TWI424851B - Peptide for promoting hair growth, composition containing the same and application of the peptide - Google Patents

Description

a peptide that promotes hair growth, a composition containing the same, and the use of the peptide

The present invention relates to a substance, a composition and a method for promoting hair growth, and more particularly to a hair growth composition comprising a peptide as an active ingredient.

Hair loss is the result of a combination of genetic factors, environmental factors, and physiological states. With the increase of environmental pollutants and the accumulation of life pressure, hair loss has gradually become an unavoidable problem in most men's lives. Since the hair loss problem directly affects the external beauty of a person, the effective treatment of hair loss and even the method of promoting hair growth will have great economic value.

There are a variety of hair growth products on the market, among which the most common are the health and softness. Although Luojian has a good clinical effect, nearly half of the people can only grow short hair, not to mention side effects such as scalp itching, blurred vision, chest pain, low blood pressure, and decreased libido. On the other hand, although it also has the effect of increasing the amount of hair, the effect will be significantly reduced after one year of use, and there are also various side effects such as decreased libido, erectile dysfunction and ejaculation disorders, especially causing male fetuses. The genital organs are abnormal and therefore not suitable for use by women who are pregnant or ready to become pregnant.

The Republic of China Patent Publication No. I338582 discloses a novel hair growth composition which uses lactoferrin as the sole active ingredient. Although lactoferrin should be expected to have fewer side effects, the size of lactoferrin is about 78-80 kDa, and there are still doubts about whether hair follicles can efficiently absorb such large molecules. In addition, lactoferrin is usually isolated from animals, making it difficult to maintain stability between batches of products. These factors are likely to reduce the actual effect of hair growth compositions with lactoferrin as the sole active ingredient.

In summary, the current hair products on the market are still not perfect, and the effectiveness of the known potential products remains to be confirmed. Therefore, more research is needed in the field to develop and display both effects and side effects. Excellent hair growth products.

Accordingly, it is an object of the present invention to provide a composition for promoting hair growth which has not only fewer side effects but also is easily absorbed by hair follicles.

It is still another object of the present invention to provide a method for promoting hair growth, the active ingredient of which can be easily synthesized by biochemical engineering to stabilize the efficacy of the product between batches.

For the purpose of the present invention, the present invention provides a peptide which promotes hair growth, which has SEQ ID NO: 01, SEQ ID NO: 02, SEQ ID NO: 03, SEQ ID NO: 04, SEQ ID NO: 05, or The sequence of combinations.

The invention further provides a composition for promoting hair growth comprising: the aforementioned peptide; and a pharmaceutically acceptable carrier.

Preferably, the aforementioned composition comprises: 100 nM to 100 mM of the aforementioned peptide; and the aforementioned pharmaceutically acceptable carrier.

Preferably, the aforementioned composition is in the form of a drop, a liniment, an ointment, a patch, a powder or a suspension.

Preferably, the aforementioned composition is a shampoo, a conditioner, a hair tonic or a hair gel.

Preferably, the carrier is water, alcohol, aloe vera gel, allantoin, glycerin, vitamin A oil, vitamin E oil, mineral oil or a combination thereof.

Preferably, the above composition further comprises an excipient, a diluent, a thickener, a filler, a lubricant, a grease or a non-greasy base, an interfacing agent, a suspending agent, a gelling agent, an adjuvant, and a preservative. , antioxidants, stabilizers, colorants, perfumes or combinations thereof.

Preferably, the above composition is applied by contacting the composition with a skin area of a subject by applying, spraying or evaporating.

Preferably, the aforementioned subject is a warm-blooded animal having hair follicles or hair follicle epidermal cells.

The invention further provides a method for preparing a composition for promoting hair growth, wherein the aforementioned composition comprises an effective amount of the aforementioned peptide.

Preferably, the aforementioned effective amount is: 10 ^-11 to 10 ^-5 mol / (cm ² ‧day).

In summary, the present invention has been made in view of the advantages and disadvantages of the conventional hair growth composition using lactoferrin as an active ingredient, and after attempting various combinations, a peptide fragment having excellent hair growth effect in lactoferrin has been studied. The largest of these fragments are 25 amino acids, and the smallest are only 5 amino acids, which are effectively absorbed by the hair follicles. Moreover, at the current technical level of biochemical synthesis, the peptide fragments of this length can be easily prepared manually, which not only makes the efficacy of the products between batches more stable, but also eliminates cumbersome extraction steps and reduces production costs. Accordingly, the present invention retains the low side-effects of the conventional hair growth composition using lactoferrin as an active ingredient, and further solves the disadvantages of unstable preparation and poor absorption between batches.

Lactoferrin is a glycoprotein with a size of about 78-80 kDa, which is mainly distributed in mammalian breast milk, saliva, tears and mucous secretions. The scientific understanding of lactoferrin is primarily focused on its role in inhibiting bacterial growth and promoting and regulating the immune system. Recent studies have indicated that lactoferrin has the potential to be an active ingredient in compositions that promote hair growth. However, considering the practical use in the industry and in the clinic, the present invention further explores an effective peptide fragment in lactoferrin in order to break through the shortcomings of the conventional hair growth composition using lactoferrin as an active ingredient.

The sequence of the "peptide" referred to in the present invention is derived from the amino acid sequence of lactoferrin. Suitably, the peptide can be isolated from the lactoferrin extracted from the organism; preferably, the peptide of the present invention is produced in a biochemically synthesized manner according to the desired sequence.

The peptide of the present invention comprises SEQ ID NO: 01, SEQ ID NO: 02, SEQ ID NO: 03, SEQ ID NO: 04, SEQ ID NO: 05, or a combination thereof, as shown in Table 1 below. It is understood by those of ordinary skill in the art that, in the absence of affecting the normal physiological action of the peptide of the present invention, it may be known in the field of additional modification at the 5' or 3' end of the sequence described in Table 1. Other peptide fragments are used to enhance the properties (e.g., stability) of the peptide of the present invention while still conforming to the spirit of the present invention.

The hair growth promoting composition of the present invention comprises the aforementioned peptide of SEQ ID NO: 01, SEQ ID NO: 02, SEQ ID NO: 03, SEQ ID NO: 04, SEQ ID NO: 05 or a combination thereof as an active ingredient, The content is preferably from 100 nM to 100 mM. The composition of the present invention is usually applied topically to the scalp of an individual in need thereof; wherein, in use, the effective amount of the above peptide is preferably 10 ^-11 to 10 ^-5 mol/(cm ² ‧day). The composition of the present invention may be in the form of, but not limited to, drops, liniments, ointments, patches, powders or suspensions, which may also be added to shampoos, conditioners, hair tonics or hair gels for use. Used daily. The foregoing administration includes, but is not limited to, application, spraying or bubbling.

The hair growth promoting composition of the present invention may further comprise a pharmaceutically acceptable carrier. By "medical acceptable" is meant that it does not substantially adversely affect the efficacy of the active ingredient and does not adversely affect the user's physiology. Such carriers include, but are not limited to, water, alcohols, aloe vera gel, allantoin, glycerin, vitamin A oil, vitamin E oil, mineral oil, or combinations thereof.

The hair growth promoting composition of the present invention may further comprise an excipient, a diluent, a thickener, a filler, a lubricant, a grease or a non-greasy base, an interfacing agent, a suspending agent, a gelling agent, an auxiliary agent, Preservatives, antioxidants, stabilizers, colorants, perfumes, or combinations thereof, to further provide the desired properties of the composition for use.

The term "promoting hair growth" as used in the present invention refers to the result of stimulating hair growth growth and dermal papilla cell proliferation observed in laboratory experiments, and particularly indicates the effect of significantly increasing the amount of hair observed in animal experiments.

The details of the present invention are set forth in the accompanying drawings, and the description of the embodiments of the present invention.

Example 1: The peptide of the present invention promotes the growth of hair follicles [peptide preparation]

In view of the shortcomings of traditional lactoferrin-promoting hair growth compositions, the present invention contemplates peptide fragments in lactoferrin which are advantageous for hair growth. Accordingly, the present invention randomly selects 10 sets of sequences based on the related research of lactoferrin and prepares the 10 peptides by biochemical synthesis. Some of these peptides have been disclosed in the scientific literature, but no research has ever indicated their potential to promote hair growth. The 10 groups of peptides are: LfcinB: FKCRRWQWRMKKLGAPSITCVRRAF (ie SEQ ID NO: 01 of the invention); Lf 1-13: APRKNVRWCTISQ (ie SEQ ID NO: 02 of the invention); Lf 8-25: WCAVSNPEATKCFQWQRN (ie SEQ of the invention) ID NO: 03); Lf 152-182: FFSASCVPGADKGQFPNLCRLCAGTG-ENKCA; Lf 265-284: DLIWKLLSKAQEKFGKNKSR; Lf 268-284: WKLLSKAQEKFGKNKSR; Lf 319-324: YLGSGY (SEQ ID NO: 04 of the present invention); Lf 524-528 : RYYGY (SEQ ID NO: 05 of the present invention); Lf 661-667: KYLGPQY; Lf 679-695: YEKYLGPQYVAGITNLK.

[hair follicle separation]

This experiment used a six-week-old Wistar rat (Lesco Biotech Co., Ltd.). The rats were first anesthetized with 10% chloral hydrate (10 ml/kg; Merck, Darmstadt, Germany) and euthanized with carbon dioxide. The skin of the rat's cheeks was then cut, rinsed with IX PBS, and stored in DMEM medium containing antibiotics at 4 °C.

[hair follicle culture and experiment]

The intact hair follicles of the whiskers were removed from the skin with scissors and forceps and placed in medium (DMEM w/ 10% FBS). In the hair follicle culture of the experimental group, 12.84 μM of LfcinB, Lf 1-13, Lf 8-25, Lf 152-182, Lf 265-284, Lf 268-284, Lf 319-324, Lf 524-528, Lf were added, respectively. 661-667 and Lf 679-695; the hair follicle culture of the control group was added with 1X PBS. The hair follicles were cultured for 5 days. The experimental results were presented as mean ± standard deviation, and the differences between the groups were statistically analyzed (Student T-test), and if p < 0.05 or p < 0.01, the results were judged to be significantly different.

[Experimental results]

Referring to the first figure, the average length of hair shaft increase in the control group was 44.0 ± 33.6 μm (n = 5). In comparison, the average length of hair shaft increase in the LfcinB group was 132.5±78.9 μm (n=4; p<0.05); the Lf 1-13 group was 173.3±61.9 μm (n=6; p<0.01); Lf 8-25 was 112±50.7 μm (n=5; p<0.05); Lf 152-182 was 50.0±20.0 μm (n=3); Lf 265-284 was 82.5±35.0 μm (n=4) Lf 268-284 group was 76.7±61.2 μm (n=6); Lf 319-324 group was 98.0±53.6 μm (n=5; p<0.05); Lf 524-528 group was 102.5+55.0 μm (n) = 4; p < 0.05); Lf 661-667 was 45.0 + 217.3 μm (n = 4); Lf 679-695 was 62.9 ± 15.0 μm (n = 7). The experimental results showed that treatment with LfcinB, Lf 1-13, Lf 8-25, Lf 319-324 and Lf 524-528 did significantly stimulate hair growth.

Example 2: The peptide of the present invention promotes the growth of dermal papilla cells

As described in the first embodiment, LfcinB, Lf 1-13, Lf 8-25, Lf 152-182, Lf 265-284, Lf 268-284, Lf 319-324, Lf 524-528, Lf 661-667 and The peptide of Lf 679-695 was used to carry out the experiment of this example.

[Separating dermal papilla cells]

The hair follicles of the six-week-old rat (purchased from Lesco Biotech Co., Ltd.) were obtained by referring to the method described in Example 1. The root of the obtained hair follicle was cut into pieces and placed in a first collagenase solution (2 mg/ml, DMEM w/ 1% FBS), and placed in a 5% carbon dioxide incubator at 37 ° C for 2 hours. . After the outer root sheath became loose, DMEM medium containing 10% FBS was added and centrifuged with gentle agitation to separate the first collagenase solution from the cells in the culture. The dermal papilla cells were then cultured by re-adding DMEM medium containing 20% FBS. After observing that the cells were attached to the bottom of the culture dish and had a profile extending outward, the culture solution was renewed every three days, and the experiment of this example was carried out after seven days of culture.

[Cell culture and experiment]

The culture of dermal papilla cells was carried out in DMEM medium containing 20% FBS. In the experimental group, 12.84 μM of LfcinB, Lf 1-13, Lf 8-25, Lf 152-182, Lf 265-284, Lf 268-284, Lf 319-324, Lf 524-528, Lf 661- were added, respectively. 667 and Lf 679-695; the control group was added with 1X PBS. The cells were cultured for 3 days. After 3 days, the cells were observed with an inverted microscope, and photographed and recorded. The experimental results were presented as mean ± standard deviation, and the differences between the groups were statistically analyzed (Student T-test), and if p < 0.05 or p < 0.01, the results were judged to be significantly different.

[Experimental results]

Please refer to the second figure, and calculate the cell volume (relative proliferation) of each experimental group relative to the control group with the cell volume of the control group being 100%. The relative number of dermal papilla cells in the control group was 100.3 ± 28.5%. The relative proliferation of LfcinB group was 218.0±85.4% (p<0.05); Lf 1-13 group was 218±45.7% (p<0.01); Lf 8-25 group was 150.4±7.5% (p<0.05); Lf 152-182 group was 115.3±17.4%; Lf 265-284 group was 147.9+23.0% (p<0.05); Lf 268-284 group was 112.8±7.5%; Lf 319-324 group was 185.5±30.4% (p <0.05); Lf 524-528 group was 162.9±21.7% (p<0.05); Lf 661-667 group was 117.8±15.7%; Lf 679-695 group was 117.8+26.4%. The experimental results showed that treatment with LfcinB, Lf 1-13, Lf 8-25, Lf 265-284, Lf 319-324 and Lf 524-528 did significantly stimulate the growth of dermal papilla cells.

Example 3: Test the efficacy of the peptide of the present invention in promoting hair growth in a mouse test

In the present example, a mouse test was carried out by taking the aforementioned LfcinB (SEQ ID NO: 01) as an example to test whether the peptide of the present invention exhibits an excellent hair growth promoting effect on a living animal.

Seven-week-old C57BL6 mice (black hair) were purchased from the Animal Center of National Taiwan University Medical College. It was anesthetized with 4% chloral hydrate (10 ml/kg; Merck, Darmstadt, Germany) and then paraffin was applied to selected areas on the back of the mouse (skin of about 9 cm ² area). After the paraffin is dried, the paraffin is removed together with the hair.

The depilated mice were then randomly divided into two groups (5 mice in each group). The control group was wiped with 1X PBS and 10 uL per day in the depilated area, and the experimental group was wiped with 2.56 × 10 ^-8 mol of LfcinB. After 10 days, the gray color of the area was recorded by comparing the hair removal area of the mouse with a 16-color grayscale color chart (Fig. 3) to determine the degree of hair renewal. The results of the experiment will be presented as mean ± standard deviation, and the differences between the groups will be statistically analyzed (Student T-test), and if p < 0.05, the interpretation will be significantly different.

Please refer to Figures 4A and 4B for the hair newborn condition in the hair removal area of the back of the mouse after 10 days of experimentation. As is evident from the figure, there is only a very small number of hair regenerations in the hair removal area of the mice in the control group (Fig. 4A), and the hair removal area of the mice treated with LfcinB is almost covered with newborn short hair. (Fourth B picture). Please refer to the fourth C picture, which quantifies the black chromaticity in the depilation area by the color chart. As can be seen from the figure, the black chromaticity of the hair removal region of the LfcinB-treated mouse is more than twice the black chromaticity of the hair removal region of the control group of mice, and the difference is shown in the fourth and fourth B-pictures. Consistent.

<110> National Taiwan University

<120> A peptide that promotes hair growth, a composition containing the same, and the use of the peptide

<130>

<160> 5

<170> PatentIn version 3.5

<210> 1

<211> 25

<212> PRT

<213> Artificial Sequence

<220>

<223> peptide

<400> 1

<210> 2

<211> 13

<212> PRT

<213> Artificial Sequence

<220>

<223> peptide

<400> 2

<210> 3

<211> 18

<212> PRT

<213> Artificial Sequence

<220>

<223> peptide

<400> 3

<210> 4

<211> 6

<212> PRT

<213> Artificial Sequence

<220>

<223> peptide

<400> 4

<210> 5

<211> 5

<212> PRT

<213> Artificial Sequence

<220>

<223> peptide

<400> 5

The first panel shows the results of experiments in which the peptides of the present invention were stimulated to grow dry.

The second panel shows the results of experiments in which the peptides of Example 2 of the present invention stimulate the growth of dermal papilla cells.

The third figure is a 16-color grayscale color chart used in the third embodiment of the present invention.

Figure 4A shows a control group of mice after 10 days of hair removal in Example 3 of the present invention.

Fig. 4B is a view showing the experimental group mice after depilation for 10 days in the third embodiment of the present invention.

The fourth C chart shows the quantified results of the depilated regions of the control group and the experimental group mice in the third embodiment of the present invention by a 16-color gray scale colorimetric ratio.

Claims (8)

A method for preparing a composition for promoting hair growth, wherein the composition comprises an effective amount of a peptide having the sequence of SEQ ID NO: 01; wherein the aforementioned effective amount is 10 ^-11 to 10 ^-5 mol/(cm ² .day). The method of claim 1, wherein the composition further comprises a pharmaceutically acceptable carrier. The method of claim 1, wherein the composition is in the form of a drop, a liniment, an ointment, a patch, a powder or a suspension. The method of claim 1, wherein the composition is a shampoo, a conditioner, a hair tonic or a hair gel. The method of claim 2, wherein the carrier is water, alcohol, aloe vera gel, allantoin, glycerin, vitamin A oil, vitamin E oil, mineral oil or a combination thereof. The method of claim 1, wherein the composition further comprises an excipient, a diluent, a thickener, a filler, a lubricant, a grease or a non-greasy base, a surfactant, a suspending agent, A gelling agent, adjuvant, preservative, antioxidant, stabilizer, colorant, perfume, or a combination thereof. The method of claim 1, wherein the composition is applied by contacting the composition with a skin area of a subject by applying, spraying or evaporating. The method of claim 7, wherein the object is a warm-blooded animal having hair follicles or hair follicle epidermal cells.