SG178346A1 - Monoclonal antibodies against the pbp2-a protein and homologous sequences for the treatment of infections by and immunodiagnostics of bacteria of the firmicutes phylum - Google Patents
Monoclonal antibodies against the pbp2-a protein and homologous sequences for the treatment of infections by and immunodiagnostics of bacteria of the firmicutes phylum Download PDFInfo
- Publication number
- SG178346A1 SG178346A1 SG2012009205A SG2012009205A SG178346A1 SG 178346 A1 SG178346 A1 SG 178346A1 SG 2012009205 A SG2012009205 A SG 2012009205A SG 2012009205 A SG2012009205 A SG 2012009205A SG 178346 A1 SG178346 A1 SG 178346A1
- Authority
- SG
- Singapore
- Prior art keywords
- seq
- sequence
- pbp2a
- mrsa
- bacteria
- Prior art date
Links
- 241000894006 Bacteria Species 0.000 title claims abstract description 119
- 208000015181 infectious disease Diseases 0.000 title claims abstract description 75
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 50
- 102000004169 proteins and genes Human genes 0.000 title claims abstract description 43
- 238000011282 treatment Methods 0.000 title claims abstract description 28
- 241000192125 Firmicutes Species 0.000 title abstract description 4
- 241000194033 Enterococcus Species 0.000 claims abstract description 14
- 241001465754 Metazoa Species 0.000 claims description 102
- 101710202686 Penicillin-sensitive transpeptidase Proteins 0.000 claims description 77
- 230000001580 bacterial effect Effects 0.000 claims description 36
- 238000000034 method Methods 0.000 claims description 15
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 11
- 150000003952 β-lactams Chemical class 0.000 claims description 11
- 239000004599 antimicrobial Substances 0.000 claims description 10
- 230000002265 prevention Effects 0.000 claims description 2
- 239000000126 substance Substances 0.000 claims description 2
- 230000007850 degeneration Effects 0.000 claims 10
- 150000007523 nucleic acids Chemical group 0.000 claims 6
- 239000002773 nucleotide Substances 0.000 claims 6
- 125000003729 nucleotide group Chemical group 0.000 claims 6
- 125000003275 alpha amino acid group Chemical group 0.000 claims 4
- 238000003745 diagnosis Methods 0.000 claims 1
- 239000003937 drug carrier Substances 0.000 claims 1
- 239000008194 pharmaceutical composition Substances 0.000 claims 1
- 239000000546 pharmaceutical excipient Substances 0.000 claims 1
- 238000012360 testing method Methods 0.000 abstract description 33
- 241000191967 Staphylococcus aureus Species 0.000 abstract description 28
- 244000052769 pathogen Species 0.000 abstract description 15
- 241000192097 Staphylococcus sciuri Species 0.000 abstract description 5
- 230000000295 complement effect Effects 0.000 abstract description 5
- 239000003782 beta lactam antibiotic agent Substances 0.000 abstract description 4
- 239000002132 β-lactam antibiotic Substances 0.000 abstract description 4
- 229940124586 β-lactam antibiotics Drugs 0.000 abstract description 4
- MYPYJXKWCTUITO-LYRMYLQWSA-N vancomycin Chemical compound O([C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=C2C=C3C=C1OC1=CC=C(C=C1Cl)[C@@H](O)[C@H](C(N[C@@H](CC(N)=O)C(=O)N[C@H]3C(=O)N[C@H]1C(=O)N[C@H](C(N[C@@H](C3=CC(O)=CC(O)=C3C=3C(O)=CC=C1C=3)C(O)=O)=O)[C@H](O)C1=CC=C(C(=C1)Cl)O2)=O)NC(=O)[C@@H](CC(C)C)NC)[C@H]1C[C@](C)(N)[C@H](O)[C@H](C)O1 MYPYJXKWCTUITO-LYRMYLQWSA-N 0.000 description 55
- 108010059993 Vancomycin Proteins 0.000 description 53
- 229960003165 vancomycin Drugs 0.000 description 53
- MYPYJXKWCTUITO-UHFFFAOYSA-N vancomycin Natural products O1C(C(=C2)Cl)=CC=C2C(O)C(C(NC(C2=CC(O)=CC(O)=C2C=2C(O)=CC=C3C=2)C(O)=O)=O)NC(=O)C3NC(=O)C2NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(CC(C)C)NC)C(O)C(C=C3Cl)=CC=C3OC3=CC2=CC1=C3OC1OC(CO)C(O)C(O)C1OC1CC(C)(N)C(O)C(C)O1 MYPYJXKWCTUITO-UHFFFAOYSA-N 0.000 description 53
- 238000003556 assay Methods 0.000 description 39
- 238000011002 quantification Methods 0.000 description 30
- 239000002054 inoculum Substances 0.000 description 26
- 230000009885 systemic effect Effects 0.000 description 23
- 210000003734 kidney Anatomy 0.000 description 21
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 19
- 239000002953 phosphate buffered saline Substances 0.000 description 19
- RJQXTJLFIWVMTO-TYNCELHUSA-N Methicillin Chemical compound COC1=CC=CC(OC)=C1C(=O)N[C@@H]1C(=O)N2[C@@H](C(O)=O)C(C)(C)S[C@@H]21 RJQXTJLFIWVMTO-TYNCELHUSA-N 0.000 description 18
- 238000007912 intraperitoneal administration Methods 0.000 description 18
- 229960003085 meticillin Drugs 0.000 description 18
- 230000009467 reduction Effects 0.000 description 17
- 206010041925 Staphylococcal infections Diseases 0.000 description 15
- 239000000523 sample Substances 0.000 description 15
- 102000004190 Enzymes Human genes 0.000 description 14
- 108090000790 Enzymes Proteins 0.000 description 14
- 238000000338 in vitro Methods 0.000 description 14
- 208000015688 methicillin-resistant staphylococcus aureus infectious disease Diseases 0.000 description 13
- 238000002965 ELISA Methods 0.000 description 12
- 108090000279 Peptidyltransferases Proteins 0.000 description 12
- 238000001727 in vivo Methods 0.000 description 12
- 230000004083 survival effect Effects 0.000 description 12
- 108010004729 Phycoerythrin Proteins 0.000 description 11
- 229940079593 drug Drugs 0.000 description 11
- 239000003814 drug Substances 0.000 description 11
- 230000003053 immunization Effects 0.000 description 11
- 238000002649 immunization Methods 0.000 description 11
- 231100000636 lethal dose Toxicity 0.000 description 11
- 150000001413 amino acids Chemical class 0.000 description 10
- 238000003119 immunoblot Methods 0.000 description 10
- 238000010172 mouse model Methods 0.000 description 10
- 239000013642 negative control Substances 0.000 description 10
- 230000001717 pathogenic effect Effects 0.000 description 10
- 210000002966 serum Anatomy 0.000 description 10
- 239000006228 supernatant Substances 0.000 description 10
- 206010011409 Cross infection Diseases 0.000 description 9
- 108010041986 DNA Vaccines Proteins 0.000 description 8
- 206010015548 Euthanasia Diseases 0.000 description 8
- 241000699670 Mus sp. Species 0.000 description 8
- 238000000684 flow cytometry Methods 0.000 description 8
- 239000012634 fragment Substances 0.000 description 8
- 238000011534 incubation Methods 0.000 description 8
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 7
- 229940021995 DNA vaccine Drugs 0.000 description 7
- 230000003321 amplification Effects 0.000 description 7
- 230000000845 anti-microbial effect Effects 0.000 description 7
- 238000010790 dilution Methods 0.000 description 7
- 239000012895 dilution Substances 0.000 description 7
- 210000004408 hybridoma Anatomy 0.000 description 7
- 230000001524 infective effect Effects 0.000 description 7
- 238000003199 nucleic acid amplification method Methods 0.000 description 7
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 7
- 108020004414 DNA Proteins 0.000 description 6
- 229920001213 Polysorbate 20 Polymers 0.000 description 6
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 6
- SOIFLUNRINLCBN-UHFFFAOYSA-N ammonium thiocyanate Chemical compound [NH4+].[S-]C#N SOIFLUNRINLCBN-UHFFFAOYSA-N 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- 239000004202 carbamide Substances 0.000 description 6
- MYPYJXKWCTUITO-KIIOPKALSA-N chembl3301825 Chemical compound O([C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=C2C=C3C=C1OC1=CC=C(C=C1Cl)[C@@H](O)[C@H](C(N[C@@H](CC(N)=O)C(=O)N[C@H]3C(=O)N[C@H]1C(=O)N[C@H](C(N[C@H](C3=CC(O)=CC(O)=C3C=3C(O)=CC=C1C=3)C(O)=O)=O)[C@H](O)C1=CC=C(C(=C1)Cl)O2)=O)NC(=O)[C@@H](CC(C)C)NC)[C@H]1C[C@](C)(N)C(O)[C@H](C)O1 MYPYJXKWCTUITO-KIIOPKALSA-N 0.000 description 6
- 238000006243 chemical reaction Methods 0.000 description 6
- 230000028993 immune response Effects 0.000 description 6
- 230000002401 inhibitory effect Effects 0.000 description 6
- 239000012528 membrane Substances 0.000 description 6
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 6
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 6
- 238000000746 purification Methods 0.000 description 6
- 230000002829 reductive effect Effects 0.000 description 6
- 241000194031 Enterococcus faecium Species 0.000 description 5
- 241000191940 Staphylococcus Species 0.000 description 5
- 210000004027 cell Anatomy 0.000 description 5
- 238000004113 cell culture Methods 0.000 description 5
- 239000000499 gel Substances 0.000 description 5
- 238000004128 high performance liquid chromatography Methods 0.000 description 5
- 238000003018 immunoassay Methods 0.000 description 5
- 229920002401 polyacrylamide Polymers 0.000 description 5
- 239000013641 positive control Substances 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- 230000001681 protective effect Effects 0.000 description 5
- 238000012163 sequencing technique Methods 0.000 description 5
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- 230000005526 G1 to G0 transition Effects 0.000 description 4
- 108010015899 Glycopeptides Proteins 0.000 description 4
- 102000002068 Glycopeptides Human genes 0.000 description 4
- 239000006137 Luria-Bertani broth Substances 0.000 description 4
- 239000000427 antigen Substances 0.000 description 4
- 102000036639 antigens Human genes 0.000 description 4
- 108091007433 antigens Proteins 0.000 description 4
- 230000000052 comparative effect Effects 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 4
- 230000004927 fusion Effects 0.000 description 4
- 238000011081 inoculation Methods 0.000 description 4
- 231100000518 lethal Toxicity 0.000 description 4
- 230000001665 lethal effect Effects 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 239000002609 medium Substances 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 238000005406 washing Methods 0.000 description 4
- 108700028369 Alleles Proteins 0.000 description 3
- 241001495410 Enterococcus sp. Species 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- 241001529936 Murinae Species 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- 230000009471 action Effects 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 238000010367 cloning Methods 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 238000010494 dissociation reaction Methods 0.000 description 3
- 230000005593 dissociations Effects 0.000 description 3
- 238000011156 evaluation Methods 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 238000009650 gentamicin protection assay Methods 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 210000000987 immune system Anatomy 0.000 description 3
- 230000003993 interaction Effects 0.000 description 3
- 238000010841 mRNA extraction Methods 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 230000003287 optical effect Effects 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 239000012521 purified sample Substances 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 229940124513 senna glycoside Drugs 0.000 description 3
- 239000007858 starting material Substances 0.000 description 3
- 229960005486 vaccine Drugs 0.000 description 3
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 2
- 229920001817 Agar Polymers 0.000 description 2
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 2
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 2
- 208000035143 Bacterial infection Diseases 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 235000006693 Cassia laevigata Nutrition 0.000 description 2
- 241000194032 Enterococcus faecalis Species 0.000 description 2
- 102100034343 Integrase Human genes 0.000 description 2
- 206010029155 Nephropathy toxic Diseases 0.000 description 2
- 206010033109 Ototoxicity Diseases 0.000 description 2
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 241000522641 Senna Species 0.000 description 2
- 208000019802 Sexually transmitted disease Diseases 0.000 description 2
- 241000295644 Staphylococcaceae Species 0.000 description 2
- ZMZDMBWJUHKJPS-UHFFFAOYSA-M Thiocyanate anion Chemical compound [S-]C#N ZMZDMBWJUHKJPS-UHFFFAOYSA-M 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- 239000008272 agar Substances 0.000 description 2
- 239000012298 atmosphere Substances 0.000 description 2
- 208000022362 bacterial infectious disease Diseases 0.000 description 2
- 229940098773 bovine serum albumin Drugs 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 230000024203 complement activation Effects 0.000 description 2
- 230000034994 death Effects 0.000 description 2
- 231100000517 death Toxicity 0.000 description 2
- 239000008367 deionised water Substances 0.000 description 2
- 229910021641 deionized water Inorganic materials 0.000 description 2
- 238000001962 electrophoresis Methods 0.000 description 2
- ZMZDMBWJUHKJPS-UHFFFAOYSA-N hydrogen thiocyanate Natural products SC#N ZMZDMBWJUHKJPS-UHFFFAOYSA-N 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 239000006166 lysate Substances 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 231100000417 nephrotoxicity Toxicity 0.000 description 2
- 230000007694 nephrotoxicity Effects 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 230000014207 opsonization Effects 0.000 description 2
- 231100000262 ototoxicity Toxicity 0.000 description 2
- UWYHMGVUTGAWSP-JKIFEVAISA-N oxacillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C1=C(C)ON=C1C1=CC=CC=C1 UWYHMGVUTGAWSP-JKIFEVAISA-N 0.000 description 2
- 229960001019 oxacillin Drugs 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 239000011347 resin Substances 0.000 description 2
- 229920005989 resin Polymers 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 210000000952 spleen Anatomy 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 231100000419 toxicity Toxicity 0.000 description 2
- 230000001988 toxicity Effects 0.000 description 2
- 230000001018 virulence Effects 0.000 description 2
- 230000007923 virulence factor Effects 0.000 description 2
- 239000000304 virulence factor Substances 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- NVKAWKQGWWIWPM-ABEVXSGRSA-N 17-β-hydroxy-5-α-Androstan-3-one Chemical compound C1C(=O)CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CC[C@H]21 NVKAWKQGWWIWPM-ABEVXSGRSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- 206010003497 Asphyxia Diseases 0.000 description 1
- 238000011725 BALB/c mouse Methods 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 101710116957 D-alanyl-D-alanine carboxypeptidase Proteins 0.000 description 1
- 238000011238 DNA vaccination Methods 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 208000032163 Emerging Communicable disease Diseases 0.000 description 1
- 101001013832 Homo sapiens Mitochondrial peptide methionine sulfoxide reductase Proteins 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 208000022010 Lhermitte-Duclos disease Diseases 0.000 description 1
- 239000012515 MabSelect SuRe Substances 0.000 description 1
- 208000037942 Methicillin-resistant Staphylococcus aureus infection Diseases 0.000 description 1
- 102100031767 Mitochondrial peptide methionine sulfoxide reductase Human genes 0.000 description 1
- MSFSPUZXLOGKHJ-UHFFFAOYSA-N Muraminsaeure Natural products OC(=O)C(C)OC1C(N)C(O)OC(CO)C1O MSFSPUZXLOGKHJ-UHFFFAOYSA-N 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 206010029803 Nosocomial infection Diseases 0.000 description 1
- 108010078471 Panton-Valentine leukocidin Proteins 0.000 description 1
- 229930040373 Paraformaldehyde Natural products 0.000 description 1
- 108700020474 Penicillin-Binding Proteins Proteins 0.000 description 1
- 108010013639 Peptidoglycan Proteins 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 238000011530 RNeasy Mini Kit Methods 0.000 description 1
- 231100000645 Reed–Muench method Toxicity 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- 206010066409 Staphylococcal skin infection Diseases 0.000 description 1
- 108010053950 Teicoplanin Proteins 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 230000004520 agglutination Effects 0.000 description 1
- 238000013019 agitation Methods 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000002924 anti-infective effect Effects 0.000 description 1
- 238000009635 antibiotic susceptibility testing Methods 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 238000010804 cDNA synthesis Methods 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 239000011545 carbonate/bicarbonate buffer Substances 0.000 description 1
- 230000007910 cell fusion Effects 0.000 description 1
- DDTDNCYHLGRFBM-YZEKDTGTSA-N chembl2367892 Chemical compound CC(=O)N[C@H]1[C@@H](O)[C@H](O)[C@H](CO)O[C@H]1O[C@@H]([C@H]1C(N[C@@H](C2=CC(O)=CC(O[C@@H]3[C@H]([C@H](O)[C@H](O)[C@@H](CO)O3)O)=C2C=2C(O)=CC=C(C=2)[C@@H](NC(=O)[C@@H]2NC(=O)[C@@H]3C=4C=C(O)C=C(C=4)OC=4C(O)=CC=C(C=4)[C@@H](N)C(=O)N[C@H](CC=4C=C(Cl)C(O5)=CC=4)C(=O)N3)C(=O)N1)C(O)=O)=O)C(C=C1Cl)=CC=C1OC1=C(O[C@H]3[C@H]([C@@H](O)[C@H](O)[C@H](CO)O3)NC(C)=O)C5=CC2=C1 DDTDNCYHLGRFBM-YZEKDTGTSA-N 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000011254 conventional chemotherapy Methods 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 229940032049 enterococcus faecalis Drugs 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 238000007499 fusion processing Methods 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 230000028996 humoral immune response Effects 0.000 description 1
- 230000000521 hyperimmunizing effect Effects 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 231100000386 immunotoxicity Toxicity 0.000 description 1
- 230000007688 immunotoxicity Effects 0.000 description 1
- 238000000126 in silico method Methods 0.000 description 1
- 238000005462 in vivo assay Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 229960000598 infliximab Drugs 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 239000004816 latex Substances 0.000 description 1
- 229920000126 latex Polymers 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 238000012792 lyophilization process Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 101150008979 mecA gene Proteins 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 238000007479 molecular analysis Methods 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 229940022007 naked DNA vaccine Drugs 0.000 description 1
- 208000004235 neutropenia Diseases 0.000 description 1
- 238000010899 nucleation Methods 0.000 description 1
- 230000003571 opsonizing effect Effects 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 229920002866 paraformaldehyde Polymers 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 102000013415 peroxidase activity proteins Human genes 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 238000012797 qualification Methods 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 235000020183 skimmed milk Nutrition 0.000 description 1
- 231100000444 skin lesion Toxicity 0.000 description 1
- 206010040882 skin lesion Diseases 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000013595 supernatant sample Substances 0.000 description 1
- 229960001608 teicoplanin Drugs 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 230000036962 time dependent Effects 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 238000012795 verification Methods 0.000 description 1
Landscapes
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
MONOCLONAL ANTIBODIES AGAINST THE PBP2-A PROTEIN AND HOMOLOGOUSSEQUENCES FOR THE TREATMENT OF INFECTIONS BY AND IMMUNODIAGNOSTICS OF BACTERIA OF THE FIRMICUTES PHYLUMAbstract: (EN)The present invention relates to monoclonal antibodies capable of recognising and binding to the PBP2-a protein and to other proteins having sequences homologous to PBP2-a, including pathogenic species such as the methyciline-resistant Staphylococcus Aureus (MRSA), coagulase-negative Staphilococcus, Staphylococcus sciuri and Enterococcus, and any other bacteria containing the PBP2-a protein or homologous sequences. The invention also relates to the use of the monoclonal antibodies capable of recognising and binding to the PBP2-a protein and to other proteins having sequenceshomologous to PBP2-a in a complementary immunodiagnostic test for detecting resistance to beta-lactam antibiotics.[err]
Description
MONOCLONAL ANTIBODIES FOR PBP2-a PROTEIN AND HOMOLOGOUS
SEQUENCES FOR TREATMENT OF INFECTIONS AND
IMMUNODIAGNOSIS ON BACTERIA FROM PHYLUM FIRMICUTES
The current invention refers to monoclonal antibodies able to recognize and bind to
PBP2a protein and other proteins presenting sequences homologous to PBP2a, including the pathogens methicillin-resistant Staphylococcus aureus - MRSA, coagulase-negative Staphylococcus, Staphylococcus sciuri, Enterococcus spp., and any other bacterium possessing PBP2a or sequences homologous to this protein,
The invention still refers to the use of monoclonal antibodies able to recognize and bind to PBP2a protein and other proteins presenting sequences homologous to PBP2a in a complementary immunodiagnosis for detection of resistance to beta-lactams.
Invention Rationales
Infections caused by methicillin-resistant Staphylococcus aureus (MRSA) are a major concern cause for clinicians, presenting mortality and morbidity rates higher than the ones of infections caused by methicillin-sensitive Staphylococci (1). Furthermore, these infections cause longer hospitalization time and higher expense with antimicrobials, leading to a higher cost in treatment of patients infected by this pathogen (1).
Vancomycin has been the first choice antimicrobial for treatment of infections caused by MRSA. However, the growing isolation of MRSA strains in communities in the
United States and Australia (2, 3, 4), together with the identification of MRSA strains with intermediate resistance to vancomycin in Japan, United States (5), and Brazil (6), cause the current scene to become more severe, The description of MRSA strains totally resistant to vancomycin in 2004 (7) has caused huge concern in the medical-scientific community. MRSA now represents a strong candidate for becoming the fearful “superbug or superbacterium” - a pathogen resistant to all drugs available nowadays.
Usually, MRSA prevalence rates (ratio of all infections by S. aureus caused by
MRSA) in hospital infections are gradually increasing in the last decades. In a study conducted by Jarvis ef al, including 1268 ICUs (intensive care units) in 337 hospitals in the United States, the number of infections by MRSA in ICUs changed from 660 to 2184 cases and the prevalence increased from 35% to 64,4% (8). In Japan, prevalence rates of hospital infections (Hls) caused by MRSA can present worrying values, from 60% to 90% (9). In studies conducted in the United States, the percentile changed from 2% in 1974 to 50% in 1997 (10, 11) and, in some hospitals in the United States, more than 80% of HIs are caused by MRSA (12). In England, the prevalence increased from 1.5% to 15.2% between 1989 and 1995 and now (2004) the estimate is 41.5% (13).
Besides high prevalence rates, especially in teaching and large-sized hospitals,
MRSA is deemed as the main pathogen causing epidemic outbreaks in Brazilian hospitals (14). In 1986, more than 50% of S. aureus strains with hospital origin isolated in patients from university hospitals in S3o Paulo were resistant to methicillin and, in 1993, the incidence of MRSA in the Pediatric Hospital of Paulista Medicine School was 70% (15). In a study conducted in hospitals in Belo Horizonte, Resende ef af (16) pointed out a prevalence of 71% of MRSA.
MRSA strains present a penicillin-binding protein with very low affinity for antimicrobials in the beta-lactam class, such as PBP2a (17). In the presence of this enzyme, which is codified by gene mecA, the bacterium is successful to synthesize the peptidoglycan, even in the presence of beta-lactams. This enzyme can be also found in coagulase-negative Staphylococcus and in Staphylococcus sciuri - a bacterium present in the normal flora of dogs. Besides resistance to beta-lactams, hospital MRSA strains present resistance to most other available antimicrobial classes, with the use of glycopeptides (vancomycin and teicoplanin) remaining as first choice treatment.
Two studies using DNA vaccine against PBP2a showed that this protein is immunogenic and that the obtained immune response was able to confer protection against MRSA in assays conducted in murine model (18, 19). However, it is known that, in hospital infections, most patients are immunodepressed (20). In this cases, a vaccine would not be able to generate protective antibodies in due time to control a bacterial infection.
PBP2a Immunogenicity
PBP2a is a class Il multimodular enzyme according to Goffin and Ghuysen’s classification (40). This 76-kilodalton enzyme is composed by a membrane-binding region, a non-transpeptidase domain, and a transpeptidase domain, containing a 4-amino acid active core (STQK), responsible for the bacterial transpeptidation reactions (20 bis
Ryfell, 1990).
State of the art studies with the DNA vaccine against PBP2a show that the results of bacterial reduction (renal quantification) in immunized animals subjected to challenge by systemic infection were of 3 to 4 times in the work of Ohwada ef al. and of 1000 times in the work of Senna er al. The authors of these studies used the full sequence (except the membrane fixation region) of the gene mecA and an internal fragment of transpeptidase domain, respectively.
But, according to what was mentioned above, a vaccine is not able to generate protective antibodies in due time to control a bacterial infection. Thus, in case of infections by MRSA, the administration of anti-PBP2a monoclonal antibodies is the most proper therapy for treating these infections.
The main objective of the current invention is to provide monoclonal antibodies able to recognize and to bind to PBP2a protein (SEQ ID NO.:1) and other proteins presenting sequences homologous to PBP2a, including the pathogens methicillin- resistant Staphylococcus aureus - MRSA, coagulase-negative Staphylococcus,
Staphylococcus sciuri, Enterococcus spp., and any other bacterium possessing PBP2a or sequences homologous to this protein.
Another invention objective is the use of monoclonal antibodies able to recognize and bind to the PBP2a protein and other proteins presenting sequences homologous to
PBP2a in a complementary immunodiagnosis for detection of resistance to beta- lactams.
The monoclonal antibodies of the current invention are represented by sequences
SEQ ID NO.: 6, SEQ ID NO.: 7, SEQ ID NO.: 8, SEQ ID NO.: 9, SEQ ID NO.: 10,
SEQ ID NO.: 11, SEQ ID NO.: 12, SEQ ID NO.: 13, SEQ ID NO.: 14, SEQ ID NO.: 15, SEQ ID NO.: 16, and SEQ ID NO.: 17.
Figure 1 shows the immunoenzyme test (ELISA) of sera of animals immunized for producing anti-PBP2a antibodies.
Figure 2 shows the result of a polyacrylamide gel with raw samples and samples after purification.
Figure 3 shows the immunoblotting test of MRSA and MSSA lysates against a supernatant containing anti-PBP2a monoclonal antibodies.
Figure 4 is a representation of flow cytometry results of MRSA (CEB) and MSSA bacteria, incubated with anti-PBP2a monoclonal antibody and marked with phycoerythrin (PE).
Figure 5 shows the in vitro protection test (MIC - minimum inhibitory concentration) conferred by anti-PBP2a purified monoclonal antibody and vancomycin against an inoculum of different MRSA strains.
Figure 6A shows renal quantification results in treated and non-treated animals with the anti-PBP2a monoclonal antibody, subjected to systemic infection with a sublethal dose of MRSA CEB strain.
Figure 6B shows renal quantification results in treated and non-treated animals with the anti-PBP2a monoclonal antibody, subjected to systemic infection with a sublethal dose of MRSA Iberian strain (European epidemic clone).
Figure 6C shows renal quantification results in treated and non-treated animals with the anti-PBP2a monoclonal antibody, subjected to systemic infection with a sublethal dose of WB79 CA-MRSA strain (Brazilian community strain).
Figure 7A shows the survival curve of treated (protected) and non-treated (control) animals after infection by a lethal bacterial dose (MRSA CEB).
Figure 7B shows the survival curve of treated (protected) and non-treated (control) animals after infection by a lethal bacterial dose (Iberian MRSA).
Figure 7C shows the survival curve of treated (protected) and non-treated (control) animals after infection by a lethal bacterial dose (WB79 CA-MRSA).
Figure 8A shows the bacterial quantification in kidneys of animals treated with anti-
PBP2a monoclonal antibody, vancomycin, and antibody + vancomycin association and non-treated animals after infection with bacteria (MRSA CEB).
Figure 8B shows the bacterial quantification in kidneys of animals treated with anti-
PBP2a monoclonal antibody.
Figures 9 show the interaction between recombining PBP2a (antigen) and monoclonal antibodies clone 38 (Figure 9A) and clone 10 (Figure 9B).
Figure 10 is a graph of the second analysis by flow cytometry of MRSA samples in presence of FITC-marked anti-PBP2a antibody.
Figure 11 shows the result of the in vitro protection conferred by the antibody against
VRE enterococcus strain.
Figure 12 refers to Ds; and lethal dose for intraperitoneal infection determination.
Figure 13 shows the efficacy result of in vivo protection of anti-PBP2a and PBP5 monoclonal antibody from enterococci against systemic infection,
The emergence of infections by bacteria multiresistant to antimicrobials is presenting an alarming increase. The prevalence of hospital infections caused by MRSA has increased in all world parts present high morbidity and cause high cost due to the intensive use of antimicrobials and to the longer period of patient hospitalization (24).
The treatment based on chemotherapy has been showing signs of exhaustion, with appearance of very few really novel and efficient drugs in the market (25).
In this context, passive immunotherapy (reappears as a promising alternative, presenting a range of advantageous features compared to conventional chemotherapy: among them, the lower toxicity, higher plasma half-life (which facilitates the treatment by dose reduction and maybe a lower final treatment cost), and, especially in the case of the product presented here, selective toxicity, recommended by Paul Ehrlich (where the drug selectively eliminates the referred pathogen) (25a). This last feature is extremely useful to prevent the so called selection pressure, played by broad-spectrum antimicrobials - which provides the appearance of multiresistant bacteria (26).
In order to develop this product, the inventors selected PBP2a as target, based on preliminary studies with DNA vaccine in murine models (18, 19, 21) and immunostructural molecule analyses. PBP2a had its structure elucidated in 2002 (29), and is deposited at PDB (Protein Data Bank) under the code lwmr,
Differently from other approaches, the inventors worked with an internal region of the molecule with 76 amino acids, which flank the enzyme active core (SxxK), at the transpeptidase domain. Epitope identification analyses were performed at the molecule and in their presentation to the different class II CHM alleles (Tepitope program), with later verification of their location at the molecule (SPDB-Viewer program). This approach enables us to evaluate the facility of antibody access to these targets at the native molecule.
This computerized analysis showed the presence of epitopes close to the enzyme active core, with excellent recognition degree by class II CHM alleles, located at PBP2a surface (not shown data).
These in silico previews were confirmed by the performed target recognition tests (immunoblotting and flow cytometry), and the antibody binding to this PBP2a region showed to be able to confer high protection, demonstrated by the results obtained in the performed ir vitro and in vivo tests. The antibodies generated by the 76-amino acid fragment showed to confer higher protection than the ones generated by immunization with full PBP2a, as previously shown by Ohwada and Senna’s works and were confirmed by the results from the inventors.
The epidemiology of infections caused by MRSA shows the presence of the predominant clonal types, responsible for outbreaks and epidemics in hospitals in the whole world. These clones present a higher colonization and virulence capacity when compared to non-epidemic MRSA strains (30).
As a way to validate the obtained results, it was intended to work with different
MRSA clones (epidemic clones), representatives from most infections (especially the hospital ones) caused by MRSA.
CEB strain (Brazilian epidemic clone) is responsible for most infections caused by
MRSA in Brazilian hospitals (31), being also identified in other countries in South
America (32, 33), Portugal, and Czechoslovakia (34). The European epidemic clone (Iberian-MRSA) is found in European countries and in the United States (35).
Due to the increase in cases of community infections caused by MRSA, one of these strains (WB79 CA-MRSA), isolated in Brazil, was included in the current trials. These trials present features differentiated from the ones found in hospitals, with higher virulence (presence of Panton-Valentine leukocidin) and profile of resistance to antimicrobials different from the one of hospital MRSA strains (36). Recently, an outbreak of infections by CA-MRSA in a population of men practicing sex with other men was identified in the United States (37). From this date, we can say that infections caused by MRSA assume a STD (sexually transmitted disease) character.
The protection results conferred by administration of anti-PBP2a antibody showed efficacy against all the different tested clones, which led us to believe in their applicability for infections (community or hospital) caused by any MRSA type.
Some significant features of the product of the current invention need to be commented. (i) In vitro protection results cause to believe that the involved mechanism of action - block of a region close to the molecule active core - is sufficient to inhibit the bacterial growth and multiplication. Similarly to the one of beta-lactam antibiotics, this mechanism is time-dependent, needing that the bacterium is in the multiplication phase to expose the target to the drug action, (ii) This feature is favored by the pharmacokinetic properties of antibodies, which present long plasma half-life (38). Comparing to the antibiotic therapy, this means an administration in lower number of doses, presenting treatment facility for the patient and maybe lower final cost as consequences. These ideas were confirmed in practice in the protection comparative assay with vancomycin (see below). (iii) The inhibition of in vitro bacterial growth also means that the antibody does not need the traditional ancillary antigen-antibody response mechanisms, such as opsonization and complement activation. Considering that most hospital infections occur in patients that has immunodepression status, this product feature is extremely significant. (iv) It is known that Staphylococcus aureus presents a protein A on its surface. This molecule characteristically binds itself to the Fc region of immunoglobulins, impeding the opsonizing activity of the immune system (38). Due to the results obtained in our trials, we believe that the administered antibody concentration was able to saturate the protein A existing at the bacterial surface, not preventing the PBP2a block by the administered antibodies.
Systemic infections caused by MRSA have been treated with use of glycopeptides, especially vancomycin. However, this drug presents a range of side effects, with immunotoxicity (42), ototoxicity, nephrotoxicity, and transient neutropenia (43) among them, and need administration for long periods, presenting high final treatment cost.
By using a murine infection model, it was possible to compare a treatment with vancomycin versus monoclonal antibody and the combination of the two drugs. The obtained results indicated that an antibody dose had action similar to or higher than 5 vancomycin doses and that the simultaneous administration of the two drugs was very more efficient in eliminating the bacterium than the isolated administration. These data are extremely significant, as it is possible to think about a lower treatment cost with the antibody and a more efficient recovery of patients with severe status with the administration of vancomycin and antibody.
In addition to the use of anti-PBP2a monoclonal antibodies for treating infections by
MRSA, the current invention still considers the following applications:
(i) the results of recognition of a protein with molecular weight close to the one of
PBPS5 in Enterococcus sp. strain by anti-PBP2a monoclonal antibody indicate that it is possible to obtain a protective response against this pathogen with the antibody administration. PBP5 presents homology with PBP2a, with both being classified as class B multimodular PBPs, with low affinity for beta-lactams (40). Enterococci are bacteria that cause severe hospital infections, presenting high degree of intrinsic and acquired resistance to antimicrobials. Strains resistant to vancomycin (VRE) represent a reservoir of genes of resistance to glycopeptides and can be transferred to other pathogens (41). (ii) these antibodies can have applicability for PBP2a identification by immunodiagnostic tests. For example, the use of immune tests based on agglutination of latex particles bound to the antibody can provide a result that foresees resistance to all beta-lactam antibiotics in few hours. In the conventional tests of sensitivity to antimicrobials (such as antibiotic sensitivity testing), these results are only released after 12 to 24 hours. (iii) once monoclonal antibodies have been successfully used in topic applications against chronic sores (infliximab, see reference Streit ef af., and WO 1999041285 Al), these antibodies might be topically administered to promote nasal decolonization by
MRSA and for treatment of skin lesions caused by this pathogen.
Based on the knowledge and issues found in the state of art, the current inventors performed immunizations in animals with a DNA vaccine with constructions corresponding to the gene mecA (SEQ ID NO.: 2) without the membrane fixation region and immunizations with a 76-amino acid internal region of the transpeptidase domain (SED ID NO.: 3) comprising the enzyme active core.
The immunizations were performed in the same conditions presented in the works of
Ohwada et al. and Senna et al., who developed a DNA vaccine against PBP2a, using the full sequence (except the membrane fixation region) of the gene mecA and an internal fragment of the transpeptidase domain. The immunizations were performed with 4 doses, and the immunized animals and a non-immunized control group were challenged by a systemic infection with MRSA and a determination of the number of bacteria present in the kidneys of animals in two distinctive periods. The obtained results showed that the immunization with the transpeptidase fragment conferred a greater reduction in the number of bacteria present in the animal kidneys than the one in the animals immunized with gene mecA.
Thus, we see that the antibodies generated against the transpeptidase fragment provided a better protection in the used conditions (DNA vaccine in murine model) than the one by antibodies against PBP2a. The transpeptidase fragment includes the enzyme active core STQK (SEQ ID NO.: 4).
Consequently, based on the found results, the inventors directed the invention for producing monoclonal antibodies able to recognize and bind to the PBP2a protein and other proteins presenting sequences homologous to PBP2a protein and using the transpeptidase fragment that includes the enzyme active core.
The invention will be now described with reference to examples, which must not be considered as limiting.
MATERIALS AND METHODS: 1. Bacteria:
The following methicillin-resistant Staphylococcus aureus strains were used: Iberian-
MRSA, COL-MRSA (ceded by Unité des Agents Antimicrobiens - Institut Pasteur [Unit of Antimicrobial Agents - Pasteur Institute], Dr. Patrice Courvalin), WB79 CA-
MRSA, and CEB-MRSA (ceded by Dr. Agnes Figueiredo, Instituto de Microbiologia [Microbiology Institute] of UFRJ); a vancomycin-resistant Enterococcus faecalis strain; and a methicillin-sensitive Staphylococcus aureus (MSSA) strain. Escherichia coli strains BL21 DE3 (Novagen) and TOP10 (Invitrogen) were also used as control. 2. Animals:
Female Balb/C mice, 4 to 8 weeks old, obtained from CECAL-FIOCRUZ, and housed at LAEAN-BioManguinhos were used in the immunization and in vivo protection assays. 3. Immunization:
The mice (4 animals) received an initial dose of 100 micrograms of pCI-Neo plasmid: fragment of MRSA mecA gene (18), followed by a 10-microgram dose of purified recombining protein 14 days later, corresponding to an internal region of the MRSA
PBP2a (21), emulsified in complete Freund adjuvant, followed by other dose 14 days later, emulsified in incomplete Freund adjuvant. Fourteen days later, the animal with best immune response (evaluated by enzyme immunoassay - ELISA) received an intravenous dose of 10 micrograms of purified protein diluted in PBS (phosphate buffered saline). Three days after the IV injection, the animal was subjected to euthanasia by asphyxia in CO; (CEUA L0009-07 Protocol - FIOCRUZ), and the spleen was aseptically removed for cell fusion. The serum of the animal with best immune response was used as positive control for other immunological tests. 4. Production of monoclonal antibodies:
Lymphocytes removed from spleen were subjected to fusion with SP2/0-Agl4 myeloma cells (ATCC 1581), using polyethylene glycol for fusion, and were cultured in hypoxanthine-aminopterin-thymidine medium at 37°C in atmosphere of 10% CO, according to the protocol for producing monoclonal antibodies in Current Protocols in
Immunology (22). The resulting hybridomas were evaluated by ELISA test after 14 days, using the purified recombining protein as antigen, according to what is described below. The best hybridomas were subjected to cloning, with selection of the best clones by ELISA and these latter being stored in liquid nitrogen. 5. Enzyme immunoassay - ELISA:
Maxisorb 98-well plastic plates were sensitized with S00 nanograms/well of recombining protein (PBP2a fragment) in carbonate/bicarbonate buffer and incubated at 4°C for the whole night. In the following day, the plates were washed three times with
PBS containing 0.05% of Tween 20 and blocked in PBS and 5% skimmed milk for two hours at 37°C. The samples to be analyzed (serum of immunized animals diluted at 1:100 or cell culture supernatants) and incubated for 2 hours at 37°C were used. The plate was washed three times with PBS and Tween 20 (0.05%) again, and the anti-ig conjugate (anti-mouse HRP Ig SIGMA A 0412) was added at 1:5000 dilution, followed by incubation at 37°C for 90 minutes. After this period, the plate was washed three times with PBS and Tween 20 (0.05%), with addition of TMB peroxidase color developer (BioRad) and incubation for 15 minutes protected from light. The reaction was interrupted by addition of 0.5 N H,SO4, and the reading was performed at 450 nm.
A 1:200 diluted hyperimmune polyclonal serum was used as positive control. 5.1. Avidity assays based on enzyme immunoassay 3.1.1. Avidity assay with urea (Niederhouser ef al. - 5.1):
The protocol is similar to the immunoassay one (5), with the following modifications: after the sample incubation (100 ng of clone 10 purified monoclonal antibody and 2.0 ng of clone 38 purified monoclonal antibody) for two hours at 37°C, the samples were subjected to three washings with 8 M urea in PBS and Tween 20 (0.05%), followed by four washings in PBS and Tween 20 (0.05%), presenting the same normally processed sample (without treatment with urea) as control. After the reading of sample optical densities, the avidity rate was calculated by the ratio of the reading with urea divided by the reading without urea, multiplied by 100 (percentile result). 5.1.2. Avidity assay with ammonium thiocyanate (Goldblat ef al. - 5.2)
The protocol is similar to the immunoassay one (5), with the following modifications: after the sample incubation (100 ng of clone 10 purified monoclonal antibody and 2.0 ng of clone 38 purified monoclonal antibody) for two hours at 37°C, the samples were subjected to treatment with ammonium thiocyanate for 30 minutes at 37°C in the following concentrations: 3 M; 1.5 M; 1.0 M; 0.75 M; 0.50 M; 0.25 M; and 0.125 M. A sample non-treated with ammonium thiocyanate was used as control for each clone.
After the reading of sample optical densities, the avidity rate was calculated by the following formula: AR (avidity rate) = [(log 50 - log A) x (B - A)/log B - log A] + A; where log 50 = 1.70. A is the lowest ammonium thiocyanate concentration that results in an absorbance reduction lower than 50%, and B is the highest ammonium thiocyanate concentration that results in an absorbance reduction higher than 50%. 6. Monoclonal antibody production and purification:
A sample of previously selected clones 10 and 38 was grown in a serumless medium (GIBCO VP-SFM) with addition of 1% BSA in 100-mL vials in a stove with atmosphere of 10% CO,. The supernatants were subjected to centrifugation, followed by filtration in 0.22-micrometer filters and purified in high performance chromatography (HPLC) with SelectSure protein A MAB resin (GE). The antibodies were neutralized at pH 7.0 with 1 M Tris, pH 10.0, dialyzed against PBS 0.5x in deionized water. The samples were subjected to lyophilization process, resuspended in deionized water, quantified by the Lowry method, and evaluated by electrophoresis in polyacrylamide gel. 7. Target recognition:
7.1. In vitro PBP2a recognition - immunoblotting:
A MRSA (CEB) strain, a methicillin-sensitive Staphylococcus aureus (MSSA) strain, a vancomycin-resistant Enterococcus faecium strain, and the BL-21 DE3 Escherichia coli strain were grown in exponential phase. One mL of each sample was centrifuged and lysed by agitation in glass beads in a mini-Bead Beater device (Biospect Products), 3 times for 30 seconds. One aliquot of each sample was subjected to electrophoresis in 12% denaturing polyacrylamide gel (SDS-PAGE), and the proteins were later transferred to a nylon membrane (Hybond N-BioRad). The membrane was blocked under mild agitation for two hours in PBS buffer containing 10% skimmed milk and [%
BSA (bovine serum albumin). The membrane was washed three times in PBS and
Tween 20 (0.05%) and three times in PBS. Then, the latter was placed in incubation for two hours, with supernatant of anti-PBP2a monoclonal antibody diluted in PBS at 1:1 ratio. After the incubation, the membrane was washed as previously described, and the alkaline phosphatase conjugate (murine anti-IgG antibody - Sigma A3688) at 1:15,000 ratio and incubated for ninety minutes. After this period, the washing in PBS was performed again, and the development with Western Blue substrate for alkaline phosphatase (Promega) was performed. 7.2. PBP2a recognition at the bacterium surface - flow cytometry:
A MRSA (CEB) strain was grown in stationary (ON) or exponential phase. The samples were washed in PBS 1x and resuspended at a DOgyp of 0.6 (~1 0 bacteria/mL).
These latter were centrifuged in 1 mL (10% bacteria) and resuspended in 0.5% BSA and a 1:10 dilution of normal serum (murine/human). Then, the samples were incubated for min at 4°C, and later, the concentrates (pellets) were washed 2 times in PBS and resuspended in 100 microliters of PBS containing 0.5% BSA and a 1:10,000 dilution of anti-PBP2a monoclonal antibody and incubated for 30 minutes at 4°C. After this step, the samples were washed as previously again and resuspended in 100 microliters of
PBS and 0.5% BSA and a dilution (1:1000) of PE (phycoerythrin) mouse anti-Ig conjugate, later being incubated at dark for 30 min at 4°C. Then, the samples were washed again and fixated for 15 minutes at 4°C in PBS containing 2% paraformaldehyde. After this preparation, the samples were analyzed in a flow cytometer (Becton and Dickinson - FACScalibur). 8. In vitro protection assays - determination of minimum inhibitory concentration:
MSRA strains (CEB, Iberian, COL, and CA) were grown in exponential phase up to 600 nm of optical density equal to 0.5. The applied inoculum was adjusted for containing approximately 100,000 bacteria. Miiller Hinton broth, bacterial inoculum, and growing amounts of purified anti-PBP2a monoclonal antibody were added to test tubes or 24-cavity plates. The plates or tubes were subjected to incubation at 37°C for 12 hours. After this period, presence or absence of turbidity was observed in the samples. The minimum inhibitory concentration was considered as the lower antibody amount able to inhibit the bacterial inoculum growth (100,000 bacteria). 9. In vivo protection assays:
9.1. Determination of lethal dose and LDDs for MRSA strains.
The determination of lethal dose and LDs, were performed according to the Reed-
Muench method (23) for MRSA strains (CEB, Iberian, WB79 CA, and COL). Groups of 8-week female Balb/C mice were inoculated by intraperitoneal route with growing bacteria doses and observed for 7 days. The animals that survived after this period were subjected to euthanasia, according to the established animal welfare rules. 9.2. Systemic infection and bacterial renal quantification assays.
MRSA strains (CEB, Iberian, and WB79 CA) were grown in exponential phase (DOgop ~0.6), washed and resuspended in sterile PBS 1x at DOggp ~0.5, corresponding to approximately 2 x 10* bacteria. This concentration was calculated by dilution and seeding on BHI agar plates containing 10 micrograms of oxacillin/mL. Female 8-week
Balb/C mice received one intraperitoneal dose of 400 micrograms of purified anti-
PBP2a monoclonal antibody in the first day. In the sixth day, the animals were subjected to euthanasia and the kidneys were aseptically removed. Then, the kidneys were homogenized in 1 mL of sterile Luria broth and successively diluted in series of 10. One hundred microliters of each dilution were seeded on BHI agar plates containing micrograms/mL of oxacillin and incubated for 24 hours at 37°C, with a count of resulting colonies and calculations of total dilutions being performed. 9.3. Survival assay.
MRSA strains were grown in the same previously described conditions, but an inoculum adjustment was performed for the previously established 1.Dsg. Female 8- week Balb/C mice received one intraperitoneal dose of 500 micrograms of purified anti-
PBP2a monoclonal antibody in the first day. In the following day, these animals plus a control group were infected with one dose of about 2.5 to 6.0 x 10° bacteria by intraperitoneal route, according to the LDso of each strain. The animals were observed for 10 days, with the survivors being subjected to euthanasia. 10. Comparative in vivo protection study of anti-PBP2a monoclonal antibody and vancomycin - renal quantification:
Assay 1
Four groups of female 8-week Balb/C mice (4 animals per group) received an infective dose of 6.0 x 107 bacteria (CEB-MRSA) by intraperitoneal route. The animals received doses of purified monoclonal antibody (MAB), vancomycin, MAB + vancomycin, and negative control, according to the groups below: group 1: MAB (400 micrograms) (first day) group 2: vancomycin (150 micrograms, intramuscular route, 12/12 hours) group 3: vancomycin + MAB (350 micrograms) (1 day after infection) group 4: control
The first doses of antibody and vancomycin were administered 4 hours after the administration of the infective dose. The animals were subjected to euthanasia in the fourth day, and the kidneys were aseptically removed and subjected to renal qualification, according to what was previously described.
Assay II
This assay was performed in the same way as the previous one, but, with a lower infective dose (7.0 x 10° bacteria), with the group 1 being treated with 500 micrograms of purified monoclonal antibody; group 2 being treated with vancomycin (150 micrograms, intramuscular route, 12/12 hours; 5 doses); group 3 being treated with vancomycin + 500 micrograms of monoclonal antibody; and group 4 being control (non-treated animals), 11. Identification complementarity-determining regions (CDRs) of light and heavy chains of the anti-PBP2a monoclonal antibody 11.1. mRNA extraction from hybridoma cells
A 10-mL centrifugate (pellet) of a cell culture of monoclonal antibody-producing hybridoma was processed for mRNA extraction using the RNeasy Minikit kit (Qiagen). 11.2. cDNA obtainment
Reverse transcriptase reaction: M-MLV reverse transcriptase kit (Invitrogen) was used for obtaining complementary DNA, following the manufacturing guidelines. 11.3. Amplification of VH and VL chains by polymerase chain reaction (PCR)
The reactions were performed using the starter sequences (primers) below.
SEQ Sequence Use
ID NO. ] FOR HEAVY CHAIN _
ATG(GA) | VH
A(GOTT(GCHTG)GG(TC)T(AC)A(AGYCT(GT)G(GA)TT Amplification 3” 19 5 VH
ATG(GA)AATG(GC)A(GCYCTGGT(CTHTAYT(TC)CTCT Amplification bY 5" GATGTGAAGCTTCAGGAGTC 3° VH
Amplification 21 5" CAGGTGCAGCTGAAGGAGTC 3° VH
Amplification 22 53" CAGGTGCAGCTGAAGCAGTC 3° VH
Amplification 23 5" CAGGTTACTCTGAAAGAGTC 3° VH
Amplification 24 5" GAGGTCCAGCTGCAACAATCT 3° VH
Amplification
5" GAGGTCCAGCTGCAGCAGTC 3° VH
B OReRSEORTE nn 26 5" CAGGTCCAACTGCAGCAGCCT 3 VH [7 CACOTORAETOIASERGETS NR en 27 5" GAGGTGAAGCTGGTGGAGTC 3° VH 7 [7 ORGOTOMATIOTOORNCT | en 28 5" GATGTGAACTTGGAAGTGTC 3° VH
RAO Yun 29 5" TGGACAGGGATCCAGAGTTCCAGGTCACT 3° VH (gamma Amplification ____ FORLIGHTCHAIN | = 5" GACATTGTGATGACCCAGICT 3° VL
I
31 5" GATGTTTTGATGACCCAAACT 3° VL
V|TONOTITIMERSEAMETY | epatn 32 5" GATATTGTGATAACCCAG 3° VL
TONIOIACORT amm, 33 5" GACATTGTGCTGACCCAATCT 3° VL
TONNTIISTORCNTY | epnnen 34 5" GATATTGTGCTAACTCAGTCT 3° VL
TOMTOM pan 5" GATATCCAGATGACACAGACT 3’ VL
B |TONMORGTIOAGTT in 36 5" GACATCCAGCTGACTCAGTICT 3° VL
P ORHTCOMAGIRTETY een 37 3" CAAATTGTTCTCACCCAGTCT 3° VL
P OMMTIOTIEIRCORTELY nin 38 S'CAGGCTGTTGTGACTCAGGAA 3° VL
B [POTTERY eptsin 39 5" TACAGTTGGTGCAGCATC 3’ VL 18) 11.4. Sequencing of light and heavy chains of anti-PBP2a monoclonal antibody
Sequencing Steps:
I. Amplification
This was performed using the previous starter sequences, defined by SEW ID NO.: 18 to SEQ ID NO.: 39.
II. Sequencing
The device ABI Prism 3100, Genetic Analyser (Hitachi) was used.
11.5. Sequence analysis and identification of light and heavy chain CDR
The obtained DNA sequences were analyzed with the aid of DNA Star program, and were translated to amino acid sequences (ExPASy site - Translate program) for later analysis by Kabat’s (24) and Chotia’s (25) algorithms for identification of light and heavy chain CDRs. 12. Determination of association and dissociation constants for monoclonal antibodies (clones 10 and 38 by surface plasmon resonance [SPR] [Biacore] method)
SPR measurements were performed using a CM-5 sensor in a Biacore X® (Biacore
AB, Uppsala, Sweden) device. Binding reagents and HBS-EP buffers (10 mM hepes, 150 mM NaCl, 3 mM EDTA, 0.005% P20 [Tween 0, pH 7.4]) were acquired with the company GE Healthcare.
Example 2 1. Obtainment of murine anti-PBP2a monoclonal antibodies:
A group of animals was subjected to the immunization protocol according to what was previously described. The result evaluated by ELISA test is described in Figure 1.
After the fusion process (fusion of number 90-LATAM), the supernatant from 96 cavities (hybridomas) was analyzed by ELISA test. From this total, the five best samples were selected and the cells were expanded (cloning). Then, again, the resulting supernatants were analyzed by ELISA. Positive samples were validated by immunoblotting against the purified recombinant protein (PBP2a) for validating the results obtained by ELISA. The final result is in Table I.
Figure 1 reveals the result from the immunoenzyme test (ELISA) of the sera of the immunized animals for producing anti-PBP2a antibodies. Each dashing corresponds to the 1:100 diluted serum of the immunized animals. Positive control serum is in angular dashing [ TUL]. First bar of each dashing: pre-immune serum; second bar: serum after fourth immunization; and third bar: serum after fifth immunization.
Table I. Clonings of fusion 90: final balance
Cloned Total number Positive Positive clones Selected hybridomas of clones clones (immunoblotting) clones (ELISA) 68 | 108 | 10 | i(loncle) | 1 1 at Zee [oo 7 [wer | Ze [oo 70 | a8 J 2 | Zeo | - 1 aw Tw [27
From the selected clones, clone 77-38 was subjected to recloning process for verifying the cell stability for secreting monoclonal antibodies. From the 50 analyzed cavities, all presented positive result by ELISA test. These clone were expanded and are stocked in liquid nitrogen at LATAM (Laboratory of monoclonal antibody technology) facilities. 2. Growth, production, and purification of monoclonal antibodies:
The process was standardized according to what was previously described. The obtained output is approximately 4 milligrams of monoclonal antibody for every 100 mL of supernatant subjected to the purification process. The obtained results can be seen below.
In Figure 2, we can see a polyacrylamide gel with raw samples and after purification.
This Figure 2 shows the non-denaturing polyacrylamide gel with supernatant samples before (column 1) and after purification (2) in HPLC column with MAb SelectSure resin. Columns 3 to 9 correspond to obtained purified sample fractions. The arrow indicates the approximate size of 150 kDa. 3. Functional characterization of monoclonal antibodies: 3.1. In vitro PBP2a recognition - immunoblotting
In order to investigate the capacity for antibody recognition by the target in the pathogen (PBP2a and similar sequences), the immunoblotting test was performed with bacteria presenting PBP2a (CEB and COL MRSA), a MSSA (methicillin-sensitive
Staphylococcus aureus) strain (not presenting PBP2a), a vancomycin-resistant
Enterococcus sp. strain (presenting PBPS), a transpeptidase with low-affinity for beta- lactam antibiotics (homologous to PBP2a), and an Escherichia coli strain (where the recombinant protein was generated) as negative control. The obtained results show that the antibody was able to recognize a protein with molecular weight of approximately 76 kDa in MRSA and Enterococcus sp. strains, corresponding to the size of PBP2a and
PBPS, respectively. No reactivity of the monoclonal antibody was seen with proteins of methicillin-sensitive Staphylococcus aureus (PBP2a-negative) neither with Escherichia coli strain. The results can be seen in Figure 3 (immunoblotting against MRSA and
MSSA).
The result of the immunoblotting test of MRSA and MSSA lysates against the supernatant containing anti-PBP2a monoclonal antibodies is shown in Figure 3. 1. - molecular weight marker (Kaleidoscope); 2. - MSSA sample grown in exponential phase; 3 and 4. - MRSA sample grown in exponential phase; 5. - MSSA sample grown in stationary phase (overnight); and 6 and 7. - MRSA samples grown in stationary phase. The left arrow indicates PBP2a molecular weight, 3.2. PBP2a recognition on the bacterium surface - flow cytometry
The objective of the flow cytometry test is to validate the capacity for target recognition on the bacterium in its native form by the monoclonal antibody. In previous tests (immunoblotting), we observed the target recognition on proteins subjected to a denaturation process, which occurs during the protein separation by electrophoresis in denaturing polyacrylamide gel. Again, we analyze a negative control strain (MSSA,
PBP2a-negative) and a MRSA strain (CEB) grown in exponential and stationary phases.
The obtained results show that the antibody is able to recognize the target on the bacterial surface in both conditions. The presence of protein A on Staphylococcus surface was not able to inhibit the antibody binding with PBP2a. The obtained results can be seen in Figure 4.
Figure 4 shows the results of the flow cytometry of MRSA (CEB) and MSSA bacteria incubated with anti-PBP2a monoclonal antibody and marked with phycoerythrin (PE). In (1), MSSA bacteria; in (2), MRSA grown in stationary phase; in (3), MRSA grown in exponential phase. MRSA populations present a right shift, corresponding to an increase in marked cells by the fluorescent conjugate. 4, Evaluation of protection conferred by anti-PBP2a monoclonal antibody: 4.1. In vitro protection tests
Determination of minimum inhibitory concentration (MIC)
These assays aim to evaluate the antibody capacity for directly binding itself to the target in a closed system. For monoclonal antibodies with therapeutic finality, positive results have extreme significance, as they mean that the antibody is able to recognize the target and to block the bacterial growth without the aid of the host immune system, such as complement activation and opsonization mechanisms, resulting from the combined action with the innate and adaptative immune system of the host. CEB, COL, and lberian MRSA strains were evaluated, where similar MIC values (approximately 500 micrograms) were seen in the evaluated conditions. These data indicate that regardless of the genetic background of the different MRSA strains, the antibody doses needed for blocking the growth are not the same. These results can be seen in Figure 5.
Figure 5 shows the test of the in vitro protection (MIC - minimum inhibitory concentration) conferred by anti-PBP2a purified monoclonal antibody and vancomycin against an inoculum of 10° cells from different MRSA strains. An absence of turbidity indicates that there was no bacterial growth in the analyzed conditions, 1A: CEB MRSA (Brazilian epidemic clone) + 250 pg of antibody; 2A: CEB MRSA + 500 pg of antibody; 3A: CEB MRSA + 750 pg of antibody; 4A and 6A: negative controls of CEB MRSA strain. 1B: COL MRSA + 250 pg of antibody: 2B: COL MRSA + 500 pg of antibody; 3B: COL MRSA + 750 pg of antibody; 4B and 6B: negative controls of COL MRSA strain. 1C: Iberian MRSA (European epidemic clone - EEC) + 250 ng of antibody; 2C: EEC MRSA + 500 pg of antibody; 3C: EEC MRSA + 750 ng of antibody: 4C and 6C: negative controls of EEC MRSA strain. 1D: CEB MRSA + 150 pg of vancomycin; 2D: CEB MRSA + 300 pg of vancomycin; 3D: CEB MRSA + 500 ug of vancomycin;
4D: CEB MRSA + 750 pg of vancomycin;
SD and 6D: negative controls. 4.2. In vivo protection tests 4.2.1. Determination of lethal and sublethal doses for CEB, Iberian, WB79 CA, and COL MRSA strains:
These assays were necessary in order that the in vivo protection was evaluated in the two used models - the renal quantification by sublethal dose one and the survival test after systemic infection with a larger inoculum of bacteria - able to cause death in about 50% of the animals (LDsp). The chosen route was intraperitoneal, due to the administration facility and the absence of losses. An adaptation of Reed-Muench method was used for conducting the assay, with two animals per condition (infective bacterial dose in growing concentrations) for determining LDso and sublethal doses, and three different doses were tested, once we had previous knowledge on the mean lethal doses for Staphylococcus aureus. COL MRSA strain, the first MRSA clone to have its genome sequenced, is used as reference strain for studies on this pathogen. However, it showed to be little virulent, needing high infective doses in relation to the other MRSA clones to cause infection in animals. Therefore, it was not used in protection assays. 4.2.2, Renal protection assays after systemic infection with sublethal dose
Using a renal quantification model after infection, these assays enable to evaluate the antibody capacity to reduce the presence of bacteria in vital organs (kidneys) after a systemic infection. A reduction higher than 3 log (1000 times) was reached in three independent assays with virulent MRSA strains from different genetic backgrounds. In these assays, the animals received a previous dose of 500 micrograms of antibody. The protection conferred by a lower antibody dose (250 micrograms) was evaluated in the assay with CA-MRSA strain, where a bacterial reduction was also observed, but lower than the one obtained with the 500-microgram dose. The results can be seen in Figures 6A, 6B, and 6C.
Figure 6A shows the results of renal quantification in animals treated and non-treated with anti-PBP2a monoclonal antibody and subjected to systemic infection with a sublethal dose of MRSA CEB strain. In horizontal stripes: log of concentration of bacteria isolated from the kidneys of each non-treated animal. In checkered pattern: log of quantity of bacteria isolated from the kidneys of each animal treated with the antibody. Bacterial quantification: controls: C1: 2000 bacteria; C2: 29,000 bacteria; C3: 220,000 bacteria; C4: 52,000 bacteria (mean of 75,750 bacteria). Treated (protected) animals: P1: 20 bacteria; P2, P3, and P4: 10 bacteria (mean of 12.5 bacteria). Reduction in the quantity of bacteria recovered from treated animals in refation to non-treated ones: 6060 times.
Figure 6B shows the results of renal quantification in animals treated and non-treated with anti-PBP2a monoclonal antibody and subjected to systemic infection with a sublethal dose of Iberian MRSA strain (European epidemic clone). In horizontal stripes: log of concentration of bacteria isolated from the kidneys of each non-treated animal. In large checkered pattern: log of quantity of bacteria isolated from the kidneys of each animal treated with the antibody. Bars in small checkered pattern indicate the respective obtained means. Bacterial quantification: controls: C1: 210,000 bacteria; C2: 44,000 bacteria; C3: 300,000 bacteria; C4: 290,000 bacteria (mean of 211,000 bacteria).
Treated (protected) animals: P1: 80 bacteria; P2: 200 bacteria; P3: 10 bacteria; and P4: 60 bacteria (mean of 87.5 bacteria). Reduction in quantity of bacteria recovered from treated animals in relation to the non-treated ones: 2420 times.
Figure 6C shows the results of renal quantification in animals treated and non-treated with anti-PBP2a monoclonal antibody and subjected to systemic infection with a sublethal dose of WB79 CA-MRSA strain (Brazilian community strain). Five first bars (in xx, horizontal dashing, and large checkered pattern): log of concentration of bacteria isolated from the kidneys of each non-treated animal. First bar (in xx): estimate in relation to an animal killed before the euthanasia. Bars 6, 7, 8, and 9 (in horizontal dashing and checkered pattern): log of quantity of bacteria isolated from the kidneys of animals treated with 250 pg of anti-PBP2a monoclonal antibody. Bars 10, 11, 12, and 13 (in triangles): log of quantity of bacteria isolated from the kidneys of each animal treated with 500 pg of antibody. Checkered bars (5™, 9", and 13" bars) indicate the respective obtained means, Bacterial quantification: controls: C1: 650,000 bacteria; C2: 26,000 bacteria; C3; 17,000 bacteria; C4: 300,000 bacteria (dead animal estimate) (mean of 231,000 bacteria). Animals treated with 250 ug of antibody: Pi: zero: P2: 5,400 bacteria; P3: 830 bacteria; and P4: 10 bacteria (mean of 1,560 bacteria). Animals treated with 500 ug of antibody: P1: 80; P2: zero; P3: 210; P4: 80 bacteria (mean of 92.5), Reduction in quantity of bacteria recovered from treated animals in relation to the ones non-treated with 250 ug of antibody: 149 times. With 500 ug: 2,497 times. 4.2.3. Survival assays
In this assay type, we evaluate the protection conferred by the antibody to animals after an infection with a bacterial load able to kill 50% of the animals {LDsp) or more.
The protection against the three strains used in the renal quantification assay was evaluated. A significant reduction in (i) survival time and (ii) the very survival of animals under treatment with antj-MRSA monocional antibodies was observed in the three independent assays.
In the assay with CEB MRSA strain, 70% of the animals under treatment survived the infection, against only 10% of the control group (non-treated). In the assay with
Iberian MRSA strain, the obtained results were similar, with 60% of protection in animals under treatment and 100% of death in control group. In the assay with CA
MRSA strain, a protection of 100% was seen, compared to 70% in control animals,
These results can be seen in F igures 7a, 7b, and 7c.
Figure 7A shows the survival curve of treated (protected) and non-treated (control) animals after infection by a dose of 2.3 x 10* bacteria (CEB MRSA) administered by intraperitoneal route (LDsp).
Figure 7B shows the survival curve of treated (protected) and non-treated (control) animals after infection by a dose of 4.2 x 10° bacteria (lberian MRSA) administered by intraperitoneal route (—LDsg).
Figure 7C shows the survival curve of treated (protected) and non-treated (control) animals after infection by a dose of 1.1 x 10° bacteria (WB79 CA-MRSA) administered by intraperitoneal route (~LDsp).
4.2.4, Comparative study on protection conferred by monoclonal antibody versus vancomycin
As vancomycin is a first choice antimicrobial for treatment of severe infections by
MRSA, a comparative study on protection was conducted in a model different from the previous ones. In this study, the animals were infected and the administration of the antimicrobial or monoclonal antibodies was started just after four hours of infection.
The study was conducted with three distinct groups: one treated with vancomycin, other treated with monoclonal antibodies, and a third one with simultaneous administration of antimicrobial + antibodies. Vancomycin doses were adjusted and administered in a way similar to the cases of infections in humans (500 mg every 12 hours).
The obtained results indicated that there was a reduction of around 15 times in the quantity of bacteria present in the kidneys of animals treated with antimicrobial or antibodies three days after the infection. However, a reduction of 4,617 times was seen in the group that received treatment with antimicrobial and antibodies.
Based on these results, we can conclude that the protection conferred by an antibody dose corresponded to five vancomycin doses and that the simultaneous administration of vancomycin and antibodies was very efficient in reducing the bacterial load observed in the kidneys of infected animals. This study was repeated with a little lower infective dose in order that we could better observe the protective action of anti-MRSA monoclonal antibodies both isolated and in association with vancomycin (See figures 8).
After the conduction of the second assay with a lower infective dose, the obtained results confirmed the initial results. The protection conferred by the treatment with monoclonal antibody caused a reduction of 89 times, which was higher than the protection obtained with the treatment with 5 vancomycin doses (reduction of 35 times).
However, the most significant reduction result was seen in the group treated with antibody + vancomycin, causing a reduction of 450 times.
Figure 8A shows the bacterial quantification in kidneys of animals treated with anti-
PBP2a monoclonal antibody, vancomycin, and association of antibody + vancomycin and in non-treated animals after infection with 6.0 x 107 bacteria (CEB MRSA). The treatment beginning happened 4 hours after the infection. Vancomycin was administered every 12 hours (5 doses). Bars 1, 2, 3, 4, and 5 (dashing): log of concentration of bacteria recovered from non-treated animals (controls). C1: 7,000,000;
C2: 295,000; C3: 380,000; C4: 3,200,000 (mean: 2,718,750 bacteria). Bars 6, 7, 8, 9, and 10 (checkered pattern): log of concentration of bacteria recovered from animals treated with 400 pg of anti-PBP2a monoclonal antibody. P1: 4,200; P2: 310,000; P3: 330,000; P4: 90,000 (mean of 183,550 bacteria}. Bars 11, 12, 13, 14, and 15 (spheres): animals treated with vancomycin. PI: 110,000; P2: 58,000; P3: 500,000; P4: 21,000 (mean of 172,250 bacteria). Bars 16, 17, 18, 19, and 290 (triangles): log of concentration of bacteria recovered from animals treated with antibody (300 pg) + vancomycin. P1: 1,100; P2: 700; P3: 450; P4: 90 (mean of 585 bacteria).
Figure 8B shows the bacterial quantification in kidneys of animals treated with anti-
PBP2a monoclonal antibody (bars 7 to 12), vancomycin (bars 13 to 18), antibody + vancomycin association (19 to 24) and of non-treated animals (bars 1 to 6) after infection with 7.0 x 10° bacteria (CEB MRSA). Treatment beginning in 4 hours after infection. Vancomycin administered every 12 hours (5 doses). Bars 1 to 6: log of concentration of bacteria recovered from non-treated animals (controls). C1: 6,000; C2:
1,000; C3: 500; C4: 118,000; and C5: 1,000 (mean: 25,220 bacteria). Bars 7 to 12: log of concentration of bacteria recovered from animals treated with 500 pg of anti-PBP2a monoclonal antibody. MB1: 450; MB2: 200; MB3: 100; MB4: 20: MB5: zero (mean of 284 bacteria). Bars 13 to 18: animals treated with vancomycin. VC1: 100; VC2: 700;
VC3: zero; VC4: zero; VCS: 2800 (mean of 720 bacteria). Bars 19 to 24: log of concentration of bacteria recovered from animals treated with antibody (500 pg) + vancomycin. MBV1: 130; MBV2: 20; MBV3: 10; MBV4: 80; MBVS5: 20 (mean of 56 bacteria), 3. Avidity assays
Results of the avidity tests of monoclonal antibodies clones 10 and 38:
Urea protocol avidity: clone 10: 1.03/1.46 (reading DOs with/without treatment) = 70.5% clone 38: 1.00/1.21 = 82.6%
Ammonium thiocyanate protocol avidity:
Clone 10 (DOs):
Control; 1.12
Thiocyanate-treated samples: 2M =0.046; 1.5 M =0,047;, 1 M=0.107; 0.75 M = 0.483; 0.5 M = 0.602; 0375 M = 0.684
Avidity rate: 2.47
Clone 38 (DOs):
Control: 1.22
Thiocyanate-treated samples: 2M=10.056; 1.5M =0.062; 1 M=10.129; 0.75 M = 0.648; 0.5 M = 0.758; 0.375 M = 0.793
Avidity rate: 4.40
It is seen that the avidity rates of clone 38 were higher than the ones of clone 10 in both assays. Furthermore, it is verified that, according to both protocols, it was necessary 10 use 50 times more antibody from clone 10 than from clone 38 in order to reach a DO close to 1.0. 6. Determination of association and dissociation constants of the monoclonal antibodies (clones 10 and 38 by surface plasmon resonance method [SPR] [BIAcore])
The results obtained by SPR method confirmed the preliminary results of antibody avidity, where clone 38 showed results higher than the ones of clone 10 again.
According to the data seen in Table II, we see that clone 38 shows affinity 450 times higher than the clone [0 one.
This affinity is mainly due to its higher association rate, which is about 100 times higher than the clone 10 one. Due to the very high affinity of clone 38, its measures present parameters close to the equipment detection threshold. Yet, due to the care in trial planning and conduction, we obtained an excellent adjustment for trial data using Langmuir’s model, which indicates that the obtained data are reliable.
Figure 9 shows the interaction between recombinant PBP2a (antigen) and monoclonal antibodies clone 38 (Figure 9A) and clone 10 (F igure 9B). Smoky dashing curves represent SPR data in the concentrations according to the right key. All samples were analyzed in duplicate, and the 1:1 Langmuir’s theoretical model for each curve is shown in black under each curve. Response units are represented in the vertical axis, and time is represented in the horizontal line in seconds. The closest lines referring to the horizontal axis represent the baseline for each sample (negative control).
Table II
Dissociation and interaction constants between antigen (PBP2a) and monoclonal antibodies clones 10 and 38. kM) TT Tk) Kem) 107° 7. Identification of complementary-determining regions (CDRs) of light and heavy chains of anti-PBP2a monoclonal antibody
After the mRNA extraction process in the hybridoma cells of the clone producing the used antibodies (clone 38), cDNA obtainment was performed and PCR reactions were performed with this material for different light and heavy chain alleles. The obtained materials were subjected to sequencing using the same starter sequences (defined by
SEQ ID NO.: 18 to SEQ ID NO.: 39) used in PCR reactions. Light chain 391 and heavy chain 310 were identified in three distinct sequencings. Applying the Kabat’s and
Chotia’s algorithms, we obtain the identification of light and heavy chain CDRs, which are the target of the attached claims.
We present the sequences of light and heavy chain CDRs below.
SEQ ID NO.: 6 - CDR 1 light chain amino acids.
RSSQSIGHSNGNTYLE
SEQ ID NO.: 7 - CDR 2 light chain amino acids.
KVSNRFS
SEQ ID NO.: 8 - CDR 3 light chain amino acids.
FQGSYVPLT
SEQ ID NO.: 9 - CDR 1 light chain DNA. cgeageagecagagcattggecatageaacggcaacacctaictggaa
SEQ ID NO.: 10 - CDR 2 light chain DNA. aaagtgagcaaccgctitage
SEQ ID NO.: 11 - CDR 3 light chain DNA. tttcagggcagcetatgtgcegetgace
SEQ ID NO.: 12 - CDR 1 heavy chain amino acids.
GFSITSSSSCWH
SEQ ID NO.: 13 - CDR 2 heavy chain amino acids.
RICYEGSISYSPSLKS
SEQ ID NO.: 14 - CDR 3 heavy chain amino acids.
ENHDWFFDV
SEQ ID NO.: 15 - CDR 1 heavy chain DNA. ggctttageattaccageageageagetgetggeat
SEQ ID NO.: 16 - CDR 2 heavy chain DNA. cgeatttgetatgaaggeageattagctatageccgageotgaaaage
SEQ ID NO.: 17 - CDR 3 heavy chain DNA. gaaaaccatgattggtttitigatgtg
Complementary data
Further other assays were conducted, proceeding the invention development. These are reported below, through examples.
Example 3
A second study using CEB MRSA strain was conducted, following the same protocol described in Example 1, item 7.2, with adding of two pulses of agitation by vortex, of seconds each one, after each washing; aiming to disaggregate Staphylococcus aureus agglomerates and to increase the quantity of PBP2a exposed to antibodies.
The markers FITC (fluorescein isothiocyanate) and PE (phycoerythrin) were tested, with control samples (i. pure bacterium, without contact with monoclonal antibody; and ii. pure bacterium plus FITC or PE marker) and the sample treated with monoclonal antibody and subjected to marking with PE or FITC being analyzed. The readings in
FACsalibur device were performed in linear mode.
Figure 10 is a graph of analysis by flow cytometry of MRSA samples in presence of
FITC-marked anti-PBP2a antibody. Curve (x) corresponds to non-marked sample, and curve (y) corresponds to marked sample.
The obtained results showed that about 22% of marked population was detected by the device, confirming the recognition of the target (PBP2a) present on the bacterial surface by anti-PBP2a antibodies (Figure 10).
Example 4
The inventors still surveyed the protection conferred by anti-PBP2a monoclonal antibody from methicillin-resistant Staphylococcus aureus against enterococcus.
According to what was already previously mentioned here, the antibody recognizes proteins present in Enferococcus sp. strains, probably PBPS - a transpeptidase with low affinity for beta-lactams, present in all enterococcus strains, with molecular weight of approximately 76 kDa (237 amino acids). This enzyme presents homology referring to
PBP2a of MRSA, according to alignment (ClustalW) related below:
PBPSEfas MERSNRNKKSSKNPLILGVSALVLIARAVGGY YAY SORQAKQELAEAKKTATTFLNVLSK 60
PBPSefam ~~~ -KHGKNRTGAY IAG--AVILIAAAGGGYFYYOHYQETQAVEAGEKTVEQFVOALNK 53
PBP2a T= --==-MKKIKIVPLILIVVVVGFGIYFYASKDKEINNT IDATEDKNFKOVYKD 48
PBPSEfas QEFDKLPSVVOEASLKKNGYDTKSVVEKYQAT YSGIQARGVKASDVOVKKAKDNQYTETY 120
PBESefam GDYNKAAEMTSKKAANKSALSEKEILDKYONIYGAADVKGLOISNLKVDKKDDSTYSFSY 113
EBP2a §8Y-—------~--ISKSDNGEVEMTERP TKI YNSLGVKDINIODRKTKKVSKNKKRVDA 97 . * - .o. or . - a . = *
PBESEfas KLSMSTPLGEMKDLS YQSS IAKKGDT YQTAWKPSLIFPDMSGNDK IST OVDNAKRGEIVD 180
PBPSefam KAKMNTSLGELKDLSYKGTLDRNDGOTT TNWQPNLVFPEMEGNDKVSLTTOEAARGNI ID 173
PBPZa QYKIKTNYGNIDRN-VQFNFVKEDGMWKL.DWDHSY II PGMOKDOS THI ENLKSERGKILD 156
Dol. Y kon, HE DRL Lrark ox ae jr KR gw F
PRPSEfas RNGSGLAINKVFDEVGVV PGKLGSGAEKTANIKAFSDKFGVSVDE IN--—QKLSOGHVOA 237
PBPSefam RNGEPLATTGKLKQLGVV PSKLGDGDEKTAN IKATASSFDLTEDAIN---QATSQSWVOE 230
PBP2a RNNVELANTGTHMRLGIVPKNVS-~~--KKDYKATAKELSTSEDY INNKWIKTIGYKMIPS 211
FR kk LEER oa Lor FFraL lr oh hk 1H so.
PBPSEfas DSFVPITVASEPVTELPTG--AATKDTESRYYPLGEACATNR-VYGTI TREDIEKN——PF 292
PBP5efam DYFVPLKIIDGATPELPAG-—AT IQEVDGRY YPLGEARAQL IGYVGDITAEDI DKN-~PE 286
PBP2a FHFKTVKKMDEYLSDFAKKFHLTTNETE SRNYPLEKATSHLLGYVGPTNSEELKQOKEYKG 271 oon. . Li. Totiln,h AEE aw Fox cA
PBESEfas LSSTGVIGKTGLERAFDKELRGODGGSLYTLDDK-ENVKKALQTKEKKDGOTIKLTIDSG 351
PBP5efam LSSNGKIGRSGLEMAFDKDLRGTTGGKLS I TDAD-GVEKKYLTEHEVONGKDIKLTIDAK 345
PBPZa YKDDAVIGKKGLEKLYDKKLOHEDGYRYVTIVDDNSNT IAHTL I EKKKKDGKDIQLTIDAK 331 vo. . LE Pkx x. * : x ok . rx ‘os H- kook kkok o
FPBPS5Efas VQOOAFATFDKRPGSAVITDPOKGDLLATVS S PSY DPNKMANG I SQKE YDAYNNNKDLPF 411
PBPhefam AOKTAFDSLGGKAGSTVATTPKTIGDLLALAS SPSY DPNKMTNGISQEDYKSYEENPEQEF 405
PBP2a VOKSIYNNMKNDYGSGTAIHPQTGELLALVSTPSY IVY PFMYGMSNEEYNKLTEDKKE PL, 391
JF : : wx Fr REAR Akhara po FrkoooE, ro. Fy
PBPSEfas TARFATGYAPGSTFKIITGAICLDAGTLKPDEELE INGLKWOKDKSWEGYFATRVEEAS~ 470
PRP5efam ISRFATGYAPGSTFRMITAATGLDNGTIDPNEVLT INGLKWOKDSSWGSYQVTRVS DVS ~ 464
PBP2a LNKFQITTSPGSTOKTLTAMIGLNNKTLODKT SYK TDOKGROKDKSHGGYNVTRYEVYNG 451 x sEF xk dark kok xs, . kok dha kak + kk . oo.
PBPSEfas PVNLRTALVNSDNIYFAQQTLRMGEDKFRAGLNKF I FGEELDLPTAMTEAQT SNEDKFNS 530
PBPSefam QVDLKTALIYSDNTYTAQETLKMGEKKFRIGLDKFIFGEDLDLPISMNPAQISNEDSENS 524
PBPZa NIDLKQATESSDNIFFARVALELGSKKFEKGMKKLGVGEDI PSDYPFYNAQT SNKN-LDN 510
PinoWp oo RRER Lk ad ok ww da kr Ady Li FEF. ae
PBPSEfas EILLADTGYGQGOLLISPIQQATMY SVFQNNGTLVYPKLVLDKETKK - KONVISANAANT 589
PBPSefam DILLADTGYGQGELLINPTQQAAMYSVFANNGTLYYPKLIADKETKD-KKNVIGETALOT 583
PBPZa EILLADSGYGQGEILINPVQTILSIYSALENNGN INAPHLLKDTKNKVWKKNI ISKENTNT. 570 phkEEE kkk da kk xk TikE Oo. Fk. Fak Foor Kk * kak :
PBP5Efas IATDLLGSVEDPSGYVYNMYNPNFS LAAKTGTAEIKDKQDTDGKENSFLLTLDRSNNKFL 649
PBESefam IVPDLREVVQDVNGTAHSLSALGI PLARKTGTARTKEKQDVKGKENSFLEAFNPDNOGYM 643
PRP2a LNDGMQQVVN~--KTHKEDI YRSYANLIGKSGTAE LKMKOGESCROIGWFISYDKDNPNMM 628 : . 3 *: . Lr Fo wrkkER Lh kk ka aaa nk :
PBPSEfas TMIMVENSGENGSATDISKPLIDYLEATTK- ———m—eme—— §79
PBPSefam MVSMLENKEDDDSATKRASELLOYLNONYQ--———————— 673
PBP2a MAINVKDVQDKGMASYNAKISGKVYDELYENGNKKYDIDE 668 a. - EE) - - .
The alignment was performed with sequences corresponding to PBP5 from the enterococci E. faecalis (Efas) and E. faecium (Efam) with MRSA PBP2a. Marked sequences (bold - PBPS; underlined - PBP2a) correspond to the used PBP2a region to generate monoclonal antibodies. Amino acids corresponding to the enzyme active core are marked in italic.
Thus, in vitro protection assays, determination of lethal dose and LDsg, and in vivo assays (sublethal dose with renal quantification and survival assay with lethal dose)
with an enterococcus strain in murine model (Balb/C mice) were conducted, as previously conducted with MRSA. These results can be seen in the corresponding reports, 1.1. In vitro protection assays
The objective of this assay was to evaluate the in vitro protection conferred by the antibody against VRE enterococcus strain.
In vitro protection test (MIC), clone 38 purified monoclonal antibody (90/DAS/CBS/AA3 hib 77) against Enterococcus Jf clinical strain (VRE), Richet laboratory.
Conditions:
Sample: purified from supernatant by HPLC, SelecSure MAB resin, dialysed, lyophilized.
Antibody quantification (Lowry’s method): 3.5 mg/mL
Inoculum: VRE strain
Pre-inoculum: 1 VRE colony in 20 mL Lb and vancomycin (10 mg/mL), ON 37°C, 160 rpm
Inoculum: 400 mL of pre-inoculum in 20 mL Lb, 200-mL erlenmayer, 37°C, 160 rpm
DOggonm reading after 7 hours: 0.7
Quantification: 5.5 x 10° bacteria/mL
Test conditions:
Inoculum: 5.5 x 10° bacteria
Antibody concentrations: 300, 400, 500, 600, and 700 mg of antibody
Culture medium: 1 mL of Luria broth
Cell culture plate, 24 cavities
Positive control: Luria broth + bacterial inoculum
Negative control: Luria broth
Incubation: 18 hours, 37°C
Figure 11 shows the result of the evaluation of the protection conferred by the antibody. In Figure 11, we have:
A. 300 mg of antibody
B. 400 mg of antibody
C. 500 mg of antibody
D. 600 mg of antibody
E. Negative control
F. Positive control
G. 700 mg of antibody 1.2. LDs; and lethal dose determination by intraperitoneal route - vancomycin- resistant Enterococcus faecium
Protocol:
Female 7-week Balb/C animals, mean weight of 20 grams
Day 01 - pre-inoculum: 1 VRE strain colony in 10 mL of Lb broth and vancomycin (10 mg/mL), 50-mL Falkow tube, growth ON 37°C, 160 rpm
Day 02 - inoculum: 1 mL of pre-inoculum in 50 mL of Lb broth/vancomycin (250-mL erlenmayer) - 4 vials, 37°C, 160 rpm, growth until ODgogum = 0.80 centrifugation for 10 min, 4000 rpm, resuspension in PBS 1x sterile, OD 1.2
Quantification: 2.1 x 10° bacteria/mL
A. 60 microliters (1.5 x 107)
B. 300 microliters (6.5 x 107)
C. 900 microliters (reduced to 300 microliters/dose) (1.5 x 10%)
D. 4.5 mL (reduced to 300 microliters/dose) (6.5 x 10%)
E. 9.0 mL (1.2 x 10° bacteria) (reduced to 300 microliters/dose)
F. 45.0 mL (6.5 x 10° bacteria) reduced to 300 microliters/dose)
The animal observation was performed from day 02 to the tenth day of the assay.
The result is shown in Figure 12, and it is concluded that the lethal dose is 1.2 x 10° bacteria and LDsg is 6.5 x 10° bacteria.
Renal quantification of animals surviving in the seventh day:
A (1.5 x 10"): no bacterial growth
B (6.5 x 107): no bacterial growth
C (1.5 x 10%): 3100 bacteria
D (6.5 x 10%): 2.8 x 10* bacteria 1.3. In vivo protection test - survival test - lethal dose, systemic infection by intraperitoneal route in murine model
The objective of this assay was to evaluate the efficacy of in vivo protection for anti-
PBP2a monoclonal antibody against systemic infection with lethal dose, Enterococcus
Jaecium (VRE) strain. 1. Antibody (purified from supernatant of the cell culture in medium with serum) - Dialysed and lyophilized purified sample (HPLC SelecSure MAB), resuspended and filtered before use. - Quantification (Lowry’s method): 1.0 mg/mL 2. Murine model: female, 8-week Balb/C animals, weigh from 23 to 25 grams 3. Protocol: group A (6 animals): 650 mg of antibody (350 mg + 300 mg) group B (6 animals): control (saline administration) 4. Preparation of bacterial inoculum:
VRE strain: pre-inoculum, day 01, 10 mL of BHI broth and vancomycin at 10 mg/mL ON, 37°C, 160 rpm inoculum, day 03: 300 mL of pre-inoculum in 30 mL of BHI and vancomycin, DOggo of 1.31, centrifuged for 10 min, 4,000 rpm, resuspended in sterile PBS 0.5x, adjustment at
OD = 1.10, dilutions and plates for quantification (2.0 x 10® bacteria/mL); inoculum: 12 mL, centrifugate resuspended in 300 mL, IP route (~2.2 x 10° bacteria)
Time schedule:
Day 01: IP inoculation of antibody (350 mg)
Day 02: IP inoculation of antibody (300 mg), systemic infection in the afternoon (IP, 250 mL of bacterial solution - 2.2 x 10° bacteria)
Day 02 to Day 13: animal observation.
The results are shown in Figure 13. Only 2 treated animals died (66.6% of protection). All control animals died in the second day. 1.4. In vivo protection test - systemic infection by intraperitoneal route in murine model with vancomycin-resistant Enterococcus faecium
The objective was to evaluate the in vivo protection efficacy of anti-PBP2a and PBP5 monoclonal antibody from enterococci against systemic infection, E. faecium (VRE) strain.
Test: 1. Antibody (purified from supernatant of the cell culture in medium with serum) - Dialysed, lyophilized, and resuspended purified sample (AffiPrep ProteinA
Biorad/HPLC SelecSure MAB). - Quantification (Lowry’s method): 1.5 mg/mL 2. Murine model: female, 8-week Balb/C animals, weigh from 19 to 23 grams 3. Protocol: group A (4 animals): 500 micrograms of antibody (in 2 months, d01, d02) group B (4 animals): non-protected control 4. Preparation of bacterial inoculum:
Iberian MRSA strain: pre-inoculum, 10 mL of Lb broth ON, 37°C, 120 rpm inoculum: 200 microliters of pre-inoculum in 20 mL of Lb, DOgqq of 0.80, centrifuged for 10 min, 4,000 rpm, resuspended in sterile PBS 0.5x, adjustment at OD = 0.51, dilutions and plates for quantification (24 x 10 bacteria/mL); inoculum: 500 microliters, IP route (2.4 x 10° bacteria)
Time schedule:
Day 01: inoculation of 250 micrograms of antibody by intraperitoneal route
Day 02: inoculation of 250 micrograms of antibody by intraperitoneal route and systemic infection (intraperitoneal, 500 microliters of bacterial solution)
Day 06: euthanasia, bacterial quantification in kidneys
Based on the results above, we can highlight that:
In vitro protection assays - determination of minimum inhibitory concentration:
A total of 700 micrograms of antibody is able to block the growth of 550,000 bacteria. These values are higher than the MIC obtained for MRSA strains, which were approximately 500 micrograms.
In vive protection assays:
In vivo protection test - systemic infection by intraperitoneal route in murine model with sublethal dose of vancomycin-resistant Enterococcus faecium,
The animals received 500 micrograms of monoclonal antibody, intraperitoneal route (IP), and were subjected to systemic infection, IP route, with 2.4 x 10° bacteria. Four days after, they were subjected to euthanasia and excision of kidneys for bacterial quantification. Treated animals presented a mean of 87.5 bacteria/animal, while controls (non-treated infected animals) presented a mean of 21 1,000 bacteria/animal.
Survival test after lethal dose administration
The animals received 650 micrograms of monoclonal antibody (IP route) and were subjected to systemic infection (IP route) and daily observed for 10 days. Control {(non- treated) animals died until the second day after the infection; two of the treated animals (6) died in the second day; the others remained alive unti] the end of the trial. Survival rate was 66.6%.
Therefore, once more we have confirmed that MRSA anti-PBPa monoclonal antibody showed to confer cross protection against enterococci. However, the doses needed for conferring protection were higher than the ones used against MRSA in similar conditions. This is probably due to the lower capacity of the antibody to recognize
PBPS with the same efficacy as PBP2a, which it was developed for.
Therefore, the current invention described here - anti-PBP2a monoclonal antibodies, able to specifically bind to PBP2a and homologous sequences - has applicability in infections caused by bacteria presenting this protein or similar substances (MRSA,
MRSE, and Enterococcus spp., and any other pathogen that has a protein homologous to PBP2a).
It is important to emphasize that once these infections are a worldwide problem and the assays were conducted against the main known epidemic MRSA clones, the product of the current invention has application in any place where there are infections by this pathogen.
The documents relative to the state of the art of knowledge of the inventors, cited in the current descriptive report, are listed below. 1. KOPP, BJ. NIX DE, ARMSTRONG EP. Clinical and economic analysis of methicillin-resistant Staphylococcus aureus infections. The Annals of Pharmacotherapy; 38:1377-82. 2004. 2. BOYCE, JM. Are the epidemiology and microbiology of methicillin-resistant
Staphylococcus aureus changing? JAMA 279(8):623-4. 1998. 3. HUNT, C; DIONNE M, er. al. Four pediatric deaths from community-acquired methicillin-resistant Staphylococcus aureus in Minnesota and North Dakota, 1997- 1999. Morbidity and Mortality weekly report-CDC USA. 48(32):707-10. 1999, 4. O'BRIEN, FG; PEARMAN, JW; GRACEY, M: RILEY, TV. GRUBB, WB.
Community strain of methicillin-resistant Staphylococcus aureus involved in a hospital outbreak. Journal of Clin Microbiol. 37(9):2858-62. 1999. 3. TENOVER, FC; LANCASTER, MV; HILL, BC; STEDWARD, CD; STOCKER,
SA; HANCOCK, GA; er al. Characterization of staphylococci with reduced susceptibilities to vancomycin and other glycopeptides. Journal of Clin Microbiol. 36(4):1020-27. 1998. 6. LUTZ, L; MATOS, SB; KUPLICH, N; MACHADO A: BARTH AL, Caracteristicas laboratoriais de Staphylococcus aureus isolado de paciente que ndo respondeu ao tratamento com vancomicina. Primeiro Encontro de Controle de Infeccdo Hospitalar do
MERCOSUL. 1999. 7. COSGROVE, SE; CARROLL, KC; PERL, TM. Staphylococcus aureus with reduced susceptibility to vancomycin. Clin Infect Diseases. 39(4):539-45. 2004. 8. JARVIS, WR; SCHLOSSER JMA, CHINN RY, TWETTEN S, JACSON M.
National prevalence of methicillin resistant Staphylococcus aureus in inpatients at US health care facilities, 2006. Am J Infect Control. 35(10):631-7. 2007. 9. YAMAUCHI, M. Japan struck by resistant Staphylococcus aureus. British Medical
Journal. 306:740. 1993. 10. PANLILIO, AL; CULVER, DH: GAYNES, RP. Methicillin-resistant
Staphylococcus aureus in US hospitals, 1975-1991. Infection Control and Hospital
Epid. 13:582-86. 1992. 11. LOWRY, F. Staphylococcus aureus infections. New England Journal of Medicine. 339:520-32. 1998. 12. FARR, BM. Prevention and control of methicillin-resistant Staphylococcus aureus infections. Current Opinion Infectious Diseases. 17:317-22. 2004. 13. TIEMERSMA, EW; BRONZWA, ER; SLAM, et. al. Methicillin-resistant
Staphylococcus aureus in Europe, 1999-2002. Emerging Infectious Diseases. 10:1627- 34, 2004. 14. BERETTA, ALRZ; TRABASSO, P.; STUCCHI, RB; MORETTI, ML. Use of molecular epidemiology to monitor the nosocomial dissemination of methicillin- resistant Staphylococcus aureus in an University hospital from 1991-2001. Braz.
Journal of Medical and Biological Research. 37:1345-51. 2004. 15. PANNUTI, CS; GRINBAUM, RS. An overview of nosocomial infection control in
Brazil. Infection Control and Hospital Epidemiology. 16(3):170-74. 1995. 16. RESENDE, EM; COUTO, BRGM; STARLING, CEF: MODENA, CM. Prevalence of nosocomial infections in general hospitals in Belo Horizonte. Infection Control and
Hospital Epidemiology. 19(11):872-76. 1998. 16a. Grundmann H., Aires de Souza M., Boyce J. and Tiemersma J. Emergence and resurgence of Methicillinn-resistant Staphylococcus aureus as a public trhreat health.
Lancet. 2006. 368:874-85. 17. GUIGNARD, B; ENTENZA, JM; MOREILLON P. Beta-lactams against methicillin-resistant Staphylococcus aureus. Curr. Opin Pharmacol. 5(5):479-89. 2005. 18. SENNA, JP; ROTH, DM; OLIVEIRA, JS; MACHADO, DC, SANTOS DS.
Protective immune response against methicillin resistant Staphylococcus aureus in a murine model using a DNA vaccine approach. Vaccine. 21:2661-66. 2003. 19. OHWADA, A; SEKIYA, M; HANAKI, H: ARAI, KK; HIRAMATSU, K,
FUKUCHLY. DNA vaccination by mecA sequence evokes an antibacterial immune response against methiciilin-resistant Staphylococcus aureus. Antimicrob Agents and
Chemother. 44:767-74. 1999. 20. DOMBROWSKI, JC; WINSTON, LG. Clinical failures of appropriately-treated methicillin-resistant Staphylococcus aureus infections. J. Infect. 57(2):110-5. 2008. 20bis. RYFFEL, C; TESCH, W; BICH-MACHIN, I.: REYNOLDS, PE; BARBERIS-
MAINO, L; KAYSER, FH; BERGER-BACHI, B. Sequence comparison of mecA genes isolated from methicillin-resistant S. aureus and S. epidermidis. Gene. 94:137-38. 1990.
21. ROTH, DM; SENNA, JP; MACHADO, DC. Evaluation of the humoral immune response in BALB/c mice immunized with a naked DNA vaccine anti-methicillin- resistant Staphylococcus aureus. Genetics Molecular Research. 5(3):503-12. 2006. 22. YOKOYAMA, W. Production of monoclonal antibodies: induction of immune responses, p. 2.5.4-2.5.8. In: JE. Coligan, A.M. Kruisbeek, D.H. Margulies, E.M.
Shevach and W. Strober (ed). Current Protocols in Immunology, vol. 1. Wiley and
Sons, Hoboken, N.J, 1995. 23. REED, LT AND MUENCH H. Am. J. Hyg. 27:493-97, 1938. 24. KABAT, EA; WU, TT; BILOFSKY, H; M REID-MULLER, PERRY, H. Sequence of proteins of immunological interest. National Institutes of Health, Bethesda. 1993. 25. CHOTIA, C; LESK, AM; TRAMONTANO, A; LEVITT, M; SMITH-GILL,
PADLAN, EA; DAVIES, D; TULIP, WR. Conformations of immunoglobulin hypervariable regions. Nature, 342:877-883. 1989. 26. GOULD IM. The clinical significance of methicillin-resistant Staphylococcus aureus. J. Hospital Infections, 61(4):277-82. 2005. 27. ANDREMONT, A; TIBON-CORNILLOT, M. Le triomphe des bactéries, la fin des antibiotiques? Ed Max Milo, 1 ed, 2007. 28. Silverstein, Arthur M. Paul Ehrlich's receptor immunology. San Diego: Academic
Press, 2002. 29. LIM, D; STRINADKA NC, Structural basis for the beta lactam resistance of PBP2a from methicillin-resistant Staphylococus aureus. Nat Struct Biol. 9(11): 870-6. 2002. 30. PAPAKYIRIAKOU, H; VAZ, D; SIMOR, A; LOUIE M; MCGAVIN Ml.
Molecular analysis of the accessory gene regulator (agr) locus and balance of virulence factor expression in epidemic methicillin-resistant Staphylococcus aureus. J Infect Dis. 181(3):2400-4. 2000. 31. TEIXEIRA, LA, RESENDE, CA; ORMONDE, IR; ROSENBAUM, R;:
FIGUEIREDO AM, DE LENCASTRE H, TOMASZ A. Geographic spread of epidemic multiresistant Staphylococcus aureus clone in Brazil. J Clin Microbiol. 33(9):2400- 4.1995, 32. DA SILVA, COIMBRA MV, TEIXEIRA, LA; RAMOS, RI; PREDARI, SC;
CASTELLO, L; FAMIGLIETTI A, VA, C; KLAN, L; FIGUEIREDO AM. Spread of the Brazilian epidemic clone of a multiresistant MRSA in two cities in Argentina. ] Med
Microbiol. 49(2):187-92. 2000. 33. SENNA, JP; PINTO, CA; MATEOQS, S; QUINTANA, A; SANTOS DS. Spread of a dominant methicillin-resistant Staphylococcus aureus (MRSA) clone between
Uruguayan and South Brazil Hospitals. J Hospital Infect. 53(2):15607. 2003. 34. MELTER, O; SANTOS SANCHES, I; SCHINDLER, J; AIRES DE SOUZA, M;
KOVAROVA, V; ZEMLICKOVA, H; DE LENCASTRE H. Methicillin-resistant
Staphylococcus aureus clonal types in the Czech Republic. J Clin Microbiol, 37(9):2798-803. 1999, 35. DA SILVA COIMBRA MV, SILVA-CARVALHO MC; WISPLINGHOFF H;
HALL GO; TALLENT SS; WALLACE, S; EDMOND, MB: FIGUEIREDO, AM;
WEINZEL, RP. Clonal spread of methicillin-resistant Staphylococcus aureus in a large geographic area of the United States. J Hosp Infect. 53(2):103-10. 2003. 36. NYGAARD, TK: DELEO, FR; VOYICH, JM. Community-associated methicillin- resistant Staphylococcus aureus skin infections: advances toward identifying the key virulence factors. Curr Op Infect Dis. 21(2):147-52. 2008.
37. DIEP, BA; CHAMBERS, HF; GRABER, Cl; SZUMOWSK], JD; MILLER, LG;
HAN, LL; CHEN, JH; LIN, F; er at Emergence of multidrug-resistang, community- associated, methicillin-resistant Staphylococcus atreus clone USA300 in men whohave
Sex with men. App Intern Med. 148(4):249.57. 2008. 38. REICHERT, IM; DEWITZ, MC. Anti-infective monociona] antibodies: perils and promise of development, Nat Rev Drug Discov. 3(3):191-5. 2006. 39. GAo, J; STEWART, GC. Regulatory elements of the Staphylococeys aureus protein A (Spa) Promoter. J Bacterio]. 186(12):373 8-48. 2004. 40. GOFFIN, ; GHUYSEN JM. Muitimodular penicillin-binding proteins: an enigmatic family of orthologs and parologs. Microbio} Mol Biol Rev, 62(4):1079-93 1998. 41. COURVALIN p. Vancomycin resistance in gram-positive cocci. Clin Infect Dis, 1542 Suppl 1:825-34. 2006. 42. BAILIE GR, NEAL D. Vancomycin Ototoxicity and nephrotoxicity, Med Toxicol
Adverse Drug Exp. 3:3 76-86. 1988. 43. SALGUEROQO E; PLAZA D; MARINO A; MORENO C; DELGADO G.
Characterising vancomycin’s immunotoxijc profile using Swiss and CFW mice as na experimental model. Biomed Pharmacother, Sept 16. 2008.
MONOCLONAL ANTIBODIES FOR PBP2-a PROTEIN AND HOMOLOGOUS
SEQUENCES FOR TREATMENT OF INFECTIONS AND
IMMUNODIAGNOSIS ON BACTERIA FROM PHYLUM FIRMICUTES
The current invention refers to monoclonal antibodies able to recognize and bind to
PBP2a protein and other proteins presenting sequences homologous to PBP2a, including the pathogens methicillin-resistant Staphylococcus aureus - MRSA, coagulase-negative Staphylococcus, Staphylococcus sciuri, Enterococcus spp., and any other bacterium possessing PBP2a or sequences homologous to this protein.
The invention still refers to the use of monoclonal antibodies able to recognize and bind to PBP2a protein and other proteins presenting sequences homologous to PBP2a in a complementary immunodiagnosis for detection of resistance to beta-lactams.
Claims (19)
1. Isolated monoclonal antibody that binds itself to PBP2a protein from methicillin- resistant bacteria (MRSA), characterized by comprising a variable chain region that comprises an amino acid sequence, according to what is selected from groups SEQ ID
NO.: 6, SEQ ID NO.: 7, SEQ ID NO.: 8, SEQ ID NO.: 12, SEQ ID NO.: 13, and SEQ ID NO.: 14 or corresponding amino acid sequences at least 80% identical to them.
2. Isolated monoclonal antibody that binds itself to PBP2a protein from methicillin- resistant bacteria (MRSA), characterized by comprising a variable chain region that comprises an DNA sequence, according to what is selected from groups SEQ ID NO.: 9, SEQ ID NO.: 10, SEQ ID NO.: 11, SEQ ID NO.: 15, SEQ ID NO.: 16, and SEQ ID
NO.: 17 or corresponding DNA sequences at least 80% identical to them.
3. Isolated monoclonal antibody that binds itself to PBP5 protein from Enterococcus spp., characterized by comprising a variable chain region that comprises an amino acid sequence, according to what is selected from groups SEQ ID NO.: 6, SEQ ID NO.: 7, SEQ ID NO.: 8, SEQ ID NO.: 12, SEQ ID NO.: 13, and SEQ ID NO.: 14 or corresponding amino acid sequences at least 80% identical to them.
4. Isolated monoclonal antibody that binds itself to PBPS protein from Enterococcus spp., characterized by comprising a variable chain region that comprises an DNA sequence, according to what is selected from groups SEQ ID NO.: 9, SEQ ID NO.: 10, SEQ ID NO.: 11, SEQ ID NO.: 15, SEQ ID NO.: 16, and SEQ ID NO.: 17 or corresponding DNA sequences at least 80% identical to them.
3. Method for diagnosis of resistance to beta-lactam antimicrobials, characterized by comprising the addition of an isolated monoclonal antibody, according to what is defined in one of claims 1 or 2, pure or in association to other substances, for bacterial samples suspected of containing PBP2a or proteins homologous to it.
6. Pharmaceutical composition for treatment or prevention of infection by bacteria possessing PBP2a or proteins homologous to it, characterized by comprising a quantity of the isolated monoclonal antibody according to what is defined in claims 1 or 2 and a pharmaceutical vehicle, either carrier or excipient.
7. Method for treating or preventing an infection by a bacterium possessing PBP2a or proteins homologous to it, characterized by comprising the administration of a quantity of the isolated monoclonal antibody to a human or animal patient, according to what is defined in claims 1 or 2.
8. Antibody according to claim 1, characterized by a variable heavy chain possessing a CDR1 region that includes the sequence GFSITSSSSCWH (SEQ ID NO.: 12) (CDRI1 VH) and the corresponding nucleic acid sequence, with the possible degenerations.
9. Antibody according to claim 1, characterized by a variable heavy chain possessing a CDR2 region that includes the sequence RICYEGSISYSPSLKS (SEQ ID
NO.: 13) (CDR2 VH} and the corresponding nucleic acid sequence, with the possible degenerations.
10. Antibody according to claim 1, characterized by a variable heavy chain possessing a CDR3 region that includes the sequence ENHDWFFDV (SEQ ID NO.: 14) (CDR3 VH) and the corresponding nucleic acid sequence, with the possible degencrations.
11. Antibody according to claim 1, characterized by a variable light chain possessing a CDR1 region that includes the sequence RSSQSIGHSNGNTYLE (SEQ
ID NO.: 6) (CDR1 VL) and the corresponding nucleic acid sequence, with the possible degenerations.
12. Antibody according to claim 1, characterized by a variable light chain possessing a CDR2 region that includes the sequence KVSNRFS (SEQ ID NO.: 7) (CDR2 VL) and the corresponding nucleic acid sequence, with the possible degencrations.
13. Antibody according to claim 1, characterized by a variable light chain possessing a CDR3 region that includes the sequence FQGSYVPLT (SEQ ID NO.: 8) (CDR3 VL) and the corresponding nucleic acid sequence, with the possible degenerations.
14. Antibody according to claim 2, characterized by a variable light chain possessing a CDRI region that includes the sequence SEQ ID NO.: 9 and the corresponding nucleotide sequence, with the possible degenerations.
15. Antibody according to claim 2, characterized by a variable light chain possessing a CDR2 region that includes the sequence SEQ ID NO.: 10 and the corresponding nucleotide sequence, with the possible degenerations.
16. Antibody according to claim 2, characterized by a variable light chain possessing a CDR3 region that includes the sequence SEQ ID NO.: 11 and the corresponding nucleotide sequence, with the possible degenerations.
17. Antibody according to claim 2, characterized by a variable heavy chain possessing a CDRI region that includes the sequence SEQ ID NO.: 15 and the corresponding nucleotide sequence, with the possible degenerations.
18. Antibody according to claim 2, characterized by a variable heavy chain possessing a CDR2 region that includes the sequence SEQ ID NO.: 16 and the corresponding nucleotide sequence, with the possible degenerations.
19. Antibody according to claim 3, characterized by a variable heavy chain possessing a CDR3 region that includes the sequence SEQ ID NO.: 16 and the corresponding nucleotide sequence, with the possible degenerations,
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| BRPI0914508-7A BRPI0914508B1 (en) | 2009-08-10 | 2009-08-10 | Monoclonal Antibodies to PBP2a PROTEIN, AND PHARMACEUTICAL COMPOSITION |
| PCT/BR2010/000263 WO2011017791A1 (en) | 2009-08-10 | 2010-08-10 | Monoclonal antibodies against the pbp2-a protein and homologous sequences for the treatment of infections by and immunodiagnostics of bacteria of the firmicutes phylum |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| SG178346A1 true SG178346A1 (en) | 2012-03-29 |
Family
ID=45896895
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| SG2012009205A SG178346A1 (en) | 2009-08-10 | 2010-08-10 | Monoclonal antibodies against the pbp2-a protein and homologous sequences for the treatment of infections by and immunodiagnostics of bacteria of the firmicutes phylum |
Country Status (6)
| Country | Link |
|---|---|
| JP (1) | JP5785544B2 (en) |
| CN (1) | CN102741281B (en) |
| AU (1) | AU2010282162B2 (en) |
| CU (2) | CU24095B1 (en) |
| HK (1) | HK1176077A1 (en) |
| SG (1) | SG178346A1 (en) |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN105315367B (en) * | 2014-07-29 | 2019-01-29 | 广州瑞博奥生物科技有限公司 | For detecting the enzyme linked immunological kit of methicillin-resistant staphylococcus aureus |
| CN113150139B (en) * | 2021-02-01 | 2022-09-09 | 深圳市龙华区疾病预防控制中心 | PBP2a monoclonal antibody and preparation method and application thereof |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1173485A1 (en) * | 1999-05-03 | 2002-01-23 | Medarex, Inc. | Human antibodies to staphylococcus aureus |
-
2010
- 2010-08-10 JP JP2012524064A patent/JP5785544B2/en active Active
- 2010-08-10 CN CN201080043628.XA patent/CN102741281B/en active Active
- 2010-08-10 SG SG2012009205A patent/SG178346A1/en unknown
- 2010-08-10 AU AU2010282162A patent/AU2010282162B2/en active Active
- 2010-08-10 CU CU2012000026A patent/CU24095B1/en active IP Right Grant
- 2010-08-10 CU CU20140101A patent/CU24180B1/en active IP Right Grant
-
2013
- 2013-03-20 HK HK13103458.4A patent/HK1176077A1/en unknown
Also Published As
| Publication number | Publication date |
|---|---|
| CN102741281A (en) | 2012-10-17 |
| HK1176077A1 (en) | 2013-07-19 |
| CU24095B1 (en) | 2015-04-29 |
| AU2010282162A8 (en) | 2012-05-24 |
| JP2013501732A (en) | 2013-01-17 |
| AU2010282162A1 (en) | 2012-04-05 |
| CU24180B1 (en) | 2016-04-25 |
| AU2010282162B2 (en) | 2016-06-02 |
| CN102741281B (en) | 2015-02-25 |
| RU2012108941A (en) | 2013-09-20 |
| CU20120026A7 (en) | 2012-06-21 |
| JP5785544B2 (en) | 2015-09-30 |
| CU20140101A7 (en) | 2015-01-29 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10781246B2 (en) | Compositions and methods for anti-staphylococcal biologic agents | |
| US9927428B2 (en) | Gram-positive bacteria specific binding compounds | |
| CN103906535B (en) | The composition related to the antibody of staphylococcal protein A and method | |
| US20180179267A1 (en) | Anti-staphylococcus aureus antibody combination preparation | |
| EP2476702B1 (en) | Monoclonal antibodies against the pbp2-a protein and homologous sequences for the treatment of infections by and immunodiagnostics of bacteria of the firmicutes phylum | |
| AU2010282162B2 (en) | Monoclonal antibodies against the PBP2-a protein and homologous sequences for the treatment of infections by and immunodiagnostics of bacteria of the firmicutes phylum | |
| CA2770771C (en) | Monoclonal antibodies for pbp2-a protein and homologous sequences for treatment of infections and immunodiagnosis on bacteria from phylum firmicutes | |
| US20180105584A1 (en) | Antibody directed against immunoglobulin-binding proteins of s. aureus | |
| KR101868160B1 (en) | Monoclonal antibodies against pbp2-a protein and homologous sequences for the treatment of infections by and immunodiagnostics of bacteria of the firmicutes phylum | |
| RU2575070C2 (en) | ANTI-PBP2A PROTEIN MONOCLONAL ANTIBODIES AND HOMOLOGOUS SEQUENCES FOR TREATING BACTERIAL INFECTION AND IMMUNODIAGNOSIS OF Firmicutes BACTERIA | |
| Rocha | Determining the Role of Panton-Valentine Leukocidin in Community-acquired Methicillin-resistant Staphylococcus Aureus Pathogenesis |