеєссу сгасусессс 1680 адсадддаєд сасчдадесває адгаєсааса ддадсудсає ссасаддадеі дддаддссаа 1740

ChdEsadeEdeaa agaedssese Esadaaaaass aeddaaaesad doadadaasesi aasaestada 1800 asaeesadae agassuaeveeese gadeaarsse SEsSESaeesa dadssaaeess adasayeaaaeyas 1860 chadaeaaded aaaasseseseE aseysdddeedsa ddEsESsSsayeta deadsudeEda asEesaesayesa 1920

Зо чаесааааеед аааесасеесеE adsadaedsa asаесаседаад sadааесада есSeadaad9ad 1980 chdsasoddaad 1989 «2105 27 «211» 663

C5 "212" Protein "2135 Artificial sequence "220" "223" Variant Sgu1B 40 "4005 D 27

Me Rgo Bek Avp Agkud pub Avp obi Avp obits I1e I1e ABp A1ia Uai 5eg 1 c) 10 15

Avp oNiv bek Aza bip Mee Avr iets beg Ietsy Avr Aza Agud I1i1e bij Avr 45 20 25 30 zek Gets Suv Uai Aia bij Uai Avp AvBp I1e Avr Rgo Rpe Uai1i bBeg Ai1a zek TPg Uai bip TPg sb1u Iie ABp I1e Aza s1u Agu Ii siu Uai z9 (210) 50 Tem biu Maii Rgo Rpe Aia siu bip Gay A1ia bek Rpe Tugk bek Rre Gay 65 70 75 80

Uuai s1u bij hei Ter Rgo bek s1iu Agud Avr Rgo Tgr b1p I1e Rpe Mee 85 90 95 bi Niv Uai soi sbip I1ie Uai1 Agud sbip bip I1e TBbg Avr bek Uai Agd 100 105 110

Avr TPg Aza I1e Aza Agd Iiep bis s1u Iiets b1u Agud s1u Tug Agd 5eg 115 120 125

Tuk bip bip Aia Gets bitz TBg Ter Gay Avr AvBp Agd ABp Avr Aia Agd 130 135 140 (516) zek Ak bek I1e I1e Gay siy Agud Tug Iie Aia ep siy Gay ABr Pe 145 150 155 160

TPg TpPg ATa Iie Rgo Gets Robe beg I1i1e Agd ABp bip bits Uai Rgo Ietsy 165 170 175

Tecp Mee Uai Tug Aza bip Aia Aza AvBp Gay Niv Gay Gay Gets Te Agd 180 185 190

Avr Aia bek ITey Rpe siu bek bii Ter sbiu Mes Aza bek bek Avr Uai 195 200 205

Avp obip Tuk Tug bip b1its bi1ip I1e Agud Tuye TP bii bi Tuk bek Avp 210 215 220

Niv Suv Ua1 sbip Ter Tug Avp o TPg s1iu Gets AvBp AvBp Tetsy Agd s1u TPg 225 230 235 240

Avp Aia soi bek Tgr Tets Agud Tut Avp o bip Rpe Agud Agud Avr Gay TEG 245 250 255

Tets b1u Mai Gay Avr Gesh Uai Aza Gay Rpe Rgo bek Tug Avr TPg Agd 260 265 270

TPE Tuk Rgo I1ie AvBp TPg back Aza sbip Gay TBPg Agud bij I1e Tuye Tig 275 280 285

Avr Rgo I1e bi1u Agd TPg ABp Aza Rgo bek bi1u Rpe Aia Bek TPg Avp 290 295 300

TER Rpe Avp Avp Avp Aza Rgo back Ripe beg Aza I1e bij Aza Aza Te 305 310 315 320

Rpe Agud Rgo Rgo No Ietsyp Gay Avr Robe Rgo bij Sip Gay TPg I1e Tug 325 330 335 zek Aia bBekg bek Agud Tgr bek bek TPg bip Niv Mesie Avp Tug Tgr Uai 340 345 350 si1u Niv Agd Getsch Ap Ribe Agud Rgo I1e s1u s1iu TPg Gay ABp TPgE 5eg 355 3Z6o 365

TPg bip s1iu Gets TBg Avp AvBp oTBg bek Iie Avp Rgo Ua1 TPg Gets sip 370 375 380

Rpe TPg back Agd Avr Ua1! Tug Agd TPg battle back ABp Aza s1u TPg Avp

From 385,390,395,400

I1e Getsp Robe TPg TPg Rgo Uai Avp siu Uai Rgo Ter Aia Agd Robe Avp 405 410 415

Rpe I1ie AvBp Rgo bip ABp I1e Tug bitsh Agkud sb1u Aza TPg TPg Tuk b5eg 420 425 430 sbip Rgo Tuk bip siu Uai siu I1e sbip Gay Robe Avr bek bij TPpk s1tsi 435 440 445

Tecp Rkgo Rgo battle TPg Tpg battle Agud Rgo Up o Tug bis back Tug back Niv 450 455 460

Akd Gay back Niv I1e s1u iep Iie I1e s1u Avp TPg Gay Agd Aia Rgo 465 470 475 480

Uai Tuk Bek Ter TPkg Niv Agd Bek Aza TPg Gets TPg ABp o TPg I1e Avr 485 490 495

Rgo bis Agd I1e ABp obip I1e Rgo Gay Uai Gpuv s1u Rpe Agud Ua1i1 Tgr 500 505 510 siu bi1u TPg Bek Uai I1ie TPg s1u Rgo sb1u Rpe TPg siu sb1u ABr Pe 515 520 525

Tets Agud Agkud Avp o TPg Rpe siu Avr RiPe Ua1i bek Gay sbip Uai ABp I1e 530 535 540

AvpobBek Rgo I1e TPg bip Agud Tug Agd Tetsy Agud Rpe Agud Tug Aia 5eg 5eg 545 550 555 560 zek Agud Avr Aia Agud Uaii I1i1e Uaii Ieshp TPg sb1u Aza Aza bBeg TPgE schu 565 570 575

Whoa si1u s1u beep Ua1! bek Uaii Avp Mee Rgo Gets bip uv TPpg Mee si1tsi 580 585 590

Iie s1u bij Avp Gay TPg bek Agud TPg Rbe Agud Tuk TPg Avr Robe 5eg 595 bo 605

Avp oRgo RiPe bBeg Rore Agud A1i1a ABp Rgo ABr I1e I1e s1u Iie bek sitz 610 615 620 bip Rkgo Hey Rpe siu Aia siu Bek Iie Bek bek siu bets Gets Tug I1e (516) 625 630 635 640

Avr puv Ii1e sbits I1e I1e ieshp Aza ABr Ai1a TPg Rpe si Aia siy 5eg

645 650 655

Авр гей сіц пув Аїа біп Гув бо «2105 28 «2115» 1989 «2125 ДНК «2135 Штучна послідовність «220» «223» Кодувальна послідовність варіанту Сгу1В «4005 28 аєдссЕєсаа аєаддааааа єЄдадаасдаа ассасаааєсд ссдсаєссдаа Ссаєссссдса (216) сааасочаєс сСаєсудсстада Едсеєсдраєс ддаадаєадсе ЄдЕдсдЕадс сдаддаєдаас 120 аасаєєдаєс саєєеєдеЕсад содсаєсааса дсссааасодд дсассаасає адссддсада 180 асасвєаддсд басгаддудЕ дссдєсЕдсе ддасаастад срадеЕеЕсеса радсеЕсесьс 240 чЧЕєдодддаає баєддсстад сододсададчає ссаєддадааа ЄЕЕеЕваєдда асаєдессдад Зоо сааассдсаа дасаасааас аасддасаде деЕсадододаста ссдстаєєсдс єсЯаєегсадаа 3З6о

ЧдаЕСєаддаа чаддчдєасад аєсссассад саддсеєсссду ааасеєсодЧчЕеЕс адасаассда 420 ааєчдаєдсаа даєсаадаад саєсасєссєс дадсдссаса СсСдсЕссада асссдасаєсс 480 асрасеєдсса бассдсЕсеє садсасасда аассаададд Ссссаєсаєєс дасодсагсає 540 дсЕСаадсед саааєєтсаса ссраєсаєса ссддададасу сасрсссєсесс содсадесдаа 60

Едводдодаєдуда саєсєєссда єЄдДдеЕсаассаа бассассаад аасаааєссад асбсасасадад 6бо чаасгасєста ассаєєдсує асаасдудєає аасасадддс Єаааєаасес аададоадаса 720 ааєдсеЕдааа чЧЕЄЧЯЧЕєєдсоЯ деаєааєсаа СсСссоасадад асссаасЯаєс аддддсаєса 78о0 чаєєвсадевад ссстраєєссс аадстаєдає асссдсасес асссааєссаа Сасчзадесдсес 840 садссаасаа дадааассса сСасадаєсса аєсдододадаа сааасдсасс сссадчЧассс 900 чдсаадеасда аєєддеЕєсаа єааєааєсдса ссассЯєсссс ссдссасада ддседссасєсєс 960

Зо сЕСаддссеЕсС соасаєссасеЕ єдаєєсеєсса даасаасеса сааєстасад єдсаєсаадс 1020 сдєЕддадса дсасеЕсааса баєдааєтає єдодЕдоддас асаддсесаа сеЕєссдссса 1080 асаддаддда сасрааасрас сєсаасасаа ддасестасса аєвгасасесс ааєсааєсся 1140 дЕаасаєсас адсеЕсасуєс Есдєдасдес сасадаасад ааєссаааєдс адддасааає 1200 асасваєєсвта срасесссьдЕ дааєддадна ссеЕгдддсва дасеєсаарс гагааассся 1260 сачдаагаєсє асоааададд сдссастасс СасадеЕсаас сдбаєсадда адеЕсоддваєсє 1320 сааєсаєєсу асеєсадааас Єдааєсасса ссадааасаа садаасудасс аааєсаєдаа 1380

Єсагаєсадес агадаєсаєс єсаєаєсадда сегааєссаєбад дааасасеьсе дададсасса 1440 дЕСвавеєсьс ддасдсаєсу гадедсаассї сЕсСасаааєса сааєєдаєсс адададаась 1500 ааєсааасас сЕсСЕадсдаа аддаєстада дЕсСЕдоддоада дсассеЕсьдЕ саєсасадда 1560 ссаддаєєса саддаддадда баєссеЕссда адааасассяє ЕсСодеЕЧдасеЕс сдсаєсеєста 1620 саадесааса Есааєссасс ааєсасссаа адасассуєе Еаадасессу сгасудсессс 1680 адсадддаєд сасчдадесває адгаєсааса ддадсудсає ссасаддадеі дддаддссаа 1740

ЧдЕсадеЕдєаа агаєдссесе Есадаааасс аєддаааєсад доададаасесї аасаєстада 1800 асаєєсадає агассуаєвєєсе гадеаарссє СЕсСЕСаєєса дадссааєсс адасаєааєяс 1860 чдадаєаадед аасаассеЕсеЕ асєсддеЕдса доасЕСТтТаєса деадсоддеЕда асеесаєсаєса 1920 чаєааааєєд аааєсасеєсеЕ адсадаєдса асаєсєдаад садааєсьєда Есгададааа 1980 дсЕсадааа 1989 «2105 29 «2115» 663 «212» Білок «2135 Штучна послідовність «220» «223 » Option Sgu1V "4005 29

Me Rgo Bek Avp Agkud pub Avp obi Avp obits I1e I1e ABp A1ia Uai 5eg 1 c) 10 15 (516) Avp oNiv bek Aia bip Mee Avr Gay bek iey AvBr Aia Agud I1e bij Avr 20 25 30 zek Gets Suv Uai Aia bij Uai Avp AvBp I1e Avr Rgo Rpe Uai1i bBeg Ai1a 35 40 45 zek TPg Uai bip TPg sb1u Iie bek I1i1e Aza s1u Agud Iie Hey siu Uai 50 55 bo

Tem biu Maii Rgo Rpe Aia siu bip Gay A1ia bek Rpe Tugk bek Rre Gay 65 70 75 80

Uuai s1u bi gay Ter Rgo bek s1iu Agud Avr Rgo Tgr bitsh I1e RPe Gay 85 90 95 bi Niv Uai siy sbip Gay I1ie Agud sbip bip Uai1 Tbg bij Avp TBbg Agd 100 105 110

Ap oTpg Aza I1e Aza Agd Iiep bis s1u Iiets b1u Agud s1u Tug Agd 5eg 115 120 125

Tuk beep beep Aia Gets bitz TBg Ter Gay Avr AvBp Agd ABp Avr Aia Agd 130 135 140 zek Akd bek I1e I1e Hey siy Agud Tug Uai! Aia ep siy Gay ABr I1e 145 150 155 160

TPg TpPg ATa Iie Rgo Gets Robe beg I1i1e Agd ABp bip bits Uai Rgo Ietsy 165 170 175

Tecp Mee Uai Tug Aza beep Aza Aza Avp Gay Niv Gay Gay Gay Ietsy Agd 180 185 190

Avr Aia bek Gets Rre bi1u bek bets Tgr bi1u Mee bek bBeg Aia Avr Uai 195 200 205

Avp obip Tuk Tug bip b1c b1ip I1e Agud Tuye TP bii bi Tuk Bek Avp 210 215 220

Niv Suv Uaii sip Ter Tug AvBp TPg b1iu Gay Avp AvBp Te Agd s1Uu Tig 225 230 235 240

Avp Asia fight back Ter Tets Agud Tut Avp o bip Rpe Agd Agud Avr Gay TEPg 245 250 255

Tets b1u Mai Gay Avr Gesh Uai Aza Gay Rpe Rgo bek Tug Avr TPg Agd

From 260 265 270

TPg Tuk Rgo Iie Avp TPg bek Aza sbip Gets TBg Agd b1cp I1e Tugye TPg 275 280 285

Avr Rgo I1e bi1u Agd TPg ABp Aza Rgo bek bi1u Rpe Aia Bek TPg Avp 290 295 300

Ter Rpe Avp Avzp Avp ATia Rgo bek Rre bek Aza Iie sbits Aza Aia I1e 305 310 315 320

Rpe Agud Rgo Rgo No Ietsyp Gay Avr Robe Rgo bij Sip Gay TPg I1e Tug 325 330 335 zek Aia bBekg bek Agud Tgr bek bek TPg bip Niv Mee Avp Tuk Ter Uai 340 345 350 bi1u Niv Akd Gay Avp Rpe Agud Rgo Iie siu siu TPkg Hey Avp TPg beg 355 3Z6o 365

TPg bip s1iu Gets TBg Avp AvBp oTBbg beg I1e ABp Rgo Uai TPg Gets sip 370 375 380

Rpe TPg bek Agud Avr Ua! Tug Agud TPg bij bBeg ABp Aia s1u TBPg Avp 385 390 395 400

I1e Getsp Robe TPg TPg Rgo Uai Avp biu Maii Rgo Tgr Aza Agd Robe Avp 405 410 415

Rpe I1ie AvBp Rgo bip ABp I1e Tug bitsh Agkud sb1u Aza TPg TPg Tuk b5eg 420 425 430 bip Rkgo Tuk sbip siu Ua1i s1u Iie sip Hey Rpe Avr bek bij TPpg s1tsy 435 440 445

Tecp Rkgo Rgo battle TPg Tpg battle Agud Rgo Up o Tug bis back Tug back Niv 450 455 460

Agd Gay back Niv I1ie si1u Gay Iie Iie s1u ABp TPg Gay Agud Az1a Rgo 465 470 475 480

Uai Tuk Bek Ter TPkg Niv Agd Bek Aza TPg Gets TPg ABp o TPg I1e Avr 485 490 495

Rgo bitz Agud I1e ABp o bip I1e Rkgo Iets Maiii Ppuv siu Ribe Agd Ua1! Tgr 60 500 505 510 sbi1u b1u TPg bek Uai Iie TPkg siu Rgo s1iu Rpe TPg siu s1u AvBr I1e

515 520 525

Tets Agud Agud Avp o TpPg Rpe siu Avr Rpe Uai bek Iiets bip Uai ABp She 530 535 540

AvpobBek Rgo I1e TPg bip Agud Tug Agd Tetsy Agud Rpe Agud Tug Aia 5eg 5eg 545 550 555 560 zek Agud Avr Aia Agud Uaii I1i1e Uaii Iieish TPg s1iu Aia Aza besg TPg 01U 565 570 575

Whoa si1u s1u beep Ua1! bek Uaii Avp Mee Rgo Gets bip uv TPpg Mee si1tsi 580 585 590

Iie s1u bij Avp Gay TPg bek Akud TBg Rre Agud Tug TBg Avr Rre 5eg 595 (51048) 605

Avp oRgo RiPe bBeg Rore Agud A1i1a ABp Rgo ABr I1e I1e s1u Iie bek sitz 610 615 620 bip Rkgo Hey Rpe siu Aia siu bek I1i1e bek bek biu bicp Iep Tu She 625 630 635 640

Avr puv Ii1e sbits I1e I1e ieshp Aza ABr Ai1a TPg Rpe si Aia siy 5eg 645 650 655

Avr gay bij Agud Aza bip Gu bo "2105 30 "2115" 1989 "2125 DNA "2135 Artificial sequence "220" "223" Coding sequence of Sgu1B variant "4005 30

Зо асдсссссаа аєаддааава Сдадаасдаа ассасааасуд ссдваєсєсдаа єсасессдса (216) сааасддаєс сассдссада Сдсссдсбасс даадасадсс сдсдсдсадс сдаддеєдаас 120 аасаєєдаєс саєєвєдеЕсад содсаєсааса дсссааасад дсассадсає адссддсада 180 агаєєддаддсда бастаддеЕдЕ дссуєсвдсе ддасаастад срадеЕеЕсеса радсеЕсесьс 240

ЧееЧdoddaae bayeddsstad sodsadade ssasdddaaa SESssSssddda asayesdessvaa Zoo saasstasaa dasaasaads aasadaagae assadddaasa soodstassds Ssoastsadaa 3Z6o

ЧдаЕСсаддаа даддстаєсад аєсеєсассад саддсесссссд ааасссддсЕс адасаассда 420 ааєдаєдсаа даєсаадаад саєсасєссєс дадсдссаєд ССдсеЕссада асссдасасєєс 480 асрасеєдсса бассдсЕсеє садсасасда аассаададд Ссссаєсаєсєс аасодсаєсає 540 дсЕСаадсед саааєєтсаса ссраєсаєса ссддададасу сасрсссєсесс содсадесдаа 60

Еддоддаєдс сассєдссда СдЕсСаассаа баєсассаад аасаааєсад абасасадад 6бо чаасаєєста ассаєєдсуає асааєддсає аасасаддадс баааєсаасес аададоадаса 720 ааєдсеЕдааа чЧЕЄЧЯЧЕєєдсоЯ деаєааєсаа СсСссоасадад асссаасЯаєс аддддсаєса 78о0 чаєєвсадевад ссстраєєссс аадстаєдас асссдсасес асссааєссаа Сасчзадесдсес 840 садссаасаа дадааассса сСасадаєсса ассдддадаа сааардсасс Ессаддаєтссес 900 чдсаадсасда аєсддеЕссаа Саасаасдса ссассЯєссеЕ ссдссасбада доасєдссатєе 960 бЕсаддссес соддсаєссасе Едаєєсеєсса даасаасеса сааєєсвасад Едсаєсаадс 1020 сдєЕддадса дсасеЕсааса баєдааєтає єдодЕдоддас асаддсесаа сеЕєссдссса 1080 асаддаддда саєсрааасас сссаасасаа ддасеЕсаста асаасасеєс аасеааєссь 1140 дЕаасаєсас адсеЕсасуєс Есдєдасдес сасадаасад ааєссаааєдс адддасааає 1200 асасваєста срассссвдЕ дааєддадса ссеєдоддсса дасєсааєст гаєааассся 1260 садааргаєсе асддааададд сдссассасс басадесаас сдеаєсададч адеЕсддаддаєсє 1320 сааєсаєєсу асеєсадааас Єдааєсасса ссадааасаа садаасудасс аааєсаєдаа 1380

Єсагаєсадес агадаєсаєс єсаєаєсадда сегааєссаєбад дааасасеьсе дададсасса 1440 дЕСвавеєсьс ддасдсаєсу бадедсаасс сЕсСасаааєа сааєєдаєсс адададааєсе 1500 ааєсааасас сеЕсСсадсдаа адчаєєсада дЕсСЕдодоадуа дсассестьудЕ саєсасадва 1560 ссаддаєєса саддадддда баєссеЕссда адаааєсассе ЕсоодЕЧасеЕєс єдесаєсесва 1620 саадесааса Есааєссасс ааєсасссаа адасассуєе Еаадасессу сгасудсессс 1680 адсадддаєд сасчдадесває адгаєсааса ддадсудсає ссасаддаде додаддссаа 1740

ЧдЕсадеЕдєаа агаєдссесе Есадаааасс аєддаааєсад доададаасесї аасаєстада 1800 (516) асаєєсадає асассдаєсє гадсаарссє СЕСсСЕСаєєса дадссааєсс адасаєааєсс 1860 чадаєаадед аасаассесеЕ аєєсддеЕдса дуасЕСТтТаєса деадсоддеЕда асеЕстатваєва 1920 чаєааааєєд аааєсасеєсеЕ адсадаєдса асаєсєдаад садааєсьєда Есгадааада 1980 дсасаааад 1989 «2105 31 «2115 655 «212» Білок «2135 Штучна послідовність «220» "223" Variant of Sgu1B "4005 31

Me Rgo Bek Ap Agkud pub Avp obi Avp obits I1e I1e ABp Aza Iets 5eg 1 5 10 15

I1ie Rgo Aia Uai bek Avp Niv bek Aia bip Mes Avr Gay bek Ietsy Avr

Aza Agkud ch11e bis Avr bek ITep Suv I1e Ai1a bij s1u AvBp Ap I1e Avp

Rkgo Gets Uai bek Aza bek TPg Uai bip TPg sb1u I1ie ABp I1e Aia 0Щ1U 20 50 55 bo

Akud I1e Ggets siu Uaiii Iets b1u Uai Rgo Rpe Aza s1u sip Gay Aia 5eg 65 70 75 80

Rpe Tuk bek Rrpe I1e Uai s1u bis Ietsy Tegr Rgo Bek b1u Agd Avr Rgo 85 90 95 25 TEr bis Iie Rpe Mee sits No Uai bi sbip Gay Uai Agud sip Niv I1e 100 105 110

TP bets Avp Aza Agud ABp Ts Aza Gets Aza Agd Te sip s1u Gesh SHU 115 120 125

Aza bek Ripe Agud Aia Tuk bip bip bek ITets bij Avr Tgr Gay bij Avp

From 130 135 140

Ak Avr Avp Aza Agud TPg Agud bBeg Uaii Ietsy Tug TPg sbip Tug Ii1e Ai1a 145 150 155 160

Tets b1ip Hey Avr Rpe Hey Avp Aza Mee Rgo Hey Robe Aza I1e ABpP AvBp 165 170 175 35 sip beep Mai Rgo Hey Hey Mes Uai! Tug Aza sbip Aia Aza ABp Gay Niv 180 185 190

Tets IGecp Gay Gay Agud Avr Aza bek Gay Rpe siu bek siy Ribe SsS1Uu Iey 195 200 205

TPg Bek bip siy I1ie bip Agd Tug Tug bis Agd bip Asi1a b1py Guv Ts 40 210 215 220

Akud bij Tuk bek Avr Tuk Suv Aia Agd Tgr Tug ABp TpPg o1u Gay Avp 225 230 235 240

Ap oh hey Agud biu TBg ABp Aza bitz bek Tegr Hey Agud Tug Avp bip Re 245 250 255 45 Agud Agud Art tey TPg Hey s1iu Uaii Hey Avr Tets Uai Aia Hey Robe Rgo 260 265 270 zek Tug Avr TPg Agud I1e Tug Rgo I1e ABp TPg back Aza sbip Gay TAG 275 280 285

Akud bij I1e Tug TBg Avr Rgo I1e s1u Agd TPg ABp Aza Rgo Beh 0Щ1U 290 295 300

Rpe Aia bek TPg Avp o Tegr Rpe Avp AvBp ABp Aza Rgo Bek Rppe beg Ai1a 305 310 315 320

Iie sbits Aza Aza I1e Rpe Agud Rgo Rgo No IYetsp Gay Avr Rpe Rgo sats 325 330 335 sip Gay TPg Iie Tuk bek Aza bek bek Agud Tgr bek bek TPg sbip Niv 340 345 350

Mee Avp Tug Ter Ua1 si1u No Agd Gay Avp Do Agd Rgo I1e Ni5v Sh1U 355 3Z6o 365

TPE gay Avp o TBbg bek TPg Ni siu Aia TPg AvBp oTPg bek I1e ABp Rgo (516) 370 375 380

Uai TpPg ge bip Rbe TPg bek Agud Avr Ua1i Tut Agd TPg bij bek Tug

385 390 395 400

Aza si1u I1e AvBp I1e Iietsy Gay TPg TBPg Rkgo Uai Avp s1iu Ua1 Rgo Tgr 405 410 415

Aza Akud Rpe Avp o Tgr Agud ABp oRgo Tets AvBp bek Gay Agud siu Bek Iets 420 425 430

Tecp Tuk TPpg I1ie s1u Tuk TPg siu Uai s1u TpPkg sip Gay Ribe Avr 5eg 435 440 445 bi TpK bij Gay Rgo Rgo bij TPg Tpg bij Agud Rgo Avp Tug bis beg 450 455 460

Tuk Bek Niv Akud Gay bBeg AvBp I1e Agd Gay I1ie I1e bBeg Avp TPkg Iets 465 470 475 480

Akud Aza Rgo Ua1! Tuk bek Tgr TPg No Agud bek Aza Avr Agd TPg Avp 485 490 495

TPgE Iie Aza TPg Ap I1e I1e TPg sip I1e Rgo Ai1a Uai Gguv S1u Avp 500 505 510

Rpe Gay Ribe Avp o biu bek Uai I1e bek b1u Rgo s1u Rpe TPgE s1u schu 515 520 525

Avr Gay Uai Agd Tets Avp AvBp o beg biu AvBp ABp I1e Tug ABp Agd 01U 530 535 540

Tuk Iie soi Uai Rgo I1e sbip Rpbe I1ie bek TPg bek TPg Agd Tuk Agd 545 550 555 560

Uai Akud Uai Agu Tug Aia bek Ua1i TPg Rgo I1e Agd Iets bek Ua1i1 Avp 565 570 575

Ter b1u Avp Bek Up I1e RiPe bek beg I1e Ua! Rgo Ai1a TPg Asia TPg 580 585 590 zek Gay Avr AvBp o Tets bip bek Agd AvBp Rpe b1u Tuk Rpe bis beg Agd 595 (51048) 605

Ap Aza Ripe TPg bek Aza TPg biu AvBp Uai Uai siu Uai Agd Avp Re 610 615 620

Zo zek bi Avp Aia si1u UMai Iie chI1e Avr Akud Rpbe si Rpe I1e Rgo Uai 625 630 635 640

TPgE Aia TPg Rbe bitz Aza bitzsh Tug Avr Getz bitz Agd Aza sip si 645 650 655 "2105 32 "2115" 1968 "2125 DNA "2135 Artificial sequence "2205 "223" Coding sequence of Sgu1V variant "4005 32 assssssssssssssssssssssss (216)

Essaassass ssdsudsadaye ddasseysssa seddasusss dsayesdadda sesaseyestsds 120 ayesdssdadd dsaasasaye saasssdsss deEsadsdsese sdassudyedsa daseddsayes 180 aasayesdsssd dESYadsavbase soddsoasssos ddadssssaye sSssdsaddessa dsgddsdads 240

BbESvasadse essayesdeyesodd sdadssssdda ssayessaddes dsdayessstd ddadasseess Zoo ayeddadsasud YesdadsadseE ddiesaddsad sasayessasducha adaasdsssud saasasddse 3Z6o sESsSdssadas Sssaaddsso soudadssads gEsadadsse assadsadss sseEsdaddwas 420

Еддсеєсдада ассдсдасаа содсдаддасс сддадсдссс Сссасассса дгсасаєсдсд 480 седдадсссд асссссодаа сдсдаєрдсса сеЕсЕссдсса саасаасса дсаддедссд 540 сеЕссссасдда сссасдссса адссдссаас ссссассссс сдссссссад адасдстгадс 60 срдеЕссддса дсдадсссдд асссасудссуд саддадаєсс адсдстраста сдадсдссад 6бо чдсддадаада сссдоддадста садсдассас СдсдсасудсЕ ддгасаасас соуддссеєдаас 720 аассеєдсдсд дсасдаасдс єдададссдд ссссдссаса ассадссссд садддассес 78о0 асасеєсддад ЄссЕСсСдассяє садєсоасдссд сссссдадсс асдасасдсуд даєсєсстасссд 840 аєсаасасда dsdsdsadse saseyesdsdad asssasasducha assssayesesduda Yesdsasddaas 900 dsEssayessd dsEeEsdssesS sassaassdud SsSsaasasa asdsdssdss dEssadsdss 960 (516) ayesdaadsvd saayersesssu sssassesas sedssdddase Esssadadsa dseEsassaes 1020

BasadsdsseE ssadssodsbd deEssadsasud sadsasayeda assassdddI sddssassds 1080 sesaassssa ddsssasssa sddsasssos aasasssda sssasddsds sasdaasasd 1140

Essayesaass sudEdasuse ssadessasud adssdddasud Eswassudsas Yedadadstas 1200 chdsEdsayesa asayesssdseE sasdasudssa deEdaasdddsd EsssdEddds asddseEyssaas 1260 bddaddaass sESSESyaaseis sseEdsdsdda YesdsyesseseE asassaesdud ssasassoddda 1320

ЧдЕсддсбассс адсссьссда садсдадасс дадсссссас ссдадассас сддададдссс 1380 аасрасдада дссасессса ссудссеєдЕссуд аасаєссусс Есаєсаєссс саасасудсес 1440 ачадсеєсссд Єсбасеєсстд дасдсасадд Ссадссдасс ддасдаасас саєссдсдасд 1500 аасаєсаєса сссадаєссс ддссдЕсаад ддсаасесссс ЕсСЕєсаасдд сессудєсаєс 1560

Ессддассад дсеЕссассоудд аддадассес деЕссдссеса асаасессудд саасаасаєс 1620 басаассддуд дссасаєсда ддЕдссдаєс садессаєсі ссасдадсас Есоддгассдс 1680 чЕсададедс дссасудсдад сдеЕсасессуд аєссдссесе ссддєсаассд дддсаасессд 1740 аасаєсьєєсєса дсессаєсудє сссадссасс дсдассрадсс Ссдасаассе дсадеЕсссдс 1800 аасеЕєсддсеЕ ассЕсдадад ссдсаасдсес СЕСасудадсуд сдасєддсаа сдЕсдссддас 1860 дЕссдсаасе ЕЄссссудадаа сдссддадед аєсаєсдасс дсеЕєсдадее саєссссдЯагд 1920 ассдсдассє Єсдаддссда дсасдассеЕс дадададсєс аддададсс 1968 «2105 33 "2115 655 "212" Protein "2135 Artificial sequence "220" "223" Sgu1V variant "4005 33

Me Rgo Bek Ap Agkud pub Avp obi Avp obits I1e I1e ABp Aza Iets 5eg 1 c) 10 15

IT1e Rgo Aia Uaii bek AvBp o Niv bek Aia bip Mee Avr Gets beg Ietsy Avr 20 25 30

Zo A1a Agud I1ie bij Avr bek Gay Suv Iie Aia bij sb1u Avp Ap I1e Avp

Rkgo Gets Uai bek Aza bek TPg Uai sip TP s1u I1ie AvBp I1e Aza 01Uu z9 (210)

Akud I1e Ggets siu Uaiii Iets b1u Uai Rgo Rpe Aza s1u sip Gay Aia 5eg 35 65 70 75 80

Rpe Tuk bek Rre I1e Uaii s1u siy Gay Ter Rgo bek S1u Agd ABr Rgo 85 90 95

Ter bish Iie Rbe Mesye sitz Ni Ua1! sitz bip Iiets Uai Agud sbip Niv She 100 105 110 40 TE bis Avp Aza Agud ABp o TPg Aza Iiei Asia Agd Gay sip sS1u Te Sh1U 115 120 125

Aza bek Ripe Agud Aia Tuk bip bip bek ITec fight Avr Tgr Gay fight Avp 130 135 140

Ak Avr Avp Aza Agud TPg Agud bBeg Uai Gay Tug TPg sip Tug I1e A1a 45 145 150 155 160

Tets b1ip Gay Avr Rpe Gay Avp Aza Mee Rgo Gay Robe Aza I1e ABpP AvBp 165 170 175 beep beep Uai Rgo Gay Gay Mee Uai Tug Aza sip Aia Aia ABp Iets Niv 180 185 190 50 Pes Gay Gets Getsp Agud Avr Aza bek Tey Rpe siu back b Rore s1u Gay 195 200 205

TPg Bek beep siy I1e beep Agd Tug Tuk bis Agd beep Asia1a b1py Guv Ts 210 215 220

Akud bij Tuk bek Avr Tuk Suv Aia Agd Tgr Tug ABp TpPg o1u Gay Avp 225 230 235 240

Ap oh hey Agud biu TBg ABp Aza bitz bek Tegr Hey Agud Tug Avp bip Re 245 250 255

Akud Agud Avr o Gets TBPg o Iets b1i1u Uaiii Iets Avr Gay Uai Aia Gay Robe Rgo 260 265 270 (516) Zzek Tuk Avr TPg Agud I1ie Tuk Rgo I1ie AvBp TPg bek Aia sip Temp TPg 275 280 285

Akud bij I1e Tug TBg Avr Rgo I1e s1u Agd TPg ABp Aza Rgo Beh 0Щ1U 290 295 300

Rpe Aia bek TPg Avp o Tegr Rpe Avp AvBp ABp Aza Rgo Bek Rppe beg Ai1a 305 310 315 320

Iie bij Aza Aza I1e Rpe Agu Rgo Rgo Niv ITetsy Gay Avr Rope Rgo s1ts 325 330 335 beep Gay TPg I1ie Tug Bek Aia Bek Bek Agud Ter bek bek TPg beep Niv 340 345 350

Mee Avp Tug Ter Ua1 si1u No Agd Gay Avp Do Agd Rgo I1e Ni5v Sh1U 355 360 365

TPE gay Avp o TBbg bek TPg Ni siu Aia TPg AvBp oTPg bek I1e ABp Rgo 370 375 380

Uai TpPg ge bip Rbe TPg bek Agud Avr Ua1i Tut Agd TPg bii bek Tug 385 390 395 400

A1i1a s1u Iie AvBp I1e Gecp Gay TPg TPg Rko Uai AvBp siu Uai Rgo Tgr 405 410 415

Aza Akud Rpe Avp o Tgr Agud ABp oRgo Tets AvBp bek Gay Agud siu Bek Iets 420 425 430

Tecp Tuk TPpg I1ie s1u Tuk TPg siu Uai s1u TpPkg sip Gay Ribe Avr 5eg 435 440 445 bi TpK bij Gay Rgo Rgo bij TPg Tpg bij Agud Rgo Avp Tug bis beg 450 455 460

Tuk Bek Niv Agd Gets beg AvBp I1e Agd Gets I1e I1e sb1u ABp TPg Ietsy 465 470 475 480

Agud Aza Rkgo Ma1 Tug Bek Ter TPg Niv Akud bek A1ia Avr Agd Tibg Avp 485 490 495

TPgE Iie Aza TPg Ap I1e I1e TPg sip I1e Rgo Ai1a Uai Gguv S1u Avp 500 505 510

Rpe Hey Ribe Avp o biu bek Uai I1e bek b1u Rgo s1u Rpe TPgE s1u schu

From 515 520 525

Avr Gay Uai Agd Tets Avp AvBp o beg biu Avp ABp I1e Tug AvBp Agd 1U 530 535 540

Tuk Iie bij Ua1i Rgo I1e bip Rbe I1ie bek TPg bek TPg Agud Tug Agd 545 550 555 560

Ua1 Akud Mai Akud Tug Aza bek Uai TPg Rgo I1ie Akd Gay Bek Uai1i Avp 565 570 575

Ter b1u Avp Bek Ap I1e RiPe bek TPg I1i1e Uaii Rgo Ai1a TPg Asia TPg 580 585 590 zek Gay Avr AvBp o Tets bip bek Agd AvBp Rpe b1i1u Tugk Rpe bij bBeg Ag4d 595 (51048) 605

Ap Aza Ripe TPg bek Aza TPg biu AvBp Uai Uai siu Uai Agd Avp Re 610 615 620 zek bis AvBp Aia bi1u Maiii Iie I1e ABr Akd Rpe siy Rpe Iie Rgo Uai 625 630 635 640

TPE Aza TPg Rbe siy Aia siy Tug Avr Gay biy Agud Aza syp sich 645 650 655 "2105 34 "211" 1968 "2125" DNA "2135 Artificial sequence "220" "223" Coding sequence of Sgu1V variant "4005 34 ayedssseEssa assdsaadaasa sadadaassada assudaas sssgdssdae sssadssdeEs (216)

Essaassase ssdssadaye ddassesesa seddasudses dsayesdadda ssaseEstds 120 ayesdssdadd dsaasaase saasssdsss dssadsdso sdassdsda dasesddsayes 180 (516) aasaesdssdud dESYadsasase soddsdEsSsEsS dadssssaye ssddsaddesa dssddsdads 2

БбESvasadse есаесудесодд sdadssssdda ssayesaddes dsdayессстд ddadassies Zoo ayeddadsasud YesdadsadseE ddEsaddsad sasayessasduda adaasdsssdu saasasddss 3Z6o sesdssadas sSssaaddssI sddadssads Essadadsso assadsades ssesdaddas 420

Еддсеєсдада ассдсдасаа содсдаддасс сддадсдссс Сссасассса дгсасаєсдсд 480 седдадсссд асссссодаа сдсдаєрдсса сеЕсЕссдсса саасаасса дсаддедссд 540 сЕССсСсаєсдуд Єсгасдссса адссдссаас сеЕссассеєсс Сдссссесад адасдстгадс 60 срдеЕссддса дсдадсссдд асссасудссуд саддадаєсс адсдстраста сдадсдссад 6бо чдсоддадаада сссдддадса садсдассас Сдсдсасудсе ддрасаасас сддсессрдаас 720 аассеєдсдсд дсасдаасдс Єдададссдд ссссдссаса ассадссссд садддассес 78о0 асасеєсддад ЄссЕСсСдассяє садєсоасдссд сссссдадсс асдасасдсуд даєсєсстасссд 840 ассаасасдуда dsdsdsadse sasssoudsdad aeyssasasdu assssayesdud Esdsasddaas 900 dsEssayessd dsEeEsdssesS sassaassdud SsSsaasaasa asdsdssdss dEssadsss 960 ayesdaadsvd saarsssssu sssassesas seEdssuddase Esssadadsa dseEsassayes 1020

BasadsdsseE ssadssodsbd deEssadsasud sadsasayeda assassdddI sddssassds 1080 sesaassssa ddsssasssa sddsasssos aasasssda sssasddsds sasdaasasd 1140

Yessayesaass soddeEdasuseE ssadeEssasu adssdudadasu Esbassdsas edadadssas 1200 chdsEdsayesa asayesssdseE sasdasudssa deEdaasdddsd EsssdEddds asddseEessaas 1260 bdddaddaass seseEssyaaseis sseEdsdsdda YesdseyesseseE asassaesdd seasassoda 1320

ЧдЕСЯддЕбассс адсеЕсеЕссда садсдадасс дадсссссас ссдадассас сдададдессс 1380 аасрасдада дссасессса ссудссеєдЕссуд аасаєссусс Есаєсаєсдд саасасудсес 1440 ачдадсссссуд Ессасесстуд дасдсасадуд Ссадсеєдасс ддасддаасас сассоосддасд 1500 аасаєсаєса сссадаєссс ддссдЕСсаад ддсаасесссс ЕсСЕєсаасдд сессудєсаєс 1560

Ессддассад дсеЕєЄсассодд аддадассос дсЕссдсссса асаассссдуч саасаасаєс 1620 басаассдудд дссасаєсда ддЕдссдаєс садессаєсе ссасдадсас Есуддгассдс 1680 чЧЕсададедс дссасудсдад сдесасессуд аєссудссеєсе ссуєсаасьд доддсаасеісд 1740 аасаєссєєса дсассассує сссадссасс дсчдастадсс ссдасаассо дсадесссддс 1800 аасеЕєсддсеЕ ассЕсдадад ссдсаасдсес СЕСасудадсуд сдасєддсаа сдЕсдссддас 1860 дЕссдсаасе ЕЄссссудадаа сдссддадед аєсаєсдасс дсеЕєсдадее саєссссдЯагд 1920 ассдсдассє Єсдадудссда дсасдассьс дадададсеєс аддаддадесс 1968

Zo "2105 35 "2115 655 "212" Protein "2135 Artificial sequence "2205 "223" Sgu1B variant "4005 35

Me Rgo Bek Ap Agkud pub Avp obi Avp obits I1e I1e ABp Aza Iets 5eg 1 c) 10 15

IT1e Rgo Aia Uaii bek AvBp o Niv Bek Aia bip Mee Avr Gay back Gay Avr 20 25 30

Aza Agkud ch11e bis Avr bek ITep Suv I1e Ai1a bij s1u AvBp Ap I1e Avp 35 40 45

Rgo Ppep Uaii bek A1ia bek TPg Uai sip TBg s1u I1e ABp I1e Aia 01Uu z9 (210)

Akud I1e Ggets siu Uaiii Iets b1u Uai Rgo Rpe Aza s1u sip Gay Aia 5eg 65 70 75 80

Rpe Tuk bek Rrpe I1e Uai s1u bis Ietsy Tegr Rgo Bek b1u Agd Avr Rgo 50 85 90 95

Ter bish Iie Rbe Mesye sitz Ni Ua1! sitz bip Iiets Uai Agkd bi1ip Mee She 100 105 110

TPg Geish Avp Aza Agud ABp o TPg Aza Gets Aza Agd Te sip s1u Gesh SHU 115 120 125

A1a back Rpe Akud A1ia Tuk sbip beep back Hey fight Avr Tgr Hey fight Avp 130 135 140

Ak Avr Avp Aza Agud TPg Agud bBeg Uaii Ietsy Tug TPg sbip Tug Ii1e Ai1a 145 150 155 160

Te b1ip Gay Avr Rpe Gay Avp Aza Mee Rgo Gay Rpe Aza I1e ABp Avp 60 165 170 175 beep beep Uai Rgo Gay Gay Mee Uai Tug Aza sip Aia Aia ABp Ietsy Niv

180 185 190

Tets Getsp Gay Gay Agud Avr Aza bek Gay Rpe siu bek siy Rpe sS1Uu Gay 195 200 205

TPg Back beep siy I1ie beep Agd Tug Tug bis Agd beep Asia1a b1py Guv Ts 210 215 220

Akud bij Tuk bek Avr Tuk Suv Aia Agd Tgr Tug ABp o TPg s1u Gets Avp 225 230 235 240

Ap oh hey Agud biu TBg ABp Aza bitz bek Tegr Hey Agud Tug Avp bip Re 245 250 255

Agud Agud Art tey TPg Gay siu UMaii Gay Avr Tetsy Uai Aia Tey Rore Rgo 260 265 270 zek Tug Avr TPg Agud I1e Tug Rgo I1e ABp TPg bek Aza sbip Gay TEG 275 280 285

Akud fight I1e Tug TBg AvBr Rgo I1e s1u Agd TPg Ap Aza Rgo beg 01U 290 295 300

Rpe Aia bek TPg Avp o Tegr Rpe Avp AvBp ABp Aza Rgo Bek Rppe beg Ai1a 305 310 315 320

Iie sbits Aza Aza I1e Rpe Agud Rgo Rgo Niv Gay Gay Avr Robe Rgo bij 325 330 335 sip Gay TPg Iie Tuk bek Aza bek bek Agud Tgr bek bek TPg sbip Niv 340 345 350

Mee Avp Tug Ter Ua1 s1u Niv Agud Tets AvBp Rpe Agd Rgo I1e s1u SHU 355 3Z6o 365

TPE gay Avp o TBbg bek TPg Ni siu Aia TPg AvBp oTPg bek I1e ABp Rgo 370 375 380

Uai TpPg ge bip Rpe TPg bek Agud Avr Ua! Tug Agud TPg battle Bek Tug 385 390 395 400

Aza si1u I1e AvBp I1e Iietsy Gay TPg TBPg Rkgo Uai Avp s1iu Ua1 Rgo Tgr 405 410 415

Zo A1a Agud Rpe Avp o Tgr Agud Avp o Rgo tey ABp bek Gay Akud biu bek Gay 420 425 430

Tecp Tuk TPpg I1iee s1u Tuk TPg siu Uai s1u TpPkg sip Gay Ribe Avr 5eg 435 440 445 bi TpK bij Gay Rgo Rgo bij Tbg TBg bis Agud Rgo ABp Tuye bij 5beg 450 455 460

Tuk Bek Niv Agd Gets beg AvBp I1e Agd Gets I1e I1e cS1u c1u TPg Iets 465 470 475 480

Akud Aza Rgo Ua1! Tuk bek Tgr TPg Niv Agd bek Aza Avr Agd TPg Avp 485 490 495

TE Iie Aia TPg ABp I1e Iie TPg sbip chI1e Rgo Aia Uai Ppuv s1U Avp 500 505 510

Rpe Hey Ribe Avp o biu bek Uai Iie bek b1u Rgo s1u Rpe TPgE s1u schu 515 520 525

Avr Gay Uai Agd Tets Avp AvBp o beg biu AvBp ABp I1e sip ABp Agd 1U 530 535 540

Tuk Iie bij Ua1i Rgo I1e bip Robe I1i1e back TPg back TPg Agud Tug Agd 545 550 555 560

Uai Akud Uai Agu Tug Aia bek Ua1i TPg Rgo I1e Agd Iets bek Uaiii Avp 565 570 575

TER b1u Avp bek Avp o I1e Rire bek bek I1ie Uai Rgo Ai1a TPg Aia TEG 580 585 590 zek Gay Avr AvBp o Tets bip bek Agd AvBp Rpe b1i1u Tugk Rpe bij bBeg Ag4d 595 bo 605

Ap Aza Ripe TPg bek Aza TPg biu AvBp Uai Uai siu Uai Agd Avp Re 610 615 620 zek bis AvBp Aia bi1u Maiii Iie I1e ABr Akd Rpe siy Rpe Iie Rgo Uai 625 630 635 640

TPgE Aia TPg Rbe bitz Aza bitzsh Tug Avr Gets bitz Agd Aza sip si 645 650 655 60 «2105 36

"2115" 1968 "2125 DNA "2135 Artificial sequence "2205 "223" Coding sequence of Sgu1B variant "4005 36 ayedssseEssa assdsaadaa sdadaasdad asaassaasud sssgdssdae sssadssdeEs (216)

Essaassass ssdsudsadaye ddasseesssa seddasusss dsayesdadda sesaseestsds 120 ayesdssdadd dsaasaase saasssdsss dssadsdsso sdassdsdsa dasesddssayes 180 aasaesdssud dESsSdsavase soddsudsssss ddadessssaye Esdsaddessa dseddsdads 240

BbESvasadse essayesdeyesodd sdadssssdda ssayessaddes dsdayessstd ddadasseess Zoo aeddadsasud YesdadsadseE ddiesaddsad asdayessasds Ssaasdsssud saasasddddss 3Z6o sESsSdssadas Sssaaddsso soudadssads gEsadadsse assadsadss sseEsdaddwas 420

Еддсеєсдада ассдсдасаа содсдаддасс сддадсдссс Сссасассса дгсасаєсдсд 480 седдадсссд асссссодаа сдсдаєрдсса сеЕсЕссдсса саасаасса дсаддедссд 540 сеЕссссасдд Сссасдссса адссдссаас срссассесс гдсеЕссссад адасдстадс 60 срдеЕссоддса дсдадсссдд асссасдсєсу саддадасєсс адсдссасста сдадсдссад 6бо чдсддадаада сссдоддадста садсдассас СдсдсасудсЕ ддгасаасас соуддссеєдаас 720 аассеєдсдсд дсасдаасдс Єдададссдд ссссдссаса ассадссссд садддассес 78о0 асасеєсддад ЕЄссЕСсСдасся сдєсдсдссд сссссодадсо асдасасдсуд даєстасссд 840 аєсаасасда dsdsdsadse saseyesdsdad asssasasducha assssayesesduda Yesdsasddaas 900 dsEssaessd dsEeEsdssesS sassaassdud SsSsaasaasa asdsdssdss dEssadsss 960 aesdaadsvd saayersesssu sssassesas seEdssdddase Esssadadsa dsesassaes 1020

BasadsdsseE ssadssodsbd deEssadsasud sadsasayeda assassdddI sddssassds 1080 sssaaasssa ddsssassdd sddsasssos aasasssda sssasddsds sasdaasasd 1140

Essayesaass soddeEdasusEe ssadessasud adssduddasu Esbassdsas Edadadssas 1200 chdsEdsaesa asayesssdseE sasdasudssa deEdaasuddsd Essudedduds asdseyesaas 1260

Zo bddaddaass seЕСЕSaaseis sseEdsdsdda СsdssssEsE asassaesdda ssasassddda 1320

ЧдЕСЯддЕбассс адсеЕсеЕссда садсдадасс дадсссссас ссдадассас сдададдессс 1380 аасрасдада дссасессса ссудссеєдЕссуд аасаєссусс Есаєсаєсдд сддсасудсес 1440 ачадсеєсссд Єсбасеєсстд дасдсасадд Ссадссдасс ддасдаасас саєссдсдасд 1500 аасаєсаєса сссадаєссс ддссдЕсаад ддсаасесссс ЕсСЕєсаасдд сессудєсаєс 1560

Ессодассад дссссассудуд аддадассес дЕСсСсдсссса асаассссудуа саасаасаєс 1620 садаассддуд дсрасаєсда ддєЕдссдаєс садессаєсе ссасдадсас Есуддгассдс 1680 чЕсададедс дссасудсдад сдеЕсасессуд аєссдссесе ссддєсаассд дддсаасессд 1740 аасаєсєєсєса дсессаєсудє сссадссасс дсдастрадсс Есдасаассе дсадеЕсссдс 1800 аасеЕєсддсеЕ ассЕсддадад ссдсаасдсс сЕсасдадсд сддассддсаа сдєсдЕсддс 1860 дЕССсСдсаасі ЕЄссссдадаа сдссддадед аєсаєсдасс дсеЕєсдадеє саєссссдаєд 1920 ассдсдассє Єсдадудссда дсасдассьс дадададсеєс аддаддадесс 1968 «2105 37 "2115 655 "212" Protein "2135 Artificial sequence "2205 "223" Sgu1B variant "4005 37

Me Rgo Bek Ap Agkud pub Avp obi Avp obits I1e I1e ABp Aza Iets 5eg 1 c) 10 15

IT1e Rgo Aia Uaii bek AvBp o Niv Bek Aia bip Mee Avr Gay back Gay Avr 20 25 30

Aza Agkud ch11e bis Avr bek ITep Suv I1e Ai1a bij s1u AvBp Ap I1e Avp 35 40 45

Rkgo Gets Uai bek Aza bek TPg Uai bip TPg sb1u I1ie ABp I1e Aia 0Щ1U 50 z9 (210) (516) Agud chI1e Hey siu Uaii Geip siu Maiii Rgo Rbe Aia siu sbip Hey Aia 5eg 65 70 75 80

Rpe Tuk bek Rrpe I1e Uai s1u bis Ietsy Tegr Rgo Bek b1u Agd Avr Rgo 85 90 95

Ter bish Iie Rbe Mesye sitz Ni Ua1! sitz bip Iiets Uai Agkd bi1ip Mee She 100 105 110

TPE Mee Avp Aza Agud ABp o TPg Aza Gay Aza Agud Iiietsy sbip s1u Iech s1Uu 115 120 125

Aza bek Ripe Agud Aia Tuk bip bip bek ITec fight Avr Tgr Gay fight Avp 130 135 140

Ak Avr Avp Aza Agud TPg Agud bBeg Uaii Ietsy Tug TPg sbip Tug Ii1e Ai1a 145 150 155 160

Tets b1ip Gay Avr Rpe Gay Avp Aza Mee Rgo Gay Robe Aza I1e ABpP AvBp 165 170 175 beep beep Uai Rgo Gay Gay Mee Uai Tug Aza sip Aia Aia ABp Ietsy Niv 180 185 190

Pes Gay Gets Getsp Agud Avr Aza bek Tey Rpe siu bek bi Rore s1u Gay 195 200 205

TPg Back beep siy I1ie beep Agd Tug Tug bis Agd beep Asia1a b1py Guv Ts 210 215 220

Akud bij Tuk bek Avr Tuk Suv Aia Agd Tgr Tug ABp TpPg o1u Gay Avp 225 230 235 240

Ap oh hey Agud biu TBg ABp Aza bitz bek Tegr Hey Agud Tug Avp bip Re 245 250 255

Akud Agud Avr o Gets TBPg o Iets b1i1u Uaiii Iets Avr Gay Uai Aia Gay Robe Rgo 260 265 270

Zzek Tuk Avr TPg Agud I1ie Tuk Rgo I1ie Avp TPg bek Aia sip Temp TPg 275 280 285

Akud bij I1e Tug TBg Avr Rgo I1e s1u Agd TPg ABp Aza Rgo Beh 0Щ1U 290 295 300

Rpe Aia bek TPg Avp o Tegr Rpe Avp AvBp ABp Aza Rgo Bek Rppe beg Ai1a

From 305 310 315 320

Iie sbits Aza Aza I1e Rpe Agud Rgo Rgo No IYetsp Gay Avr Rpe Rgo sats 325 330 335 bip Gay TPg I1ie Tug Bek Aia Bek Bek Agud Ter bek bek TPg beep Niv 340 345 350

Mee Avp o Tuk Ter Ua1i siu Niv Agud Gay Avp Rpe Agkd Rgo I1e s1u SHU 355 3Z6o 365

TPE gay Avp o TBbg bek TPg Ni siu Aia TPg AvBp oTPg bek I1e ABp Rgo 370 375 380

Uai TpPg ge bip Rbe TPg bek Agud Avr Ua1i Tut Agd TPg bii bek Tug 385 390 395 400

Aza si1u I1e AvBp I1e Iietsy Gay TPg TBPg Rkgo Uai Avp s1iu Ua1 Rgo Tgr 405 410 415

Aza Akud Rpe Avp o Tgr Agud ABp oRgo Tets AvBp bek Gay Agud siu Bek Iets 420 425 430

Tem Tug TPgE Iie s1u Tuk TPg si1u Mai sb1u TPg bip Gay Robe Avr 5eg 435 440 445 bi TpK bij Gay Rgo Rgo bij TPg Tpg bij Agud Rgo Avp Tug bis beg 450 455 460

Tuk Bek Niv Agd Gets bBeg ABp I1e Agd Tieshp I1e I1e sSi1u s1u Tik Iey 465 470 475 480

Akud Aza Rgo Ua1! Tuk bek Tgr TPg No Agud bek Aza Avr Agd TPg Avp 485 490 495

TPgE Iie Aza TBPg Ap I1e I1e TPg bip I1e Rgo Ai1a Uai Ppuv S1u Avp 500 505 510

Rpe Hey Ribe Avp o siu bek Uai Iie bek sbiu Rgo sb1u Rpe TPg s1iu 01Uu 515 520 525

Avr Gay Uai Agd Tets Avp AvBp o beg biu AvBp ABp I1e Ssip AvBp Agd b1Uu 530 535 540

Tuk Iie bij Ua1i Rgo I1e bip Rbe I1ie bek TPg bek TPg Agud Tug Agd (516) 545 550 555 560

Uai Akud Uai Agu Tug Aia bek Ua1i TPg Rgo I1e Agd Gay Bek Ua1i1 Avp

565 570 575

Ter b1u Avp Bek Up I1e RiPe bek beg I1e Ua! Rgo Ai1a TPg Asia TPg 580 585 590 zek Gay Avr AvBp o Tets bip bek Agd Avp Rpe siu Tuk Robe bis b5eg Agd 595 (51048) 605

Ap Aza Ripe TPg bek Aza TPg biu AvBp Uai Uai siu Uai Agd Avp Re 610 615 620 zek bis AvBp Aia biu Maiii I1і1e I1e ABr Agud Rpe sitz Rbe I1e Rgo Uai 625 630 635 640

TPE Aza TPg Rbe siy Aia siy Tug Avr Gay bij Agud Aza sip Jan 645 650 655 "2105 38 "2115" 1968 "2125 DNA "2135 Artificial sequence "2205 "223" Coding sequence of Sgu1B variant "4005 38 ayedssseEssa assdsaadaa sadasssadaas (216)

Essaassase ssdssadaye ddasssssa ssddasdsss dsassdadda sssasestsds 120 ayesdssdadd dsaasaase saasssudseEs deEsadsdsese sdassudyedsa daseddsayes 180 aasaesdssdud dESYadsasase soddsdEsSsEsS dadssssaye ssddsaddesa dssddsdads 240

BbESvasadse essayesdeyesodd sdadssssdda ssayessaddes dsdayessstd ddadasseyess Zoo ayeddadsasud YesdadsadseE ddiesaddsad asdayesesasda Sdaasdsssa saasasadse 3Z6o sesdssadas sSssaaddssI sddadssads Essadadsso assadsades ssesdaddas 420

Eddseyesdada assdsdasaa sodsdaddass sddadsdsss Sssasasssa dgsasayesdsd 480

Зо сеЕддадсссуд асеЕєсседаа содсдасдсса сЕСсСЕЕсудсса Ссаасаасса дсаддсдссд 540 сеЕссссасдд Сссасдссса адссдссаас срссассесс гдсеЕссссад адасдстадс 60 срдеЕссддса дсдадсссдд асссасудссуд саддадаєсс адсдстраста сдадсдссад 6бо чдсоддадаада сссдддадса садсдассас сдсдсасдсс ддсбасаасас сддеседаас 720 аассеєдсдсд дсасдаасудс єдададссдд ссссдсраса ассадесссд садддассес 78о0 асасєсддад Ессссдассе сдЕсдсдсвЧЯ сЕСсСссддадсе асддасасоосду даєстасссд 840 аєсаасасда дсдсдсадсе сасеєсдсдад асссасасдуча ассссаєсєсдуда Єсдсасддаас 900 dsEssayssd dsEeeEsdssS sassaassdud SsSsaasasa asdsdssdss dEssadsdss 960 aysdaadsvd saarsssssu sssassesas seEdssuddase Esssadadsa dseEsassayes 1020

BasadsdsseE ssadssodsbd deEssadsasud sadsasayeda assassdddI sddssassds 1080 sESaaassessa ddsssassoud soodsassss aasasssda sssasddddsds sasddaasasd 1140

Ессаєсаасс судЕдасусе ссадесєсасу адссуддасуд Есвассудсас Єдададстас 1200 чдсЕддсаєса асаєсссдсеЕ сасдасудсса деЕдаасддсд ЕсссдЕдддс асддсеЕєссаас 1260 бддаддаасс сЕСЕСяасеіс ссеЕдсдсдда ЄсдсєссесеЕ асассаєсдуд ссасассоддда 1320 чЧдЕСЯддбассс адсеЕсьєсда садсдадасс дадсссссас ссдадассас сдададдессс 1380 аассасдада дссасессса ссдссєдссуд аасаєссудсс саєсаєсдда сддасасосес 1440 ачадсеєсссд Єсбасеєсстд дасдсасадд Ссадссдасс ддасдаасас саєссдсдасд 1500 аасаєсаєса сссадаєссс ддссдЕсаад ддсаасесссс ЕсСЕєсаасдд сессудєсаєс 1560

Ессддассад дсеЕєЄсассодд аддадассеєс дсссдсссса асаассссдуч саасаасаєс 1620 садаассддуд дсрасаєсда ддЕдссдаєс садеєсаєсь ссасудадсас Єсддеассдс 1680 дЕСсададеєдс дссасодсдад сдЕСсасессу аєссудесесе ссдєсаассд дддасаасессду 1740 аасаєсьєєсєса дсессаєсудє сссадссасс дсдасрадсс Есдасаассє дсадеЕсссдс 1800 аасеЕєсддсеЕ ассЕсдадад ссдсаасдсес СЕСасудадсуд сдасєддсаа сдЕсдссддас 1860 дЕссдсаасе ЕЄссссудадаа сдссддадед аєсаєсдасс дсеЕєсдадее саєссссдЯагд 1920 ассдсдассє Єсдадудссда дсасдассьс дадададсеєс аддаддадесс 1968 «2105 39 "2115 655 "212" Protein "2135 Artificial sequence bo "2205

"223" Variant of Sgu1B "4005 39

Me Rgo Bek Ap Agkud pub Avp obi Avp obits I1e I1e ABp Aza Iets 5eg 1 c) 10 15

IT1e Rgo Aia Uaii bek AvBp o Niv Bek Aza bip Mee Avr Gets beg Ietsy Avr 20 25 30

Aza Agkud ch11e bis Avr bek ITep Suv I1e Ai1a bij s1u AvBp Ap I1e Avp 35 40 45

Rgo Gpep Uai bek A1ia bek TPg Uai! sip TPg s1u Iie Ap I1e Ai1a sh1U 50 55 bo

Akud I1e Ggets siu Uaiii Iets b1u Uai Rgo Rpe Aza s1u sip Gay Aia 5eg 65 70 75 80

Rpe Tuk bek Rre I1e Uai s1u siy Gay Ter Rgo Bek b1u Agd Avr Rgo 85 90 95

Ter bish Iie Rbe Mesye sitz Ni Ua1! sitz bip Iiets Uai Agkd bi1ip Mee She 100 105 110

TPE Niv Avp Aza Agud ABp o TPg Aza Gets Aza Agd Te sip s1u Gesh SHU 115 120 125

A1a back Rpe Akud A1ia Tuk sbip beep back Hey fight Avr Ter Hey fight Avp 130 135 140

Ak Avr Avp Aza Agud TPg Agud bBeg Uaii Ietsy Tug TPg sbip Tug Ii1e Ai1a 145 150 155 160

Tets b1ip Gay Avr Rpe Gay Avp Aza Mee Rgo Gay Robe Aza I1e ABpP AvBp 165 170 175 beep beep Uai Rgo Gay Ggesh Mee Uai Tug Aza sip Aia Aia ABp Ietsy Niv 180 185 190

Tets IGecp Gay Gay Agud Avr Aza bek Gay Rpe siu bek siy Ribe SsS1Uu Iey 195 200 205

Zo TPg Bek bip bii Iie sbip Agud Tug Tuk bii Akud bip Aza bi Buv TBbg 210 215 220

Akud bij Tuk bek Avr Tuk Suv Aia Agd Tgr Tug ABp TpPg o1u Gay Avp 225 230 235 240

Ap oh hey Agud biu TBg ABp Aza bitz bek Tegr Hey Agud Tug Avp bip Re

Z5 245 250 255

Akud Agud Avr o Gets TBPg o Iets b1i1u Uaiii Iets Avr Gay Uai Aia Gay Robe Rgo 260 265 270 zek Tug Avr TPg Agud I1e Tug Rgo I1e ABp TPg bek Aza sbip Gay TEG 275 280 285

Agud bij Iie Tug TPg Avr Rgo Iie s1u Akud TBg ABp Aza Rgo bek 01Uu 290 295 300

Rpe Aia bek TPg Avp o Tegr Rpe Avp AvBp ABp Aza Rgo Bek Rppe beg Ai1a 305 310 315 320

Iie sbits Aza Aza I1e Rpe Agud Rgo Rgo No IYetsp Gay Avr Rpe Rgo sats 325 330 335 bip Gay TPg I1ie Tug Bek Aia Bek Bek Agud Ter bek bek TPg beep Niv 340 345 350

Mee Avp Tug Ter Ua1 si1u No Agd Gay Avp Do Agd Rgo I1e S1u Shchu 355 3Z6o 365

TPE Getsp Avp TPg o bek TPE Ni s1u Aia TPg Avp TBPg bBeg I1e AvBp Rgo 370 375 380

Uai TpPg ge bip Rbe TPg bek Agud Avr Ua1i Tut Agd TPg bii bek Tug 385 390 395 400

Aza si1u I1e AvBp I1e Iietsy Gay TPg TBPg Rkgo Uai Avp s1iu Ua1 Rgo Tgr 405 410 415

Aza Akud Rpe Avp o Tgr Agud ABp oRgo Tets AvBp bek Gay Agud siu Bek Iets 420 425 430

Tecp Tuk TPpg I1ie s1u Tuk TPg siu Uai s1u TpPkg sip Hey Ribe Avr 5eg 435 440 445 (516) fight Tk bi Hey Rgo Rgo fight TBg TBg bi Agud Rgo Avp Tugk fight 5eg 450 455 460

Tuk Bek Niv Agd Gets beg AvBp I1e Agd Gets I1e I1e cS1u c1u TPg Iets 465 470 475 480

Akud Aza Rgo Ua1! Tuk bek Tgr TPg No Agud bek Aza Avr Agd TPg Avp 485 490 495

TE Iie Aia TPg ABp I1e Iie TPg sbip chI1e Rgo Aia Uai Ppuv s1U Avp 500 505 510

Rpe Gay Ribe Avp o biu bek Uai I1e bek b1u Rgo s1u Rpe TPgE s1u schu 515 520 525

Avr Gay Uai Agd Tets Avp AvBp o beg biu AvBp ABp I1e sip ABp Agd 1U 530 535 540

Tuk Iie bij Ua1i Rgo I1e bip Rbe I1ie bek TPg bek TPg Agud Tug Agd 545 550 555 560

Uai Akud Uai Agu Tug Aia bek Ua1i TPg Rgo I1e Agd Iets bek Uaiii Avp 565 570 575

TER b1u Avp bek Avp o I1e Rire bek bek I1ie Uai Rgo Ai1a TPg Aia TEG 580 585 590 zek Gay Avr AvBp o Tets bip bek Agd AvBp Rpe b1i1u Tugk Rpe bij bBeg Ag4d 595 (51048) 605

Ap Aza Ripe TPg bek Aza TPg biu AvBp Uai Uai siu Uai Agd Avp Re 610 615 620 zek bis AvBp Aia bi1u Maiii Iie I1e ABr Akd Rpe siy Rpe Iie Rgo Uai 625 630 635 640

TPgE Aia TPg Rbe bitz Aza bitzsh Tug Avr Getz bitz Agd Aza sip si 645 650 655 «2105 40 «2115» 1968 «2125 DNA «2135 Artificial sequence

From "2205 "223" Coding sequence of variant Sgu1B "4005 40 asdsssEssa assdsaadaa sdadaasdad agbaassaaasu sssedssdae sssadssdes (216)

Essaassase ssdssadaye ddasssssa ssddasdsss dsassdadda sssasestsds 120 ayesdssdadd dsaasaase saasssdsss dssadsdsso sdassdsdsa dasesddssads 180 aasaesdsssd dESYadsavbase soddsoasssos ddadssssae sSssdsaddessa dsgddsdads 240

BbESvasadse essayesudesodd sdadssssdda ssayesaddeEs dsdayessstd ddadassyes Zoo asddadsasd EsdadsadseE ddEsaddsad ayedchassasds asaasdsesud saasasdddse 3Z6o sesdssadas sSssaaddssI sddadssads Essadadsso assadsades ssesdaddas 420

Еддсеєсдада ассдсдасаа содсдаддасс сддадсдссс Сссасассса дгсасаєсдсд 480 седдадсссд асссссодаа сдсдаєрдсса сеЕсЕссдсса саасаасса дсаддедссд 540 сеЕссссасдд Сссасдссса адссдссаас срссассесс гдсеЕссссад адасдстадс 60 сЕДдДссСсоодса дсдадссєсоод асссасуєсд саддадаєсс адсдстасса сдадсдссад 6бо чдсоддадаада сссдддадса садсдасрас гєдсдсасудсе ддрасаасас сддсессрдаас 720 аассеєдсдсд дсасдаасдс Єдададссдд ссссдссаса ассадссссд садддассес 78о0 асасеєсддад ЄссЕСсСдассяє садєсоасдссд сссссдадсс асдасасдсуд даєсєсстасссд 840 аєсаасасда dsdsdsadse saseEsdsdad asssasasdd assssayessdd esdsasddaas 900 dsESsSsayesdu dssssussesS sassaassdu SEsaaasa asdsdsessues dEsSsSadssss 960 ayesdaadsvd saarsssssu sssassesas seEdssuddase Esssadadsa dseEsassayes 1020

BasadsdsseE ssadssodsbd deEssadsasud sadsasayeda assassdddI sddssassds 1080 sssaaasssa ddsssassdd sddsrasssos aasasssda sssasddsds sasdaasasd 1140

Essayesaass soddeEdasusEe ssadessassud adssduddasu Esbassdsas Edadadssas 1200 dseEdssayesa asayesssdsE sasdasdssa deEdaasddsud EsssdEddds asdseEssaas 1260 bddadddaass sESSEsyaaseis sseEdsdsdda Esdseyesssss asassayesudd seasssoda 1320

ЧдЕСЯддЕбассс адсеЕсеЕссда садсдадасс дадсссссас ссдадассас сдададдессс 1380 аасрасдада дссасессса ссудссеєдЕссуд аасаєссусс Есаєсаєсдд сддсасудсес 1440 ачадсеєсссд Єсбасеєсстд дасдсасадд Ссадссдасс ддасдаасас саєссдсдасд 1500 (516) аасаєсаєса сссадаєссс ддссдЕсаад доасаассєсс ЕсЕссаасдд сессдаєсаєс 1560

Ессддассад дсеЕєЄсассодд аддадассос дсЕссдсссса асаассссдуч саасаасаєс 1620 садаассддуд дсрасаєсда ддЕдссдаєс садеєсаєсь ссасудадсас Єсддеассдс 1680 чЧЕсададедс дссасудсдад сдесасесссу асссуссеєсе ссуєсаасьд доддсаасеісд 1740 аасаєсєєсєса дсессаєсудє сссадссасс дсдастрадсс Есдасаассе дсадеЕсссдс 1800 аасеЕєсддсеЕ ассЕсдадад ссдсаасдсес СЕСасудадсуд сдасєддсаа сдЕсдссддас 1860 дЕССсСдсаасі Сссссдадаа сдссддадед аєсаєсдасс дссєсдадесе саєссссо9аєд 1920 ассдсдассє Єсдадудссда дсасдассьс дадададсеєс аддаддадесс 1968 «2105 41 "2115 655 "212" Protein "2135 Artificial sequence "220" "223" Sgu1B variant "4005 41

Me Rgo Bek Avp Agud pub Avp obi Avp obits I1e I1e ABp Aza Iets 5eg 1 5 10 15

IT1e Rgo Aia Uaii bek AvBp o Niv Bek Aia bip Mee Avr Gay back Gay Avr 20 25 30

Aza Akud ch11e bis Avr bek ITecyp Suv I1e Ai1a bij sb1u ABp ABp IchI1e Avp 35 40 45

Rkgo Gets Uai bek Aza bek TPg Uai bip TPg sb1u I1ie ABp I1e Aia 0Щ1U 50 55 bo

Agud chI1e Hey siu Uai Getsh siu Mai Rgo Rbe Aia si1u bip Hey A1ia 5eg 65 70 75 80

Rpe Tuk bek Rrpe I1e Uai s1u bis Ietsy Tegr Rgo Bek b1u Agd Avr Rgo 85 90 95

Ter bish Iie Rbe Mesye sitz Ni Ua1! siy bip Getz Uai Agku sbip Niv I1e

From 100 105 110

TPE Mee Avp Aza Agud ABp o TPg Aza Gets Aza Agd Te sip s1u Gesh SHU 115 120 125

Aza bek Rpe Agud Aia Tuk bip bip bek Te bij Avr Ter Gay bits Avp 130 135 140

Agud Avr Avp Aza Agud Tbg Agu bek Uai Gay Tug TPg sbip Tug I1ie A1a 145 150 155 160

Tets b1ip Gay Avr Rpe Gay Avp Aza Mee Rgo Gets Rore Aza I1e ABp ABp 165 170 175 beep beep Uai Rgo Gay Gay Mee Uai Tug Aza sip Aia Aia ABp Ietsy Niv 180 185 190

Tets Getsp Gay Gay Agud Avr Aza bek Gay Rpe siu bek bicp Rpe sS1Uu Gay 195 200 205

TPg Back beep siy I1ie beep Agd Tug Tug bis Agd beep Asia1a b1py Guv Ts 210 215 220

Agud bij Tugk bek Avr Tuk Suv Asia Akud Tgr Tuk Avp TPg s1u Gay Avp 225 230 235 240

Ap oh hey Agud biu TBg ABp Aza bitz bek Tegr Hey Agud Tug Avp bip Re 245 250 255

Akud Agud Avr o Gets TBPg Iets b1u Uaiii Gay Avr Gay Ua1 Aia Gets Robe Rgo 260 265 270 zek Tug Avr TPg Agud I1e Tug Rgo I1e ABp TPg bek Aza sbip Gay TEG 275 280 285

Akud fight I1e Tug TBgE AvBr Rgo I1e s1u Agud TPg Ap Aza Rgo beg 01U 290 295 300

Rpe Aia bek TPg ABp o Ter Rpe Ap Azp Avp Aza Rgo bek Rope beg A1a 305 310 315 320

Iie sbits Aza Aza I1e Rpe Agud Rgo Rgo Niv Gay Gay Avr Robe Rgo bij 325 330 335 beep Gay TPg I1ie Tug Bek Aia Bek Bek Agud Ter bek bek TPg beep Niv 60 340 345 350

Me Avp Tug Ter Ua1 s1u No Agd Tets AvBp Rpe Agd Rgo I1e s1u SHU

355 360 365

TPE gay Avp o TBbg bek TPg Ni siu Aia TPg AvBp oTPg bek I1e ABp Rgo 370 375 380

Uai TpPg ge bip Rbe TPg bek Agud Avr Ua1i Tut Agd TPg bii bek Tug 385 390 395 400

Aza si1u I1e AvBp I1e Iietsy Gay TPg TBPg Rkgo Uai Avp s1iu Ua1 Rgo Tgr 405 410 415

Aza Akud Rpe Avp o Tgr Agud ABp oRgo Tets AvBp bek Gay Agud siu Bek Iets 420 425 430

Tem Tug TPkgE Iie s1iu Tuk TPg siu Uai sb1u TPkg sbip Gay Robe Ar 5eg 435 440 445 bi TpK bij Gay Rgo Rgo bij TPg Tpg bij Agud Rgo Avp Tug bis beg 450 455 460

Tuk Bek Niv Agd Gets beg AvBp I1e Agd Gets I1e I1e cS1u c1u TPg Iets 465 470 475 480

Akud Aza Rgo Ua1! Tuk bek Tgr TPg No Agud bek Aza Avr Agd TPg Avp 485 490 495

TPgE Iie Aza TPg Ap I1e I1e TPg sip I1e Rgo Ai1a Uai Gguv S1u Avp 500 505 510

Rpe Hey Ribe Avp o siu bek Uai Iie bek sbiu Rgo sb1u Rpe TPg s1iu 01Uu 515 520 525

Avr Gay Uai Agd Tets Avp AvBp o beg biu AvBp ABp I1e sip ABp Agd 1U 530 535 540

Tuk Iie bij Ua1i Rgo I1e bip Rbe I1ie bek TPg bek TPg Agud Tug Agd 545 550 555 560

Uai Akud Uai Agu Tug Aia bek Ua1i TPg Rgo I1e Agd Iets bek Uaiii Avp 565 570 575

Ter b1u Avp Bek Up I1e RiPe bek beg I1e Ua! Rgo Ai1a TPg Asia TPg 580 585 590

Zo zek Gay Avr AvBp Gay bip bek Agud Avp Rbe siu Tuk Rpe siy bek Agd 595 (51048) 605

Ap Aza Ripe TPg bek Aza TPg biu AvBp Uai Uai siu Uai Agd Avp Re 610 615 620 zek bis AvBp Aia bi1u Maiii Iie I1e ABr Akd Rpe siy Rpe Iie Rgo Uai 625 630 635 640

TPgE Aia TPg Rbe bitz Aza bitzsh Tug Avr Getz bitz Agd Aza sip si 645 650 655 "2105 42 "2115" 1968 "2125 DNA "2135 Artificial sequence "2205 "223" Coding sequence of the Sgu1B variant "4005 42 (216)

Essaassase ssdsdsadaye ddasssssa ssddasdsss dsassdadda sssasestsds 120 assodssdadd dsaasaase saasssdseEs dESadsudssE sdassdeEdsa daseeddsaes 180 aasaesdssud dESsSdsavase soddsdEsseEs ddadesssaae Esdsaddesa dseddsdads 240

BbESvasadse essayesdeyesodd sdadssssdda ssayessaddes dsdayessstd ddadasseyess Zoo ayeddadsasud YesdadsadseE ddEsaddsad sasayessasda Sdaasdsssdu saasasddss 3Z6o sesdssadas sSssaaddssI sddadssads Essadadssya assadsades ssssdaddas 420

ЕддсЕсдада ассдсдасаа сдсдаддасс соодадсуєсс сстасассса деасаєсдсд 480 седдадсссд асссссодаа сдсдаєрдсса сеЕсЕссдсса саасаасса дсаддедссд 540 сеЕссссасдд Сссасдссса адссдссаас срссассесс гдсеЕссссад адасдстадс 60 срдеЕссддса дсдадсссдд асссасдссуд саддадаєсс адсдстраста сдадсдссад 6бо чдсоддадаада сссдддадса садсдассас сдсдсасдсс ддсбасаасас сддеседаас 720 (516) аассеєдсдсд дсасдаасус Сдададссду сеЕСсСсдстаса ассадссєссуд саддчассес 78о0 асасеєсддад ЕЄссЕСсСдассе сдєсдсдссд сссссдадсе асдасасдсуд dahstasssd 840 aesaasasda dsdsdsadse saseesdsdad asssasasducha assssayesesduda Yesdsasddaas 900 dsEssaessd dsEeEsdssesS sassaassdud SsSsaasaasa asdsdssdss dEssadsss 960 aesdaadsvd saarssssu sssassesas seEdssuddase Esssadadessa dse20Essassa

BasadsdsseE ssadssodsbd deEssadsasud sadsasayeda assassdddI sddssassds 1080 sESaaassessa ddsssassoud soodsassss aasasssda sssasddddsds sasddaasasd 1140

Essayesaass soddeEdasusEe ssadessasud adssduddasu Esbassdsas Edadadssas 1200 chdsEdsaesa asayesssdseE sasdasdssa dsedaasuddsd Essudedduds asdseyesaas 1260 bddadddaass sSEESyaaseis sseEdsdsdda YesdsesseseseE assayesdud ssasassoddda 1320

ЧдЕСЯддЕбассс адсеЕсеЕссда садсдадасс дадсссссас ссдадассас сдададдессс 1380 аассасдада дссасеЕссса ссдсссдссуд аасаєссдсс Ссаєсаєсда сододсасддсес 1440 ачадсеєсссд Єсбасеєсстд дасдсасадд Ссадссдасс ддасдаасас саєссдсдасд 1500 аасаєсаєса сссадаєссс ддссдЕсаад ддсаасесссс ЕсСЕєсаасдд сессудєсаєс 1560

Ессддассад дсеЕєЄсассодд аддадассос дсЕссдсссса асаассссдуч саасаасаєс 1620 садаассддуд дсрасаєсда ддЕдссдаєс садеєсаєсь ссасудадсас Єсддеассдс 1680 дЕСсададеєдс дссасодсдад сдЕСсасессу аєссудесесе ссдєсаассд дддасаасессду 1740 аасаєсєєсєса дсессаєсудє сссадссасс дсдастрадсс Есдасаассе дсадеЕсссдс 1800 аасеЕєсддсеЕ ассЕсддадад ссдсаасдсс сЕсасдадсд сдаседдсаа сдєсдЕсддс 1860 дЕссдсаасе ЕЄссссудадаа сдссддадед аєсаєсдасс дсеЕєсдадее саєссссдЯагд 1920 ассдсдассє Єсдадудссда дсасдассьс дадададсеєс аддаддадесс 1968 «2105 43 "2115 655 "212" Protein "2135 Artificial sequence "220" "223" Sgu1V variant "4005 43

Zo Mee Rgo Bek Avp Akud Guv ABp obi ABp obits Iie I1ie ABp Aza Gay 5eg 1 c) 10 15

IT1e Rgo Aia Uaii bek AvBp o Niv Bek Aia bip Mee Avr Gay back Gay Avr 20 25 30

Aza Agkud ch11e bis Avr bek ITep Suv I1e Ai1a bij s1u AvBp Ap I1e Avp

Z5 35 40 45

Rkgo Gets Uai bek Aza bek TPg Uai bip TPg sb1u I1ie ABp I1e Aia 0Щ1U 50 z9 (210)

Akud I1e Ggets siu Uaiii Iets b1u Uai Rgo Rpe Aza s1u sip Gay Aia 5eg 65 70 75 80

Rpe Tuk back Rrpe I1e Uaii siu bii Gay Ter Rgo bek s1u Agd AvBr Rgo 85 90 95

Ter bish Iie Rbe Mesye sitz Ni Ua1! sitz bip Iiets Uai Agkd bi1ip Mee She 100 105 110

TPE Niv Avp Aza Agd ABp o TPg Aza Gets Aza Agd Te sip s1u Gesh SHU 115 120 125

Aza bek Ripe Agud Aia Tuk bip bip bek ITec fight Avr Tgr Gay fight Avp 130 135 140

Ak Avr Avp Aza Agud TPg Agud bBeg Uaii Ietsy Tug TPg sbip Tug Ii1e Ai1a 145 150 155 160 em bij Gets Avr Rpe Gay AvBp Aza Mes Rgo Gay Rpe Aza I1e ABp Avp 165 170 175 beep beep Uai Rgo Gay Gay Mee Uai Tug Aza sip Aia Aia ABp Ietsi Niv 180 185 190

Tets IGecp Gay Gay Agud Avr Aza bek Gay Rpe siu bek siy Ribe SsS1Uu Iey 195 200 205

TPg Back beep siy I1ie beep Agd Tug Tug bis Agd beep Asia1a b1py Guv Ts 210 215 220

Akud bii Tuk bek Avr Tuk Suv Aia Agd Tgr Tug ABp TpPg o1u Gay Avp 225 230 235 240 (516) Avp o Gei Akud b1iu TEG AvBp Aia bii bek Tkgr Gay Agud Tuk Avp bip Rie 245 250 255

Akud Agud Avr o Gets TBPg o Iets b1i1u Uaiii Iets Avr Gay Uai Aia Gay Robe Rgo 260 265 270 zek Tug Avr TPg Agud I1e Tug Rgo I1e ABp TPg bek Aza sbip Gay TEG 275 280 285

Agud bij Iie Tug TPg Avr Rgo Iie s1u Akud TBg ABp Aza Rgo bek 01Uu 290 295 300

Rpe Aia bek TPg Avp Ter Rpe Avp AvBp ABp Aza Rgo Bek Rppe beg Ai1a 305 310 315 320

Iie sbits Aza Aza I1e Rpe Agud Rgo Rgo No IYetsp Gay Avr Rpe Rgo sats 325 330 335 bip Gay TPg I1ie Tug Bek Aia Bek Bek Agud Ter bek bek TPg beep Niv 340 345 350

Mee Avp Tug Ter Ua1 si1u No Agd Gay Avp Do Agd Rgo I1e ABp schu 355 3Z6o 365

TPE Getsp Avp TPg bek TPg No sb1u Aia TPg Avp TBPg o bBeg I1ie ABp Rgo 370 375 380

Uai TpPg ge bip Rbe TPg bek Agud Avr Ua1i Tut Agd TPg bii bek Tug 385 390 395 400

Aza s1u I1e AvBp I1e Iiets Gay TBPg TPg Rkgo Uai AvBp siu Uai Rgo Tgr 405 410 415

Aza Akud Rpe Avp o Tgr Agud ABp oRgo Tets AvBp bek Gay Agud siu Bek Iets 420 425 430

Tecp Tuk TPpg Iie s1u Tuk TPkg siu Uai s1u TPg sbip ITec Rpre Avr 5eg 435 440 445 bij Tk bi Gay Rgo Rgo bij TBg TBg bi Agud Rgo Avp Tugk bij 5eg 450 455 460

Tuk Bek Niv Agd Gets bBeg ABp I1e Agd Tietsshp I1e Iie cS1u AvBp TPg Iey 465 470 475 480

Akud Aza Rgo Ua1! Tuk bek Tgr TPg No Agud bek Aza Avr Agd TPg Avp

From 485 490 495

TPgE Iie Aza TBPg Ap I1e I1e TBPg bip I1e Rgo Aia Ua1! puv S1u Avp 500 505 510

Rpe Gay Ribe Avp o biu bek Uai I1e bek b1u Rgo s1u Rpe TPgE s1u schu 515 520 525

Avr Gechp Uai Akd Gay ABp o Avp bek s1u ABp ABp ch1I1e sbip ABp Agd 1U 530 535 540

Tuk Iie bij Ua1i Rgo I1e bip Rbe I1ie bek TPg bek TPg Agud Tug Agd 545 550 555 560

Uai Akud Uai Agu Tug Aia bek Uai TPg Rgo I1e Agd Gay Bek Ua1i1 Avp 565 570 575

Ter b1u Avp Bek Up I1e RiPe bek beg I1e Ua! Rgo Ai1a TPg Asia TPg 580 585 590 zek Gay Avr AvBp o Tets bip bek Agud Avp Rpe siu Tuk Robe bis b5eg Agd 595 bo 605

Avp o AZia Rpe TPg bek Aza TPK s1iu Avp Uai! Uai siu Maii Ag9d Avp Rire 610 615 620 zek bis AvBp Aia biu Maii Ii1e I1e AvBr Agud Rpe sitc Rbe I1e Rgo Uai 625 630 635 640

TPgE Aia TPg Rbe bitz Aza bitzsh Tug Avr Gets bitz Agd Aza sip si 645 650 655 "2105 44 "211" 1968 "212" DNA "2135 Artificial sequence "220" "223" Coding sequence of Sgu1V variant 60 "4005 44 ayedssseEssa assdaddaasaadaa sdadaas asaassaasud sssgdssdaye sssadssdeEs (216)

Essaassase ssdssadaye ddasssssa ssddasdsss dsassdadda sssasestsds 120 ayesdssdadd dsaasaase saasssdsss dssadsdsso sdassdsdsa dasesddssads 180 aasaesdsssd dESYadsavbase soddsoasssos ddadssssae sSssdsaddessa dsgddsdads 240

BbESvasadse essayesdeyesodd sdadssssdda ssayessaddes dsdayessstd ddadasseyess Zoo asddadsasd EsdadsadseE dodEsaddsad aechayesassuds asaasudsssu saasasoodse 3Z6o sesdssadas sSssaaddssI sddadssads Essadadsso assadsades sssdaddas 420

Еддсеєсдада ассдсдасаа содсдаддасс сддадсдссс Сссасассса дгсасаєсдсд 480 седдадсссд асссссодаа сдсдаєрдсса сеЕсЕссдсса саасаасса дсаддедссд 540 сеЕссссасдд Сссасдссса адссдссаас срссассесс гдсеЕссссад адасдстадс 60 сЕДдДссСсоодса дсдадссєсоод асссасуєсд саддадаєсс адсдстасса сдадсдссад 6бо чдсоддадаада сссдддадса садсдассас сдсдсасдсс ддсбасаасас сддеседаас 720 аассеєдсдсд дсасдаасудс єдададсеєдд сеЕссдстраса ассадесссд садддассес 78о0 асасеєсддад ЄссЕСсСдассяє садєсоасдссд сссссдадсс асдасасдсуд даєсєсстасссд 840 аєсаасасда dsdsdsadse saseesdsdad asssasasducha assssayesesduda Yesdsasddaas 900 dsESsSsayessdu dssssussesS sassaassdud SEsaaasa asdsdssuyes deEgSsadsdass 960 aiesdaadsvd saarssssu sssassesas seEdssuddase Esssadadsa dseEsassaes 1020

BasadsdsseE ssadssodsbd deEssadsasud sadsasayeda assassdddI sddssassds 1080 sesaassssa ddsssassaa sddsasssos aasasssda sssasddsds sasdaasasd 1140

Ессаєсаасс соддеЕдасусЕе ссадеєсасу адссдуддасу Есбассдсас Едададссас 1200 дсеЕддсаєса асаєсссдсЕ сасдасдсса деЕдаасддсуд ЕсссдЕдддс асдсеЕссаас 1260 бддаддаасс сЕСЕСяасеіс ссеЕдсдсдда ЄсдсєссесеЕ асассаєсдуд ссасассоддда 1320 чЧдЕСЯддбассс адсеЕсьєсда садсдадасс дадсссссас сердадассас сдададдесс 1380 аасрасдада дссасессса ссудссеєдЕссуд аасаєссусс Есаєсаєсдд саасасудсес 1440 ачадсеєсссд Єсбасеєсстд дасдсасадд Ссадссдасс ддасдаасас саєссдсдасд 1500 аасаєсаєса сссадаєссс ддссдЕсаад доасаассєсс ЕсЕссаасдд сессдаєсаєс 15560

Ессддассад дсеЕєЄсассодд аддадассос дсЕссдсссса асаассссдуч саасаасаєс 1620 садаассддуд дсрасаєсда ддЕдссдаєс садеєсаєсь ссасудадсас Єсддеассдс 1680 чЕсададедс дссасудсдад сдеЕсасессуд аєссдссесе ссддєсаассд дддсаасессд 1740 аасаєсьєєсєса дсессаєсдє сссадссасс дсудассадсс Есдасаассє дсадеЕсссдс 1800

Zo aasEesddsse assssdadad ssdsaasudses SESasdadsu sdaseddsaa sdEsSdssdades 1860 dEssdsaase EEssssudaadaa sdssdddaded ayesaesdass dseEesdadee saessssdYaagd 1920 assdsdasse Yesdadudssda dsasdasss dadadadssees addaddadess 1968 4 «5 210

C5 "2115 655 "212" Protein "2135 Artificial sequence "2205 40 "223" Sgu1B variant "4005 45

Me Rgo Bek Ap Agkud pub Avp obi Avp obits I1e I1e ABp Aza Iets 5eg 1 c) 10 15 45 I1ie Rgo Aia Uai bek Avp Niv bek Aia bip Mes Avr Gay bek Ietsy Avr 20 25 30

Aza Agkud ch11e bis Avr bek ITep Suv I1e Ai1a bij s1u AvBp Ap I1e Avp

Rkgo Gets Uai bek Aza bek TPg Uai bip TPg sb1u I1e ABp I1e Aia 0Щ1U 50 z9 (210)

Akud I1e Ggets siu Uaiii Iets b1u Uai Rgo Rpe Aza s1u sip Gay Aia 5eg 65 70 75 80

Rpe Tuk bek Rrpe I1e Uai s1u bis Ietsy Tegr Rgo Bek b1u Agd Avr Rgo 85 90 95

TER bis Iie Rpe Mee sits No Uai bi sbip Gay Uai Agud sip Niv I1e 100 105 110

TPE Mee Avp Aza Agud ABp o TPg Aza Gets Aza Agd Te sip s1u Gesh SHU 115 120 125

Aza bek Ripe Agud Aia Tuk bip bip bek ITets bij Avr Tgr Gay bij Avp (516) 130 135 140

Ak Avr Avp Aza Agud TPg Agud bBeg Uaii Ietsy Tug TPg sbip Tug Ii1e Ai1a

145 150 155 160

Tets b1ip Gay Avr Rpe Gay Avp Aza Mee Rgo Gay Robe Aza I1e ABpP AvBp 165 170 175 beep beep Uai Rgo Gay Gay Mee Uai Tug Aza sip Aia Aia ABp Ietsy Niv 180 185 190

Tets IGecp Gay Gay Agud Avr Aza bek Gay Rpe siu bek siy Ribe SsS1Uu Iey 195 200 205

TPg Back beep siy I1ie beep Agd Tug Tug bis Agd beep Asia1a b1py Guv Ts 210 215 220

Agd bij Tugk bek Avr Tuk Suv Aza Agud Tkgr Tug ABp TPg s1u Iech Avp 225 230 235 240

Ap oh hey Agud biu TBg ABp Aza bitz bek Tegr Hey Agud Tug Avp bip Re 245 250 255

Akud Agud Avr o Gets TBPg o Iets b1i1u Uaiii Iets Avr Gay Uai Aia Gay Robe Rgo 260 265 270 zek Tug Avr TPg Agud I1e Tug Rgo I1e ABp TPg bek Aza sbip Gay TEG 275 280 285

Akud bij I1e Tug TBg Avr Rgo I1e s1u Agd TPg ABp Aza Rgo Beh 0Щ1U 290 295 300

Rpe Aia bek TPg ABp o Ter Rpe Ap Azp Avp Aza Rgo bek Rope beg A1a 305 310 315 320

Iie sbits Aza Aza I1e Rpe Agud Rgo Rgo No IYetsp Gay Avr Rpe Rgo sats 325 330 335 bip Gay TPg I1ie Tug Bek Aia Bek Bek Agud Ter bek bek TPg beep Niv 340 345 350

Mee Avp Tug Ter Ua1 si1u No Agd Gay Avp Do Agd Rgo I1e ABp schu 355 36o0 365

TPE gay Avp o TBbg bek TPg Ni siu Aia TPg AvBp oTPg bek I1e ABp Rgo 370 375 380

Zo Ua1i TpE Ggetsp sbip Rbe TPg bBeg Agud Avr Ua! Tug Akd TPg battle back Tug 385 390 395 400

Aza si1u I1e AvBp I1e Iietsy Gay TPg TBPg Rkgo Uai Avp s1iu Ua1 Rgo Tgr 405 410 415

Aza Akud Rpe Avp o Tgr Agud ABp oRgo Tets AvBp bek Gay Agud siu Bek Iets

Z5 420 425 430

Tecp Tuk TPpg I1ie s1u Tuk TPg siu Uai s1u TpPkg sip Gay Ribe Avr 5eg 435 440 445 bi TpK bij Gay Rgo Rgo bij TPg Tpg bij Agud Rgo Avp Tug bis beg 450 455 460

Tuk Bek Niv Akud Gay bBeg AvBp I1e Agd Gay I1ie I1e s1u Avp TPkg Iets 465 470 475 480

Akud Aza Rgo Ua1! Tuk bek Tgr TPg No Agud bek Aza Avr Agd TPg Avp 485 490 495

TPgE Iie Aza TPg Ap I1e I1e TPg sip I1e Rgo Ai1a Uai Gguv S1u Avp 500 505 510

Rpe Gay Ribe Avp o biu bek Uai I1e bek b1u Rgo s1u Rpe TPgE s1u schu 515 520 525

Avr Gay Uai Agd Tets Avp AvBp o beg biu AvBp ABp I1e sip ABp Agd 1U 530 535 540

Tuk Iie soi Uai Rgo I1e sbip Rpbe I1ie bek TPg bek TPg Agd Tuk Agd 545 550 555 560

Uai Akud Uai Agu Tug Aia bek Ua1i TPg Rgo I1e Agd Iets bek Uaiii Avp 565 570 575

Ter b1u Avp Bek Up I1e RiPe bek beg I1e Ua! Rgo Ai1a TPg Asia TPg 580 585 590 zek Gay Avr AvBp o Tets bip bek Agd AvBp Rpe b1i1u Tugk Rpe bij bBeg Ag4d 595 bo 605

Ap Aza Ripe TPg bek Aza TPg biu AvBp Uai Uai si1u Uai Agd Avp Re 610 615 620 (516) zek bi Avp Aia s1u UMai Iie chI1e Avr Akud Rpbe bij Rpe I1e Rgo Uai 625 630 635 640

TPgE Aia TPg Rbe sic Aza bic Tug Avr Gets bic Agd Ai1a sip sic 645 650 655 "2105 46 "2115" 1968 "2125 DNA "2135 Artificial sequence "2205 "223" Coding sequence of Sgu1B variant "4005 46 ayedssessa ssudadsssssssssssa (216)

Essaassase ssdsdsadaye ddasssssa ssddasdsss dsassdadda sssasestsds 120 assodssdadd dsaasaase saasssdseEs dESadsudssE sdassdeEdsa daseeddsaes 180 aasaesdssd dESYadsavbase soddsoasssos ddadssssaae sSsdsaddessa dsgddsdads 240

БбESvasadse есаесудесод sdadsesdud sсаесадсе дсаессстд ддассаје Zoo ayeddadsаsud ЕсдадсадсеE ddEsадсад сасајесасда Сдаасдсссду саасадсдсс 3З6о сесдссадас сСссааддссI sddadssads Essadadsso assadsades сесдаддас 420

ЕддсЕсдада ассдсдасаа сдсдаддасс соодадсуєсс сСстасассса дгасаєсдадсд 480 седдадсссд асссссодаа сдсдаєрдсса сеЕсЕссдсса саасаасса дсаддедссд 540 сеЕссссасдд Сссасдссса адссдссаас срссассесс гдсеЕссссад адасдстадс 60 срдеЕссддса дсдадсссдд асссасудссуд саддадаєсс адсдстраста сдадсдссад 6бо чдсоддадаада сссдддадса садсдассас сдсдсасдсс ддсбасаасас сддеседаас 720 аассеєдсдсд дсасдаасус Сдададссду сеЕСсСсдстаса ассадссєссуд саддчассес 78о0 асасеєсддад ЄссЕСсСдассяє садєсоасдссд сссссдадсс асдасасдсуд даєсєсстасссд 840 аєсаасасда dsdsdsadse saseEsdsdad asssasasudd assssayesudda esdsasddaas 900 dsEssayessd dsEeEsdssesS sassaassdud SsSsaasaasa asdsdssdss dEssadsss 960 aeysdaadsvd saarsssssu sssassesas seEdssuddase Esssadadsa dseEsassayes 1020

Zo basadssss ssadssudsebud dEsSsadsasu sadsasayeda astassdodds sdddssassdds 1080 sesaassssa ddsssassaa sddsasssos aasasssda sssasddsds sasdaasasd 1140

Essayesaass soddeEdasusEe ssadessassud adssduddasu Esbassdsas Edadadssas 1200 chdsEdssayesa asayesssdseE sasdasudssa deEdaasdddsd EsssdEddds asddseEessaas 1260 bddaddaass sSEESyaaseis sseEdsdsudda EsudseEsesss assayesudd seasassoda 1320

ЧдЕсддсбассс адсссьссда садсдадасс дадсссссас ссдадассас сддададдссс 1380 аасрасдада дссасессса ссудссеєдЕссуд аасаєссусс Есаєсаєсдд саасасудсес 1440 ачадсеєсссд Есгасесстуд дасдсасадд Ссадссдасс ддасдаасас саєсдсдасд 1500 аасаєсаєса сссадаєссс ддссдЕсаад ддсаасесссс ЕсСЕєсаасдд сессудєсаєс 1560

Ессддассад дсеЕєЄсассодд аддадассос дсЕссдсссса асаассссдуч саасаасаєс 1620 садаассддда дстгасаєсда ддєЕдссдаєс садеєсаєсє ссасдадсас ссуддсассдс 1680 чЕсададедс дссасудсдад сдеЕсасессу асссдссесе ссддєсаассд дддсаасессд 1740 аасаєсєєсєса дсессаєсудє сссадссасс дсдастрадсс Есдасаассе дсадеЕсссдс 1800 аасеЕєсддсеЕ ассЕсдадад ссдсаасдсес СЕСасудадсуд сдасєддсаа сдЕсдссддас 1860 дЕссдсаасе сссссудадаа сдссддадед аєсаєсдасс дсЕссдадьс саєсссс9авд 1920 ассдсдассє Єсдаддссда дсасдассеЕс дадададсєс аддададсс 1968 «2105 47 "2115 655 "212" Belok "213" Vasiiyyitsv Epihipdiepviv "4005 47

Has TPg Bek Avp Agud pub Avp obi Avp obits I1e I1e ABp Aza Iets 5eg 1 c) 10 15

I1ie Rgo Aia Uai bek Avp Niv bek Aia bip Mes Avr Gay bek Rgo Avr 20 25 30

Aza Agkud ch11e bis Avr bek ITep Suv I1e Ai1a bij s1u AvBp Ap I1e Avp 35 40 45

Rkgo Gets Uai bek Aza bek TPg Uai bip TPg sb1u I1ie ABp I1e Aia 0Щ1U 60 50 z9 (210)

Akud I1e Ggets siu Uaiii Iets b1u Uai Rgo Rpe Aza s1u sip Gay Aia 5eg

65 70 75 80

Rpe Tuk bek Rrpe I1e Uai s1u bis Ietsy Tegr Rgo Bek b1u Agd Avr Rgo 85 90 95

Ter bish Iie Rbe Gets bis Ni Ua1 sii bip Gets Uai Agkd b1ip s1ip TPShe 100 105 110

TP bets Avp Aza Agud ABp Ts Aza Gets Aza Agd Te sip s1u Gesh SHU 115 120 125

Aza bek Rpe Agud Aia Tuk bip bip bek Te b1p Avr Tgr Gay bits Avp 130 135 140

Agud Avr Avr Aza Agud TbPg Agu bek Uai Gay Tug TPg sbip Tug I1ie A1a 145 150 155 160

Te b1ip Gay Avr Rpe Gay Avp Aza Mee Rgo Gay Rpe Aza I1e ABp AvBp 165 170 175 beep beep Uai Rgo Gay Gay Mee Uai Tug Aza sip Aia Aia ABp Ietsy Niv 180 185 190

Tets Getsp Gay Gay Agud Avr Aza bek Gay Rpe siu bek sitz Rpe sS1Uu Gay 195 200 205

TPg Back beep siy I1ie beep Agd Tug Tug bis Agd beep Asia1a b1py Guv Ts 210 215 220

Agud bij Tugk bek Avr Tuk Suv Aza Agkud Tkgr Tug ABp TPg s1u Gay Avp 225 230 235 240

Ap oh hey Agud biu TBg ABp Aza bitz bek Tegr Hey Agud Tug Avp bip Re 245 250 255

Akud Agud Avr o Gets TBPg Iets b1i1u Uai Ietsyts Avr Iietsy Ua1 Aia Gets Robe Rgo 260 265 270 zek Tug Avr TPg Agud I1e Tug Rgo I1e ABp TPg bek Aza sbip Gay TEG 275 280 285

Akud fight I1e Tug TBg AvBr Rgo I1e s1u Agud TPg Ap Aza Rgo beg 01U 290 295 300

Zo Rpe Aia bek TPg ABp o Ter Rpe Ap Azp Avp Aza Rgo bek Rope beg A1a 305 310 315 320

Iie sbits Aza Aza Uaii I1e Agud Rgo Rgo Niv Gay Gay Avr Robe Rgo bij 325 330 335 bip Gay TPg I1ie Rpe bek Ua1i Gay bek Agud Ter bek Avp TPg beep Tug

Z5 340 345 350

Me Avp Tug Ter Ua1 s1u No Agd Iiets bit back Agud TPg I1e Agd Sh1U 355 3Z6o 365 zek Gay back TPg back TP Niv b1u Avp TPg ABp o TPg bBeg Iie Avp Rgo 370 375 380

Ua1i TpE Ggetsp sbip Rbe TBPg bBeg Agud Avr Ua1i Tug Agd TPg siy bek Tug 385 390 395 400

Aza si1u I1e AvBp I1e Iietsy Gay TPg TBPg Rkgo Uai Avp s1iu Ua1 Rgo Tgr 405 410 415

Aza Akud Rpe Avp o Tgr Agud ABp oRgo Gay Avp bek Gay Agud siu bek Iey 420 425 430

Tecp Tuk TPpg I1iee s1u Tuk TPg siu Uai s1u TpPkg sip Gay Ribe Avr 5eg 435 440 445 bi TpK bij Gay Rgo Rgo bij Tbg TBg bis Agud Rgo ABp Tuye bij 5beg 450 455 460

Tuk Bek Niv Akud Gay bBeg AvBp I1e Agd Gay I1e bek sb1u Avp TPg Iets 465 470 475 480

Akud Aza Rgo Ua1! Tuk bek Ter TPg Niv Agud bek Aza Avr Agd TPg Avp 485 490 495

TPgE Iie Aza TPg Ap I1e I1e TPg sip I1e Rgo Ai1a Uai Gguv S1u Avp 500 505 510

Rpe Hey Ribe Avp o biu bek Uai Iie bek b1u Rgo s1u Rpe TPgE s1u schu 515 520 525

Avr Gay Uai Agd Tets Avp AvBp o beg biu AvBp ABp I1e sip ABp Agd 1U 530 535 540 (516) Tuk hep siy Uai Rgo I1e sbip Rpbe I1ie bek TPg bek TPg Agd Tuk Agd 545 550 555 560

Uai Akud Uai Agu Tug ATia bek Ua1i TPg Rgo I1e bip Iets bek Uaiii Avp 565 570 575

Ter b1u Avp Bek Up I1e RiPe bek beg I1e Ua! Rgo Ai1a TPg Asia TPg 580 585 590 zek Gay Avr AvBp Gay bip bek Agud Avr Ribe siu Tuk Rpe siy bek TPg 595 (51048) 605

Ap Aza Ripe TPg bek Aza TPg biu AvBp Uai Uai siu Uai Agd Avp Re 610 615 620 zek bis AvBp Aia bi1u Maiii Iie I1e ABr Akd Rpe siy Rpe Iie Rgo Uai 625 630 635 640

TPgE Aia TPg Rbe bitz Aza bitzsh Tug Avr Gets bitz Agd Aza sip si 645 650 655 "2105 148 "2115" 1965 "2125 DNA "213" Vasii1its5 Epigipdieepviv "4005 48 asdaassesaa ayeadava Sdadaasdaa assadassedaasud ssevaesadschasae c16

Есдааєсаєє ссдсасааає ддаєссаєса ссадасдссс дсассдадда СССЕсСсоаєсае 120 аєадссдадуд ддааєаасає сааєссассс дссадсдсає саасадссса аасдддраєсєс 180 аасаєєдсед деадаасасе аддсоабаєса ддсдсассЯдсє ссдссддаса ассадссадс 240 гЕсвавадесє єваєсудєсод Єдааєвсаєдд сссадсддса дадаєссуєд ддааассеЕве Зоо стадаасаєд Ссдаасаасс Едсаадасаа саааєаасад аавгаєдссад даасасодса 3З6о сЕсдсессдає сСасааддессс аддадсеєссс єЕссададсся ассаасааєс асеЕсдаадасєс 420

Eddsvbadaaa assdedayeda edsaadaasu adaazdzsdeEyes eeyesavrasssa agagagadss 480

EbadadseyesChd aEyeseeeesevsaa edsdayesdssd sEssssdsaa Saaaasayessa asaddesssa 540

Egayedayeda basayesdsesa adsyedsaaaye sSasayestay basvaysdad adasdsesesyae 60

Зо сСЕЄЕСсСЕЧддса дсдаасеводд дсссасаєсд саддаааєєс аасдеЕсаєта Сдадсдссаа 6бо чдсоддаааааа сдададааса ЄЄСсСЕеЕЧчаєсає сдсдсаадає ддсасаасас ддоддеЕссааає 720 ааєеєєдадад ддасаааєдс єдааадессдда Ссдсдасаса ассааєссссд сСададасеса 78о0 асодасбаддад баєсадаєсє адеддсасса сссссаадсо асдасасдсдд басссаєсса 840 аєаааєсасса деЕдсЕеєСсСааєє аасаададаа асссаєсасад аєссааєсдд дадаасаааєс 900 дсассссєсад чассєдсаад Сасддаасєсодд СЕсЄааєсааса асСдсассаєс чдЕСЕЕССдсс 960 асададдсед ссдеЕсаєтад дссеЕссудсає срасеседавєе єеєссадааса дсеЕсасааєяе 1020 gEsadsubaye saadssdayed dadesaavassi saagaeayeda ayesaseddadE ddadasaesada 1080 sEedaayesds daasaayesaad ddddeEsayesa adgasseyesda sasasddaaa bassaavase 1140

Esvsayesayes seEdEaasayese asadeEssasa sessdeEdasu EEsasadaas adaayesaevaye 1200 dsadddayaa agsasasseseE aassasesse deEdaaeddad basseyevedddse badaeseaae 1260 bddadaaaes ssseEdaaaees ESEsadaddeE adsessesse agassayesadu dsasasedda 1320

ЧЕддддасас аасраєсєда Ессадааассі дааєсассас садааасаас адаасдасса 1380 ааєстаєдаає сеЕсасадеса бадаєсаєсі аасасаадас Єааєаєсадуд ааасасеЕєстд 1440 ачдадсассад басасеєсьсуд дасдсассує адсдсадаєс деасдаасас даєседссаса 1500 аасаєсаєвта сеєсааасєсс єдсадесдаад ддааассеєєсс ЄЕЄЕсеЕсааєда ЕССсСЯєсСааєс 1560

Єсаддассад дасєсаседу Еддддасева дЕсСадаєсаа аєагаєсадедуч аааєсаатацєєе 1620 сааааєгадад дстассеЕєда ддЕсссдасе сааєєсаєсь ссасаєссас садаєаєсда 1680 дЕєЄСЯдєдвас деЕсСасддсесс єдеЕаассссду аєссаасеса дЕДдЕсааєсу ддаддесааєсса 1740 аасаєєвЕвєес ссадсасадеЕ ассадсвраса дссасуєсає бадаєааєсе асааєсаад 1800 чаєсєєєсєсєдаеЕсє аєсесооааауд бассааєдса СЕсСасаєссд саасаддеєаа ЕєДдеЕадсадче 1860

ЧдЕсадаааєє Євадсдадаа Едсаддадед асаагадаса дасєєсєдааєє бассссадсе 1920 асєдсаассє Єсдаадсада асаєдаєсва дааададсдс аадад 1965 «2105 49 «2115 6550 «212» Білок «213» Васії1їц5 Єпигіпдієепвів «4005 49 (516) Меє Рго Бек Авп Акуд Гув АБп обі АБп обіц І1їе І1їе АБп Аїа Гей 5ег 1 c) 10 15

IT1e Rgo Aia Uaii bek AvBp o Niv bek Aia bip Mee Avr Gay Bek Rgo Avr 20 25 30

Aza Agkud ch11e bis Avr bek ITecp Suv Uai Aia bij s1u Avp Ap I1e Avr 35 40 45

Rgo Rpe Uaii bek Aia bek TPg Uai sip TBg s1u I1e bek I1e Aia 01Uu 50 55 bo

Agud chI1e Ggets siu Uaii Iets b1u Uaii Rkgo Rpbe Aza s1u sip Gets Aia 5eg 65 70 75 80

Rpe Tuk bek Ripe Iets Uai si1u bis Ietsy Tegr Rgo Bek b1u Agd Avr Rgo 85 90 95

Ter bish Iie Rbe Mesye sitz Ni Ua1! siy bip I1e Uai Aku sbip sip I1e 100 105 110

TPE Avr bek Uaii Agd Avr TPg Aia I1e Ai1a Agd iep siy s1u Hey SHU 115 120 125

Agud sb1iu Tug Akud bek Tuk beep beep Aia Gay bij TPg Tkgr Gay ABr Avp 130 135 140

Ak Avp o Avr Aza Agud bek Agud bBeg I1e I1e Agd siy Agud Tug Ii1e Ai1a 145 150 155 160

Tets b1p Gay Avr I1ie TPg TpPg Aza I1ie Rgo Gets Rore bek I1e Agd Avp 165 170 175 bip bij Mai Rgo Gay Gay Mee Uai Tug Aza sip Aia Aia ABp Ietsy Niv 180 185 190

Tets Getsp Gay Gay Agud Avr Aza bek Gay Rpe siu bek bij Ter s1u Mee 195 200 205

Zzek bek Aza Avr Uai Avp sip Tuk Tuk beep bij sbip chI1e Agkud Tuk TPg 210 215 220 bi bij Tuk Bek Avp Niv Suv Uai bip Ter Tug Avp TPg b1u Gechp Avp 225 230 235 240

Akud tey Agud biu TB Ts Aza bitz bek Ter Uai Agud Tuk Avp bip Re

From 245 250 255

Akud Agud Avr o Gets TBPg Iets b1u Uaiii Gay Avr Gay Ua1 Aia Gets Robe Rgo 260 265 270 zek Tug Avr TPg Agud TpPg Tug Rgo I1e Rgo TPg TPg Aza sip Gay TEG 275 280 285

Agud bij Uai Tuk TPg Avr Rgo Avzp biu Uai Uaiii Aia s1u Rgo ABp Avp 290 295 300 zek Ter Robe Agd ABp o b1i1u Ai1a bek Rpe bek Aia I1e bii A5Bp Aia Te 305 310 315 320

I1e Akud beep Rkgo No ITecy Tugk Avr Rpe Gay TPg Up Gay TPg I1e Tug 325 330 335

TPgE Agud Agud beg bip Uai b1u TBPg TBg I1e Mee AvBp Gay Tgr Aia 0Щ1U 340 345 350

Niv Agud I1e TBg Rbe AvBp Agud I1e bip s1u siu Bek TPg Bek siy Mee 355 3Z6o 365

Uai Tuk b1u Aia I1ie TBg ABp o Rgo Uai! back Uai back AvBr I1e Rgo Rie 370 375 380

Uai Avp Agud Avr o Ua1 Tug Agud TBg Uaii bek Gets Aia sS1u S1u ep SHU 385 390 395 400 zek Hey bek biu I1e Agud Tuk b1i1u Iiecp TPg Agud Uai Avr Rpe Avr Mee 405 410 415

I1e Rbe Agd AvBp o Niv Rgo Avr Iie Ua! TPpg s1u Gay RPe Tukg Niv Rgo 420 425 430 sbi1u Niv Aza si1u Iie Aia TPg sip Uai Gpuv Avr bek bij TPg sitc Iey 435 440 445

Rgo Rgo fight TPg TP fight beep Rgo Avp Tug Agud Aza RPe bek Niv Ietsy 450 455 460

Tecp bek Niv Iie Bek Mee siu Rgo TPg TpPg bip Avr Uai Rgo Rgo Uai 465 470 475 480

Tuk Bek Ter TPg Niv beep bek Aza Avr Agud TPg AvBp o TPg I1e ABp 5eg 60 485 490 495

Avr Agud h1I1e TBg bip I1e Rgo Gets Uaii Guv Asia Niv TPg Gay bip b5eg

500,505,510

Akud Agud Ts beg biu b1u Rgo Rbe Aza Rpe bek Avp Uai Avp Gay Avr 530 535 540

Rpe Avp Gets beg beep Agud Tug Agd Ai1a Agud I1e Agud Tu Aia Bek TEG 545 550 555 560

TPE Ap Gay Agud I1e Tug Uai TPg Uaii Aza sS1u b1cp Agud I1e Rpe Aza 565 570 575 si1u bip Rpbe Avr Ppuv TPg Mes Avr Aia sb1u Aza Rgo Gay TPg Rore sip 580 585 590 zek RPe bek Tug Aia TPg I1ie Aza ABp TPg Rpe Rgo bij Agd 595 (51048) 605 zek bek bek ITets TPg Uai s1u Ai1a Avr TPg Rpe bek bek s1u AvBp s1its 610 615 620

Uai Tuk Uai Avr Akud Rbe sits Gay Iie Rgo Uai TPg Asia TPg Rpe sites 625 630 635 640

Aza siy bek Avr Tets biy Agd Aia Agd Gu 645 650 "2105 50 "2115 1950 "2125 DNA "213" Vasii1its5 Epigipdieepviv "4005 50 aedssEesaa ayeaddaaaaa Yedadaasdaa assasaaaed ssssaessdae sssadsesdga (216)

Esdaaesaee ssdsasaaaae ddayestaesa ssadasdsss dsayessdadda Sadsessoayesdei 120

ChdEadssdad ddaasaasaye edayessasss dssadsdsaye saasadsssa aasaddadsayeses 180

Zo adetayeadsed deadaasaee adosdbayesta dododsdssYadE YesSdssoddasa assadssade 240

HEsravradeEsse ЕЕСЕСsЭвод9Ud ddaaesayedda sssadsuudsa dadayessayed ddaaaryesvese Zoo aeddaasayed Yesdaasaaae Yedeaadasaaa saaasaasdda asadsdssad ddaasassdses 3Z6o ayegeedseEsSChdEE eadaadChdeese addaadaddd basadasss assadsaddses Ssesdaaass 420

BEddeEsadayea assdaaaeda Yedsaadayesa adaadsayesa sSssoasdadad asbsasayesssdss 480

Esadaaseyed asastassas Sdssasassu seEEesSsSsadsa basdaaaesa adaddesssa 540

Ебаєєсааєдоа баєсаєдсеса адсеєдсаааєсє сСсасассстає сассаєсєсдад адасдсаєсс 60 сСЕСсСссСсодса дсдаасодддад дасдссаєсі дссдаєдесра ассаасаєса ссаадаасаа 6бо аєсадаєаєа сададдааса єссеаассає Єдсдсбасаає доасаєсаасас аддассааає 720 ачаєсаадад ддасаасеєдс сдааадссда дсасддсаса ассааєссссд сСададасста 78о0 асаєсадучаєд бассачасєє адеддсасста СЕСсСсСсаадсе асСдасасьсду дасеЕтаєсссс 840 аєеєссаасва ссдсссаасе басаададаа дсдсасасад асссааасдд ЄЯдЕсЕсоасадса 900 ддасссааса агсадеЕсддеЕє єадааасдда дяссссссЕсс ссдссасада ааасдсаасс 960 аєєсдасаас сеЕСсасссаса Едаєєсєсьа асдаассеєса сааєєсвасас дадаадааде 1020 саадсаддса ссасааєсає дааєєєдеЕду дсадддсаєа дааєссасдєс сааєсадааєа 1080 сааддеЕдаєє ссастадеєда ааєддаєдсає ддддсваєса ссаасссаде садеЕДдесвсаде 1140 часаєассає єЕдЕСяаєсу ддаєдеЕеєсас судааседває саєвєадсьда Едддсесєдос 1200

ЕсеЕСєДдадед даагасдеєса ЕддЕєеєсаасі ададеседаєсє єєдасаєдає асеЕссдеаас 1260 саєсседаєса гадсаасєдуда аєваєесває саєссоудддас асдсдддсає Едсаасссаа 1320 дЕаааадаєє садааасада аєсассассо дааасдасад аасадссааа Ссасададса 1380 сЄЕсадеЕсаєс сасеаадеса баєєсєсааєд додасєссаасда сеєсаадасуде ассесссадеа 1440 баєєсевєдда сасассадад Єдсадаєсує асдаасасаа Єсааєєсууда гаддаєсааса 1500 сааасассає Едудсаааддс дсабассссс сааєсддддбра ссасеЕдбадс аааадддсса 1560 чадЕєсасад даддддаває ссеЕСссдЕСсСЧда асаадеЕдчад дассаєєстдс ЕсЕсСадеаає 1620 дЕсааєсстад арсеЕсаасеє дссасааадд бСассдєдсса дааєєсдеєса ЕдссеЕСТасе 1680 ассаасссаа дааєстасує аасуддеєдса оддЕдаасдаа ЄЕСЕСЕдссод Єсааєєєдас 1740 аааастаєдда агдссддеЕдс сссаєсааса СЕССВ8ассвє єсадевасдс аассаєтаає 1800 асадсеЕєсєва сасесссада аадаєсдадс адсеЕєсєдасвд баддеЕдссда гасадеЕстаде 1860

Esaddeeaaed aadeEstayedeE adaeadaseEs daaeesaayess sadeEsaseds aasseEesszad 1920 chdsadaaesd ayestadaaad adsdsddaad 1950 60 «2105 51

"2115 3771 "212" DNA "213" Vasii1its5 Epihipdiyeepviv "4005 51

Eyedaseyesaa ayesaddaaaaaa Yedadaasdaa assasaaaed ssssassdae sssaasddddaga (216)

Esdaaysseeee ssasdsaaae daayesstaaysa ssadchasdsess dsassdaada Sadsessoayesdei 120

ChdEadssdadd Yedaasasaye edayessasss dssadsdsaye saasadsssa aasdddadbsayegsa 180 aasayeadsed deadaavaee doddsoabayesa doasdssssYaae ssdssddasa assadssads 240

EEssasaadeEs EEESSsSUCHEEeChdu Yedaaesayeduda sssadeddsa dadayessayed ddaaaryeseses Zoo sgddaasayed Sadaaasss Sasaadasaa saadsaasasad aaaaassad daagsasddse 3З6o ayeedseEsdChaye badaaddeyese addaaaddds basadasss assadsaddses Ssesdaaass 420

BEddeEsadayea assdaaaeda Yedsaadayesa adaadsayesa SsSsSeEsdadsu ssasdessedse 480

Ebadaaseeed asayesasastas edssasassd sEssssadaa Sasdaaaessa adddesssa 540

Есаєєєааєда бгасаєдссса адссдсааає Сгасасссає саєтасеєдад ододасодсаєсс 60 сСЕСссссодса дсдаасдддад дасддсаєст гссдаєдесра ассаасаєса ссаадаасаа 6бо аєсадаєаєа сададдааса єЄссеЕаассає Сдсодсбасаає доасаєсаасас дадассааає 720 аасеєЕсаадад ддасаааєдс єдааадессдда дсасддсаса ассааєссссдд сададасста 78о0 асаєсаддада баєсадаєсє адеддсссста сссссаадесс асдасасссуд сасесаєсса 840 ассаасасда дЕдсЕСадеє аасаададаа дЕЄСсСасасад асдсааєсдд чассдєасає 900 ссдадссаад СЕСсСсдсаад Сасдчдасеєсдд єЕссаасааса асдсассасус дЕЕЕЕсСвдсс 960 асадаадсвд ssdEeEsayesad dsseEsSsudsaye sraseseyedavyeee eyeyssadaasa aseEsasaayeyae 1020 basadsasaye saadssdayed dadeaaasassi sadeEstayeda ayeaeaeedodads addesaeada 1080 sEyedaayesss dsssaasasads adddesayeta aaassayessa sasaaddayes gassaatase 1140

Yessayesayes seEdeaaasase asadeEstasu Ssssdadasa EEsasaddas edaayesayetd 1200 chdsadddseeaa agagaesvtae aaseeesaasse dEsSaaedodd EESSEEDdoChadE gadaesteaae 1260 bddadaaaes ssseEdaaaees ESEsadae adssesessse aeyasdaya deagasesdda 1320dda

Чеедодасодс ааесасааада ессадааасо даассассс садааааас адаасдаса 1380 ааестаедаае сасасадаеса бадаесаес сасасаддас есаеееееесаес асссааедаед 1440

From achadsayesdu basaseyesu dasdsassodaye adsdsadayes desasdaasas dahesodassa 1500 aasadaaevta seESsaaaaseess edsadeEdaad ddaadaseeees eEEsEeEsaayedu seESEEeVaakyae 1560

Yesaddassad daseesasedu Eddadasdra deEsSadaeeda aeyaddaaeaaa Eddesaaataceee 1620 saaaaegadad ddbagaeesda adesssaase saaeesasasude sdasayessas sadaeyesda 1680 deeeESsSdadeas dEsSasudsess edEaassyasud aeeesdadsssa ayedeEsaaevd doadsaaeessa 1740

Yesaaeeeesva sdaasasaseee assadsaasa dssdsayesae badaeaeaseee asaaesad9dad 1800 chae ayedeEsdaaae saasaaedess eeEsSasaessu saasaddeaa gagadsadche 1860

ЧдЕсадаааєє Єгадсдсааа Едсададдра агаасадаса дасєєєсєдааст гаєсссадсе 1920 асєдсаассє Єсдадудсааа асаєдаєєста дааададсас ааааддсоадЕ дааєсдсесьд 1980 рЕсасеєсва саааєссаауд аадаєсдаад асадаєдеда садаєвтаєса гаєсдассаа 2040 дЕДЯДЕССааєс ЄоддЕдоосасу ЕсСваєсадає дааєсеЕсдсеЕ Єддаєдадаа дсдадааєта 2100 геЕсдадааад Єдааагаєдс даадсдасес адедаєдааа дааасевсасе ссаадаєсса 2160 аасеЕєсасає ссаєсааєду дсаассааде СЕсСддсаєсса Есдаєддаса ассавасесєс 2220 ассеЕСстаєва аєдадссаєс ааєсаєдда соддЕдддддса деЕдсдааєдЕ гассаєсесад 2280 чаадддааєд асдеаєстаа ададааєсас деЕсасастас сдддбасьсеЕ гааєдадеде 2340 баєссаааєсє аєссаваєса ааааасадда дадеЕсадаає Єаааддсеєса гасдсдстає 2400 сааєсаадад ддєагаєєсда адаєсадссаа даєстадада Есваєсваає єсдесасаає 2460 дсааадсаєд ааасаєсааа ЕдДдЕеЕєЄсСсадудє ассдадессс баєддсссе Ессадесеєдаа 2520 адсссааєсд дааддеЕдсду адаассааає сдаєдсдсас сасаєєсвду асддааєсся 2580 чаєсвєадаєє дЕсссеЕдсад адаєададаа аааєдеЕдсдс аєсаєеєссса Есаєеєссасе 2640

ЄЕЧдддасаєєдд аєдеЕсодаєд сасадассвуд саададдаєс Єаддсуаєдеса осдЕсСЧОСасес 2700 аадаєсаада содсаддааду Есаєдсаада Сгаддаааєс сддааєеєсає сдаададааа 2760 ссаєсааєсуд дадаадсасе деЕСсСЕсуєудсд аадададсдд аааааааааєд дададасааа 2820 адддааааас басаадеєдда аасаааасчда дсасасасад асдсаааада адссдсддває 2880 дсЕЕваєєсд бадасеєсьса асаєдаєада Сгасаадсад абасааасає сддсаєдаєе 2940 саєдсддсад асадасеЕсдеЕ єсаєсодаєс сасудаддсеє асссессада ассассесес Зоо аєєссаддаа саааєсдєддеЕ давЕєєсвдаа дааєсадааа ассуасасесс гасесдсаєье З06о

ЕссеЕвсаєаєд аєдсдадааа ЕдЕсаєтааа аасоддсдаєє єсааєааєдуч асеЕдасаєдес 3120 бддаасудєда аадддсаєдеЕ ададдсасад садсеєЕдааса ассарсуєес ддєсєссеЕвдЕсС 3180 аєсссддаає доаодаадсада адесєссасаа ааддєдсдсд ЕсЕдЕСсСсадд Есдєддсває 3240 (516) авєєсеЕссодЯвд Єсасадсуєба сааададдда сСасододаад дсеЕдсдсаас гаєссаєдаа 300

ChdEsdayeasa agasadassa aseedadaadeses adsaassdyed adaaaddasa adgagaessa 3360

ЧддабЄаасасда бадсаєдеаа Єдаєсаєаає аадааєсаєд дЕдсдааєдс асдсадесся 3420 сдбааєсуєд даєаєдасда асеєсвтаєсддда аасассссад сеєдаєсаєсес сдсаааєсаа 3480 ааадааєсасд доадудєдсуєба сасеєсєсссас аассаєдсає аєддсдааєс Есаєдаааде 3540 ааєєсЯдєсса бассадседа Есаєдсдссу дЕЕсаєсдаад аадаадсудбєа басасаєсдда 360 сдаачдаддаєба асєсеЕсдєсєда асасаасада дддасасасас саєсассадс содЕСсаєдед З6бо асадсададе бадааргасее сссадааасуд дасасадтає чдододЕєдадає гддадааасд 3720 чааддаасає сєваєсуєдда сааєдеддаа Сгасесссьса Еддадддааєа 4д 3771 « 2105 52 "211" 1256 "212" Belok "213" Vasii1its5 Epihipdieepviv "4005 D 52

Mee Tpg Bek Avp Akud Guv ABp obi ABp obits Iie I1ie ABp Aza Gay 5eg 1 5 10 15

IT1e Rgo TPg Uaii bek Avp Rgo Bek TPg bip Mee Avzp Gets beg Rgo Avr

Aza Agkud ch11e bets Avr bek Iietsp Suv Uai Ai1a bij Uai Avp Ap I1e Avr 20 35 40 45

Rkgo RiPe Uai bek Aza bek TPg Uai sip TP s1u Iie AvBp I1e Aza 01Uu 50 55 bo

Akud I1e Ggets siu Uaiii Iets b1u Uai Rgo Rpe Aza s1u sip Gay Aia 5eg 65 70 75 80 25 Rpe Tuk bek RiPe Ge Uai siu bij Gay Tgr Rgo bek s1u Agd AvBr Rgo 85 90 95

Ter bish Iie Rbe Gets bitz Ni Ua1i! sitz bip yeets I1e Akd sbip sip Uai 100 105 110

TPgE bis Avp o TBg Agud ABp Ts Aza chI1e Aza Agd iep siy s1u Hey SHU

From 115 120 125

Akud s1u Tug Agd bek Tuk beep beep Aia Iiets bij TPg Ter Gay Avr Avp 130 135 140

Ak Avp o Avr Aza Agud bek Agud bBeg I1e I1e ieyp siy Agud Tugk Ua1 Ai1a 145 150 155 160

Tem bij Ggetsp Avr I1ie TPg TPg Aza I1e Rgo Gay Rpe Akud I1e Agd Avp 165 170 175 bip bij Mai Rgo Gay Ggesh Mee Uai Tug Aza sip Aia Aia ABp Ietsy Niv 180 185 190

Tets IGecp Gay Gay Agud Avr Aza bek Gay Rpe siu bek bij Ter s1u TEPg 195 200 205

Aza bek bek Avr Uai AvBp o beep Tug Tu beep bij sbip I1e Agd Tuk TEG 210 215 220 bi bij Tuk Bek Avp Niv Suv Uai sbip Ter Tug Avp TPg s1u Gay Avp 225 230 235 240

Avp o Gei Akud b1iu TEG AvBp Aia bij bek Tkr Uai Agd Tuk Avp bip Rie 245 250 255

Akud Agud Avr o Gets TBPg o Iets b1i1u Uaiii Iets Avr Gay Uai Aia Gay Robe Rgo 260 265 270 zek Tug Avr TPg Agud TP Tug Rgo I1e ABp TPg bBeg Aza sbip Gay TEG 275 280 285

Akud bij Uai Tug TPg Avr Aza I1e s1u TPpg Uai Niv Rgo Bek sbip Ai1a 290 295 300

Rpe Aia bek TPg TPg Ter Rpe Avp AvBp ABp Aza Rgo Bek Rppe beg Ai1a 305 310 315 320

Iie sbiits Aza Aia Uaii I1ie Agud Rgo Rgo Niv ITetsy Gay Avr Rope Rgo s1ts 325 330 335 bip Gay TPg I1ie Tuk Bek TPg Gay bek Agud Ter bek Avp TPg beep RBe 340 345 350

Mee ABp I1i1e Tgr Aia siu Nibv Agd Gay sitz beg Agd Rgo I1e Ai1a Sh1U 60 355 360 365 zek Gay Avp TPg bek TPg bip biu Bek TPg AvBp TPg bBeg Iiee Avp Rgo

370 375 380

Uai TpPg ge bip Rbe TPg bek Agud Avr ch1I1e Tut Agd TPg bii bek Ietsy 385 390 395 400

Aza si1u Gets AvBp I1e Rpe I1e TBPg bip Rkgo Uai Avp s1iu Ua1i Rgo Tgr 405 410 415

Uai Akud Rpe Avp Tgr Agud Avp o Rgo Gay Ap beg Iets Agud biu bek Ietsy 420 425 430

Tecp Tuk TPpg I1iee s1u Tuk TPg siu Uai s1u TpPkg sip Gay bip Avr 5eg 435 440 445 bij Tk bi Gay Rgo Rgo bij TBg TBg bi Agud Rgo Avp Tugk bij 5eg 450 455 460

Tuk Bek Niv Agd Gets bekg Niv Iie siu Pec I1e bek bek bek Niv Uai 465 470 475 480

Akud Aza Gay Uai! Tuk bek Tgr TPg No Agud bek Aza Avr Agd TPg Avp 485 490 495

TPgE Iie s1u Rgo AvBp Agud TI1e TPg sip I1e Rgo Ai1a Uaii uv S1u Ag4d 500 505 510

Rpe Gay Ribe Avp o biu bek Uai I1e bek b1u Rgo s1u Rpe TPgE s1u schu 515 520 525

Avr Uaii Uai Akd Gay Avp Agud AvBp o Avp s1u ABp o I1e bip Avp Akd s1Uu 530 535 540

Tuk Iie bij Ua1i Rgo I1e bip Rbe TPg bek TPg bek TPg Agud Tug Agd 545 550 555 560

Uai Akud Uai Agu Tug Aia bek Ua1i TPg bek Ii1e bets Iets Avp Uai Avp 565 570 575

Ter b1u Ap bek bek I1e Robe TPg Ap TPg Iets Rgo Ai1a TPg Aza Aia 580 585 590 zek Gay Avr AvBp o Tets bip bek b1i1u Avr Rpe si1u Tug Uai bij I1e Avp 595 bo 605

Zo Avp o AZia Rpe TPg bek Aza TPK s1iu Avp I1e Uaii siu Mai Ag9d Avp Rire 610 615 620 zek Aia ABp Ai1a bis UMai Iie I1e ABr Akd Rpe siy Rpe Iie Rgo Uai 625 630 635 640

TPg Aia TPg Rbe sitz Aia Gguv Tug Avr Gets bitz Agud Ai1a sip Guv Aia

Z5 645 650 655

Uai Avp Aia Gay Rpe TPg bek TPg Ap Rgo Agud Agd Tetsy Guv TPg Avr 6bvo 665 670

Uai TPpgE Avr Tuk Niv Iie Avr beep Ua1i bek Avp iets Uai! Uai Suv Ietsy 675 68 685 vek Avr bij Rope Sub Getsp Avr bij puv Akud bi Hey Rpe siy Guv Uai 690 695 700

Tpuv Tuk Ai1a puv Agud Gay back Avr bij Agud Avp o Gay Gets beep ABr Rgo 705 710 715 720

Avp o Rpe TPg Rbe I1e ABp b1u bip Rgo back Rpe Aia b5Beg Iie Ar 0Щ1U 725 730 735 beep back Avp Rpe TPg bBeg Iie AvBp bis Hey back Ap o Niv s1u Tgr Tgr 740 745 750 bi1u vek Ai1a Avp Uai TPg Iisipbe1 u si Aup Avr Uai Ribe Gpuv b1its 755 760 765

Avp oTuk Uai TBg Hey Rgo siu TPg Rpe Avp bij Suv Tuk Rgo Avp Tug 770 775 780

Tecp Tuk beep puv Iie si1u bij Bek bij Gay puv Aia Tug TPg Agd Tug 785 790 795 800 beep tey Akud siu Tug Iie bij Avr bek beep Avr Hey siy I1e Tukg Ieeets 805 810 815

I1e Akud Tug ABp Asia Guv Niv bis TB Tetsy Ap Uai Rgo s1u TPg sats 820 825 830 zek Gay Ter Rgo Iets bek Uai bis bek Rgo I1e s1u Agd Suv s1u bij 835 840 845 (516) Rgo Avp Akud Suv Asia Rgo Niv Rpe s1u Ter ABp Rgo Avr Gay Avr Suv 850 855 860 zek Suv Agd AvBr Agd bicp Guv Suv Aza Niv Niv bek Niv Niv Roe TEG 865 870 875 880

Tets Avr I1i1e Avr Ua1i s1u Suv TPg Avr Gay bip sii Avr Gets sSiu Uai 885 890 895

Ter Mai Uai Rbe Guz I1e Ppuv TPg sip sit bi1u Tuk Aia Agkd Ieshp 0Щ1U 900 905 910

Ap oh gay sit Rbe I1e b1itsp bij pub Rgo Iietsp I1i1e sS1u si Aia Gay 5eg 915 920 925

Akud Ua1 puv Agud Aia bish Guv puv Tgr Agud Avr o Guv Agud bij pub Iey 930 935 940 bip Maiii bij TPpg Gpuv Agud Ua1i Tu Iie AvBr Aia Ppuv bis Aza Ua1i Avr 945 950 955 960

A1i1a gay Ribe Uaii Avr back beep Tut Avr Agd Gay beep Aza Avr TPg Avp 965 9370 975

Iie s1u Mee I1e Ni5 Aza Aza Avr Agud Iiei Uai Nibv Agud I1e Niv s1tsi 980 985 990

A1ia Tuk Gay Rgo bis ITets Rgo Rpe I1ie Rgo biu I1e ABp Uai Uai I1e 995 1000 1005

Rpe bis bi gay bii Avp Agud o I1e bek TPg Aza Rpe bek Iets Tug 1010 1015 1020

Avr Aza Agud Avp o Uai Iie puv Avp o sb1iu Avr Rpe A5p o AvBp s1Uu Gay 1025 1030 1035

TPE Suv TeEr AvBp Uai Ppuv siu Niv Uai bis Uai bi1ip Sbip Gets Avp 1040 1045 1050

Avp oNiv Agud bek Uai Gay Uai Iie Rgo bij Tgr bi Aia si Uai 1055 1060 1065 zek bip Ppuv Uai Akud Uaiii Suv Rkgo b1u Agud siu Tuk I1e Te Ag4d 1070 1075 1080

Uai TpPg Aia Tuk guv bi s1u Tuk b1u b1p sb1u Suv Uai TPkgE I1e

From 1085 1090 1095

Niv bets Mai Avr Avp Avp o TPg o Avr obip Gets Gu Rope Bek Avp Suv 1100 1105 1110 bi guv s1i1u bip Uai Tuk Rkgo s1i1u ABp TPg I1e Aia Suv ABp Avr 1115 1120 1125

TUk Avp o Tuv ABp oniv s1u Aia Avp Aia Sub bek bek Agd Avp Agd 1130 1135 1140 bi1u Tuk Avr bis Robe Tuk b1u Avp TPg Rgo A1i1a AvBr Tuk bek A1a 1145 1150 1155

Avp obip o puv bi Tuk s1u s1u Aia Tug TPg bek Niv Avp Niv A1a 1160 1165 1170

Tuk b1u bii bek Tu bi Bek AvBp bek Bek Iie Rgo Aa ABvr Tug 1175 1180 1185

Aza Rkgo Uai Tu bij bish bij Aia Tug TP Niv b1u Agd Akd 01Uu 1190 1195 1200

Avp obBek Suv bis Tuk Avp Akud biu Tuk TPg Rgo Te Rgo Aia s1Uu 1205 1210 1215

Tuk Uai1 TPg Aza siy Gay bij Tuk Rore Rgo b1p TPg Avr Ts Uai 1220 1225 1230

Ter Ua1 s1sh I1e s1u bi Tpkg bij sb1u TPps Rpe Iie Uai AvBr Avp 1235 1240 1245

Uai bish Hey Iey Ge Meye si si 1250 1255 "2105 53 "2115 3714 "212" DNA "213" Vasii1its5 Epigipdieepviv "4005 53 (516) Esdaassesaa aeyaddaaaaava Sdadaa assasachasud sseyesasevaye esssoosadtga (216)

EssaayedadeE seEdeEsasaae seESeaaadaa Sbasdsasaaa saaaesaayess asaaaaaae 120 adsaeedadcha ayegdChdEyeseeeeeded bayesadssdaa ddddaasasa Ssdayessayess sdssadsodvsa 180

Есаасадесс ааасоддодадає бадеасєсодсс ддасадаастає єдоддеЕЧдчтаєє аддеєдедссд 240 гЕєдссоудас аастадстад ЕСЕЄрараді сЕсСаєтЧЕеЕЄЧ деЕдааєсаєдд дсссаааддс Зоо ачадассаає додааавєєеєє вєаєддаасає дсадаасаас Ссдсаадаса асааасааса 3З6о чдсааасдста дддаасасддс ссЕсСдсссда Сгасааддсє Садчдадарєс сеЕссададсесс 420

Bayesaasade saseeedaada eedodssadad aassdsaasd asdsaadaas dadaadesdoss 480 sSEEevavaseis aagagayeads seEgadadsse daveeeeeeesyaa asodsddayedss dsEsEssdsa 540 ayeaadadads aadadeEess seEsayesaaedd dsasasdsss aadssdsaaa sssdsassta 60

Ebayesaeeda dadasdsesees ssEeEesaeduae sayedaasso doadseesassees ssaadaaasse 6bo saasdeEeaseE asooaasdssa adsadaaada asdachododass ayesedassa SEdsdeEdsaa 720

Eddsayeaasa sodddeESsStaaa bEaaseEsaada dddasaaasd ssdaaadessda ddadsdsdatagae 78o0 aayesaaeeess deadadassya aasayesaddad dsassadayes sadsddsaso aresssaads 840

Баєдасасес дсасеєсаєсс аасааасасду адсдсссадс Саасааддда адесссагсаса 900 часдсааєєд дадсаасадд додсааасаєд дсаадсаєда ассддсаєсаа Саасааєсдса 960 сСсСЕсСсСЯЄЕсЕ ссоостаєбада дассдсдуаєЕ асссдаадсс сдсаєстасе єдаєєееста 1020 даасаасеєва ааарсеЕсвад сдсЕєссаєса сдаєддадса аєассаддса гаєдасесає 1080 бдасодддддс асасдаєсеєса ассєсддсса агаададуддд саєєааєвас сессдасасасєс 1140 ддааасасса аграсесеєстає гаассседна асаєсссаде ЕсссдЕсссу адасуаєесає 1200 аддасеєдаає сасаєсдсаду адеЕдсееєЕСста соддооадааєсс ассеЕєдаасс баєсесаєдЧе 1260 дЕЄССТасвуд Єсадаєстаа ЕСЕсаддаас ссссадааса сЕсеєсдааад аддасаседсе 1320 аастасадес аасссраєда деЕсассвддд сЕссааєсаа аадаєєсада аассдааєта 1380 ссассадааа саасадаасуд ассаааєтає дааєсаєбаєса дссагадаєс ассесасаєва 1440 чадаєсаєесє сасааастад дЕєдааєдна ссдубасаєє сеЕсддасодса Есудсадедса 1500 чаєсдбрасаа агасааєсєду ассаааєада аєсасеєсааа ЕЄсСсеЕдсадеі даадддааас 1560

SsSEEESEEsSeeEsa asodeEsstdeE aayeseyesadda ssaddaeesa ssoddeEddaddda sEsadeEsada 1620

Yebaaaaaava deEddaaaaa baseysaaaae aaddstaayes EeChdaddesess aasesaayees 1680 asaesdasaye srassadayesa EsdchadeEeeesue degasdesesased sEssedsaas sssdayesesas 1740 sESadeEdEeEsa aseddddudbaa eYessaaaasase esEeEesssadsa sadesessads sSasadseyedsd 1800

Yesayesadava ayestasaayes aadddayess douastayesesdd aaadsassaa Edsayesasa 1860

Zo Yesedsaasad deaaesdsadeE addedsaada aaseEstadesd aaaaesdssad adeEdaessaayea 1920 chasadayeevd aaseEsaeyss adesasedsa asseEssdaad sadaaeasda EsgEadaaad 1980 dsdsaadadd soddEdaaeds ESEDEsvasoi aasasudaaes saadaadase daaaasadae 2040

ChdEdasadaee aeysasaeeda Esaadeayess aagstadeEdd sdedeEeesayes dodaesdaass 2100 bdsEsadaed aaaadadada aeystasesedad aaadsdaaae ayedsdaaasu asEsadedaye 2160 daaadaaass Saseyessaada Essaaasses asayessaesa asaadsaass adaseEessaea 2220

Есвасвсааєд адсааєсудаа ЕЕссасаєсті асссаєдаас аасседааса соддаєдаєда 2280 чдаадедада асаєсасаає ссаддаадда аасдасдрає Єсааададаа Есасудєсаса 2340 сеЕассаддба сегаєааєда деЕдеЕваєссу асдєаєєває ассаааааає аддададесд 2400 чааєєсаааад сеЕсасасьсу ссассааєта ададдеЕсаєса Єєдаадаєад Есаадаєєста 2460 чачаєавєаєсє Єдчаєссудеєса єааєдсдааа саєсдааасає ЄдчдаєдеЕсєсс аддсассдад 2520

Ессудбаєддс сЯсЕсЕСсСаде Едааадссса аєсадааддЕ дсддадаасс дааєссдаєдс 2580 дсассасаєє єЕдааєддаа Ессєдаєста дасєдеЕссся дсададаєду адаааааєде 2640 дсдсаєсавс сссаєсаєсє сЕСЕЄсоодає асеєдчаєдеЕвєд даєдсаєрада сЕєсЄдсаєдад 2700 аассвєаддсд ЕдеЕддЧдєдадЕ асеЕсаадаєс аадасудсадуд ааддесаєдс аадассаддад 2760 аассєддаає Сваєсоаада дааассаєта Ссаддадаад сасєдеЕсСьсЯя єдЕЧдаадада 2820 чдсададаааа ааєддадада сааасдсдаа ааассасаасє Сддааасааа асчадсагсає 2880 асададдсаа аадаадсеЕдЕ ддаєдсеЕсвта СЕсСЧдсадаєє сеєсаавгаєда гадаєсасаа 2940 дсоддабасаа асаєсдддсає даєєссаєдсд дсадаєааас ЕєдДдЕссаєсу ааєссдадад Зоо дсавгаєсеЕс садааєсаєс єдЕеЕсаєссса дуаєдсаааєд содддаааєтєсе гЕдаадааєта З06о чааддеЕсдса Єсаєсаседс ааєсеЕсссста гасдаєдсда даааєдеЕсудє Саааааєсоде 3120 чаєєєсаава аєддаєсадс аєсдседдаає деЕаааадддс аєдеадаєде асаасададс 3180 саєсассуєеЕ седсссеЕсдЕ баєсссадаа Едддаадсад аадсдссаса адсадеєсдс 3240 дЕСЕдДЕеЕСсСсЯд доасуєЄдоасса баєсссссує деЕсасадсудє асааададудд агаєддадад 300

ЧчєЕдеЕдсаа сдаєссаєда ааєссдадаас аасасадасу аасеєаааасе гаааааседе 3360 чдаачаададу аадедбаєсс аасуддаєбаса ддаасуєдса аєдаєтаврас єдсасассаа 3420 чддабасадсад саєдсааєсс ссудєааєдсс ддаєаєдадчча аєдсаєаєда адеЕсдатвасе 3480 асадсаєсьд ЄЕаасвасаа ассдасеєває даадаадааа судбасасада Едгасдаада 3540 чаєааєсаєє деЕдааваєда сададдуаєає деЕдааєсаєс сассадсасс адссддеЕсає З6о0 аєдасаааад аасрадааса сеЕссссадаа ассудаєаад баєддаєєда даєсодадаа З6бо (516) асдддчааддда адсеєсасеєдЕ адасадсудєд дааєсасссс сєгаєддаадда Hagad 3714

"2105 h54 "211" 1237 "212" Protein "213" Vasii1its5 Epigipdieepviv "4005 54

Me Avp Bek Ap Agud Guv Avp obi Avp obits I1e I1e ABr Az1a bek RPe 1 5 10 15

IT1e Rgo Aia Uaiii bek AvBp bii bek Uai TPg I1i1e bek Gguv bii Tug Ai1a 20 25 30 bip TpgE Avp obip Gay bip Avp Avp bBeg Iie bij Avr siu Gets Suv I1e 35 40 45

Aia sitz s1u bits Tuk I1e Avr Rgo Rpe Ua! back Aza Back TPg Ua1! sip 50 55 bo

TPE b1u Iie bek Iie Aia s1iu Agud Iie Hey s1iu Uai Iets s1iu Uai Rkgo 65 70 75 80

Rpe Aia siu bip Iiets Aza bek RoPe Tug bek Rpe Iie Ua1i s1u siy GIets 85 90 95

TER Rgo puv s1u Agd Avr bip Ter siy Ii1e Rre Mee bitsh Niv Ua1i s1y 100 105 110 bip Gay Uaii Agud sbip bip I1ie TPpg Aza Av5p Aza Agud Ap o TBPg Aia Iey 115 120 125

Aza Akd Gets bip sb1u Iiets b1u Avr bek Rpe Agud Aza Tug bip bip b5eg 130 135 140

Tem bij Avr Ter Gay bij Avp Agkud Avp Avr Aza Agud TBg Agud bek Uai 145 150 155 160

Tecp Tuk TPpg sip Tug Iie Aia Hey fight Hey Avr Robe Gets AvBp Aia Mee 165 170 175

Rgo Gets Rre Aia I1e Akd bij bip bits Mai Rkgo Gay Gays Mee Ua1 Tug

From 180 185 190

Aza sip Aia Aza ABp o Tets Ni Gets Iets ITetsy Iiey Agud Avr Aia bek Ieets 195 200 205

Tuk b1u Akud siy Rbe siu Tets TPg bek bip bis I1e bi1ip Agud Tug Tug 210 215 220 sich Agud bip Uai bij Akud TBg Akud AvroTug bBeg Avr Niv Suv Ua1i sip 225 230 235 240

Ter Tuk Avp o TPg s1u Gets AvBp Avp Gay Agud biu TPg ABp Aza siy 5eg 245 250 255

Ter Uai1 Akud Tug Avp obip Rbe Agud Agud Avr o Tets TPg Iets bi1u Uai Ietsy 260 265 270

Avr Gay Uaii Aia Ietsy Rpe Rgo bek Tug Avr TPg Agud TPg Tuk Rgo I1e 275 280 285

Avp oTPg bek Aza bip yetsyp TPg Agkud bis Uai Tuye TPpg AvBr Aia She 0Щ1U 290 295 300

A1ia TPKg siu Mai AvBp Mee Aia bek Meyese Avp Tgr Tug Avp Avp Ap A1a 305 310 315 320

Rkgo Bek RiPe bek Aia I1e siy TBPg Aza Uai I1ie Agud Bek Rgo Niv Iets 325 330 335

Tets Avr Rpe Gay bi bip Gay Ppuv Iie Rpe bBeg Aia bek bBeg Agd Tgr 340 345 350 vek Avp TPg Agud No Mee TPg Tug Tgr Agkud s1u Niv TPg I1e sip b5eg 355 3Z6o 365

Akud Rgo I1e Agud biu Aia Iieetsp I1e TPg bek TPg Niv s1u AvBp TPg Avp 370 375 380

TPg Bek Iie Aup Rgo Ua! TP Rpbe bip Rpe Rgo back Agud Avr Ua1i Tug 385 390 395 400

Akud Tk bis bek Tug Aia s1u Uai Ietsyts Ietsyp Ter s1u I1ie Tug Gay sits 405 410 415

Rgo I1ie Niv siu Maii Rkgo TPg Uai Agd Rpe AvBp Rpe Agud Avp Rgo sip 60 420 425 430

AvpoTPE Robe bitz Agud b1u Tpg Aza AvBp o Tug bek bip Rgo Tu bij b5eg

435 440 445

Rkgo s1i1u Petz bip ITets Guv Avr bek bits TPg bij Gay Rgo Rgo bij TEG 450 455 460

TPgE bi Agud Rgo Avp o Tug bec bek Tukg bek Nibv Agd Ietsy bek Niv She 465 470 475 480 sb1u I1e I1e Gay sbip TPg Agud Gay Avp o Ua1i Rgo Ua1 Tuk bek Tgr TEPg 485 490 495

Niv Agud bek Aza Avr Agd TBPg Ap o TBg I1e b1u Rgo ABp Agd Te TPg 500 505 510 sip I1ie Rgo Aia Uaii Ppuv biu Avp Hey Gay Rpe Azp siu bek Uai Pe 515 520 525 zek s1iu Rgo biu Rpe TPpg siu b1u Avri Uiets Agd Hey Avp Avp beg 530 535 540 b1u AvBp ABp o ch1I1e bip Avp Agud siu Tuk Hey fight Ua1i! Rgo I1e sip RBe 545 550 555 560

TPg Bek TPg bek TPg Agud Tug Agud Uai Agkd Uai Agud Tug Aza bek Uai 565 570 575

TPE Rgo Iie Niv Ggets bek Uai Avp Ter b1iu Avp bBeg AvBp I1e Rppe 5eg 580 585 590 zek TpPg Uaii Rgo Ai1a TPg Aza Aza bek Tetsy Avr ABp Gay sip beg Agd 595 bo 605

Avr Rpe siu Tuk Rore bit bek TBPg AvBp Asia Rpe TPg bek Uai TP sh1U 610 615 620

Ap oUai1! Uai siu Uai Agud Avp Rrbe bek bij ABp Aza Agud Uai te Pe 625 630 635 640

Avr Akud Rpe bitz Robe I1e Rgo Ua! TPg Aza TPg Rpe soi Aia soi Tug 645 650 655

Avr gay sbits Agud Aia bip bij Aza Uaii AvBp A1i1a Gay Rpe TPg Avp TP g 6bvo 665 670

Zo Avp oRgo Akud Akud Gay pub TpPg Avr Uai Tibg Avr Tukye Niv I1e Avr sip 675 68 685

Uai Bek Avp Ge Ua1 Aia Sub Gay back Avr bis Robe Sub5 Ietsy ABr si1y 690 695 700 pub Akd bij Gay Gay bij puv Uaii Ppuv Tug Aia puv Agd Gay bBeg Avr 705 710 715 720 bi Agud Avp o Hey Gay bip Avr Rgo Avp Rpe TPg back I1i1e Avp Guv beep 725 730 735

Rgo Avr Ripe I1e bek TPg Avp o bis bip bek Avp Rpe TPg beg I1e Niv 740 745 750 siy bip bek bis Niv s1u Ter Tkgr biu bek bii Ap I1e TPg I1e sip 755 760 765 bi b1u Avp Avr Uai Rpe puv bij Avp Tug Ua1i TPg Ietsy Rgo s1u TPg 770 775 780

Tuk Avp bitz Suv Tuk Rgo TPg Tuk Gay Tug bip uv I1e sS1u siy 5eg 785 790 795 800 bip TGeshp puv Aia Tug TPg Agud Tu bip Gay Agud bi1u Tuye I1e siy Avr 805 810 815 zek bip Avr Tec bitsh I1e Tuk Iets I1e Agud Tug ABp Aia Ppuv Niv sic 820 825 830

TPE Ггецп Авр Уа1! Rgo si1u TPkK bit bek Ua1i Ter Rgo Gay bek Uai si1ts 835 840 845 zek Rgo I1e Agd Agd Suv b1u bets Rgo ABp Agud Suv Aza Rgo Niv Riye 850 855 860 bits Ter Avp o Rgo Avr Gay Avr Suv Bek Suv Agd Avr b1u siy Ppuv Suv 865 870 875 880

Aza Niv Niv bek Niv Niv Rpe beg Iets Avr I1e Avr Ua1i s1u Suv She 885 890 895

Avr Hey Niv bis AvBp o Tec bi1u Uaii Ter Uai1i Ua1i Rpe Ppuv I1e Puv TEPg 900 905 910 (516) sip bis b1u Ni Aia Akd Hey biu ABp Hey siy Rpe I1e sit si Guv 915 920 925

Rgo Gets Gets biu b1its Asia Gay back Agud Uai1 puv Agud Aia si Gpuv Guv 930 935 940

Ter Agud Avr pub Agud bis Gu Gay sbip Gets bis TP Guv Agud Ua1i Tug 945 950 955 960

TPE bitz Aia puv bij Aza Uai Avr Aia Getsy Rre Uai Avr bek sip Tug 965 970 975

Avr Agd Gets bip Aza ABr TPg AvBp o I1e s1u Mee I1e NivB Aza Aia Avr 980 9385 990 uv IGecp Uai Niv Agud Iie Akud sitz Aia Tuk Gay back bij TGecp bek Uai 995 1000 1005

I1e Rgo si1u Uai ABp Aia biy I1e Rpe siy biy geish bi s1u Agd 1010 1015 1020

I1e I1ie TPg Aia Iie bek Gets Tug Avr A1i1a Agud AvBp o Uaiia Uai Guv 1025 1030 1035

Avpobiu Avr Rbe Avp Avp biu TIetsy Aia Suv Ter Avp o Uai puv U 1040 1045 1050

Niv Uai Avr Uai sbip beep back Niv Nibv Agd bek Uai IGec Uai I1e 1055 1060 1065

Rgo fight Ter fight Aia fight Uai! Beck Bip A1a1a Uai Agd Uai Sut Sut 1070 1070 1075 1080 B1U AKUD SIU I1E TIA AKD UAI TPPG AZA TUK PUV BI S1U TUug 1085 1090 1090 1095 Rpe iuv AvBp o Suv bi bij bij bij Uai Tuk Rgo TPg 1115 1120 1125

Avr o TPg s1u TpPg Suv Avp Avro Tug TPg Aza Niv sbip s1u TPg A1a 1130 1135 1140

A1ia Suv Avp o bBeg Agud ABp Aia siu Tu 611 Avr Aia Tuk sbits Uai

From 1145 1150 1155

Avr TPg Tpg Aza bek Uai Avp o Tukg puv Rgo TPg Tu bi sbits s1ts 1160 1165 1170

TPg Tuk TPg Avr Uai Agud Agd Avr AvBp o Nibv Suv bij Tukg Avr Agd 1175 1180 1185 siu Tuk Mai Avp Tuk Rgo Rgo Uaii Rgo Aia si1u Tuk Mee Tk Guv 1190 1195 1200 bi yGeshp bis Tuk Rbe Rgo bij TPg Avr puv Uai Ttr Iie siy Pe 1205 1210 1215 sbi1u b1y TB bis b1u pub Rpe Iie Uai Avr bek Uaiii bij Getsy Gay 1220 1225 1230

Tem Maye this January 1235 "2105 shMO55 "211" 650 "212" Belok "213" Vasii1its5 Epigipdieepviv "4005 5:55

Mee Tpg Bek Avp Akud Guv ABp obi ABp obits Iie I1ie ABp Aza Ua1i 5eg 1 5 10 15

Avp oNiv bek Aza bip Mee Avr Hey Gay Rgo Avr Aza Agud I1e bij Avr 20 25 30 zek Gets Suv I1e Ai1a bij sb1u AvBp ABp I1e Avr Rgo Rpe Uai1i bBeg Ai1a 35 40 45 zek TPg Uai bip Ts b1u I1i1e ABp I1isi1 Ague Ai I1e Gets Ssi1u Uai 50 55 bo

Tets b1u Mai Rgo Rpe Aia siu sip Gesh Aia bek Rpe Tuk bek Rpe Iey 65 70 75 80 (516) Uai b1u bets Hey Ter Rgo Agud b1u Agd Avr bip Tgr bij I1ie Ribe Ietsy 85 90 95 bi Niv Uai siy sbip Hey Iie ABp sbip sbip I1e Tbg siy AvBp Aza Agd 100 105 110

Ap oTpg Aza Gets Aza Agd Iiep sbip siu Hey b1u Avr Bek Rpe Agud Ai1a 115 120 125

Tuk beep beep back Tey bis Avr Tgr Getsp bij Avp Agud Avr Avr Aia Agd 130 135 140

TPg Agud Bek Uai Gets Tug TPg bip Tug I1i1e Aia Iiets bij Gay Avr RBIGe 145 150 155 160

Tets AvBp Aza Mee Rgo Gay Rpe Aza I1i1e Agd AvBp bip sats Uai Rgo Iey 165 170 175

Tecp Mee Uai Tu Aza bip Aza Aia Avp Gay Niv Gay Gay Gay Ietsy Agd 180 185 190

Avr Aia bek Gets Rre bi1iu bek bis Rre b1u Gay TPg Bek bip bij I1e 195 200 205 sip Akud Tuk Tuk bij Akud bip Ua1i bij Agud Ts Agu Avr o Tug bek Avr 210 215 220

Tuk Suv Ua1 siy Ter Tug Avp o TPg siu Gets Avp beg ITetsy Agd s1u TPg 225 230 235 240

Avp Aza Aza bBeg Tgr Uai Agud Tut Avp o bip Rpe Agd Agud Avr Gay TEPg 245 250 255

Tets b1u Mai Gay Avr Gesh Uai Aza Gay Rpe Rgo bek Tug Avr TPg Agd 260 265 270

TPE Tuk Rkgo Iie Avp TPg bek Aza sbip Gets TBg Agd bis Uai Tukyek TPg 275 280 285

Avr Aia Iie si1u A1i1a TPg siu Mai Avp Mee Aza bek Mee Avp Tgr Tug 290 295 300

Avp o Avp o Avp Aza Rgo bek Rpe beg Aia I1e siy Aza Aza Aia I1i1e Agd 305 310 315 320 zek Rgo Niv Iets ITec Avr Rpe Iiets bis bip Hey TPg Iie Rrpe beg Ai1a

Zo 325 330 335 zek Bek Agd Tgr bek AvBp TPg Agud Ni Mee TPg Tug Ter Agdud s1u Niv 340 345 350

TE Iie sbip bek Agud Rgo I1e siu siu sbiu Iets AvBp TPg bBeg TPg Niv 355 3Z6o 365 s1u Aia TPg AvBp oTPg obek I1e Avp Rgo Ua! TPg Gay Akud Rbe A1ia 5eg 370 375 380

Akud Avr o Uai Tut Agkd TPg bij bek Tug Aia si1u Uai Iey Gay Ter 01U 385 390 395 400

ITIe Tuk Gets bit Rgo I1e Niv siu Maii Rkgo TPpg Uai Agud Rpe Avp Riye 405 410 415

TPE Avp Rgo bip Avp I1e bBeg Avr Agud biu TBPg Aza ABp Tug bek sip 420 425 430

Rkgo Tuk bec bek Rkgo b1i1u Hey bip ITetsshs Guv Avr bek bi TPg siy Gets 435 440 445

Rgo Rgo fight TPg TP fight Agu Rgo Ap o Tug fight bek Tuk bek Niv Agd 450 455 460

Tecp back Niv Iie s1u Iie Iie Gay sbip Bek Akud Uai Aup Uai Rgo Uai 465 470 475 480

Tuk Bek Ter TPg Niv Agd bek Aza Avr Agud TPg ABp o TPg I1e sS1u Rgo 485 490 495

Ap Agud ch1I1e TBg o bip I1e Rgo Mesye Uaii Guv A1ia bek bij Hey Rgo sip 500 505 510 bi1u TPpg TpPg oUai Uai Agu s1iu Rgo siu Rpe TPg siu s1iu Avr I1e Iey 515 520 525

Agud Agud TVg AvBp Tk b1iu s1u Rpe s1iu Rkgo I1i1e Agud Ua1i TPg Ua1! Avp 530 535 540 b1u Rko Gay TPg sbip Agud Tug Agud I1ie s1u Rpe Agkud Tug Aza bek TEG 545 550 555 560

Uai Avr Rpe Avr Rpe RibPe Uai Bek Akud siu biu TPg TPg Uai Avp Avp 60 565 570 575

Rpe Agud Ribe Tets Agd TPg Mee AvBp bek b1u Avr siy Gay Gpuv Tu Sh1U

580 585 590

Ap oRpe Uai Agud Agd Asia1a Rpe TPg TPg Rgo Rpe TPg Rpe TPg sip I1e 595 bo 605 bip Avr chI1e I1e Agu TPg bek Iie sip siu Hey bek s1u AvBp b1iu bij 610 615 620

Uai Tuk I1ie Avr puv Iie sitz Iie I1ie Rgo Uai TPg Aza TPg Rpe sites 625 630 635 640

Aia sii Tug Avr Tets b1its Agud Aia sip sii 645 650 "2105 56 "2115 655 "212" Belok "213" Vasii1its5 Epigypdieepviv "4005 MYA56

Has TPg Bek Avp Agud pub Avp obi Avp obits I1e I1e ABp Aza Iets 5eg 1 5 10 15

IT1e Rgo TPg Uaii bek Avp Rgo bek TPg bip Mee Avp Gets beg Rgo Avr 20 25 30

Aza Agkud ch11e bis Avr bek Iiietsp Suv Uai Ai1a bij Uai Avp Ap I1e Avr 35 40 45

Rkgo RiPe Uai bek Aza bek TPg Uai bip TPg s1u I1ie Avhp I1e Aza 01Uu 50 55 bo

Agud chI1e Gay siu Uaii Geip siu Maii Rgo Rbe Aia siu sbip Gay Aia 5eg 65 70 75 80

Rpe Tuk bek Ripe Iets Uai si1u bets Ietsy Ter Rgo bek S1u Agd AvBr Rgo 85 90 95

Ter bish Iie Rbe Gets bitz Ni Ua1i! sitz bip yeets I1e Akd sbip sip Uai

From 100 105 110

TPgE bis Avp o TBg Agud ABp Ts Aza I1e Aza Agd geish sitc s1u Gets s1Uu 115 120 125

Akud s1u Tug Agd bek Tuk beep beep Aia Iiets bij TPg Ter Gay Avr Avp 130 135 140

Agud Avp Avr Aza Agud bek Agud bek I1e I1e Getsp siy Akd Tug Uaii Aia 145 150 155 160

Tets b1p Hey Avr I1ie TPg TPg Aza I1ie Rgo Hey Robe Agd I1e Agd Avp 165 170 175 bi bij Mai Rkgo Hey Ge Mee Ua! Tug Asia beep Aza Aza ABp Gay Niv 180 185 190

Tets Getsp Gay Gay Agud Avr Aza bek Gay Rpe siu bek bets Tgr s1u Mee 195 200 205

Aza bek Bek Avr Uai AvBp o beep Tug Tuye beep bish sbip I1e Agd Tuk Ts 210 215 220 si bij Tuk Bek Avp Niv Suv Ua1i bip Ter Tuk Avp TBPg s1u Gay Avp 225 230 235 240

Ap o hey Agud biu TBg ABp Asia1a biy bek Ter Hey Agud Tut AvBp o bip RBe 245 250 255

Akud Agud Avr o Gets TBPg o Iets b1i1u Uaiii Iets Avr Gay Uai Aia Gay Robe Rgo 260 265 270 zek Tug Avr TPg Agud TP Tug Rgo Iie ABp TPg bek Aza sbip Gay TEG 275 280 285

Akud bij I1e Tug TBg Avr Rgo I1e s1u Agd TPg ABp Aza Rgo Beh 0Щ1U 290 295 300

Rpe Aia back TPg ABp o Ter Rpe Avp Avzp Avp Aza Rgo back Rope beg A1a 305 310 315 320

Iie sbits Aza Aza I1e Rpe Agud Rgo Rgo No IIetsp Gay Avr Rpe Rgo sats 325 330 335 bip Gay TPg I1ie Tug Bek Aia Bek Bek Agud Ter bek bek TPg beep Niv 60 340 345 350

Mee Avp Tug Ter Ua1 si1u No Agd Gay Avp Do Agd Rgo I1e S1u Shchu

355 3Z6o 365

TPE Gay Avp o TBPg back TPg bip s1iu Gay TBg AvBp AvBp Ts bek I1e AvBp 370 375 380

Rkgo Uai TPg Iiets bip Rpe TPg o bBeg Agd Avr Uai Tug Agud TPg siy b5eg 385 390 395 400

Ap Aza s1iu TPg AvBp o I1e Gay Robe TPg TP Rgo Uai Avp s1iu Ua1 Rgo 405 410 415

Ter Aia Akud Robe AvBp Robe I1e Av5p Rgo bip ABp I1e Tugye bij Agd Sh1U 420 425 430

A1ia TPg Tpg Tuk back beep Rgo Tuk sip siu Uai s1u I1e sip Tei Rie 435 440 445

Avr Bek bet TPg bet Tets Rgo Rgo bets TPg Tpg bij Agud Rgo Avp o Tug 450 455 460 bet bek Tuk Bek Niv Agd Gay bek Niv Iie siu Gay I1e I1e S1Uu Avp 465 470 475 480

TPg geish Agud Aza Rgo Uai Tuk bek Ter TPg Nibv Agd bek A1a Avr Ag4d 485 490 495

TPE Ap o TPg Iie s1iu Rgo ABp Agud I1e TBg o bip I1e Rgo Gay Ua1i Guv 500 505 510

A1ia Gay Ap o Tetsy Niv bek siu Uaii TPg Ua1! Uai s1u s1u Rgo s1u RiPe 515 520 525

TP s1u s1u Avr Ii1e Gets Agd Agud TBg Avp TB b1u Ts Rpe sS1Uu Avr 530 535 540

I1e Agd Gets AvBp o I1e ABp Ua! Rkgo Iets back beep Agud Tug Agd Ua1 Agd 545 550 555 560

I1e Akud Tut Aza bek TPg TPg Avr o Tets bip Rpe Rpe TPg Agud I1e Avp 565 570 575 bi1u TPpg TpPg oUai Avp chI1e si1iu Avp Rpe bBeg Agud TPg Mee Avp Agd 01Uu 580 585 590

Zo Avr Avp Gay fight Tug Agud bek Rpe Agud TPg Aza s1i1u Rpe bek Tik Rgo 595 bo 605

Rpe Avp Rbe Tets AvBp Asia1a beep back TPg Rpe TPg Hey s1u Aia sip b5eg 610 615 620

Rpe bek Avp o bip bits UMai Tug I1e AvBr Akd Uai siy Rpe Uai1i Rgo Ai1a 625 630 635 640 bi Mai TPpg Rpe bij Aza siy Tug Avr Hey siy Agud Aia bip Guv 645 650 655 "2105 557 "2115 655 "212" Protein " 213" Vasii1its5 Epigipdieepviv "4005 57

Mee Tpg Bek Avp Akud Guv ABp obi ABp obits Iie I1ie ABp Aza Gay 5eg 1 5 10 15

IT1e Rgo TPg Uaii bek Avp Rgo Bek TPg bip Mee Avzp Gets beg Rgo Avr 20 25 30

Aza Agkud ch11e bis Avr bek Iiietsp Suv Uai Ai1a bij Uai Avp Ap I1e Avr 35 40 45

Rkgo RiPe Uai bek Aza bek TPg Uai sip TP s1u Iie AvBp I1e Aza 01Uu 50 55 bo

Akud I1e Ggets siu Uaiii Iets b1u Uai Rgo Rpe Aza s1u sip Gay Aia 5eg 65 70 75 80

Rpe Tuk bek RiPe Ge Uai siu bii Gay Tgr Rgo bek s1u Agd AvBr Rgo 85 90 95

Ter bish Iie Rbe Gets bitz Ni Ua1i! sitz bip yeets I1e Akd sbip sip Uai 100 105 110

TPgE bis Avp o TBg Agud ABp Ts Aza chI1e Aza Agd iep siy s1u Hey SHU 60 115 120 125

Akud s1u Tug Agd bek Tuk beep beep Aia Iiets bij TPg Ter Gay Avr Avp

130 135 140

Ak Avp o Avr Aza Agud bek Agud bBeg I1e I1e ieyp siy Agud Tugk Ua1 Ai1a 145 150 155 160

Tets b1p Gay Avr I1ie TPg TPg Aza I1ie Rgo Gay Robe Agd I1e Agd Avp 165 170 175 bis bij Mai Rkgo Gay Ggesh Mee Uai Tug Aza sip Aia Aia ABp Iets Niv 180 185 190

Tets Getsp Gay Gay Agud Avr Aza bek Gay Rpe siu bek bets Tgr s1u Mee 195 200 205

A1a bek bek Avr Uai AvBp sbip Tuk Tuk bij sbip chI1e Agud Tuk TPg 210 215 220 bi bij Tuk Bek Avp Niv Suv Uai sbip Ter Tug Avp TPg s1u Gay Avp 225 230 235 240

Ap oh hey Agud biu TBg ABp Aza bitz bek Tegr Hey Agud Tug Avp bip Re 245 250 255

Akud Agud Avr o Gets TBPg o Iets b1i1u Uaiii Iets Avr Gay Uai Aia Gay Robe Rgo 260 265 270 zek Tug Avr TPg Agud TP Tug Rgo I1e ABp TPg bBeg Aza sbip Gay TEG 275 280 285

Agud bij Iie Tug TPg Avr Rgo Iie s1u Akud TBg ABp Aza Rgo bek 01Uu 290 295 300

Rpe Aia bek TPg Avp o Tegr Rpe Avp AvBp ABp Aza Rgo Bek Rppe beg Ai1a 305 310 315 320

Iie sbits Aza Aza I1e Rpe Agud Rgo Rgo No IYetsp Gay Avr Rpe Rgo sats 325 330 335 bip Gay TPg I1ie Tug Bek Aia Bek Bek Agud Ter bek bek TPg beep Niv 340 345 350

Mee Avp Tug Ter Ua1 si1u No Agd Gay Avp Do Agd Rgo I1e S1u Shchu 355 3Z6o 365

From TPE Gecp Avp TPg o bek TPg bip b1u Gecp TPg Avp AvBp o TPg bek I1e Avp 370 375 380

Rkgo Uai TPg Iiets bip Rpe TPg o bBeg Agd Avr Uai Tug Agud TPg siy b5eg 385 390 395 400

Ap Aza s1iu TPg AvBp o I1e Gay Robe TPg TP Rgo Uai Avp s1iu Ua1 Rgo

Z5 405 410 415

Ter Aia Akud Robe AvBp Robe I1e Av5p Rgo bip ABp I1e Tugye bij Agd Sh1U 420 425 430

Aza TPg TBg Tuk back beep Rgo Tug beep sb1u Uaii s1u I1e sbip Gay Rie 435 440 445

Avr bek bij TBPg bi Gay Rgo Rgo siy TBg TBg bij Agud Rgo AvBp Tug 450 455 460 bis bek Tuk Bek Niv Agd Gay bek Niv Iie siu Gay I1e I1e S1Uu Avp 465 470 475 480

TPg geish Agud Aza Rgo Uai Tuk bek Ter TPg Nibv Agd bek A1a Avr Ag4d 485 490 495

TPE Ap o TPg Iie s1iu Rgo ABp Agud I1e TBg o bip I1e Rgo Gay Ua1i Guv 500 505 510

Aza gay Avp o Gets Niv bek bi1u Uai TPg Uai Uai s1u s1u Rgo s1u Re 515 520 525

TPE b1u b01u Avr I1ie Gets Agud Agud TPg AvBp TBg biu TE Rre s1Uu Avr 530 535 540

I1e Agd Gets AvBp o I1e ABp Ua! Rkgo Iets back beep Agud Tug Agd Ua1 Agd 545 550 555 560

I1e Akud Tut Aza bek TPg TPg Avr o Tets bip Rpe Rpe TPg Agud I1e Avp 565 570 575 bi1u TPpg TpPg oUai Avp chI1e si1iu Avp Rpe bBeg Agud TPg Mee Avp Agd 01Uu 580 585 590

Avr Avp o Gay bets Tug Agud bek Rore Agud TPpg Aza s1u Rpe Bek TPg Rgo 595 bo 605 (516) Rpe Ap Ripe Gay ABp Aza sip bek TPg Rbe TPg Hep s1u Aia sbip 5eg 610 615 620

Rpe bek Avp o bip bits UMai Tug I1e AvBr Akd Uai siy Rpe Uai1i Rgo Ai1a 625 630 635 640 bi Mai TPpg Rpe bij Aza siy Tug Avr Hey siy Agud Aia bip Guv 645 650 655 "2105 58 "211" 653 "212" Belok "213" Vasii1its5 Epigipdieepviv "4005 58

Has TPg Bek Avp Agud pub Avp obi Avp obits I1e I1e ABp Aza Iets 5eg 1 5 10 15

IT1e Rgo Aia Uaii back AvBp o Niv back Aia bip Mee Avp Gay back TPg Avr

Aza Agkud ch11e bets Avr bek Iiep Sub I1e Aza bij s1u Avp Ap I1e Avr

Rkgo RiPe Uai bek Aza bek TPg Uai bip TPg sb1u I1ie ABp I1e Aia 0Щ1U bo 20 Agud chI1e Hey siu Uaii Geip siu Mai Rgo Rbe Aia si1u sbip I1e Aia 5eg 65 70 75 80

Rpe Tuk bek Ripe Iets Uai s1u bets Ietsy Ter Rgo Agud s1u Agd Avr Rgo 85 90 95

Ter bish Iie Rbe Gets bitz Ni Ua1i! sitz bip yeets I1e Akd sbip sip Uai 25 100 105 110

TPgE bis Avp o TBg Agud Avr Ts Aza Gets Aza Agd iep sip s1u Gesh SHU 115 120 125

AvpobBek Ripe Agud Aia Tuk beep beep back ITec fight Avr Tgr Gay fight Avp 130 135 140

Zo Agud Avr Avr Aza Agud TbPg Agu bek Uai Gay Tug TPg sbip Tug I1ie A1a 145 150 155 160

Te b1ip Gay Avr Rpe Gay Avp Aza Mee Rgo Gay Robe Aza I1e Agd Avp 165 170 175 bip bij Mai Rgo Gay Gay Mee Uai Tug Aza sip Aia Aia ABp Ietsy Niv

Z5 180 185 190

Tets IGecp Gay Gay Agud Avr Aza bek Gay Rpe siu bek siy Ribe SsS1Uu Iey 195 200 205

TPg Bek bip siy I1e bip Agd Tug Tukg bis Agd bip Uai bij Gpuv TPg 210 215 220 40 Agd bij Tugk bek Avr Tuk Suv Aza Agud Tkgr Tug ABp TPg s1u Iech Avp 225 230 235 240

Ap oh hey Agud biu TBg ABp Aza bitz bek Tegr Hey Agud Tug Avp bip Re 245 250 255

Akud Agud Avr o Gets TBPg o Iets b1i1u Uaii Iets Avr Gay Uai Aia Gay Robe Rgo 45 260 265 270 zek Tut Avr TPg Agd Uai Tuk Rkgo Mee ABp TPg bek Aza sbip Gay TEG 275 280 285

Akud bij I1e Tug TBg Avr Rgo I1e s1u Agd TPg ABp Aza Rgo Beh 0Щ1U 290 295 300 50 Rpe Aia bek TPg ABp o Ter Rpe Ap Azp Avp Aza Rgo bek Rope beg A1a 305 310 315 320

Iie sbits Aza Aza Uaii I1ie Agud Rgo Rgo No IIetsp Gay Avr Rpe Rgo sats 325 330 335 bip Gay TPg I1ie Rpe bek Ua1i Gay bek Agud Ter bek Avp TPg beep Tug 55 340 345 350

Mee Avp Tug Ter Ua1 siu No Agd Gay sit beg Agd TPg I1e Agd Sh1U 355 36o0 365 zek Gay back TPg bek TP Niv b1u Avp TPg ABp o TPg bBeg Iie Avp Rgo 370 375 380 (516) Ua1i Tpg Ggecp sbip Rbe TPg bek Agud Aur Woah! Tug Agkud TPg fight back Rie 385 390 395 400

Aza si1u I1e AvBp I1e Iietsy Gay TPg TBPg Rkgo Uai Avp s1iu Ua1 Rgo Tgr 405 410 415

Aza Akud Rpe Avp o Tgr Agud ABp oRgo Tets AvBp bek Gay Agud siu Bek Iets 420 425 430

Tem Tug TPkgE Iie s1iu Tuk TPg siu Uai sb1u TPkg sbip Gay Robe Ar 5eg 435 440 445 bi TpK bij Gay Rgo Rgo bij TPg Tpg bij Agud Rgo Avp Tug bis beg 450 455 460

Tuk Bek Niv Agd Gets beg AvBp I1e Agd Gets I1e bek b1u ABp TPg Ietsy 465 470 475 480

Akud Aza Rgo Ua1! Tuk bek Tgr TPg No Agud bek Aza Avr Agd TPg Avp 485 490 495

TPg Iie Bek bek Avr beg I1e TPg sip I1e Rkgo Iets UMai Ppuv Bek RIPe 500 505 510

Avp o Gay Avp bek b1iu TPg bek Uaii Uai bek biu Rgo sb1u Rpe Tbg 01Uu 515 520 525 b1u Avr I1e I1e Agu TPg Ap Uai Avp siu Bek Ua1 Gay bek Mee s1U 530 535 540

Tets Avp Rpe Avp Avp TPg back Gay beep Agud Tug Agud Uai Agd Uai Agd 545 550 555 560

Tu Aia Aza back beep TPg Mesye Uai1! Hey Agkud Ua! TPg Ua1i s1u s1u 5beg 565 570 575

TPE TpPE Rbe Avr bip biu RbPe Rgo bek TPg Mee bek Aza Ap bij 5eg 580 585 590

Pes TiPg back beep back Robe Agud Rbe Aia si Rre Rgo Ua1! s1u I1e 5eg 595 bo 605

A1i1a back siu back beep TPg Aza siu I1e back I1e back ABp ABp Aza 01Uu 610 615 620

Akud bip TBe Rbre Ni Rpe Avr Guv I1e bij Rpe I1e Rgo Iie TPg Aia

From 625 630 635 640

TP Rpe siy Aia bets Tug Avr Gets bets Agd Ai1a sip s1tsi 645 650 "2105 59

Z5 "2115" 654 "212" Belok "213" Vasii1its5 Epigipdieepviv "4005 59

Mee Tpg Bek Avp Akud Guv ABp obi ABp obits Iie I1ie ABp Aza Gay 5eg 1 5 10 15

IT1e Rgo Aia Uaii bek AvBp o Niv bek TPg bip Mee Avr Gay Bek Rgo Avr 20 25 30

Aza Agkud ch11e bis Avr bek ITep Suv I1e Ai1a bij s1u AvBp Ap I1e Avp 35 40 45

Rkgo Gets Uai bek Aza bek TPg Uai bip TPg sb1u I1ie ABp I1e Aia 0Щ1U bo

Akud I1e Ggets siu Uaiii Iets sb1u Uai Rgo Rpe Asia s1u sip Iie Aia 5eg 65 70 75 80 50 Rpe Tuk bek RiPe Ge Uai siu bii Gay Ter Rgo Agud s1u Agd ABr sip 85 90 95

Ter bish Iie Rbe Gets bitz Ni Ua1! sitz bip iets I1e ABp bi1ip sip She 100 105 110

TP bets Avp Aza Agud ABp Ts Aza Gets Aza Agd Te sip s1u Gesh SHU 55 115 120 125

Avr Bek Ripe Agud Aia Tuk beep beep back ITec fight Avr Tgr Gay fight Avp 130 135 140

Ak Avr Avr Aza Agud TPg Agud bBeg Uaii Ietsy Tug TPg sbip Tug Ii1e Ai1a 145 150 155 160 (516) em bij Gets Avr Rpe Gay AvBp Aza Mes Rgo Gay Rpe Aza I1e Ag Avp 165 170 175 bip bij Mai Rgo Gay Gay Mee Uai Tug Aza sip Aia Aia ABp Ietsy Niv 180 185 190

Tets IGecp Gay Gay Agud Avr Aza bek Gay Rpe siu bek siy Ribe SsS1Uu Iey 195 200 205

TPg Bek beep bij I1ie sbip Agud Tug Tuk bij Akud beep Uai sbits sbip TBg 210 215 220

Akud Avr o Tuk bBekg Avr Tuk Suv Uaiii bitsch Ter Tug AvBp TPg o1Uu Gay Avp 225 230 235 240 zek Gay Agud biu TPg ABp Aza Aza bek Ter Uai Agud Tug Avp bip Re 245 250 255

Akud Agud Avr o Gets TBPg o Iets b1i1u Uaiii Iets Avr Gay Uai Aia Gay Robe Rgo 260 265 270 zek Tug Avr TPg Agud TP Tug Rgo I1e ABp TPg bBeg Aza sbip Gay TEG 275 280 285

Agud bij Uai Tug TPg Avr Aia I1ie siu Aia TPg siu UMai Avzp Mee A1a 290 295 300 zek Mee Avp o Tgr Tug AvBp Avp AvBp Aza Rgo bek Rpe bBeg Aia Ii1e sitc 305 310 315 320

TPg Aia Ua1 Iie Agd bek Rgo Niv Gay Gets Avr Rope Iiets biy sip Gay 325 330 335

TPg Iie Ribe back TPg back back Agud Ter beg Aza TPg Agud Niv Mee TPg 340 345 350

Tug Ter Akud siu Niv TPg I1e sip beg Agud Rgo I1e Ssi1u s1u s1U Hey 355 36o0 365

Avp oTPg obek TPg Niv siu bek TPg Avp TBbg bek I1e Avp Rgo Uai1i Agd 370 375 380

Tecp bek Rpe Rpe bBeg Agud Avr Uai Tug Ter TPg siy bek Tug Aia 01Uu 385 390 395 400

Uai Gay geish Ter s1u Iie Tuk geish siy Rgo I1e Ni bi1u Uaii Rgo TPg

From 405 410 415

Uai Akud Rpe Avp Rpe Agud Avp Rgo bip Avp TBPg Robe b1ts Agud s1u TPg 420 425 430

Aza Avp o Tuk bek bip Rgo Tuk bis bek Rgo biu Gay bip Gay uv Avr 435 440 445 zek bi TBg bij Gay Rgo Rgo bij TPg TBg bij Agud Rgo Avp Tug s1tsi 450 455 460 zek Tuk bek Nibv Agd ITecyp bek No I1e b1u Iieyp Iie Bek beep bBeg Agd 465 470 475 480

Uai Niv Uai Rgo Ua1 Tuk bek Ter TPg Niv Agd beg Asia1a AvBr Agd TPg 485 490 495

Avp OTG I1i1e back back Avr back I1e TPg beep I1e Rgo Gay Uai1i Ppuv b5eg 500 505 510

Rpe Avp o Gets Avp bek biu TPg bek Uai Uai bek s1u Rgo sb1u Rpe TEPg 515 520 525 siu b1u Avr I1ie Iie Akud TBPg Avp Uai ABp o siu bek Ua1yi! Gay back Mee 530 535 540 b1u Gay Avp Rpe Avp Avp TPg back Gay beep Agud Tug Agud Uaiyi Agud Uai 545 550 555 560

Akud Tut Aza Aza back beep TPg Mes Uaii Iets Agkgud Uai TPg Uai1i O1u SHU 565 570 575 ek TPg TPg Rre Avr beep sb1u Robe Rgo back TPg Mee bek Aia ABp bij 580 585 590 zek Gay TPg bek beep bek Rpe Agd Rpbe Rpe Ai1a bij Rgo Uai sS1u Te 595 bo 605 zek Aia bek biu bek bip TPg Aza siu I1e bek I1e bBeg ABp ABp Aia 610 615 620 b1u Akd bip TpPs Rpe Niv Rpe Avr Gpuv Iie bij Rbe I1i1e Rgo I1e TEPg 625 630 630 6

Aza TPg Rbe bitz Aza sbitzsh Tug Avr Gets bitz Agd Aia sip sitz 60 645 650

"2105 60 "211" 661 "212" Protein "213" Vasii1its5 Epigipdieepviv "4005 60

Me Avp Bek Ap Agud Guv Avp obi Avp obits I1e I1e ABr Az1a bek RPe 1 5 10 15

IT1e Rgo Aia Uaii bek AvBp bii bek Ua! TPg I1i1e bek Gguv bij Tug Ai1a 20 25 30 bip TpgE Avp obip Gay bip Avp Avp bBeg Iie bij Avr siu Gets Suv I1e 35 40 45

Aia sitz s1u bits Tuk I1e Avr Rgo Robe Ua! back Aza Back TPg Ua1! sip 50 55 bo

TPE b1u Iie bek Iie Aia s1iu Agud Iie Hey s1iu Uai Iets s1iu Uai Rkgo 65 70 75 80

Rpe Aia siu bip Iiets Aza bek RoPe Tug bek Rpe Iie Ua1i s1u siy GIets 85 90 95

TER Rgo puv s1u Agd Avr bip Ter siy Ii1e Rre Mee bitsh Niv Ua1i s1y 100 105 110 bip Gay Uaii Agud sbip bip I1ie TPpg Aza Av5p Aza Agud Ap o TBPg Aia Iey 115 120 125

Aza Akd Gets bip sb1u Iiets b1u Avr bek Rpe Agud Aza Tug bip bip b5eg 130 135 140

Tem bij Avr Ter Gay bij Avp Agkud Avp Avr Aza Agud TBg Agud bek Uai 145 150 155 160

Tecp Tuk TPpg sip Tug Iie Aia Hey fight Hey Avr Robe Gets AvBp Aia Mee 165 170 175

Rgo Gets Rre Aia I1e Akd bij bip bits Mai Rkgo Gay Gays Mee Ua1 Tug

From 180 185 190

Aza sip Aia Aza ABp o Tets Ni Gets Iets ITetsy Iiey Agud Avr Aia bek Ieets 195 200 205

Tuk b1u Akud siy Rbe siu Tets TPg bek bip bis I1e bi1ip Agud Tug Tug 210 215 220 sich Agud bip Uai bij Akud TBg Akud AvroTug bBeg Avr Niv Suv Ua1i sip 225 230 235 240

Ter Tuk Avp o TPg s1u Gets AvBp Avp Gay Agud biu TPg ABp Aza siy 5eg 245 250 255

Ter Uai1 Akud Tug Avp obip Rbe Agud Agud Avr o Tets TPg Iets bi1u Uai Ietsy 260 265 270

Avr Gay Uaii Aia Ietsy Rpe Rgo bek Tug Avr TPg Agud TPg Tuk Rgo I1e 275 280 285

Avp oTPg bek Aza bip yetsyp TPg Agkud bis Uai Tuye TPpg AvBr Aia She 0Щ1U 290 295 300

A1ia TPKg siu Mai AvBp Mee Aia bek Meyese Avp Tgr Tug Avp Avp Ap A1a 305 310 315 320

Rkgo Bek RiPe bek Aia I1e siy TBPg Aza Uai I1ie Agud Bek Rgo Niv Iets 325 330 335

Tets Avr Rpe Hey bi bip Hey Ppuv Iie Rpe bBeg Aia bek bBeg Agd Tgr 340 345 350 vek Avp TPg Agud No Mee TPg Tug Tgr Agkud s1u Niv TPg I1e sip b5eg 355 3Z6o 365

Akud Rgo I1e Agud biu Aia Iieetsp I1e TPg bek TPg Niv s1u AvBp TPg Avp 370 375 380

TPg Bek Iie Aup Rgo Ua! TP Rpbe bip Rpe Rgo back Agud Avr Ua1i Tug 385 390 395 400

Akud Tk bis bek Tug Aia s1u Uai Ietsyts Ietsyp Ter s1u I1ie Tug Gay sits 405 410 415

Rgo I1ie Niv siu Uaii Rkgo TPg Uai Agd Rpbe AvBp Rpe Agud AvBp Rgo bip 60 420 425 430

AvpoTPE Robe bitz Agud b1u Tpg Aza AvBp o Tug bek bip Rgo Tu bij b5eg

435 440 445

Rkgo s1i1u Pec bip ITetsshp Guv Avr bek bis TPg biy Gay Rgo Rgo bis TEPg 450 455 460

TPgE bi Agud Rgo Avp o Tug bec bek Tukg bek Nibv Agd Ietsy bek Niv She 465 470 475 480 sb1u I1e I1e Gay sbip TPg Agud Gay Avp o Ua1i Rgo Ua1 Tuk bek Tgr TPg 485 490 495

Niv Agud bek Aza Avr Agud TBPg Ap o TBg I1e beg bBeg Avr bek ISH1e TPg 500 505 510 sip I1ie Rgo Getsp Uaii Puv bek Ribe Avp Gay Avp bek s1i1u TPg bek Uai1! 515 520 525

Uai Bek s1u Rgo siu Rpe TPg siu s1u Avr I1ie I1e Agd TPg AvBp Uai 530 535 540

Avp osiu bek Uaiyi Iets bek Mee biu Gets Avp Rpe Avp Avp TPg bek Iey 545 550 555 560 beep Akud Tu Agud Uai Agud Uai Agud Tug Aza Aza bek beep TPg Mee Uai 565 570 575

Tets Akud Uai TPg Uai siu siu Bek TPg TPg Rre Avr bip sb1u Rpe Rgo 580 585 590 zek TpPg Mee bek A1ia Avp siy bek Hey TiPg bek bip bek Rope Agkud RiPe 595 bo 605

A1ia siy Ribe Rgo Uaii sb1u I1e bBeg Aza Bek siu Bek bip TBPg Aia 01Uu 610 615 620

IT1e bek I1e Bek ABp ABp Aza b1u Akud bip TPpg Rpe Niv Rope Avr Guv 625 630 635 640

Iie sbits Rre I1e Rgo I1e TPg Aza TPg Rpe sits Aza sits Tug Avr Iey 645 650 655 bi Agd Aza sip si 6bvo

From "2105 61 "211" 643 "212" Bilok "213" Vasii1its5 Epigipdieepviv

Z5 "4005 61

Mem gpuv Avp Bek Iie Ppuv Gets bek fight Hey Tgr Tuk Rpe Avp fight Agd 1 5 10 15

Ace Ter Agkud Tuk Rpe Mee siy I1ie Uai Avp Avp beep Avp beep Suv Uai 40 20 25 30

Rkgo Tuk Avp Suv Tets AvBp ABp Rgo bis Iie sbish Iie Gay sitc s1u 01U

Akud I1e bek Uai b1u AvBp TPg Rgo I1e ABr I1e bek Hey Bek Hey TEG bo 45 sip Rbe Getsy Hey back bitz Robe Mai! Rgo s1iu Aia s1u Rpe Uaii Iech s1Uu 65 70 75 80

Tets I1ie Avr Gay Iie Ter siu Rpe Uai s1iu Rgo back beep Tgr ABr A1a 85 90 95

Rpe Ggets Aia bip Uai biy bip Hey Iie AvBp sbip Agud I1e Aza s1its A1a 50 100 105 110

Uai Agkud ABp TPg Aza I1ie sip bish Hey sitz siu Mesye Aza Agd Ua1i Tug 115 120 125

Akud Tag Tut Aza TPg Aza Rpe Aia siy Ter bij puv Aza Rgo ABr AvBr 130 135 140 55 Rgo bi Gay Agud bis Aza Gay Agud TPg bip Rbe TPg Aza TPg bij Tog 145 150 155 160

Tuk Iie Bek siu Agud I1e bek Uai Ieip puv Iie sbip TPg Rpe sitz Uai 165 170 175 sip Gay Ge bek Uai Rbe Aia sbip Aia Aza Avp Gay Niv Gay bek Gay 60 180 185 190

Tets Agud Avr Uai Uai Rpe Rpe siu sip Agd Ter s1iu Robe bek TPg TEPg

195 200 205

TPE Uai1 Avp Avp o Tuk Tug Avp Avr Gay TPg bis b1u I1e bek TPg Tug 210 215 220

TPE Avr Tug ATia Uai Agd Tr Tuk ABp o TBPg b1iu Te 611 Agud Ua1i Tgr 225 230 235 240 b1u Rgo Avr bek Agud Avr Ter Uai Agud Tug Avp bip Robe Agd Agd bij 245 250 255

Tecp TPpg Gay TPg o Uai geish Avr I1e Uai Aia Gay Rpbe Rgo Avp Tug Avr 260 265 270 zek Akad Akud Tug Rgo Iie Akud TPkg Uaiyi back beep Gay TPg Agkud bij I1e 275 280 285

Tuk TpPkg Avp o Rgo Uaii Gets bij Avp Robe Avr biu bek Rpe Agud s1u 5beg 290 295 300

Aza sip s1u I1e b1itssh Agud bek I1e Agd bek Rgo Niv Gay Mee Ar Te 305 310 315 320

Tets AvBp bek Iie TPg Iie Tug TPg Avr Aza Niv Akd siu Tuk Tuk Tug 325 330 335

Ter Bek siu Niv sip I1e Mes Aia bek Rgo Ua! b1u Rpe bek s1u Rgo 340 345 350 bij Rrbe TPE Rre Rgo Gay Tukg s1iu TPg Mes s1u AvBp Aza Aza Rgo sip 355 3З6o 365 bip Akd I1e Uai Aza sbip Geschts siu sbip siu Ua1 Tukg Agkd TPg Iecs 5eg 370 370 Tukg TP 300 375 Agd Agud Rgo Robe ABp I1e s1u I1ie AvBp Ap bip sip 385 390 395 400

Tecp bek Uaii Gay Avr sb1iu TPg si Rpe Aia Tuk siu TPg bek bek Avp 405 410 415

Tecp Rkgo Bek Aia Ua1i Tuk Agkud Ppuv Bek s1iu TPg Ua1 Avr bBeg Ietsy Avr 420 425 430

From Jan. Iie Rgo Rgo bip Avp Avp o Avp Uai Rgo Rgo Agud bip sb1iu Rore 5eg 435 440 445

Niv Agd Gay bek Niv Waii bek Mee Ribe Agud bek biu bek bek bek beg 450 455 460

Uai Bek Iie Iie Akud Aza Rgo Mee Ribe beg Tgr I1e Nib5 Agd bek Aa 465 470 475 480 bi Rpe AvBp Ap I1ie Iie Aza bek Avr bBeg Iie TPg sip I1e Rgo A1a 485 490 495

Uai puv b1u Avp Rpe Gay Ribe Azp siu bek Uai I1e bek b1u Rgo U 500 505 510

Rpe TPg siu b1u Avr Gay Uai Agud Gay Avp bBeg bek s1u Avp ABp I1e 515 520 525 bip AvBp Agud siu Tug Iie bis Uaii Rgo Iie Niv Ribe Rgo bek TPg 5eg 5eg 530 535 540

TPgE Agud Tug Agud Uaiyi Agd Uai Agkud Tut Aza bek Uai TPg Rgo I1e Niv 545 550 555 560

Tets Avp Uaiyi Avp Ter b1u Avp bek Bek Iie Rpe bek Avp TPg Uai1i! Rgo 565 570 575

Aza TPg Aia TBPg bek Tets Avr AvBp o Tets beep bek bek Avr Rpe s1u Tug 580 585 590

Rpe siy bek Aza ABp Aza Rpe TPg bek bek Te sb1u AvBp I1e Ua1 s1Uu 595 (21019) 605

Uai Agud Avp Rpe bek siu TPg Aia siu Uaiii I1i1e I1e ABr Akd Rpe sitsy 610 615 620

Rpe Iie Rgo Uai TPg Aza TPg Iiets b1itssh Aza siy Tug Avp Gay bij Agd 625 630 635 640

A1ia sip Guv 60

Claims (1)

FORMULA OF THE INVENTION 1. Variant Sgu1B polypeptide containing an amino acid sequence that is at least 98 95 identical to an amino acid sequence selected from FEO IU MO: 23, 5EO IU MO: 25, 5EO IU MO: 27 or 5EO IO MO: 29, and an amino acid substitution in position 50 compared to the corresponding reference polypeptide Stu!B with 5EO IO MO: 47, where the variant polypeptide Stu!B has increased insecticidal activity against the corn bollworm and/or grass bollworm compared to the corresponding reference polypeptide Cgu1B with BEO IU MO: 47. 2. Variant Sgu1B polypeptide according to claim 1, where the amino acid substitution at position 50 is selected from E, I, B, A, H, M, 5, E, M, KII, and M. 3. Recombinant polynucleotide encoding the variant Sgu18B polypeptide according to claim 1 or 2. 4. Recombinant polynucleotide according to claim 3, where: (a) the nucleic acid sequence has been optimized for expression in a plant; and/or the nucleic acid sequence is a synthetic nucleotide sequence having plant-preferred codons that have been engineered for expression in a plant; or (B) the polynucleotide contains a nucleic acid sequence with ZEO IU MO: 24, 5EO IUO MO: 26, ZEO IU MO: 28 or ZEO IU MO: 30. 5. Recombinant polynucleotide according to claim 4 (a), where the plant is corn or soybean. 6. Recombinant polynucleotide according to any one of claims 3-5, where the recombinant polynucleotide is functionally linked to a heterologous regulatory element. 7. A transgenic plant containing a recombinant polynucleotide according to claim 6, where the indicated plant is selected from the group consisting of corn, sorghum, wheat, cabbage, sunflower, tomato, cruciferous varieties, pepper varieties, potatoes, cotton, rice, soybeans, sugarcane beet, sugar cane, tobacco, barley and oilseed rape. 8. Seed containing the recombinant polynucleotide according to claim 6. 9. An insecticidal composition containing the variant Sgu1B polypeptide according to claim 1 or 2. 10. Insecticidal composition according to claim 9, where the composition contains from 1 to 99 95 by weight of the Stu1B variant polypeptide. 11. A method of controlling the population of a lepidopteran pest, which involves the absorption by the indicated population of a pesticidally effective amount of the Stu1B variant polypeptide according to claim 1 or 2. 12. A method of destroying a lepidopteran pest, which involves absorption by the specified pest of a pesticidally effective amount of the Stu1B variant polypeptide according to claim 1 or 2. 13. The method of obtaining a polypeptide with pesticidal activity, which involves the cultivation of a host cell containing a DNA construct, where the DNA construct contains a polynucleotide according to claim 6 under conditions under which the polynucleotide encoding the polypeptide is expressed. 14. Transgenic plant according to claim 7, where the recombinant polynucleotide is stably integrated into the plant genome. 15. A method of protecting a plant from an insect pest, which involves introducing a recombinant polynucleotide according to claim 6 into the specified plant. 16. The method according to claim 15, where the insect pest is resistant to an insecticidal polypeptide that is not Sgu1!B, and/or the insect pest is a corn borer, a grass borer or a corn butterfly. th 5 seuiva. (і МДеМВЕМЕМНЕТІМАХВІРАУЄМНОАОМОБОІОАНІКОВСТАЕСММІМТ ІРІВ-ВІ (1) МРЕКНЕМЕМЕТІМ-----АУБМНЕАОМОСВОВАВІКОБІСУАЕШНМІЮРІЇ МР2БВ (1) МИДЗМЕКМЕМЕТІМАСОІРАУВМНВАОМОБОМОАВІКОВІСІДЕСММІМРИ ІРІіВ-Бої (1) МРЕМАКМЕНЕТІМАЦБІРАУМНЯАОМОрЕчІ АВТ ССІАЕСММІНР ІРІВ-НОЗ (1) МРОМВИМЕМЦТТМАТОЗТРАУЯМНОАОМОМОПОАВТЕРЕТСУАХЦММІВЬИ трув-веЗ (й МКК. АУЗМНе ОМ ОААТЕО ВТС ІрРІіВ- В2ї (1) МеЗМВЕКЕМЕТІМАТВІРАУВМННЗАОМОБЕТОАВТЕОВІСТАВОММІМР хРіВв-вг (і) МЕЗКВЕНЕМЕТ ХМАТОТРАУВМНЯОАОМОСВІОАВІВБРОІСІДЕОММІМРІ, Ірів-В26 (І МРЕМОКМЕМИТІ МАСІ РАМОМНОАОМОБЗІОАВІКОВЬСТАЕСНМІМРЬ ївів-вгї (13 МРОМЕКМЕМЕТІМАТВТРАУБВННОДОМОБЕТПАВТЕрРВОСІАВОММІНЕ Івів-В2В8 (11 МеОМеКМЕМЕТІМАСЗІРАУЗМИОЛОМОСВСВАНТВОВБСТАКОММ МЕ ІРіВ-БІВ (1) МРЕМНКМЕНКТТМАТВІРАУЗМНВАОМОТЯСОАВІБОВССТАКОММІНРІ, ІрРІВ-ВАО (Ху МРЕМЕКМЕМЕЇЗМАБОІРАУЗМНОАОМО З BOAKIVOVVSTAEOMMIMR. РіІВ-ВЯ4 її) МеРОМАККЕМЕТІМАСВІРАУВННІАОМОБОБОАВТЕОВЬСТАВОММІМЕ, ІРіВв-БА5 (1) МеБМеКМиМЕХІНАЧІРАУБМНОАОМОБОБОАКІВрРОБСТАвСММІНЕ ІРіВ-ВіЄ6 (1) МРОМЕКМЕВКІТМАТЕТРАМОМНОЛОМОСОТОАНІКООССІАКОММІМРІ тІрРІВ-ВА7 411) мМмРеШЕЖМЕНЕТТМАТЯОТРАУБМНІАОМОБОСОАНІКОВІСІАКОММЕМРЬ трув-ваХ і) МеБМВЕМЕМИТІМ--ееАУЯМНЕДОМОББТОАИТЕОВОСУАЕИННІ Кв хрів-в32 ген! МРОМВКМЕКЕТІК----АМЕМНЕАОМОПЕТОАНТКОБІСУАЕЦКНІ Я т8РіВв-БЗЗ (1) МЕЄМВЕМЕМЕТІМ---- ВУЗ ННОАОМОСОІОАНІЕОВЬСУАВЦММУ ев ї1рРІів-в34 (0) МеКРКМЕНТТН---- ЛУ НАОМІ ЕРАВТЕОЗпСУАЕИТТ в свО6о (1) МеЗМЕКМЕНЕТІНАТВІРАУВМНОЛОМОСЗНОАВІКОВІСУАКОММІ КР 109 сеуїіва (51) УБАВТУОТСІМНІАСВІБСУТ СУРКАСОПАВУУВЕУСЕІНРЕСВЮОРМЕТЕ тхрРіВв -Ві (46) УБАБТУОТОСТЦІАСКЕОСУЮСУРКАСОСАБКУВЕТУСЕТИРЕСВОРНЕХЕ МРе2БВ (51) УБАБТУОТОТМІАСНІССУБСУРКАСОПАВКХВКТУСЕБМРОСВОРНИТЕ хрРІіВ-ВІХ 153) УБАОТУОТОТМНІВСВІ Б ОУДОТрЕиВООГСАаКч ВЕ ОВиМ РОС РИВІ ІРІВ-ВУ ї51) УБАЯТУОТОТМНІВСВТЬСУПОУРКАСОГАВЕХОКІУСЕБИРЕСВОРИКІВ ІРІВ-В»З (46) УЗАВТУОТСІМІАСНІТСУТСТРЕАСОБАВКУВЕПУСЕІМРЕСВОРНВІВ ІРіІВ-ВРЯ 51) УБАЗТУСТОСІМНІАСВІСБСУТИРЕАСОБАБКУБЕТУСЕІИЙРЕСНОРМЕІТЕ ІРІВ-ВУ5 151) УБАБТУОТСІМІАСВІБОУТСУРЕАСОСАБЕУВКІУСКІНРЕСВОРИЕТЕ IRIiV-Web (51) UBABTUOTOTMIAOVITOUBOUREASOPABETVEITUONIMREOVORNKIE hriv-B27 (51) UBABTUOTSTMIASVIOPSUREASOGAVKUSEKTUSKEMEOSVORNETE iIriv-vov 51) UBAVTUOTOIMIASVITOUBOUREASOGAYEKUVETUSEIMROSVORIBII triv-vIOT (51) VISOUBOUrKASOSAYAKUVKIUSKIMRESVORIBIK Iriiv-VYA0 151) UZAVTUSTSIMNIASVIBOTOVUREASOTAVEUVEKTUEVNMRreSVOVMEI KE IRIV-BLTY (51) UBAZTUSTOIMIAOKIBOUSOUREAAOOSAVKUVKTUSVIMRVOVOVORNKIE IRrRIV-VA? 51) УЗАБТУОТСІМІАСВТБСУТСУРЕАСОБАБУУБЕТУСЕІМРЕСНОРНЕТЕ ІРІВ-НВАЗ (51) УВАБТУСТОІМТАСВІТСУТСУРКАСОГАБЕУВЕТУСЕСУРБСНОРИВІХ ІРІВ-ВЯЯ (51) МБАБТУЮТОТМІАСНІССУТОУРЕАСВОБАВЕХНЕТУЗиВНРЕСНОРЧЕТЕ ІБІВ-ВЯ5 (51) УБАЄТУОТСІНІТАЗНІСОУОУРЕАСОБАБЕКУВКІУСВОМРОСВОРИВІЕ ІВІВ-БАЄ (51) ЧУЯАВТУОТОХМІАСВІБСУБЄМРЕАСОГАЄКУВКТУСЕБИРВСВОРИКІТЕ тхрів-ва7 (Б) УЗАСТУОТСТМІВСНТТОУ0ОУРКАСОПАЕКУВКІУСЕБМРЕСВОРИКІВ ІРІВ-ВІЗІ (46) УеАЕТУОТСІСІАСНТІСУБСУРЕАСОТАВЕУВЕ УСКІМРВСВОРНВІЕ трів-в32 ( AB of Ubastutsivtosvtosubsubsreasobsobubkubetkubet of Usssktsnrosyvievie Ibiv-W33 146) Fig. And Скуїва (101) БЕНУВОГІВООВТЕМЛВХТА ТАНЯ шо й й ше дя ТРІВ-ВЕ (96) МЕНУБО УВОСІТОВВВСА АВ: Вокстття оодтернцохво ал МРОБВ (101) БЕНУКОГУВОСІТЕМАВМТАТАНІОВІСАБЕВАЖООЗБЕВНТКМВО АНТ ІРІВ-ВЖїі (305) МЕНУБОБУВОМСІТЕНАВИТАВБАВЦОЗОАВЕКАООВОВБОМОЕМВИМАНІ ІРІВ-НОЇ (101) дЕНУКОБУВООХТЕНАННТАТАВООСОЬСАВЕНАУООВІКОМТЕМООТАВТ ІхІрІіВ-ВеЗ (96) flowers t dovu t felt tyrinennn ny tIRiIV-VOYA (101) MENMUKOIALOSITEMAVMTATANTOVISAVEVAUOOZ ICONS EMNOMANT IRIV-VO5 (201); МЕНУВОБУВОСІТЕМАВМТАТАВТОВІСАЗЕБВАХООВІВОНСЕННОМАНКТ хрів-ваЄ (101) МЕНКОСУВООТТЕНАВНТАсАНВІОССЬСАЕТНАХООЗІКОЧОЕМВОНАНТ хХРІіВ-ВО7 (103) МЕНУЖОБУВОМІТИМАНКТАТАНІОСЬСАЕКААУООВСЕОНСЕМНОМАКТ тІРІВ-ВОВ (501) МЕНУКОБУВОЄ ТІДНАВНТАТАВІОСІСАВЕВАХОО І ЕРНЦЕНЕРМАНТ ІРІВ-В2О (101) МЕНУБОБУВО ІТНИМАВНТАТАНІОСТОАВЕКАХООВІ ВОК ЕННОМАВЯ ІРІВ-В40О (101) МЕНУКОБУВОЦІТЕМАВНТАСАВСОСЬСАВЕКАХООВІБОНТЕМВОМАЯТ ІРІвВ-Ва1 (101р МЕНУЮБОМУВОТІТЕМАВМНТАБАВТОСОСАВКВАХООСБЕВКТЕНВрМАВІ ІРІіВ- В4А9 (101) МЕНУКОСУВОІТНМНАВМТАСАНІТОСІСАВЕВАУООЗТЕОНСЕМНОМАВТ ТРІВ-ВЯЗ (101) МЕН КОНТ КАННТАБАВЬОСЬСАВЕНАХООВТКОКТЕМНОМАНТ ІРіВ-ВіЖЯ (101) МЕНУБОТЛ НО, ТТ ИЯАВКТАТАНТОСТСА ВА ОО БТЕОНЬЕМАЮМАН ІРІВ-Вва5 (101) МЕН ВОЛО МАВКТАБАНЦОСВОАЧЕКАТООЗЬКЕОСЕМНОКАНЯІ тРів-ВЯЄ (301 МЕНУКОТУВОТІТМАВМТАТАНІОСТІСАВЕНАУООВТКОКТЕМКРКАКТ Ірів-ві7 (101) МЕНУКОТАВОВІ TOMAVKNTATANIOSISASKVAUOVOKOMSEKVOMACT Iriv-v31i (96) MENUBOTUVOSITNOI nta AnTSDenod voZhos TEDTGKeshAVI IR1iv-v32 (96) MENUEOTULOSTST SHVUTA AVT peersi ee from c to even IRIV-V3Z3 (96) MENUKOT UVOOTTOSMNYTA AVTOOTSVEIKHOOACEDIS MA eAV tIRiv-v3Я4 (96) PENUBOPIVOOITENTSVMTA AVIDSIED; VOKHOOLEDNIOKN AV. сБОбО (101) МЕНУКОЇУВООТТИВЦКЕ ТА ТАВХДСЬСІВКОХООАСЕЦК ТКАНІ і155 200 сСтуїва 01513 ва етаенто АГРО РБІМУУАОВАМНЬНІВПЦВВАБ ІРІВ-ВІ (146 НЯНИ ТАВЕЦ ОА РОКВІНОВУРСОМУХАОВАНЬНІИТВОАЕ МРІЯ (153 БЕМОУТОУТАСЕВОРІМАМИБКАІМНОСУРЬСМУХАОВАМНІЬНІЬОСЬВОАЯ ІРІВ-ВОї (181) КЕУБЖУТОУТАБЕБОКІМАМСТКАТНМООУРІЛМУХАОВАМОНЬВОВОВЕ ІРІіВ-ВБО (151) ББУБУТОУТАБЕСОКБМНАМРОЬКАТНКОФУРЬСМУХАЛОААМНЬНІВСІВОАБ ІРІВ-НОЗ (ч146) КЕУБУТОУТАТЕБОКІМАМРІТАТММООУРІТМУУАОВАМЬНІСЬСЕПАВ Ірів-вІЯ (151) НеОУТУТОТХІАЛІНСРЕСКАМЕБЕАТНМООУРІТМУУЛОЛАНОНІИІВВАВ твів-виЗ ї51, За ТОТтАТІВКОМАМВСЕІННООи МУКА ОПОВ ІРІіВ-В2б6 (151) КеМБУТОУТАЦИООКСМАМРСРАХНМОСУРІМОКАОВАНЬНІВИЬНОАВ ІрРІіВ-В27 (151) БВБУБУТОУТАСВІПРІМАМРІКАТМКОСУРІЛМУУЛОВАМЕНІТЦЬСНОДО ІРІВ»-ВОЯ (151); пЕУБУТОХІАТЕБОКЬНАМЕБКАТКМОСУРІІМУУАОЛАНЬНІШВЬНОА В 18РівВ-вІУ (1517 ББУПЕУТОХТАПВІОКСМАМРБЕАХМНООУРСТМУУАОААНЬНІЬООВОдЯ ІРІВ-ВАО ( 151. СВЕСОКОМАМРЬКАТМКООУРССЬМУХАОААНЬНІТІІВОАВ ІРІВ-ВБ4АЗ (151) ВБУБУТОЖТАБЕОРІЧАМВОКАТНКООУРІНОУАОвАНЬНОМОМВОВВ ІВІВ-В4АЯХ (1513 ВБУБПУТОУТАБЕКПОКІМАМРЕКАТННОСУРЬСМУУАОВАМНЬНИВЬСВВАВ ІРІВв-вІАб5 51513 ВОУТИТОХТАБЕБОЖОМАМВЬКАІММООУРЬСМУХАОВЛАМЬНІКОМВОАЯ тхріВв-ві6 (151) ВаУБУТОУТАТЕКООКІМАМЕСУАІННОСТРІІМОХАОВАНЬНІТІВОАВ ІВІВ-ВЯ7 4151) НЗУБХУТОУХТАБЕПОБОМАМЕСКАІМНООУРЬСМУХАОВАМЬНИ ОАЄ хрів-в3і (14с)у вет уУтАОСВСОМВАТРОКО ПИМО РІС МУХАОААМТНІСТІ ВО. irRiV-B3? (146). AREIOVNEA REK TDKODTREEMUH UT VOAAMNYVSVOKYA. IRIV-V3YA (146) VVE TI OTTABEBO ATR KO KIV s ROM HAOAAMI NI VOAV s5o50 (5) VBOTSOSHUTATESOVV Year, PIMONUVIIMUU MUULOAANNITSVVAV Fig. 15 I'm a specialist 250 Схуїва (201) Тов ув оку ст стат нетнАкеи ТІРІВ-Бі (196) БУсБЕНОМОсБО неЕУХОЮюЮВО тону НСМемуКтТотММрВстМмАЕВИ МРОБЯ (203) БЕССККСІТООКІОВУУЕНОЛЕКТиКУСУСАНМУМТСсЬММеВСТМАКОИ ІРІВ-ВОї (291) БПРОБЖРСБТВОВБІОВУУНКОДЕКТНВУБОУСАВНЕНТОІНМНСНОТМАКОИ ІРІВ-ВУ» (201) БПЕОБЕЕСТТВОБІОКУХЕВОВЕКТВВУВОІСАВНУ МІ ММЬНОТМАВОИ їрІіВ-БРЗ (196) БЕУСЕКЕРСПІТЯОБІОВУХЕКОДЛЕКТВВУСОУСАВНУМТОТКМоВсТМАНоЯ YIRIV-VOa (201) BROBEKOPTVOBTOVUUNKOVEKTAKUVOHSAVIUMTOSNMOOSTMAVNY trRiV-noya (901) ptssvysoteOVtOVuUKVOAEKTNEuVOuSANNUMTSsMIOASTMAEVY IRIiIV-BOE (295) PRSBEESITVOBIONUUVODEKTVVUuSANIRIHITSsSOMNIVOT-YABOYA? (201). ІРІВ-В?О (201) БЕОБЕКОТТВОБІОНУХЕНОАЕКТВВУВВУСАВНУМТОСНМІНОТчАВИ ІРІіІВ-НаО (201) ПЕСБЕУСЬТООВТОВУУЕВОДЕКТНЕХОХСАВНІМТОТМНЬВОСТМАКоЯ хІрРів-вагі1 (20 їз ВОВКОМ ТВОВІОНУХЕКОАЕКТАВУВОУСАННЕНЕЗОНМСНО НАВ МЯ ІРІВ-ВіВ (201) ПЕОБЕКСЬТБОВІОВХУВНОАЕКТНВУВВУСАВНУ МОНО РМАВВИ ЇРІВ-БІЗ (901) БУСЕБЕСЬТБОБІОВУТЕНОВЕКТНВУВрУСАННУМТОТКМЬВСсТНАНОЯ ІРіВ-Ві4 (201) БУСВЕЕСИТЕОБІОВУУЄКОЛЕКТКВУВОУСАВНУМТОСКМВНОТМАВОМ їрів -ваб5 (203) ПРОББЕОТСТВОВІОКУУКВОАеКТННХВВУСАВНУНТОСТМВІНОТМАКЕМ ІРІВ-БІЄ (201) БЕСБЗЕРСОТБОБІОВУТЕВОЛЕКТНВУВОУСАВнуМТОоІнКЬВсТМАЕВИ ІРІВ-НА7? (203У БЕСБЕКССТЕОВІОПУУБНОЛЕКТВЕУВОУСАННХ НСС ОВТМАВВЯ тРІВ-В3З1 (195) БЕСВЕНОМ ВД он шив С тМТСІНКЬАСТНАЮВЯ ІРІВ-ВЗ2 (156) птовЕНоМ вд У оте СУ КтСтМяотнАю ІРІВ-БЗЗ ( 196) ПЕСЕЕНСМЕВОМВ Хто то хво се УМТсІММНЬНАОоТивЕвИ ІРІіВ-В34 (196) БЕСВЕНСКОВ Оу НХ о т ен СМ НУКТСЬКМИВСтТМАЕЯ спОоБО (801) ПБЕСВЕНСМ ВНІ УМЛУУИНОВ т кУВ СИНУ ктсІ Мт ЬвстТДАВеМ 251 зво Стуїва (251) ГАУКОККВВІТЬСУМОБУАТКРБУрТВАХВІНТВАОТТВЕХУТОРІСВТМ ІБІіВ-Ві (24635 БЕУМОВКНОБТОЬОСОУ ПОТУАСЕРВХОТВУУРММИТВАСІТВЕТУТОРІСВІВ МРОБА (851) ПЕУМОКВНОПТІСУТОБМАБЕРБУВТНІУРІНТВАОСТВИтУТОРІСНТМ трів-н?і (250 БАУМОБАВОБТЕСУБОМУВЬЕРЕЖУВТНІУРІМТЕАОБТВиТУТОРІСНІМ ІРІВ-НБО2 (251) БЕУМОКВАООТІСУСОБУАВЕРБОУЮТВУУРІНТВАОСТКИТУТОРІСВТИ ЇІРІВ-Н2З (246) АХМОКВВОБТІСУСОБУАСЕРОХУОТВІХРІМТОАОПТЕКІУТОРІСНІМ ІВІВ-В2Я (251) ПЕУМОЖНВОІТІОУЛОСУАЦКРЕЖОТВІУРЕНТОАОПТВЕХУТОРІСВТИ ї1рР18-БО5 (251У ПИУМОКНВОТТЬОСУТОБУАТЕРЕХОТВІХРІМТВАОСТВЕТУТОРІСВТМ ІріВ-БВРб (9513 БЕУМОБВВОБТООУТОБУАСЕКЕРЕХОТВІУРІНТВАСТЬТВЕТУТОРІСВ ЕМ ІВ1іБ- БВОІ) (251) БЕУКОКЕННОБТІСУ0 І УАБЕРЗТОТВІУРІМТОВОПТВНІУТОРІСНТМ ІВіВв-вОЯ (251) ТЕУКОЕНЕВОСТОСУТОБУАОЖРОУОТВІХРІМТЕАОБТКВІХТОРІСВЕМ ІвБів-в?З (251У ПВУКОККАРЬТООУБОБУАВЕРЕХОТАІУРІМТВАОБТВЕТУТОРІЄВТИ ІРІВ-БАО (9515 ПЕУМОВВВОСТОСУБОСУАСЕРБХОТВІХРІНТЗАСЬТНЕТУТОРІСВІН ХРІВ-ВІЇ (3511 ПЕУМОРАНОБТОСУСОПУВСКРОУЮТрВІУРІБТОАОСТНЕТУТОРІСНТМ ІРІВ-Ві? (9513 ПЕУМОБНАПІТІСУПОСУАОЕКРЕХОТВІХРІМНТВАОТТВЕТУТОРІСВТМ ТРІВ-ВБАЗ (251) ПЕУКОЖВНОЇТЬСУБОПУАОКРОУОТВІХРІНТВАОСТЕЕТУТОРІСВІК трів-ВваіЯї (251) ІНУМОКНВВОТІОМОВУАОЬКРЕХУРрТВІТРІМНТОАОБТВЕТУТОРІСВТИ трІВ-Ва5 251) БЕУКОКВВОБТІСУТОСУАБКРОУОТВІХРІМТЯАОБТВЕХУТОРІСВІМ трів-вяє (2511 ХВУКОБАНВБТІСУБЦНМАТЕКРОУЮТЕІУВІМНТОАОБТВАВІУТОРІСКТМ тРІВ-БЯ7 (251) БНУМОКЕНАООТІСМООБУА СКРУТІ ХРІНТОВОБТВЕХУТОРІСНІМ трів-ВЗї (246у БЕУМОКНВОБТІСУБОгУАТКРОХОТАУУВМиТяАОСТинтУТОрРІСНІМ трів-В32 (246) PEUMOKVAOTTISUMNALABERBUYUVTEDURIMTOAOSTVVTUTORISVIM tviv-vZZ 946) NVHKOENVOITTSSHTOgUVNEKRBUVTEDURINTVAOTTVNITUTORISNTI IRIV-VZa (245) TAUKOUVNOKT OAE ti RE NtVATan ut sn svobo (251) UvukorVVOBTOSUMyMABERVUOTADU TO ROS TAUS Fig. 1s Зп 250 Схуїніа (301) АРБСБАБТММЕКММВАРЕКОАТКААТЕВРРНСБОКРЕОгПТІУЄДЕВНМВУТ ІРіВ-Ві (2985) АРЕСЕАЯТНИКМИМАРЕКОАТЕААТТНРРИСІОКРЕОСТІХВАСЕНИСВ МРО5В (301) АРЕОКАЄТКНУМММАРСУВАТКААУДИРРНІОКРЕОБТІ ЗМОВИ трів-вої (301) АРОСРТАЯТММЕМнМАРСЕКСАТЕЛАТУВррНІЛОБТРВЕОБТІУАссрМоо ТРіВ-В2О (301) ОТАК тЕАЛІ нт овно ІРІВ-В2З (296) ДРЕСТАБТМИКМИМАРОАВАТЕААУННРРНОСОЖРЕОБТІУВАЕБНИВ ІРІВ-В2Я (301) БРЯОСКАЄРМИКНИМАРОЕЗАТВАВІУНРРШІОКрЕОБТІТеВаБНИВВ Трів-во5 (301) АРОСКАБТМИКМММАРВЗЕУВАТЕААТЕКВРРНІДОКРЕОБТІУВАБКИВЕТ ІБІВ-ВОб (301) АРЕСТАБТМЧЕММНМАРЗЕВАТЕААТУКРРНІОКРЕОЇТІУВАяВННяВХ ІРІВ-В27 301) АРОЗБЗЕАЯТММЧЕНММАРЗЕВАТЕААХРВЕРНІ ОКРЕОБтТІУВАВНМЕВ Ірів-воВ8 (301) ДРЕСБГАСТММЕМИМАРОКВАТЕААТЕВРРНЕБОКРрРЮЕОТТІЧУВДЕВНИНО хРІіВН-НЕО (301) АРЕСКАЕТНИВКММИМАРЕКСАТЕААХЕВНРРИТІОКРЮСЬТТУВАВЕВИВОХ ЇРіВ-ВАО «301) АРБОХАВТМИВММНМАЕЗКВАТЕАВІКВРРНІТОКРЕОЇТІУЗАЕУВИЯВТ ІРІіВ-БВЯХ 4301) АРОСКТАБТНШЕМНМАРЗЕБАТЕААТЕВРРНІОКРЕОБТІУВАВОНИВЕ ІРІВ -NIiII (301) AVZSKABTNMCHEMNMNARBEXATKAATEVRNRILOKREOBTIHEAOVNIVOV IriV-VnAZ (301) AREEZHAVT Mnemmerekvatykvatykvrrnykreotnihvnakhnovatyama-bovia (301) areosrabtnmenimaroshonistoshotrrnozhnuzhnyauni-s) of Tirriivv-Viia (301) Droocavtmmmarvetiotythythythythyon. 4305) AROSTVETMNYAKMNMMARZENATEAATKVRYNY OKREOBTIUVAVOOOV IRIV-VZi (296) AROSTASTNMEMMNMAROKVAIKAATKVRRNILOKRYUSTTIHVAVEVNOVT IRiV-VZ? (296) АРОСКАСТМИЕНММАРОКЗАТЕААТУВРРНІТОКРЕОГТІХУВАОННЯВЕТ Ірів-в33 (396) АРЕЯСЕАБТММЕМНММАРЕКЗАТЕААТЕВРРНІОКРЕОМТТУВАЧяВИВОТ їБіВв-БЗА (296) АРЕСБАЗТМНЕММКАРЕКОАІКААТКВРРНІОКРКОСТТУВАНЕВИВВ т ввобо (301) БАМИ ВЕСЕ МО КБАТКОАТНАКРНІМОКІВУ ТІ УТ ЗБі «по Сеуїва (351) ОНММУЙУСНЕІМЕНРІССТЬМТВТОСПІУМНтВІМРУТООКТеНОУУВТЕВ ІРІВ-Ві (346) ОНИМУИУСНВОМНЕВРІССТЬНТВТНСАТМ-ТВІНРУТЬОКТВНОУУВТКВ Ммро5В (351) ОУМКУМУСсНЕІЛерДІ БІВ ТНОКтТМ- ТЗІ МРУТТОКТВДОУХВТКВ ІРіВ-Вті (3851) ОНМНУМУСИВОІМУВРІССТІЬНІОТНОАТМ-ТВІМРУТІОКТВНОУУНТКе Ірів-в2о (351) ОНММУМУЄНАІМОННЦІНОВІОТВ НОМ ТБІНРУТЬОКТОНОУУАТИВ тІрів-в»З (336) ОНМЕУМУСНВІМЕВРІССТІМТЗТНСАТМ-ТВІМРУТООКТаНОУУНТЕО твін-вІї (3511 ОНММИХНУСНАСНЕІВРІСОТОМРУВТНОАТВ ТоІМРУТІОКТОВОУХНТКВ; ІВІіВ-Вв25 (351) ОНИМТНУСНЕКСМРУАРІССТЬМНТЗТНОСАТК -TVIMRUTTOKTVNOUHETIV IRIiV-VIE (351) ONMMUKHUSNVINEVRIOSTINTVINOATM-TOIMRUTTOJTBVOUHNTKV IRIN-VII (351) ONMMUMUSNNNIMNIUVRIOSTINTOTNOATM-TOIMRUTTOKTBNOUTETIV thriv-vov (351) ONMMUyMeUSNEIMLERIVROTHNOSTITOKVITVONTUUMi khriv-vov віВ-Б29 (351) ОНММУМУСНАІЦЕВРІВОТІЬМТВТНСАТМ-ТяІКРУТТОКТВВОУХАТЕ ІРіВв-ВЯ0О (351) ОНММУМУСНВІМЕАРІ СТІКТЕТНСАТМ-ТОІМРУТТОКТЕВОУХУВТЕВ тріВв-няі (351) ОНММУКОСНВІНУКРІ СТІЛТЕТИСАТИ-ТеІМРУТТОКТОВОУХВТЕВ ІрРІВ-ВаАЙ (351) ОНММНУКУСНВІМЕВРІССТІМНТВТНОАТМ-ТВІМРУТСОКТВНОУХКТКО: їрів-ВвАЗ (351) ОНММУЙУЄННІМЕНРІССТЬМНТОТНОАТМИ-тТВІМРУТТЬОКТВВАОУТНТНА тІрів- внай (351) ОНММУМУСНВІМЕВРІССТІВТВТНОАТМИ-ТОІНРУТТОКТОНОУТВТКЕ трів-Вав (351) ОНИМУЧУСНЕІМУВРІЄСТІНТОТНСАТМ-ТВІНРУТТОКТОВОЧЖХВТНЕ ІРІВ-ВЯЄ (351) ОНММичснвІнЕнРІДОТІНТЕТНОАТЮ-ТеІМРУТЬОЕТЕНОМУУВТЕВ трів-в4» (351) ОНММУМУЄСНВІМКВРІШСТЬНТВТНОАТМ-ТВІМРУТЬОКТЕВОУТНТЕ тІрів-в3зі (346) онмкучУснвІмЕветОогЕнтв тс ВЕН етКрУТТОГЕБВОУНТЕЬ ТрРІВ-В32 (326 ) ONMKUZHUSNRIMEVRISSTIMTETNS TIN tToIMRUTIOKTOVOUTNTEV Iriv-BvZZ (346) ONMMTNUSNRIMTARISSTIMT Ts Tit nVUTTOkTyaVoUUvTEE IRIV-B3a (346) ONMMUKUSNVIMUKRISTINTETUS TM MTeIKRUTYOGTEVOUTVATEEE svovoo (345) ММоВОН Швом вДИМ окок Fig. la 401 450 Стуїва (401) овнтІНтт нота у КВУ етев то ІрІіВ-Ві (395) БАСВМІЦУТТРУМОУРИАВЕМЕНМ РМК М ол оУоМОВЕОВ МРОБЯ (400) УАСІМІТЬТТРУМСУРИАВЕНМЕМРІЬМОЬНИ ЗТ ТІСУТОУСТОШКОВ ІРІіВ-Б2Ї (400) УАСІКІІЛТТРУМНСУРНАВЕМНИСВМРОМаЬКОВІБУуУтТІСЖТОУСТОМТОВ ІР1іВ-В22 (400) ХАСІМІІБТТРУМОУРНАВЕМЯВМРЬНЗІВИОВІБУТІСУТОУСТОБЕВЕ ІРІіВ-Н2З3 (395) ХАСІМІПЬТТРУНСУРИАВУНИВМРІМУСВВСВІТУТІСТТОУСНОБЕКОВ ІРІіВ-В24 (400) УАСІМІТЬТТРУМОУРИАВЕМНОВМРІМЕЬВВСВІЛЛТІСУТОУСсТОВКОВ ІРІВ-Б2Б (400) ХАСІМІТІТТРУМСУРМАВЕНКВМРІНВЬНДОВІСБУТІСУТОУЄСТОСКОВ ТРІВ-В2Є (400) УАСІМІТІТТРУМСУРМНАКЕНЧВАМРІМВБНЕДОВБьУТІСУТОУСТОШКОВ ІРіІВ-В?7 (400) УАСІМІТБТТРУМОУРМАВЕМНВМРІМВІНВСВЬСУТІСУТСУСТОГЕОВ трРіВ-В28 (400) ХАСІМІІЛТТРУМОУРНАВЕМНВНРІМОІНЕССБЬУТІСТТОУСТОБКО5 ІРІіВ-В29 (400) УАСІМІТІТТРУМНСУРКАВЕММВМРІМСІВИСЗІОУТІСУТОУСТОБЕрВ ІРІВ-В2О (400 ) UASIMIBTTRUMSURNAKENIVMYREMVNEOBBUTISUTOMSTOBKOV IRIV-B:.і1 (400) UASIMHILTTRUMOSURMNAVEMNYMRIMEI VSSU TISTTOUETOBKOV IRIV-VI? (400) УАСІМКІІТТРУМСУРМАВЕМИНМРЬНІБЕДОЗЬЬУТІСУТСУЄТОБЕОЕ ІРІіВ-Б4АЗ (400) УАСІМІМІТТРУКСТРМАВЕМННВМРОЬМОЬВВОВЬрУТІСТТСУСТОСКОВ ІРів-В44 (200) УАСІМІТІТТРУМСУРМНАВЕНКВМРІМЕЬВИСВІТУТІСУТОУСТОЬКОВ ІРІВ-В4А5 (400) УАСІМІІІТТРУМСУРМИАВЕМУНМРІМОЬКИОВІБУТІСУТОУСТОСЕОВ ІРІВ-ВАЄ (400) УАСІМІІІТТРУМОУРИАВЕННИМРОМЕІВДСВІЛУТІСУТОУСТОПЕОВ ІРіВ-НА7 (400) УАСІМІТЬТТРУМОСУРМИАВЕМНЧЕНРІМВІВВОВІСУТІСУТСУСТОШЕОВ ІРІВ-В31 (396) даси ТТРУМСУРНАВЕМ КВК Вс ПО SUVSUSVOMKOV IRIV-V3Z2 (396) vve vi TTRUMSURNAVEMENM RN M AREU pev sMOBkOV IRIV-VZZ (356) DASVMIT, TTRUKOURNAVENENM craft essay IRIiV-V34 (396) also IGTTRUMOURMNAVEKEMM Re sen do otsovtoye svobo (395) nase or orally 04 A51 KO05 Скгуїва (451) ЕТЕБРРЕТТЕВРМУВЕУБНАЬВІЦОІІОМТОВАРУУБИТНАБАОВТМТІ ІРіВ-ВЬ (445) ЕТЕБРРЕТТЕВРМУЄБСУЗНАЬСЕЦСЬТІСМНТІКАРУХВИТНЕБАРЕТМТІ МР25Я (449) ЕТЕБРРЕТТЕВРМУЕЗУЗНЕТЕМІНСІЩОМТІВАРУХВИТНВОАВВТМТІ ІРІіВ-В21 (449) ЕТЕГРРЕТТЕВРМУЕБУВНЕТОМІВІЛТІОМТІНАРУХБИТНИВАРВТКТЕ ІРІВ-ВІ2 (449) ЕТЕБРРЕТТЕВРМУЕВУВНАЗШЦЕТІСМТІВАРУУБИТНАБАЮВТМТВЯ ІРІіВ -Б23 (444) ЕТЕБРРЕТТЕВРМНТЕЗУВНВЬМІНСІВСМТЬВАРУУБИТНАЗАРНТМТІ ІРІВ-В24 (449) ЕТЕБРРЕТТЕВРМУЕБУВНЕСОМІВІТТОМТІНАРУУВМТНАБАОНТМТІ ІРІВ-В25 (449) ЕТЕБРРЕТТЕВРМНТЕБВУВНЕСЕМІВЬІІСМТЬНАРУУВИТНЕБАВВТНТХ ІБ1іВ-В26 (449) ЕТЕБРРЕТТЕНРМУЕБЗУЗНВОЗМІНЬІТЕКНТІНАРУХБЯТНАВАОВТМТІ трів-В27 (448) ЕТ ЕТН нау ННМІ НІВ ВІВАТ ТИН АОАТМТХ ІРІВ-ВОЯ (449) ЕТЕПРРЕТТЕВРМУЕЗУВНЕСОМІВОТІОМТІВАРУУВИТНАБАЮВТМТІ ІРІВ- В29 (449) ЕТЕБРРЕТТЕВРМУЕВХЕНАТОМІВОТІСМТІВАРУХБНТНВВАЮВТМТХ ІРІВ-В4А0 (449) ЕТЕПРРЕТТЕВРМУЕЗУВНВООМІНІТІЮНТІНАРУХБЗИТНАВАОВТМТІ ІРІВ-ВА) (449) ЕТЕБРРЕТТЕКРМУКВУВНАТЯМІВТТІОМТЬВАРУХОИТНЕБАЮВТМТІ ІРіВ-Б42 (449) ЕТЕБРРЕТТЕВРМУЕБУЄНКЬЯМІВІТІСЕТІНАРУХБИТНАВАВЕТНТІ ІРіВ-ВАЗ (449) ЕТЕТРРЕТТЕВРМТЕСУЄНВОМІВІІІСУТІЯАРУУУИТНАВАВВТМТІ ІРІВ-БА4 (449) ЕТЕТРРЕТТЕЯРМУЕЗУВНВІОМІВІІІССТІВАРУУЄМНТНВяАРАТМТІ ІРІВ-В4А5 (249) ЕТЕГРРЕТТЕВРМУЕЄУЄНВІЯМІВТІІСЕТІВАРУУЗНТНАЗАВВТКТІ ІРІВ- VIE (449) ETEBRRETTEVRMTEZUZNVZMINTISMTIKARUUBVYTNABARITKTI IRiIV-Vi7? (449) ЕТЕПРРЕТТЕВРМНУВБУЄНВОЯМІВТІТІТОМТОВАРУУБИТНАБАОВТМТІ Ірів-в31ї (446) ТЕКРРЕТТЕ РН нви вив ДІІТ от вв в Кт ІРІВ-БВ32 (446) ЕТЕТРРЕТТЕВРНУЕСУВНЕ НІ ІТІОМТЬВАРУУВИТНВОАМИТКТІ ІРІіІВ-БЗЗ (446) ЕТЕБРРЕТТЕВРМУЕБУВНВАТЬВИНЕ т тн АЙйтнт хІРів-В34 (446) ЕТЕБРРЕТТЕКРЕУЕВУВИАЬВТЕЬІТСМТІВАРУХБИТННЕАНТМТІ с506О (445) ЕТЕМРРЕТТЕВРИУВАВВНИ TEM If UTVYTNEZAVKTKTI Fig. That ОХ ЗВО Сеуїва (501) ПЕК ЩЕ тот вАУКОДеЬЕМо-БУТеРОКТОСоУ ВЕК ШІЕКТОКАСТ ТЕ їРіВ-ві (495) СОКСІТОТРАХУКСВРБУМС-ВУТВСРОКТССрУУВІН І МІОМВСУІЕ МРОБ5О (499) АТМНЕІТОТРАУКОМЕБЕМИ- ВУХО ЕТОСПЬУ ВОМ ОМиОУЕ іРІіН-ВЯ1 (499) АТМЕТТОТРАУКОМРЬКМО БУТ ВОРСЕТОСОБУНІМИБОМНІОМНСтІВ ІБів-Бе2 (499 ) НО ТТОТРАУКОМЕБЕНО-ВУХЗОРСЕТООВІ ВІ ММЯСНКТОМНУ А ЇІРіВ-БВЗ (4943) АТИТІТОТРАУКОМЕЦЕМО- ВУВООРОКТОСВІУВМНЕСМНІОКНОХЕ ЇВіВ-ВІЯ (499) АТМІТТОтРАУКСМЕмиМО- ВУтВОсрОКТсСрІУВІннасчМНІОМасУТЕ ЇІРІВ-БІВ (459) АТМТІТОТРАУКОМЕБЕМО ЗМІВСРОКТОСОБУВІНМОСИМІОМисСУТЕ трів-воє (499) АТМІТТОТРАУКОМЕСЕМС-ВУХВСрОКТОСОБУВОММЕСММІОМВОХТЕ ІРІіВ-ВР?7 (499 ) АТНІХТОГТРАУКОМНЕБЕМО-ЗУТБОСРОКТССОЬУВІМННЯСММІОМНСХІВ ІрРіВ-ВОВ (499) АТМІТТОТРАУКОМЕСЕМО-БУТОСРОСЕТОСВЬУВІМКБЯМНМІОМНОХІВ ї1РівВ-В29 (499) АТМІТтТОТрРАУКОМНК КМ ВУТВОрРОЕТОСОВЬУНОММОММІОМАОУТВ ІРІіВ-ВЯО (495) АТМТІТОТРВУКСМЕБЕМОо БУХВСРСЕТОСВІНЬММВОММІМНВОМІВ ІРіВ-БАЇ (499) АТМІТТОТРАУКОМиТЕМО-вУтВОорРаттОоО умову ЕЕ ІрРІУВ-ВЯ? (499) АТМІТТОТРАУКОСМЕНЕМО яУхВОрсСКТВІсВрУВИНВ СНОМ ТЕ ІРІіВ-БАЗ (499) АТМІТТОТРАУКСМЕБКНО- БУТХВОСРОСЕКЕТОСОБУВИВМІОММІОМАОУТЕ ІР1іВ-Б4Я (499) АТМІХТОТРАУКСМЕЗ МО БУТЕОрОКТОСОДУВІММЯСММНІОМАСУТЕ їІРІіВ-ВІбВ (499) АТМІІтТОгрРАУКОМЕБЕНО-ВУІЗОРОКТОСОБУВЬНМОСИМІОМАСУ Ти ІРіВ-ВаАЄ (4994) АТЕІІТОТРАУКОМЕБЕНО ЗУІВСРОКТОСПЬУВЬМисММНІОНВОМІВ ЇРіВ-БА7 (499) АТМІТТОТРАУКОМЕСЕМНО -BUTVORSKTOSPIZVINMVSMNIOMNOHIE i5iV-B31 (495) VDT Shoteshch kov DotvUttsroktosot such and VMT IRiV-B32 (496) To ootedukov pogouttorortosotiya in vevy Z; IrRiV-NZZ (496) SE TOOTRNUKOYA, dotUttSRSETOSOT. sv Tedok VOK IRIV-VB3YA (496) PI Shoted eco eteUtUSroEtoso ti KV CODE sBO6O (495) DKASHITOHRSHUKA NN NOTI UR SktosrIA s 551 Sh vov Shuiiva 4550) NBoosni pniv sn mo zhe NN IRIV-NIi (544) URIOBDETOTKU pnAVVIIUUSKU Б я МРОчЯ (548) MRIOKIUZTOTNUVUNUVTAVUTRIENOUMNOMEM-- и HEZBIURAT iIvRiv-vbi (558) TESTI KUTY KIR et. TEetta YIIRIiV-vO" (558) CHRIOBIBTaOTVUNUVUKIAVUTRIZVUMNOMOM- ----- TK VBIURAT Iriv-v23 (553) TRIORIVtoTVUKUNUAETRI PEUVNOMKM------- TEEB GURA IRIV-B2a (548) URIOKICHTETVUNUVUVUVUAVU TRIO UMNOMOM-U RAT nn TEIBI (5151) 5АЙ) УРІОБІВТЕТВУНУВУВУАЕУТВІНЬВУМИСМОМ ння ТКББІУРАТ трРіВ-БВ26 (548) УРІОКІВТОТВУКУВУКТАВУТРІВСБУННОМЕОМ с нн ХЕВБУУРАТ ІРІВ-ВІ7 (548) УБІОКІЄТЕТВУКУКУКВУАВУТРІНЬОУЮНИМОМ- нн ТЕББІЧРАТ ЇІРІіВ-НІВ (548) УРІОБІБТОТВУВУКУВІИАВУТРІВЬВУЮНОМОМ- не ТЕВВІТВАТ тріВ-БОО (58) УРІОБІСТОТНІУВУВУВНХАВУТРЕІНЬЗУМНОМОМ сне КРВБІУРАТ ЇІрРІіВ-ВБЛО (548) MRIOKISTOTEUVUNUVHABUTRINVUMINSMOM dream KEVVIURAT IRIV-BYA4Й (548) URIOBIBTYATNUNUPUVTABUTRIVSOUMNNOMOM se - I TEETIMRAT khIrRiV-«VA? (B5ya) Uruguvutivutrovzhuminommium ------- Tevmrat of Girov-V4AZ (548) Urinctivutivutrin-in-the-way-and -Tebbuburat Iriv-Biya) (548) (548) Uriocistoztvuzhuzhubutrinvomykamyskayom-node Tevbvujurat Irov-VA7 548) Uriocbi is a reactoring of the erubchi and 546) (546). ) PRI KA and what is the world oi Iriy-v3za (545) Kran nen KIV UAe VKOA tn e ee UMME UK sheObo (845) svoi UVK VHA VV An TE EVT Fig. 1 Battles are5O Skuiva (593) Adotontov des DEETSATE -ALSKTUEDAYU- 7-7 EVDNATSU zhhriv-vi (587) tot - -ATOMTUSVM- ten petnntsnya REMA 7 MR25V (591) ATVIOMSOVNCESTSKEVTSMAKT- --ATOMUUVUVN-A------EVENASU triv -voi (591) ATEBOMOSVKUOH VOVKA KT ATO SVK nn KUKVVOU triv-no? (591) dtetOomtOov KESTEVVEMARTV--SATSYULUVK-------KVEMASU triv-V23 (586) EeIrNINoNRsutke nagte SAT 222 KoENasU trRiVv-vae (891) APETOMIOYAVNESTENU MAHTE---ATSMUSUVM-------REENASU TRIiVv-vae5 (591). Dezhbbomusutmusutkvnmacty-atomomik no koemasu-nons 1591) atrettosyninkovyacto-atochmmmommmme nvmasu (5913 athumosukkomn-s) (5913) ) Athetomyobnmeoshkvonm of this atoms of Nn Quaemasm Iriv-Nb4AZ (591) DTTEIOTIOSUMOSUMESUKEMIUMYUMA---- atoutovuvuvuvm---ee quamas Irov-b4yas) -BVAYE (591) ATROPOMIOCHIERSUKEVNyMABTYA---ATOMUCHEUVK ------- KEVEMASU hriv-v4i7 (5913 ATB POMBO UKNESZHEV VAMAKTENYA ATOM UUVIVIM pejhnhvtynia ns KOVI IVIV-VZI (591) PTDEeVKI lav Ke UT DI - DS shEorIgovs ev Shchi Iriv-B32 (591) SHOSCHEYUKI introduction PA SO ROAD KSASS IVIiV-VZ3Z3 (5981) I pdevdenv o O--AoASH, Poryt ІРІіІВ-НЗЯ (591) МЕНІ ВОР М КАШ СІ ОРОЕСАСЬКТ свобо (583) УКНД ДЕР ТТН РЕВЕ дн ВВБЕДеМ Бі 578 Схуїва (633) ІТОВБЕКІрУТАТТЕЛЕХОЬКНАС ТХРІВ-ВЕ (БО) ІІОВРЕРІРУТАТЕКАЕУТТЕНАСЯ МР2БЯ 4631) БТОБЖКЕТРУТАТЕЕАЛЕЖОНТКНАОЄ ІБІВ-Н?Рі (631) ІТОВЕЕКІРУТАТЕКАКУЮТЬЕНАОК ЇР1іВ -В?2 1531) ІТОБЕКРІРУТАТЕЕКЛЕУВТЕВАОВ ЇІвВіВв-ВоЗ 16526) ТІПЕРЕРІВУТАТКЕАКУСЬСКВАОХ ІБІВ-БІЯ (631) ІТОВЕЕКІРУТАТЕЕАЕХОПЕНАОЄ ЩрРіІВ-ВІУ5 (6531) ТІТОВЕБУТРУТАТЕЕАЕХОБКНАОМ ї1рРіВ-ВОЄ (531) ТІрЕРЕТІРУТАТКЕАЕУрЬКВАОВ ТРІВ-В2Т (631) ІТОБЕЕКІРУТАТЕВКАЖУСЬККАЮВ ІРІВ-БВЯВ (631) ІІОВЕЕТІРУТАТУКАВУВЬЕНКАОВ Ірів- вб2а (531) IIOVUEKIRUTATUEAEUVEKIVOK IRIiIV-B40O (6531) KHIREKEKIRUTATUVABUVYENAOE triv-vai (551) TTOVREEKETRUTATEKAVUVVVNAYUE IRiV-VYA? (631) ТХОБРЕБКІВУТАТККАВУВЬЕНАОВ ІРІіВ-ВНЯЗ (631) ІТОБЕЕКІРУТАТЕВАБУВЬВААОВ ІРІВ-БЯ4А (631) ІТОБУЕКІРУТАТЕЕАЕХОВЕНАОЄ ІРІВ-В45 (631) ІІРВЕЕРТРУТАТЕКАВУПЬКИАОВ ІРІіВ-ВЛЄ (6311 ІТОБУЕКІРУТАТЯКАКЖОВЬКААОК ІрРІіВ-ВЯ7? (631) ІТОБЕВЕІТРУТАТЕНАВУВІЕВАСЕ Ірів-В31 (639) ДІОКНЕ ІЕСЩАТЕЕАЄЦОТЕНАСИ ІРІВ-В32 (639). Fig. 19 Meb TE bek Vvp Akch Buv Av biz dvy bij T16e ii A5poAia ivo Bbet 1 5 To і5 zhkzhj zhk zhk zhk zhk zhki zhk hzk zhk zhk zho zho zhko zhko zhko khoz Koko ii ho Aza Chai bek Avv» Niv bek AtTa bip Meb Avrogeb bek Rkgo Ver 29 25 Z zhi zho vm zov kokos zhk zhk kozh kozh okon zh kozh ko ok zh ozhozh vok koks Aia dk tHe sli Ayar beh Sey Suz T1i6 Aza bij bi Ava Avap o t1e Ave i evzhatat innyNiAiaNNnchIiINni Na yanNUVNniNiaVNniNNniNiNiNiNNNUNN Rho pev Уді бек Аївз Бех Тих Уві Зіп ТБ: біУу Її Дав оїїе Аїа біу 5О 59 6о НВАНВНННАВаНАННННННННННННННННННННАННУНУННАНеНуНЧиНнУНниНННиННЕ Ага ї1їе їй сту Уаї пев бі Уві РКО Ре Аза біу бБіп беюв Аїа Вех: а 75 5О НННННАННИННННечНиНННаНиНННННН НН НННиНиННуНННННиННнеНЕЕ рве Тук Бах Ре ї16є Уаї біу біз Бей ТЕр Рхо бек 51у Аку Ав» рко 85 50 З НН ННиЧННЧиННННЕаАНННННиНаНиНННучНиННиЯ НУВиНННУНННННуННиНнНННеЯЕ Ткр сіб Тіїє Ре Цей біз Нів Маі Сі зЗіб Пе) Уві АжЯ ба Бім ЇХе 190 105 110 ІНИНННВНИНННННННЕННННиНЦааННННиННАННАНННННННУНННЧНИННАУНИННАНАННІ Твх Сійп Ап Аза Ату АвпоТвт Аза рей Аза Ак їв С ip ssiu pe Siu 115 120 125 ANNA NauNNNEnichNANNNnichNiVNNNNANNNniNNuNNniNNniNiNNniNUNniNNniNE Aia beh Riee Aka Aza Tukh biv" biv Bek this Bib Avr Ter Bey Ti Or 130 і35 140 nyni NaNtsNiNNNNniNNNaNNN a ANNA NyNANNNiNNniNN Fig. 2a Ак Авр Авр АтТа Ак ТБ АхЯ бек Уві БПем Тук Тьх біп Тух Ії Аїз 145 Ж5О 185 160 ЕННННЕаНННННННННиННЕчНУЗННННННННННУННННиННННиННАНННЕНея ев не їм біз пев Авр Ре пбей Аза Аза Мебє Рхбо йемй Ре Ата ї)1є Авп о Аво 155 70 175 яаиаНАНННННиНННиАННННННиНиННеНННичНиНННаНННиНичНУНиаННУННуНННННННІ біп о бсіп Уві Rhke This res Mei Uai Tuk Aza biy Aiz Atia Awp o bey Piv 180 185 90 ABY NNy chnim aNNiNUNaNNANNNNYCheNNENUNyZCHNNniNNN Bey ey bez zey Aku ABr Aza beh Bey Rve siu Zeh Fil; Бе сіу тев 195 290 205 ЗАННННАЧНВАНЕНННЕВиННиНННИЧиНННННЕННННАННиННАННЕЧНЕЧНУНУНУНИННЕЙ Тих Бек біп бів (1 біп Аху Туш ТУх біз Ака біп Аїа біб бує Твх 515 220 зНУННННННичННННННЯНННиННиНННеНННиННЕННиНННННаННиНиНиНиННННиНеН Ак біз ТУух бек Авр Тук Сув Аза Аха Ткр Тук Авв Тих біу їв) Авв 225 230 235 240 ЗННННЦННАЧНННЕНуНННННННчУЧиНВНЧАННУННАЯНННЕНаАНиНнАННУННУНННиНННЕ Ази oiev Ah Biu Tpzh Aa Aza bez Beh Tzhr Ge Ak Tuk Ap obei RBe 245 250 55 INNA NN NiNNNNNNNNNiNNCHANiNNniNNNNNNNNNiNNniNiNNENNNNE Ahu Ak Avropey Ts Ppez biu Chai Pea Ayar Bey Uyai Aiv tem Rne rRgo 260 | 265,270 Fig. 26 Ag biz tie Tuk Tyh Avr Rko T1ie biu hu Tyh AvpoAla Rho beh siu 290 295 300 Ekon kvkkkakva advance I ky rve Aia be tak Av Ter Re Aa Abp dey Via Rko bej rRBe bek dia zo5 319 35 32o dev esheneneviekevawanakaikakanevavivavakasvakkakanviakan a t12 biz Aiz Aza Uai ti de Bo Rho Ni Bez bez Abo" rve Bho biv zav 330 335 ESE kavyavksenikinekakikikananakekinananakikikawamaveekiank Zip bej TVJ i1e Re Beh Uai Pep bek AkYa Thr Bee Avyu TBE bit Tukh 340 za5 350 kwavnikivavkiknkisaavokakikvn kak Mei dvokak Ter Uvi Siu Ni Du this bii bek Aha Tph i1e Aha b1iu 355 360 365 EM I I bZeh pev bek Tk Zeh TveE Niv biu Avyu TV Avp o TVh bek Ii Azp o rRko zlo 878 80 Eva kEvaivakivankwonkwkavsvvekokekovinokkkakiakanvavakov ik Chai Twk pe biv RBe Tk Beh Ah Ar Uvi Tuk Ak Tv bij Tuk zv 350 95 400 acne kanokvanideaanivianvakaikakanavashkvankankkvavakakkwn yak Asia sSiu ti Aza ti16 Pebz tsevz TBE tvj Rgo Uai Azp oSiu Uvi Rkgo Ter: 405 410 415 en nki Ky V yiz Ahto RBe Ap o Tkr Ag dva Rgo ila Avpobeh Bey Ak Siu bek Bey 420 455 30 Fig. 2s Pez TUuH TP yiee siu Tuk Tvj sib Uaii biu Tyh bij bes Rve Avr Beh 435 440 445 vacancies ikoksknakaeaaanavasiva y siv Tk btsh Bez Rko Rkeo bib TVk Tph bib Aga Rho Av Tuk siy Bey Bek OR 455. 460 dekEvaknpaniknEaakakiivEaknnvknanna Nikonak Bek Bek Bek Bekvah Tiie Aa Bey Hie Bek ypiuUu Ayav TVE Pech 465 470 475 zvo sheeshkekiakwomeknoikiyinivonoinkivakikennimo mak kanwa ak Aha Aia Rho Uvi Tukh bek TkEr TVh Ni Aku Beh A1i1v AzroAjoa Twk Aut 485 450 495 So NN VV VVV YAN Tvh Ii Aia Tvs Azvoi Tjeh Tjeh 1 Rho Aia Uzi Puv biu Av Yu ZO ZO TZOV EE EE EE TT VE EE KEKV EE KYU Rpe Bez RKe dep osiu beih Uvi her bek biu RgOo biu Rre TVh bi biu 515 52 5yB YOU ATKE VVA VE VESELE EE EE I Avrobey Chai As iz Avv Avop bej Siu Avp Av Ti biz Avpovdkd biu 5ZO 53. zZ40 TELESCOPE Tukh Bey bish Uai rRho hiv bib Re Iiiie Beh TVj Bet Tyzh Aku Tukh AhF 5aV VO 55 56o VIYALO chai Ak Uai Aku Tukh Aiya Beh Uvi Tv Rho Herye bij Pes bek Uvi Avp 5e5 570 ot TIKAEEDEYA EMISSIONS ETEEKT IA KIT ET EE Fig. 24 Ttr sib ze bek Ap tiv Be Beh bek iiye Uvi Rko Aiia Tvky Diz tah BO va pai THEATER ZE ET EE ag Bey vro Dey yiv bij beg Ah Dvr Re biu Tuk Rpe bib bek Tah zav 600 vOo5 YOU EI I TE EE EE ET t ET A Avap dia Re Tah bek Aza TPk bi vp Uvi Chai biu Uai Ahgu dev rde eyi0 615 620 TEEEREEITKT GENIYA BYA I VKA WAT EE KEVEEEEEI vah bij ad5p dia piu wai tiv her dar vt vBe bish Rve herye go Uzi 525 530 635 50 EEDHTDOVETEIIU TI VENEZUELI REVE KK tTVh Aia tkh rve bij Ata bij Tukh ABr opei bis dkYA Aia bip biv 645 550 655 TET YATI ELEN EL VVE AVK IT VEK VE KE Fig. 2е 1 я й 5 СууїВе рот ї (ОО ЕКОБІСІЛЕОМНІВРЕУВЗАВТУОТОІМІАСКІЦОУТОСУРЕАСОГАБЕКХНЕ МРОБЕ рот їх (1) ІБОЯБСІАВОММІВРІУВАВТУОТСІНТАСВІТОУПОУРЕАСОГАВКУВЕ Зі я пд Об СкуїВе бою І (51) МУСЕШИРЕСВОРНЕТУСЕНУКОЇ ВООУТЕМТВОТАТАВІОСОСКЗЕВАУ МРОБВ Вот Її (5) ТУСЕБИРОБВОРИЕХКОКНУВОСУВОО С ТЕМАВОТАКСАКТОСЬСАОКВАХ о. АВ СтуїВе бот Її (105) ООБТЕВИСЕНВОЮВКТКВУПУТОУТАСИОКІМНАМРОКАТОМОВУРЬСМУ Мр бот Ж (101) ОбБСЕОКБЕМВОЮАКТИВУБУТОХТАСЕСОЕСМАМРОКАХИМОСМРІТМУ 51 НИ 200 СгуйВе бож х (151) УЗОДАМЕЬНІТСБСБВРАВОКОВЕКСІТВОКІОКУТУЕКОЕКТЕЕУВВУСАВИ МРО5ЗВ Прош Її (151) УЛОВАМІНІЛІВРАВІУСВЕКСЬТООКІОВУХЕВОВЕКТЕЕХВОВХУСАВИ 231 СхуїВе Бош Ії (201) УМТССЬММІАСТМАКБЗЧИВУМОКВВОСТ УСБУ РВХО МРОБ5О йот Її (201) УМНТОСПИІНІКОГМАюОМНІВУКМОКВеВОТОУТОСУАТЬКРОХО 251 Fig. WITH В. 5О Скуїдв 3 (13 МеТІАЗОЗІТОТВАУКОМЕТЕМОВУТОРОКТасОБУВЕМОВОММХОМА Скуїва 03 (1) ВІНТІСРНКІТОТРАУКСНИТЕМОВУКЯСРСУТСОЮУУВІМАНКОМХОКВ СкуїВв ОЗ (1) ВТМТІСРМВІТОХРАМКСВТТКМСВУТВСРСЕТССОМУВІМВИМОМІОНИ Схуїві ВЗ (1У ВТНТІСРЕВІТОТРАУКОМИСЕМНСВУХОСРСЕТОСОВУВІННОСНМІОМА МРОБА ВЗ (1) втМтТІТВІІТОТРАУКСМЕБУМСВУТВСРСЕТОСОВБУВЬНИБОММІОМВ ві що 100 Сгуївв 03 (50) СУХЕУРІПЕОЗТОТВУВУВУКУАОУТЕТНІКУМНСМОВІКОМТУРАТАТВ Скуїва Ба (51) СУТЕУРІОБТВТОТВУВУНУВУАВУТОІВІМУМЕ СМТ КЕОМТІРАТАН Я СкуїВЬ 03 (51) СУТЕУРТОКТВТОТКУВУВУВУАВУТ ІВІМУМНСМО ВІКІ МТПРАТАЛ СтуїВі ОЗ (51) СУТЕУРІОРТОТОТВУВУКУВУАВУТРІНСОУМНОМОНІ КУ ТУРАТАДЯ Ммро58 ВЗ (51) ШУБЕУРІОКІЗТЯТАУКУКУВХАВУТРІЮСОУМИСМУНІКЗ ТУРАТАТЕ чої ї50 СЕЧІДЬ ОЗ (500) БОМІОБООЕСУКЕОАМАКтТО В ОМІУСУВНКВОВАСУТІОВЕВКІ ВУ ТАТ Скуїва 03 (101) ЗОМЕОБСОБОУУКІННАКТВАТСМІУСАВКНЕВАМНАВУТІОКЕЕКІРУТАТ сСкуїва ВЗ (101) пОМІОЗСОЕСУ БІЗШАКЕТУАТСМІУСУНМЕВАМАНУТІОЗАРЕКІРУТАТ Скуїві р3 (101). UVMNESEMNASMITOKREKIRUTAT 155 162 Sguidv r3 (150) BELEKHVKNAOK Shuivya 03 (151) KEDEKHOBENAOK StuyivV 03 (151) KEAKUOBENAYUK Sguivi Ba (251) EABHOBEVAOV MRI5V 03 (151) EBAKUYUBEVAOV Fig. 4 4 50 MROBV ria? (1) teOZISIAESMMMIMRKUZAVTUOTOSIMIASVIPSUUSUREASOSAVEHUVE sSkuivVe year? (1) ХЕОВИСТАВСММИОРКУЗАВТУСТОИМИАСВИШЗУТСУРЕАСОГАЗЕХ VE Skuiiv rih2 (1) IEOVISIAESVSTOREUZAZTUOTSIVIAOVITISSUSREASOBAVETVE Sguiva rik2 (1) IERSISTABSVUTORKUVAVTUOTSIVTASVIBSUBSUREASOBABEKUVE SkuiVyaE ri? 1 (1) teOZISIAEOMMIYUREUZASTUOTSIMIVOVICTSSUUBSUBEAVOSAVEHVE sSkuyivn ovi? (1) KEOBBSMAVUMKIYUREUVATSUOTSIMIASVISTSTSTREVSOBABEHVE sSskuiva rod? (1) TEOBISIAESMMIMREUZAZTUOTSIMIASVITSUPSUREASOBAVEHVE skuivb year? (1) IEOVISTAEUMMIORKUVAZTUOTSIMIASVISSUTSSUREASOBAVEHVE Skuiivs year? (1) IEBBISUAEMKMIYUREUZAVZTUOTSIMIASVITSSUBSTREASOBABKUVE 5i | 100 Mg258 year? (55). 51) 51 51. 51. (51) IUSEIMRBOSVORKETEBENUKOTIVOOOUTEMTVMTATANTVSSVOHVVU 101 | , 150 MROBO ribe? (101) OO5BERIPENEORAVTVEUSUTOJIATEBOKICHAMROKATNMOSTRITMU SguiVe year? 101 (101) ОО5БЕРНЬЕНЕМОАВТВЗУПУТОУТАБККОКІМАМРІКАТНЕОВУРІТМИ Схуїва 0152 (105) ООЗБЕОНПЕМВМОДЕРЕВУБУТОУТАШЕПОКІМАМРОЕАТВКОЮУРІМУ СкуївЕж рів2 (101) ОО8ІЖОКОЕМВООАВТНВУБУТОУТАБЕСОКІМАМРЬКАТВМОКУРІСМУ СгуїВа 01852 (101) ООББЕРМЬЕМВОСАКТВВУВУТОУІАТЕБОКТЬМАМРІ КАТ ЕМОВУРТЬСМУ Скуївв ріб2 (101) ООАПЕЙТНЬОМВМНОАВОВО СЦЕНУ ЧАБЕЦОЕСТАТРСХІВМОЕУРІЇМУ скуїва рій? (101) OOaBETKI MVMOAVOVU! 1 PUTABETOY GIATROEBIVMNEMURIDMU Hide the ditch? 101 (101). 200 MROBV swarms? (151) UAOAAMINLEVOAZKSZBESITVOKTOVUUKVOVEKTvEUVO STI SkuiVe riv" (1851) ХАОААМИНИЛИБКОАЯПЕСВБЕСТЗОВИОВУУЕВОУЕКТВЕУОХСАНИ SkuiVi riy? (151). (151) Ukraine (151) TAOAAMNNITILKOAVTKoVKNo Pav UKOUU KOT KUVNYSUSY Shuiiva rie? (151). 151) 151) Fig. Ba 201 а МР?БВ БіІ (201) УМТОПНМСНАСТНАЄВНОВУМОКВНОвТІСуБОГУАСЕОЕХртТВІУРІМтТ СтуївВе піва (201) УВТОТНМСеСТИАЕВМСНУМОКВВОБТІСУСОПУАДОЕРЕУЮТВУХ ВИМ Єхуїв;: рій2 (201) чМТСсІНМОВОтТиАеЕВИУВУМОВВВОБТС СУТІ УАЬКРОУОТВТУрІНТЯ Схуїву рівО (201) УМТОБММІВСТМАЕВЯУКУМОУВКОСБТСУБОІХАСКРЕЖОТВТУРІМТО сЕуїВЕ рік? (205) UMTERNVIVSTNAaAZNUKUMOKKVOBTOMVIUASKROUOTVTURIMTO. Skuzva ria? (201). (201) UMTSINMOVSTMAEZuTAHUMOKVVOMTOSUBOGUATEROHOTTVtuRINTV Stuyivv rare (201) UKtTSTNMEVSTNAEZNInuMOKVVrOTTSUVOPUASEROHOTETURIMNTV Ohuive riy? (201) UMtTSYNMUVSTTnANVNO CONDITION OF VOBTSUROTULIKEEURtVTHrRIMEV 251 ZAO Mrob5V year? 251 (251) AOPTVETUTORISVTMARBOSKAZTMNEMMNAEVKZATELAUTVRRNKOH Skuivy riv (251) DOBTTEEUUTOY IOV TO m --NAZMEKUMKKYAROKVATE TATKO RECOYU suuiva Vi? (251). (251). (951). (251). (251). (301). (289) ПЕОШСТЕВАЗУКМЯМТ НМІУНеОМІ ОБАРІНСЯЬ ТОТНОМТН-ТЕТК СхуїБа біо (299) БЕОБКІЖЗАВУВИЗМТНМІХИНОНТ ОвКРІБОВМИ ТЕТНОМТМ-ТВІЯ СкуіївЕж рієї (299) ІЕОПТІКВІВЗБКМяАТННМІУИНОН ОБВРІСССІМТяТНСЕТЮ-ТБІМ сеуїва рід2 (299) пЕОБТІЕВАЗВАМЕМТеНМІУКЕсну ОЗКРІСССТЬМТОТНСАТМ-ТВХМ Стуїзнв рій (301) РЕОБТІУВТ ВВМаМтТОНММІйоСснВоВРІВСЗЬМТЕТОСВТМИ-ТаТИ Схуїва рі«? 1301. 350 350 (348). (348). 351 Fig. 55 291 450 MmRO5V Brid? (397). (397). (398). (388). (387). (399) attuvOrRUOSUSISKOVETEBRRUeVNRnueVUyannIONisI OCT ShuiV River (389) ATTUZOVOOSUYE OBKOSETEPRETTENUMUKVUVNYHVNISTT SMT, Skuive riy? (3990) dttTUVORUOEMSTOBIOOOETEBRRETTEVRMUYUUVTVNVSONISTI OM, 45 44 MROZV PIi42 (447) BARUTBITNYAV- Skuibe BIO (447) BARUUVITNEVAOK Skuevi ri? (448) burUuzitneYaAoV Skuyiv BiZh? (4495) NURUKHYTNBOAYUV StuiVa rizh? (448) NURUUZYTNAVAOVK skuivn Age? (447) VAbUubchtTiVOVOV Shuiva riy (449) VlRUHUVYTNAOAVV SkuivV Peak? (449) VARUUZCHKNYIAAOE Squives BIB? (449) VARUKHBUTNNEAOV Fig. 5s