RU2816175C1 - INTEGRATIVE PLASMID VECTOR pVEAL3-RBDdel, PROVIDING SYNTHESIS AND SECRETION OF RECOMBINANT PROTEIN OF RECEPTOR-BINDING DOMAIN RBDdelta OF CORONAVIRUS SARS-CoV-2 IN MAMMALIAN CELLS, RECOMBINANT CELL LINE STRAIN CHO-K1-RBDdelta AND RECOMBINANT PROTEIN RBDdelta SARS-CoV-2 PRODUCED BY CELL LINE STRAIN - Google Patents
INTEGRATIVE PLASMID VECTOR pVEAL3-RBDdel, PROVIDING SYNTHESIS AND SECRETION OF RECOMBINANT PROTEIN OF RECEPTOR-BINDING DOMAIN RBDdelta OF CORONAVIRUS SARS-CoV-2 IN MAMMALIAN CELLS, RECOMBINANT CELL LINE STRAIN CHO-K1-RBDdelta AND RECOMBINANT PROTEIN RBDdelta SARS-CoV-2 PRODUCED BY CELL LINE STRAIN Download PDFInfo
- Publication number
- RU2816175C1 RU2816175C1 RU2023120047A RU2023120047A RU2816175C1 RU 2816175 C1 RU2816175 C1 RU 2816175C1 RU 2023120047 A RU2023120047 A RU 2023120047A RU 2023120047 A RU2023120047 A RU 2023120047A RU 2816175 C1 RU2816175 C1 RU 2816175C1
- Authority
- RU
- Russia
- Prior art keywords
- rbddelta
- cov
- sars
- protein
- recombinant
- Prior art date
Links
- 241001678559 COVID-19 virus Species 0.000 title claims abstract description 58
- 238000009739 binding Methods 0.000 title claims abstract description 20
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 title claims abstract description 16
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 title claims abstract description 16
- 239000013600 plasmid vector Substances 0.000 title claims abstract description 14
- 210000004962 mammalian cell Anatomy 0.000 title claims abstract description 10
- 230000028327 secretion Effects 0.000 title claims abstract description 10
- 230000015572 biosynthetic process Effects 0.000 title claims abstract description 9
- 238000003786 synthesis reaction Methods 0.000 title claims abstract description 8
- 210000004027 cell Anatomy 0.000 title claims description 31
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 22
- 108091005634 SARS-CoV-2 receptor-binding domains Proteins 0.000 claims abstract description 20
- 239000013598 vector Substances 0.000 claims abstract description 20
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 17
- 239000002773 nucleotide Substances 0.000 claims abstract description 16
- 210000004978 chinese hamster ovary cell Anatomy 0.000 claims abstract description 15
- 102000005962 receptors Human genes 0.000 claims abstract description 15
- 108020003175 receptors Proteins 0.000 claims abstract description 15
- 125000003729 nucleotide group Chemical group 0.000 claims abstract description 14
- 238000004113 cell culture Methods 0.000 claims abstract description 13
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract description 7
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims abstract description 5
- 230000001900 immune effect Effects 0.000 claims abstract description 4
- 230000035772 mutation Effects 0.000 claims abstract description 3
- 230000002068 genetic effect Effects 0.000 claims description 10
- 239000013612 plasmid Substances 0.000 claims description 9
- 230000003115 biocidal effect Effects 0.000 claims description 6
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 claims description 6
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 5
- 238000013461 design Methods 0.000 claims description 5
- 239000003814 drug Substances 0.000 claims description 4
- 102000008579 Transposases Human genes 0.000 claims description 3
- 108010020764 Transposases Proteins 0.000 claims description 3
- 229940079593 drug Drugs 0.000 claims description 3
- 238000000746 purification Methods 0.000 claims description 3
- 229950010131 puromycin Drugs 0.000 claims description 3
- 241000710188 Encephalomyocarditis virus Species 0.000 claims description 2
- 241000588724 Escherichia coli Species 0.000 claims description 2
- 241000282326 Felis catus Species 0.000 claims description 2
- 108091034057 RNA (poly(A)) Proteins 0.000 claims description 2
- 230000003321 amplification Effects 0.000 claims description 2
- 230000001580 bacterial effect Effects 0.000 claims description 2
- 239000013522 chelant Substances 0.000 claims description 2
- 238000004587 chromatography analysis Methods 0.000 claims description 2
- 239000003623 enhancer Substances 0.000 claims description 2
- 238000001415 gene therapy Methods 0.000 claims description 2
- 229930027917 kanamycin Natural products 0.000 claims description 2
- 229960000318 kanamycin Drugs 0.000 claims description 2
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 claims description 2
- 229930182823 kanamycin A Natural products 0.000 claims description 2
- 108020004999 messenger RNA Proteins 0.000 claims description 2
- 229910052751 metal Inorganic materials 0.000 claims description 2
- 239000002184 metal Substances 0.000 claims description 2
- 238000003199 nucleic acid amplification method Methods 0.000 claims description 2
- 230000008488 polyadenylation Effects 0.000 claims description 2
- 229920002704 polyhistidine Polymers 0.000 claims description 2
- 230000010076 replication Effects 0.000 claims description 2
- 230000000087 stabilizing effect Effects 0.000 claims description 2
- 238000002360 preparation method Methods 0.000 abstract description 3
- 230000000694 effects Effects 0.000 abstract description 2
- 230000036642 wellbeing Effects 0.000 abstract description 2
- 101150028074 2 gene Proteins 0.000 abstract 1
- 239000000126 substance Substances 0.000 abstract 1
- 210000002966 serum Anatomy 0.000 description 15
- 229960005486 vaccine Drugs 0.000 description 14
- 241000700605 Viruses Species 0.000 description 10
- 230000014509 gene expression Effects 0.000 description 10
- 241000699670 Mus sp. Species 0.000 description 9
- 230000000120 cytopathologic effect Effects 0.000 description 9
- 239000001963 growth medium Substances 0.000 description 8
- 238000004519 manufacturing process Methods 0.000 description 8
- 208000025721 COVID-19 Diseases 0.000 description 7
- 102100031673 Corneodesmosin Human genes 0.000 description 7
- 108020004414 DNA Proteins 0.000 description 7
- 241000315672 SARS coronavirus Species 0.000 description 7
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 7
- 230000003472 neutralizing effect Effects 0.000 description 7
- 238000002965 ELISA Methods 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- 238000000034 method Methods 0.000 description 6
- 101710139375 Corneodesmosin Proteins 0.000 description 5
- 239000002671 adjuvant Substances 0.000 description 5
- 239000007788 liquid Substances 0.000 description 5
- 239000002609 medium Substances 0.000 description 5
- 239000002356 single layer Substances 0.000 description 5
- 229940031626 subunit vaccine Drugs 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- 238000011097 chromatography purification Methods 0.000 description 4
- 238000010790 dilution Methods 0.000 description 4
- 239000012895 dilution Substances 0.000 description 4
- 230000003053 immunization Effects 0.000 description 4
- 238000002649 immunization Methods 0.000 description 4
- 230000005847 immunogenicity Effects 0.000 description 4
- 239000000725 suspension Substances 0.000 description 4
- 239000013638 trimer Substances 0.000 description 4
- 241000283690 Bos taurus Species 0.000 description 3
- 101000914947 Bungarus multicinctus Long neurotoxin homolog TA-bm16 Proteins 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 3
- 239000012571 GlutaMAX medium Substances 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 229940096437 Protein S Drugs 0.000 description 3
- 101000629313 Severe acute respiratory syndrome coronavirus Spike glycoprotein Proteins 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 235000015097 nutrients Nutrition 0.000 description 3
- 230000008685 targeting Effects 0.000 description 3
- 238000011725 BALB/c mouse Methods 0.000 description 2
- 208000001528 Coronaviridae Infections Diseases 0.000 description 2
- 108010061994 Coronavirus Spike Glycoprotein Proteins 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- 241000672609 Escherichia coli BL21 Species 0.000 description 2
- 206010071602 Genetic polymorphism Diseases 0.000 description 2
- 235000003228 Lactuca sativa Nutrition 0.000 description 2
- 108010031318 Vitronectin Proteins 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- 239000006285 cell suspension Substances 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 238000005138 cryopreservation Methods 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 230000002327 eosinophilic effect Effects 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 210000004700 fetal blood Anatomy 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- 230000013595 glycosylation Effects 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- 230000036039 immunity Effects 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 239000000203 mixture Substances 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 230000001681 protective effect Effects 0.000 description 2
- 108091008146 restriction endonucleases Proteins 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 238000007619 statistical method Methods 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 238000006467 substitution reaction Methods 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 1
- 108010071134 CRM197 (non-toxic variant of diphtheria toxin) Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 241000711573 Coronaviridae Species 0.000 description 1
- 230000004544 DNA amplification Effects 0.000 description 1
- 244000309467 Human Coronavirus Species 0.000 description 1
- GRRNUXAQVGOGFE-UHFFFAOYSA-N Hygromycin-B Natural products OC1C(NC)CC(N)C(O)C1OC1C2OC3(C(C(O)C(O)C(C(N)CO)O3)O)OC2C(O)C(CO)O1 GRRNUXAQVGOGFE-UHFFFAOYSA-N 0.000 description 1
- 238000012313 Kruskal-Wallis test Methods 0.000 description 1
- 241000208822 Lactuca Species 0.000 description 1
- 240000008415 Lactuca sativa Species 0.000 description 1
- 238000000585 Mann–Whitney U test Methods 0.000 description 1
- 108010090054 Membrane Glycoproteins Proteins 0.000 description 1
- 102000012750 Membrane Glycoproteins Human genes 0.000 description 1
- 208000025370 Middle East respiratory syndrome Diseases 0.000 description 1
- 241000127282 Middle East respiratory syndrome-related coronavirus Species 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 208000034712 Rickettsia Infections Diseases 0.000 description 1
- 229940124680 SARS vaccine Drugs 0.000 description 1
- 108091005774 SARS-CoV-2 proteins Proteins 0.000 description 1
- 201000003176 Severe Acute Respiratory Syndrome Diseases 0.000 description 1
- 101000629318 Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein Proteins 0.000 description 1
- 101710198474 Spike protein Proteins 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 238000000137 annealing Methods 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- ZXJXZNDDNMQXFV-UHFFFAOYSA-M crystal violet Chemical compound [Cl-].C1=CC(N(C)C)=CC=C1[C+](C=1C=CC(=CC=1)N(C)C)C1=CC=C(N(C)C)C=C1 ZXJXZNDDNMQXFV-UHFFFAOYSA-M 0.000 description 1
- 238000012364 cultivation method Methods 0.000 description 1
- 230000008021 deposition Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 238000001493 electron microscopy Methods 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 239000012467 final product Substances 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 229940125777 fusion inhibitor Drugs 0.000 description 1
- 229960001235 gentian violet Drugs 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 229940098197 human immunoglobulin g Drugs 0.000 description 1
- 230000008348 humoral response Effects 0.000 description 1
- GRRNUXAQVGOGFE-NZSRVPFOSA-N hygromycin B Chemical compound O[C@@H]1[C@@H](NC)C[C@@H](N)[C@H](O)[C@H]1O[C@H]1[C@H]2O[C@@]3([C@@H]([C@@H](O)[C@@H](O)[C@@H](C(N)CO)O3)O)O[C@H]2[C@@H](O)[C@@H](CO)O1 GRRNUXAQVGOGFE-NZSRVPFOSA-N 0.000 description 1
- 229940097277 hygromycin b Drugs 0.000 description 1
- 230000008105 immune reaction Effects 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 230000002906 microbiologic effect Effects 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 238000009522 phase III clinical trial Methods 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 108090000765 processed proteins & peptides Proteins 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 238000004062 sedimentation Methods 0.000 description 1
- 238000007873 sieving Methods 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 238000004114 suspension culture Methods 0.000 description 1
- 230000010474 transient expression Effects 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Abstract
Description
Изобретение относится к интегративному плазмидному вектору pVEAL3-RBDdel, обеспечивающему синтез и секрецию рекомбинантного белка рецепторсвязывающего домена RBDdelta коронавируса SARS-CoV-2 в клетках млекопитающих, рекомбинантному штамму клеточной линии СНО-К1-RBDdelta и рекомбинантному белку RBDdelta SARS-CoV-2, продуцируемому указанным штаммом клеточной линии и может быть использовано в генной инженерии, биотехнологии и медицине. Рекомбинантный белок RBDdelta может служить, в первую очередь, для создания вакцины против новой коронавирусной инфекции COVID-19, а также для создания диагностикумов.The invention relates to an integrative plasmid vector pVEAL3-RBDdel, which ensures the synthesis and secretion of the recombinant protein of the receptor-binding domain RBDdelta of the coronavirus SARS-CoV-2 in mammalian cells, the recombinant strain of the cell line CHO-K1-RBDdelta and the recombinant protein RBDdelta SARS-CoV-2 produced by the said cell line strain and can be used in genetic engineering, biotechnology and medicine. The recombinant protein RBDdelta can be used, first of all, to create a vaccine against the new coronavirus infection COVID-19, as well as to create diagnostics.
Уровень техники.State of the art.
В последнее десятилетие для создания вакцины против возбудителя атипичной пневмонии SARS-CoV, был реализован ряд подходов, включая использование инактивированного цельного вируса, рекомбинантного белка S SARS-CoV и рецепторсвязывающий домен (RBD) белка S. Был разработан ряд вакцин, содержащие инактивированный цельный вирус, в комплексе с адъювантом Alhydrogel©, однако, у мышей иммунизированных этой конструкцией наблюдалась эозинофильная патология, вероятно, из-за антител озависимого усиления инфекции (ADE) [1,2]. Позднее были разработаны вакцины с использованием рекомбинантного S-белка SARS-CoV, но полноразмерный S-белок, по-видимому, так же индуцирует ADE [3]. В качестве альтернативного подхода, был апробирован подход на основе RBD белка S. В молекуле поверхностного гликопротеина SARS-CoV и MERS, выделяют два основных региона уязвимости RBD и HR1 (регион пептида слияния) [4-8]. Рекомбинантный RBD, в комплексе с адъювантом Фрейнда и с системой адъювантов Sigma вызывает индукцию нейтрализующих антител и формирование протективного иммунитета у вакцинированных животных, без ADE и других побочных иммунных реакций [6,9].In the last decade, a number of approaches have been implemented to create a vaccine against the SARS-CoV pathogen, including the use of inactivated whole virus, recombinant SARS-CoV S protein and the receptor binding domain (RBD) of the S protein. A number of vaccines containing inactivated whole virus have been developed, in combination with the adjuvant Alhydrogel©, however, eosinophilic pathology was observed in mice immunized with this construct, probably due to antibody-dependent enhancement of infection (ADE) [1,2]. Vaccines using recombinant SARS-CoV S protein were later developed, but full-length S protein also appears to induce ADE [3]. As an alternative approach, an approach based on the RBD of the S protein was tested. In the surface glycoprotein molecule of SARS-CoV and MERS, there are two main regions of vulnerability RBD and HR1 (fusion peptide region) [4-8]. Recombinant RBD, in combination with Freund's adjuvant and the Sigma adjuvant system, causes the induction of neutralizing antibodies and the formation of protective immunity in vaccinated animals, without ADE and other adverse immune reactions [6,9].
В настоящее время накопилось достаточно свидетельств того, что вакцина на основе RBD показывает высокий уровень иммуногенности, при низкой реактогенной и хорошей переносимости. В первую очередь это следует из результатов клинических испытаний. По данным на 30 марта 2023 года, 57 субъединичных вакцин находятся на стадии клинических испытаний. Из них 23 проходят III фазу клинических испытаний, [https://www.who.int/publications/ m/item/draft-landscape-of-covid-19-candidate-vaccines]. Отчет об испытаниях вакцины на основе RBD, свидетельствует об отсутствии серьезных побочных эффектов при использовании трехкратной схемы введения (0, 30 и 60 сутки), в то время как уровень сероконверсии составляет 93-100% [NCT04466085]. Еще 20 вариантов субъединичных вакцин проходят I и II фазы клинических испытаний [https://www.who.int/publications/ m/item/draft-landscape-of-covid-19-candidate-vaccines].At present, sufficient evidence has accumulated that the RBD-based vaccine shows a high level of immunogenicity, with low reactogenicity and good tolerability. First of all, this follows from the results of clinical trials. As of March 30, 2023, 57 subunit vaccines are in clinical trials. Of these, 23 are undergoing phase III clinical trials, [https://www.who.int/publications/m/item/draft-landscape-of-covid-19-candidate-vaccines]. A report from a trial of an RBD-based vaccine indicates that there are no serious side effects when using a three-dose schedule (0, 30 and 60 days), while the seroconversion rate is 93-100% [NCT04466085]. Another 20 subunit vaccine options are undergoing phase I and II clinical trials [https://www.who.int/publications/m/item/draft-landscape-of-covid-19-candidate-vaccines].
Использование только последовательности RBD в качестве вакцины позволяет добиться появления высоких титров нейтрализующих антител, этот факт тем более примечателен что использование тримера S или фрагмента S1 дает сходные или худшие результаты [10-12].Using only the RBD sequence as a vaccine allows one to achieve high titers of neutralizing antibodies, this fact is all the more remarkable since the use of the S trimer or S1 fragment gives similar or worse results [10-12].
Ближайшие аналоги.Closest analogues.
Известна заявка на изобретение Китая (CN 111217917, МПК А61К 39/215, опубл. 02.06.2020 г.), в которой описан способ получения слитых белков RBD-CTB и RBDCRM 197(A) для создания рекомбинантных субъединичных вакцин для лечения и профилактики COVID-19. Для этого в экспрессионный вектор рЕТ9а встраивали нуклеотидные последовательности, кодирующие RBD соединенные линкером с адъювантами СТВ или CRM 197(A), и проводили трансформацию клеток Escherichia coli BL21 полученными конструкциями. Недостатком данного изобретения является выбор системы экспрессии в клетках Escherichia coli BL21, поскольку известно, что у прокариот отсутствуют некоторые системы посттрансляционной модификации белков, например, гликозилирование, необходимое для получения корректной формы RBD, так же существует риск некорректного фолдинга молекул. Такие особенности могут критически снижать уровень иммуногенности итоговой вакцины.There is a known application for an invention from China (CN 111217917, IPC A61K 39/215, published June 02, 2020), which describes a method for producing fusion proteins RBD-CTB and RBDCRM 197(A) to create recombinant subunit vaccines for the treatment and prevention of COVID -19. To do this, nucleotide sequences encoding RBD connected by a linker to CTB or CRM 197(A) adjuvants were inserted into the pET9a expression vector, and Escherichia coli BL21 cells were transformed with the resulting constructs. The disadvantage of this invention is the choice of the expression system in Escherichia coli BL21 cells, since it is known that prokaryotes lack some systems for post-translational modification of proteins, for example, glycosylation, necessary to obtain the correct form of the RBD, and there is also a risk of incorrect folding of molecules. Such features can critically reduce the level of immunogenicity of the final vaccine.
Известна заявка на изобретение Китая (CN 111254155, МПК A61K 39/215, опубл. 09.06.2020 г. ), в которой варианты RBD для субъединичных вакцин против вируса SARS-CoV-2 получали с использованием растений-хозяев. Авторы с помощью транзиентной экспресии в Lactuca sativa (салат-латук) получали слитые белки CTB-RBD и RBD-Fc, используемые в вакцине для профилактики COVID-19. Недостатком изобретения является способ выделения целевых белков, включающий многоступенчатую систему очистки, а также особенности экспрессии, связанные с некорректным гликозилированием и фолдингом белков в растительных системах экспрессии.There is a known Chinese invention application (CN 111254155, IPC A61K 39/215, published 06/09/2020), in which RBD variants for subunit vaccines against the SARS-CoV-2 virus were obtained using host plants. The authors used transient expression in Lactuca sativa (lettuce) to obtain CTB-RBD and RBD-Fc fusion proteins used in a vaccine for the prevention of COVID-19. The disadvantage of the invention is the method for isolating target proteins, which includes a multi-stage purification system, as well as expression features associated with incorrect glycosylation and folding of proteins in plant expression systems.
Известен аналог (патент РФ №2723008, МПК C07K 14/165, C12N 15/50, опубл. 08.06.2020 г. ), содержащий:An analogue is known (RF patent No. 2723008, IPC C07K 14/165, C12N 15/50, published 06/08/2020) containing:
- генетическую конструкцию для экспрессии рекомбинантного белка RBD вируса SARS-CoV-2, включающую последовательность SEQ ID NO: 1;- a genetic construct for the expression of the recombinant RBD protein of the SARS-CoV-2 virus, including the sequence SEQ ID NO: 1;
- штамм клеток яичника китайского хомячка CHO-S-RBD - продуцент рекомбинантного белка RBD вируса SARS-CoV-2, содержащий генетическую конструкцию, включающую SEQ ID NO: 1;- strain of Chinese hamster ovary cells CHO-S-RBD - producer of recombinant protein RBD of the SARS-CoV-2 virus, containing a genetic construct including SEQ ID NO: 1;
- способ получения штамма клеток яичника китайского хомячка CHO-S-RBD, включающий: получение генетической конструкции, включающей SEQ ID NO: 1; введение указанной генетической конструкции в клетки путем липофекции; селекцию клеток на антибиотике Hygromycin В;- a method for obtaining a strain of Chinese hamster ovary cells CHO-S-RBD, including: obtaining a genetic construct comprising SEQ ID NO: 1; introducing said genetic construct into cells by lipofection; cell selection on the antibiotic Hygromycin B;
- рекомбинантный белок RBD вируса SARS-CoV-2 для выявления антител к SARSCoV-2, имеющий последовательность SEQ ID NO: 2, являющийся продуктом штамма CHO-S-RBD;- recombinant RBD protein of the SARS-CoV-2 virus for the detection of antibodies to SARSCoV-2, having the sequence SEQ ID NO: 2, which is a product of the CHO-S-RBD strain;
- способ получения рекомбинантного белка RBD вируса SARS-CoV-2, включающий: культивирование штамма клеток яичника китайского хомячка CHO-S-RBD; хроматографическую очистку рекомбинантного белка RBD вируса SARS-CoV-2 из культуральной среды штамма клеток яичника китайского хомячка CHO-S-RBD; подтверждение получения рекомбинантного белка RBD вируса SARS-CoV-2, имеющего SEQ ID NO: 2.- a method for producing recombinant RBD protein of the SARS-CoV-2 virus, including: cultivating a strain of Chinese hamster ovary cells CHO-S-RBD; chromatographic purification of the recombinant RBD protein of the SARS-CoV-2 virus from the culture medium of the Chinese hamster ovary cell strain CHO-S-RBD; confirmation of the receipt of the recombinant RBD protein of the SARS-CoV-2 virus having SEQ ID NO: 2.
Недостатком изобретения является использование относительно слабого лидерного пептида тяжелой цепи иммуноглобулина G человека, что может снизить выход целевого белка. Кроме того, негативное влияние на выход продукта может оказать тот факт, что не проведена оптимизация кодонного состава нуклеотидной последовательности, кодирующей RBD, для продуцента, а также использован вектор для эписомальной (внехромомсомной) экспрессии. Авторами показан довольно низкий уровень продукции 5-10 мг/л суспензионной культуры.The disadvantage of the invention is the use of a relatively weak leader peptide of the heavy chain of human immunoglobulin G, which can reduce the yield of the target protein. In addition, the product yield may be negatively affected by the fact that the codon composition of the nucleotide sequence encoding the RBD for the producer has not been optimized, and a vector for episomal (extrachromosomal) expression has been used. The authors showed a rather low level of production of 5-10 mg/l of suspension culture.
Известна рекомбинантная плазмида pVNV-GL-RBDind, обеспечивающая синтез и секрецию рекомбинантного рецепторсвязывающего домена (RBD) коронавируса SARS-CoV-2 линии В. 1.617 в клетках млекопитающих (патент РФ №2754930, МПК C12N 15/50, опубл. 09.09.2021 г.).The recombinant plasmid pVNV-GL-RBDind is known, providing the synthesis and secretion of the recombinant receptor-binding domain (RBD) of the coronavirus SARS-CoV-2 line B. 1.617 in mammalian cells (RF patent No. 2754930, IPC C12N 15/50, published 09.09.2021 .).
К недостаткам данной генетической конструкции следует отнести используемый дизайн ДНК, кодирующей последовательность RBD, не учитывающий современные представления о молекулярно-генетическом полиморфизме вируса SARS-CoV-2 вследствие чего концентрация белка RBD составляет 5-10 мг на литр культуральной среды.The disadvantages of this genetic construct include the design of DNA encoding the RBD sequence used, which does not take into account modern ideas about the molecular genetic polymorphism of the SARS-CoV-2 virus, resulting in the concentration of the RBD protein being 5-10 mg per liter of culture medium.
Наиболее близким аналогом (прототипом) является изобретение (патент РФ №2752858, МПК C12N 15/74, опубл. 11.08.2021 г.), которое содержит:The closest analogue (prototype) is the invention (RF patent No. 2752858, IPC C12N 15/74, published 08/11/2021), which contains:
- интегративный плазмидный вектор pVEAL2-S-RBD, обеспечивающий экспрессию и секрецию белка RBD коронавируса SARS-CoV-2 в клетках млекопитающих;- integrative plasmid vector pVEAL2-S-RBD, which ensures the expression and secretion of the RBD protein of the SARS-CoV-2 coronavirus in mammalian cells;
- рекомбинантный штамм клеточной линии яичника китайского хомячка CHO-K1-RBD продуцента рекомбинантного белка RBD вируса SARS-CoV-2, содержащий интегративный плазмидный вектор pVEAL2-S-RBD, имеющий нуклеотидную последовательность SEQ ID NO:2, обеспечивающий экспрессию и секрецию белка RBD коронавируса SARS-CoV-2;- a recombinant strain of the Chinese hamster ovary cell line CHO-K1-RBD, a producer of the recombinant RBD protein of the SARS-CoV-2 virus, containing an integrative plasmid vector pVEAL2-S-RBD, having the nucleotide sequence SEQ ID NO: 2, ensuring the expression and secretion of the coronavirus RBD protein SARS-CoV-2;
- рекомбинантный белок RBD коронавируса SARS-CoV-2, продуцируемый рекомбинантным штаммом клеточной линии яичника китайского хомячка CHO-K1-RBD, имеющий аминокислотную последовательность SEQ ID NO:3 и предназначенный для создания иммунобиологических препаратов.- recombinant RBD protein of the coronavirus SARS-CoV-2, produced by a recombinant strain of the Chinese hamster ovary cell line CHO-K1-RBD, having the amino acid sequence SEQ ID NO: 3 and intended for the creation of immunobiological drugs.
К недостаткам данной генетической конструкции следует также отнести используемый дизайн ДНК, кодирующей последовательность RBD, не в полной мере учитывающий современные представления о молекулярно-генетическом полиморфизме вируса SARS-CoV-2 вследствие чего концентрация белка RBD варианта Wuhan SARS-CoV-2 составляла 50-100 мг с литра культуральной среды.The disadvantages of this genetic design also include the design of DNA encoding the RBD sequence used, which does not fully take into account modern ideas about the molecular genetic polymorphism of the SARS-CoV-2 virus, as a result of which the concentration of the RBD protein of the Wuhan SARS-CoV-2 variant was 50-100 mg per liter of culture medium.
Техническим результатом заявленного изобретения является повышение выхода целевого рекомбинантного белка RBDdelta SARS-CoV-2 за счет:The technical result of the claimed invention is to increase the yield of the target recombinant protein RBDdelta SARS-CoV-2 due to:
- создания кодон-оптимизированной нуклеотидной последовательности, кодирующей белок RBDdelta SARSCoV-2 для экспрессии в клетках СНО, конструирования интегративного плазмидного вектора pVEAL3-RBDdelta, содержащего кодон-оптимизированный ген RBDdelta и обеспечивающего его экспрессию в клетках млекопитающих, и разработки с помощью указанного вектора штамма-продуцента рекомбинантного белка RBDdelta SARS-CoV-2 на основе рекомбинантного штамма клеточной линии яичников китайского хомячка СНО-К1;- creation of a codon-optimized nucleotide sequence encoding the RBDdelta protein of SARSCoV-2 for expression in CHO cells, construction of an integrative plasmid vector pVEAL3-RBDdelta containing a codon-optimized RBDdelta gene and ensuring its expression in mammalian cells, and development using the specified strain vector - a producer of the recombinant protein RBDdelta SARS-CoV-2 based on the recombinant strain of the Chinese hamster ovary cell line CHO-K1;
адаптации клона №33 культуры-продуцента СНО-K1-RBDdelta, показавший наибольшую продуктивность при адгезионном культивировании к суспензионному культивированию.adaptation of clone No. 33 of the producer culture CHO-K1-RBDdelta, which showed the greatest productivity during adhesion cultivation to suspension cultivation.
Технический результат достигается созданием интегративного плазмидного вектора pVEAL3-RBDdelta, обеспечивающего синтез и секрецию белка RBDdelta коронавируса SARS-CoV-2 в клетках млекопитающих, имеющего размер 5160 п. н., нуклеотидную последовательность SEQ ID NO:l (фиг. 5) и содержащего в соответствии с физической и генетической картой, представленной на фиг. 1, следующие конструктивные элементы:The technical result is achieved by creating an integrative plasmid vector pVEAL3-RBDdelta, which ensures the synthesis and secretion of the RBDdelta protein of the SARS-CoV-2 coronavirus in mammalian cells, having a size of 5160 bp, nucleotide sequence SEQ ID NO: l (Fig. 5) and containing according to the physical and genetic map shown in FIG. 1, the following structural elements:
- участок начала репликации ori, имеющий координаты с 4552 по 5139;- the origin of replication site ori, having coordinates from 4552 to 5139;
- последовательности прямых и инвертированных повторов IR/DR, содержащие сайты связывания с транспозазой SB 100, имеющие координаты с 88 по 368 и с 3210 по 3487;- sequences of direct and inverted IR/DR repeats containing binding sites for the SB 100 transposase, having coordinates from 88 to 368 and from 3210 to 3487;
- CMV энхансер, имеющий координаты с 369 по 733 и CMV промотор, имеющий координаты с 734 по 937 и являющийся наиболее часто используемым промотором в генно-терапевтических конструкциях;- CMV enhancer, which has coordinates from 369 to 733 and the CMV promoter, which has coordinates from 734 to 937 and is the most commonly used promoter in gene therapy designs;
- лидерный пептид S-SP, обеспечивающий экспорт белка из клеток СНО-K1- RBDdelta и имеющий координаты с 3090 по 3134;- leader peptide S-SP, which ensures protein export from CHO-K1-RBDdelta cells and has coordinates from 3090 to 3134;
- кодон-оптимизированная нуклеотидная последовательность SEQ ID N0:2 (фиг. 6) гена, кодирующего рецепторсвязывающий домен RBDdelta коронавируса SARS-CoV-2, в которую внесены 2 мутации для получения белка RBDdelta варианта В. 1.617.2 и которая имеет координаты с 1066 по 1767;- codon-optimized nucleotide sequence SEQ ID N0:2 (Fig. 6) of the gene encoding the receptor-binding domain RBDdelta of the coronavirus SARS-CoV-2, into which 2 mutations were introduced to obtain the RBDdelta protein of variant B. 1.617.2 and which has coordinates from 1066 by 1767;
- последовательность 10xHis, имеющая координаты с 1768 по 1797 и являющаяся полигистидиновым тэгом для очистки рекомбинантного белка с помощью металл-хеллатной хроматографии;- sequence 10xHis, having coordinates from 1768 to 1797 and being a polyhistidine tag for purification of the recombinant protein using metal chelate chromatography;
- участок внутренней посадки рибосомы EMCV IRES, имеющий координаты с 1847 по 2421;- site of internal landing of the ribosome EMCV IRES, having coordinates from 1847 to 2421;
- последовательность PuroR, кодирующая фактор устойчивости к антибиотику пуромицину, имеющая координаты с 2434 по 3033;- the sequence PuroR, encoding the resistance factor to the antibiotic puromycin, having coordinates from 2434 to 3033;
- последовательность SV40 poly(A) signal для стабилизации мРНК-транскриптов за счет полиаденилирования, имеющая координаты с 3068 по 3189;- SV40 poly(A) signal sequence for stabilizing mRNA transcripts due to polyadenylation, having coordinates from 3068 to 3189;
- промотор cat синтетический бактериальный промотор, имеющий координаты с 3571 по 3673;- cat promoter is a synthetic bacterial promoter having coordinates from 3571 to 3673;
- нуклеотидная последовательность KanR, кодирующая фактор устойчивости к антибиотику канамицину, позволяющая проводить амплификацию плазмиды в E.coli и имеющая координаты с 3674 по 4489.- nucleotide sequence KanR, encoding the resistance factor to the antibiotic kanamycin, allowing amplification of the plasmid in E. coli and having coordinates from 3674 to 4489.
Указанный технический результат достигается также созданием рекомбинантного штамма клеточной линии яичника китайского хомячка СНО-Kl-RBDdelta продуцента рекомбинантного белка рецепторсвязывающего домена RBDdelta коронавируса SARS-CoV-2, содержащего интегративный плазмидный вектор pVEAL3-RBDdelta по п. 1, и депонированного под номером 327 в коллекции культур клеток ФБУН ГНЦ ВБ «Вектор» Роспотребнадзора.This technical result is also achieved by creating a recombinant strain of the Chinese hamster ovary cell line CHO-Kl-RBDdelta, a producer of the recombinant protein of the receptor-binding domain RBDdelta of the SARS-CoV-2 coronavirus, containing the integrative plasmid vector pVEAL3-RBDdelta according to claim 1, and deposited under number 327 in the collection cell cultures of the Federal Budgetary Institution of Scientific Research Center for Virology and Biochemistry "Vector" of Rospotrebnadzor.
Указанный технический результат достигается также получением рекомбинантного белка RBDdelta коронавируса SARS-CoV-2, продуцируемого рекомбинантным штаммом клеточной линии яичника китайского хомячка СНО-К1-RBDdelta по п. 2, имеющего аминокислотную последовательность SEQ ID NO: 3 (фиг. 7) и предназначенного для создания иммунобиологических препаратов.This technical result is also achieved by obtaining the recombinant RBDdelta protein of the SARS-CoV-2 coronavirus, produced by the recombinant strain of the Chinese hamster ovary cell line CHO-K1-RBDdelta according to claim 2, having the amino acid sequence SEQ ID NO: 3 (Fig. 7) and intended for creation of immunobiological drugs.
Изобретение поясняется графическими материалами, представленными на фиг.1,2,3,4 и таблицами 1. На фиг. 1 изображена физическая и генетическая карта универсального рекомбинантного вектора pVEAL3-RBDdelta. На фиг. 2 приведена относительная продуктивность клонов СНО-К1-RBDdelta в ИФА. На фиг. 3. представлены данные анализа сывороточных IgG у мышей иммунизированных 50 мкг RBD Delta SARS-CoV-2 с гидроокисью алюминия по результатам ИФА. На фиг. 4 представлены данные анализа сывороточных IgG у мышей иммунизированных дозой 50 мкг RBD Delta SARS-CoV-2 с гидроокисью алюминия в тесте на ингибирование цитопатического действия вариантов Delta(B. 1.617.2), Wuhan и Omicron (В. 1.1.529) вируса SARS-CoV-2 (100 ТЦД50) на культуре клеток Vero Е6. На фиг. 5 представлена нуклеотидная последовательность интеграционного вектора pVEAL3-RBDdelta. На фиг.6 приведена нуклеотидная последовательность гена, кодирующая рекомбинантный рецепторсвязывающего домен (RBDdelta) коронавируса SARS-CoV-2. На фиг. 7 представлена аминокислотная последовательность белка рекомбинантного рецепторсвязывающего домена (RBDdelta) коронавируса SARS-CoV-2.The invention is illustrated by graphic materials presented in Figs. 1,2,3,4 and tables 1. In Figs. Figure 1 shows a physical and genetic map of the universal recombinant vector pVEAL3-RBDdelta. In fig. Figure 2 shows the relative productivity of CHO-K1-RBDdelta clones in ELISA. In fig. 3. Presents data from the analysis of serum IgG in mice immunized with 50 μg of RBD Delta SARS-CoV-2 with aluminum hydroxide according to the results of ELISA. In fig. Figure 4 presents data from the analysis of serum IgG in mice immunized with a dose of 50 μg of RBD Delta SARS-CoV-2 with aluminum hydroxide in a test for inhibition of the cytopathic effect of variants Delta (B. 1.617.2), Wuhan and Omicron (B. 1.1.529) of the SARS virus -CoV-2 (100 TCD50) on Vero E6 cell culture. In fig. Figure 5 shows the nucleotide sequence of the integration vector pVEAL3-RBDdelta. Figure 6 shows the nucleotide sequence of the gene encoding the recombinant receptor-binding domain (RBDdelta) of the coronavirus SARS-CoV-2. In fig. Figure 7 shows the amino acid sequence of the recombinant receptor binding domain protein (RBDdelta) of the SARS-CoV-2 coronavirus.
Для лучшего понимания сущности предлагаемого изобретения ниже приведены примеры его осуществления. Все стандартные генно-инженерные и микробиологические манипуляции, а также амплификацию и секвенирование ДНК проводили по известным методикам [13].For a better understanding of the essence of the proposed invention, examples of its implementation are given below. All standard genetic engineering and microbiological manipulations, as well as DNA amplification and sequencing, were carried out according to known methods [13].
Пример 1. Конструирование интегративного плазмидного вектора pVEAL3-RBDdelta для синтеза и секреции белка RBD delta SARS-CoV-2 в клетках млекопитающихExample 1. Construction of an integrative plasmid vector pVEAL3-RBDdelta for the synthesis and secretion of the SARS-CoV-2 RBD delta protein in mammalian cells
Ранее в нашей лаборатории на основе клеток СНО-К1 был разработан штамм CHO-K1-RBD, продуцент RBD варианта Wuhan SARS-CoV-2 (патент РФ №2752858).Previously, in our laboratory, based on CHO-K1 cells, we developed the CHO-K1-RBD strain, a producer of the RBD variant of Wuhan SARS-CoV-2 (RF patent No. 2752858).
Для получения RBD варианта Delta SARS-CoV-2 в нуклеотидную последовательность, кодирующую RBD в векторе pVEAL2-RBD, вводили нуклеотидные замены для получения аминокислотных замен (L452R и Т479К).To obtain the RBD of the Delta variant of SARS-CoV-2, nucleotide substitutions were introduced into the nucleotide sequence encoding the RBD in the pVEAL2-RBD vector to obtain amino acid substitutions (L452R and T479K).
На матрице RBD Wuhan проводили ПЦР с использованием праймеров T479K F и URBD-R, а также URBD-F и T479K_R, а затем отжиг продуктов реакции и ПЦР с праймерами URBD-F и URBD-R (таблица 1). Итоговый продукт гидролизовали рестриктазами Bspl3I и AspA2I. В таблице 1 представлены последовательности синтезированных олигонуклеотидов, использованных для получения плазмиды pVEAL3-RBDdelta.PCR was performed on the RBD Wuhan template using primers T479K F and URBD-R, as well as URBD-F and T479K_R, and then annealing of the reaction products and PCR with primers URBD-F and URBD-R (Table 1). The final product was hydrolyzed with restriction enzymes Bspl3I and AspA2I. Table 1 shows the sequences of the synthesized oligonucleotides used to obtain the pVEAL3-RBDdelta plasmid.
Отдельно матрице RBD Wuhan проводили ПЦР с использованием праймеров URBD-F и L452R-R и гидролиз рестрикатазами AsuNHI and Bspl3I.Separately, the Wuhan RBD template was subjected to PCR using primers URBD-F and L452R-R and digestion with restriction enzymes AsuNHI and Bspl3I.
Затем вектор pVEAL2-RBD гидролизовали по сайтам AsuNHI и AspA2I и проводили одновременную встройку двух фрагментов. Подтверждение структуры плазмиды проводили секвенированием по методу Сенгера. Затем, чтобы уменьшить размер плазмиды из вектора удаляли элементы UCOE. Вектор получил название pVEAL3-RBDdel (на фиг. 1 представлена физическая и генетическая карта интегративного плазмидного вектора pVEAL3-RBDdelta). Нуклеотидная последовательность SEQ ID NO:l вектора pVEAL3-RBDdel приведена на фиг.5 и в приложении.Then the pVEAL2-RBD vector was hydrolyzed at the AsuNHI and AspA2I sites and the simultaneous insertion of two fragments was carried out. The plasmid structure was confirmed by sequencing using the Sanger method. The UCOE elements were then removed from the vector to reduce the size of the plasmid. The vector was named pVEAL3-RBDdel (Fig. 1 shows the physical and genetic map of the integrative plasmid vector pVEAL3-RBDdelta). The nucleotide sequence SEQ ID NO:l of the pVEAL3-RBDdel vector is shown in Fig. 5 and in the Appendix.
Пример 2. Получение штамма рекомбинантной клеточной линии CHO-Kl-RBDdelta, продуцента рекомбинантного домена RBD delta SARS-CoV-2.Example 2. Production of a recombinant cell line strain CHO-Kl-RBDdelta, a producer of the recombinant RBD delta domain of SARS-CoV-2.
Рекомбинантную клеточную линию CHO-Kl-RBDdelta, продуцент рекомбинантного домена RBD Delta SARS-CoV-2, получали на основе клеточной линии яичников китайского хомячка СНО-К1 с использованием разработанной конструкции pVEAL3-RBDdelta. Клетки растили в инкубаторе при 5% содержания С02, 80%-ной влажности. При достижении 80% плотности монослоя проводили трансфекцию клеток плазмидой pVEAL3-RBDdelta с помощью Lipofectamine 3000 (ThermoFisher, США) в соответствии с инструкцией производителя. Для интеграции экспрессионной кассеты вектора pVEAL3-RBDdelta в геном клеток совместно с плазмидой pVEAL3-RBDdelta добавляли плазмиду pCMV(CAT)T7-SB100, кодирующую транспозазу SB 100, в отношении 10:1. Через 3 дня в культуральную среду добавляли селективный антибиотик пуромицин (InvivoGen, США) в конечной концентрации 10 мкг/мл, ген устойчивости к которому входит в состав вектора.The recombinant cell line CHO-Kl-RBDdelta, a producer of the recombinant RBD Delta domain of SARS-CoV-2, was obtained based on the Chinese hamster ovary cell line CHO-K1 using the developed pVEAL3-RBDdelta construct. The cells were grown in an incubator at 5% CO2 and 80% humidity. When the monolayer density reached 80%, cells were transfected with the pVEAL3-RBDdelta plasmid using Lipofectamine 3000 (ThermoFisher, USA) in accordance with the manufacturer's instructions. To integrate the pVEAL3-RBDdelta vector expression cassette into the cell genome, the pCMV(CAT)T7-SB100 plasmid, encoding the SB 100 transposase, was added together with the pVEAL3-RBDdelta plasmid at a ratio of 10:1. After 3 days, the selective antibiotic puromycin (InvivoGen, USA) was added to the culture medium at a final concentration of 10 μg/ml, the resistance gene for which is included in the vector.
Селекцию устойчивых клонов проводили в течение трех суток, затем поликлональную клеточную культуру рассевали в 96 луночном планшете в концентрации 1 клетка на лунку. Спустя две недели, анализировали наличие единичных колоний в лунках, отбирали культуральную жидкость и оценивали продуктивность клонов с помощью ИФА.Selection of resistant clones was carried out for three days, then the polyclonal cell culture was seeded in a 96-well plate at a concentration of 1 cell per well. Two weeks later, the presence of single colonies in the wells was analyzed, the culture liquid was collected, and the productivity of the clones was assessed using ELISA.
На фиг. 2 представлена относительная продуктивность клонов CHO-Kl-RBDdelta в ИФА. Клон №33 культуры-продуцента CHO-Kl-RBDdelta, показавший наибольшую продуктивность при адгезионном культивировании адаптировали к суспензионному культивированию.In fig. Figure 2 shows the relative productivity of CHO-Kl-RBDdelta clones in ELISA. Clone No. 33 of the producer culture CHO-Kl-RBDdelta, which showed the highest productivity during adhesion cultivation, was adapted to suspension cultivation.
Штамм депонирован 08.11.2022 г. в коллекции ФБУН ГНЦ ВБ «Вектор» Роспотребнадзора под номером 327. Характеристика рекомбинантного штамма CHO-Kl-9E2ch (справка о депонировании прилагается).The strain was deposited on November 8, 2022 in the collection of the Federal Budgetary Institution of Scientific Research Center for Virology and Biochemistry "Vector" of Rospotrebnadzor under number 327. Characteristics of the recombinant strain CHO-Kl-9E2ch (certificate of deposition is attached).
Характеристика штамма.Characteristics of the strain.
Морфология: веретеновидные и эпителиоподобные клетки с круглыми ядрами, содержащими от 1 до 2 ядрышек.Morphology: spindle-shaped and epithelial-like cells with round nuclei containing 1 to 2 nucleoli.
Способ культивирования: монослойный.Cultivation method: monolayer.
Среда для культивирования: питательная среда DMEM/F-12 (1:1) - 90%, сыворотка крови плодов коровы - 10%.Cultivation medium: nutrient medium DMEM/F-12 (1:1) - 90%, fetal blood serum of a cow - 10%.
Температура культивирования: 37°С.Cultivation temperature: 37°C.
Посевная концентрация: 100 тыс.клеток в 1 мл.Seed concentration: 100 thousand cells in 1 ml.
Метод снятия: 0,25% трипсин (1/3) и 0,02% версен (2/3).Removal method: 0.25% trypsin (1/3) and 0.02% versen (2/3).
Кратность рассева: 1:3.Sieving ratio: 1:3.
Частота пассирования: 3-4 суток.Passaging frequency: 3-4 days.
Условия криоконсервации: питательная среда DMEM/F-12 (1:1) - 50%, сыворотка крови плодов коровы - 40%, ДМСО - 10%.Cryopreservation conditions: nutrient medium DMEM/F-12 (1:1) - 50%, fetal blood serum of a cow - 40%, DMSO - 10%.
Режим замораживания: при температуре 4°С выдерживают 1 ч; минус 80°С -12 ч; минус 196°С - хранение.Freezing mode: hold at 4°C for 1 hour; minus 80°С -12 h; minus 196°C - storage.
Условия хранения: в криопробирках в количестве 5 шт. хранится в жидком азоте при температуре минус 196°С.Storage conditions: in cryovials in the amount of 5 pcs. stored in liquid nitrogen at minus 196°C.
Номер пассажа в жидком азоте: 3.Passage number in liquid nitrogen: 3.
Жизнеспособность после криоконсервации: 85-90%.Viability after cryopreservation: 85-90%.
Маркерый признак: наличие в культуральной среде рекомбинантного рецепторсвязывающего домена (RBD) S-белка SARS-CoV-2 размером ~35 кДа, подтверждается с помощью белкового электрофореза и иммуноблотинга. Область применения: биотехнология.Marker feature: the presence in the culture medium of the recombinant receptor-binding domain (RBD) of the SARS-CoV-2 S protein of ~35 kDa in size, confirmed by protein electrophoresis and immunoblotting. Area of application: biotechnology.
Пример 3. Получение рекомбинантного белка RBD delta с использованием штамма рекомбинантной клеточной линии CHO-Kl-RBDdelta. Клон №33 культуры-продуцента CHO-Kl-RBDdelta, показавший наибольшую продуктивность при адгезионном культивировании, адаптировали к суспензионному культивированию.Example 3. Production of recombinant RBD delta protein using the recombinant cell line strain CHO-Kl-RBDdelta. Clone No. 33 of the producer culture CHO-Kl-RBDdelta, which showed the highest productivity during adhesion cultivation, was adapted to suspension cultivation.
Затем проводили наработку препарата RBDdelta в суспензии. Клон-продуцент RBDdelta рассевали в 5 мл свежей среды HyCell СНО + 4 mM GlutaMAX с концентрацией 1×106 живых кл/мл в 50 мл центрифужные пробирки. Культивировали на шейкере 200 об/мин, орбита 19 мм, при +37°С во влажной атмосфере 5% СО2 6-7 дней до достижения концентрации 8×106 живых кл./мл. Суспензию клеток 5 мл с концентрацией 8×106 живых кл./мл инокулировали в стеклянной колбе с 35 мл свежей среды HyCell СНО + 4 mM GlutaMAX. Культивировали на шейкере при тех же условиях 6-7 дней до достижения концентрации 8×106 живых кл./мл. Суспензию клеток 5 мл с концентрацией 8×106 живых кл./мл инокулировали в новую стеклянную колбу с 35 мл свежей среды HyCell СНО + 4 mM GlutaMAX. Оставшийся объем переносили на шейкере (200 об./мин, орбита 19 м) при +31°С инкубировали 10 дней. Культуральную жидкость очищали от клеток при помощи центрифугирования 12000g при 4°С.Для получения рекомбинантного белка RBDdelta была проведена двух-стадийная хроматографическая очистка, включающая аффинную и ионообменную хроматографии. Аминокислотная последовательность SEQ ID NO:3 приведена на фиг. 7 и в приложении.Then the preparation RBDdelta was produced in suspension. The producer clone RBDdelta was seeded in 5 ml of fresh HyCell CHO + 4 mM GlutaMAX medium with a concentration of 1×10 6 live cells/ml in 50 ml centrifuge tubes. They were cultured on a shaker at 200 rpm, orbit 19 mm, at +37°C in a humid atmosphere of 5% CO 2 for 6-7 days until a concentration of 8×10 6 live cells/ml was achieved. A cell suspension of 5 ml with a concentration of 8×10 6 live cells/ml was inoculated in a glass flask with 35 ml of fresh HyCell CHO + 4 mM GlutaMAX medium. They were cultured on a shaker under the same conditions for 6-7 days until a concentration of 8×10 6 live cells/ml was achieved. A cell suspension of 5 ml with a concentration of 8×10 6 live cells/ml was inoculated into a new glass flask with 35 ml of fresh HyCell CHO + 4 mM GlutaMAX medium. The remaining volume was transferred on a shaker (200 rpm, orbit 19 m) at +31°C and incubated for 10 days. The culture liquid was purified from cells by centrifugation 12000g at 4°C. To obtain the recombinant RBDdelta protein, a two-stage chromatographic purification was carried out, including affinity and ion exchange chromatography. The amino acid sequence of SEQ ID NO:3 is shown in FIG. 7 and in the appendix.
Пример 4. Оценка иммуногенности рекомбинантного белка RBD SARS-CoV-2Example 4. Assessment of the immunogenicity of the recombinant SARS-CoV-2 RBD protein
Оценку иммуногенности RBD проводили в экспериментах по иммунизации мышей линии BALB/c. В качестве адъюванта использовали гидроокись алюминия (А1(ОН)3).The immunogenicity of RBD was assessed in experiments on immunization of BALB/c mice. Aluminum hydroxide (A1(OH)3) was used as an adjuvant.
Мышей иммунизировали внутримышечно, дважды с двухнедельным интервалом дозой 50 мкг белка RBD с гидроокисью алюминия. Через две недели после второй иммунизации получали сыворотки крови и анализировали титры специфических IgG в ИФА с использованием RBD Delta, а также тримеров S-белка вариантов Delta, Wuhan и Omicron SARS-CoV-2 (фиг. 3).Mice were immunized intramuscularly, twice at a two-week interval, with a dose of 50 μg of RBD protein with aluminum hydroxide. Two weeks after the second immunization, blood sera were obtained and specific IgG titers were analyzed in ELISA using RBD Delta, as well as trimers of the S protein variants Delta, Wuhan and Omicron SARS-CoV-2 (Fig. 3).
На фиг. 3 представлены данные анализа сывороточных IgG у мышей иммунизированных 50 мкг RBD Delta SARS-CoV-2 с гидроокисью алюминия по результатам ИФА.In fig. Figure 3 presents data from the analysis of serum IgG in mice immunized with 50 μg of RBD Delta SARS-CoV-2 with aluminum hydroxide according to the results of ELISA.
А. Титры RBD Delta специфических IgG.A. RBD Delta specific IgG titers.
Б. Титры IgG специфических к тримерам S-белка штаммов Wuhan, Delta, Omicron.B. IgG titers specific to S-protein trimers of Wuhan, Delta, Omicron strains.
Статистический анализ выполнен в GraphPad Prism 8.0 с использованием непараметрического теста Манна-Уитни.Statistical analysis was performed in GraphPad Prism 8.0 using the nonparametric Mann-Whitney test.
По результатам анализов, показано, что иммуноген достоверно вызывает индукцию специфических IgG у мышей линии BALB/c. Кроме того, сывороточные антитела иммунизированных мышей, способны связываться с тримерами S-белка штаммов Delta и Omicron. Среднегеометрический титр (GMT) составил 2,4×105±2,1 для Wuhan S, 7,1×105±±2,5 для Delta S и 4,1×103±2,1 Omicron S.Based on the test results, it was shown that the immunogen reliably causes the induction of specific IgG in BALB/c mice. In addition, serum antibodies from immunized mice are able to bind to S-protein trimers of the Delta and Omicron strains. Geometric mean titer (GMT) was 2.4 × 105 ± 2.1 for Wuhan S, 7.1 × 105 ± 2.5 for Delta S, and 4.1 × 103 ± 2.1 for Omicron S.
Анализ нейтрализующей активности сывороток мышей определяли в реакции нейтрализации цитопатического действия (ЦПД) вируса на культуре клеток. В работе использовали штаммы вируса Wuhan- hCoV-19/Australia/VICO 1/2020 (EPIJSL 406844), Delta- hCoV-19/Russia/PSK-2804/2021 (EPIJSL 7338814) и Omicron 1- hCoV-19/Russia/Moscowl71619-031221/2021 (EPI_ISL_8920444) SARS-CoV-2 были получены из государственной коллекции возбудителей вирусных инфекций и риккетсиозов ФБУН ГНЦ ВБ «Вектор» Роспотребнадзора. Вируссодержащий материал хранился при температуре -70°С.Концентрация вируса в наработанном препарате составляла 5×106 ТЦД50/мл (тканевая цитопатическая доза на миллилитр).Analysis of the neutralizing activity of mouse sera was determined in the reaction of neutralization of the cytopathic effect (CPE) of the virus in cell culture. The virus strains used in this work were Wuhan-hCoV-19/Australia/VICO 1/2020 (EPIJSL 406844), Delta-hCoV-19/Russia/PSK-2804/2021 (EPIJSL 7338814) and Omicron 1-hCoV-19/Russia/Moscowl71619 -031221/2021 (EPI_ISL_8920444) SARS-CoV-2 were obtained from the state collection of pathogens of viral infections and rickettsial diseases of the State Research Center for Virus and Diseases "Vector" of Rospotrebnadzor. The virus-containing material was stored at a temperature of -70°C. The concentration of the virus in the prepared preparation was 5×10 6 TCD50/ml (tissue cytopathic dose per milliliter).
Образцы крови получали от всех животных через две недели после 2-й иммунизации. Из крови животных были получены сыворотки путем осаждения форменных элементов с помощью центрифугирования при 1000 × g в течение 7 - 10 мин. Полученные сыворотки термически инактивировали при 56°С в течение 30 мин.Blood samples were obtained from all animals two weeks after the 2nd immunization. Serum was obtained from the blood of animals by sedimentation of formed elements using centrifugation at 1000 × g for 7 - 10 minutes. The resulting sera were thermally inactivated at 56°C for 30 min.
Определение нейтрализующих титров сывороток, проводили путем учета неповрежденного монослоя культуры клеток Vero Е6 в лунках 96-луночного планшета (Corning, США). Культуру клеток выращивали в 96-луночных культуральных планшетах в ростовой питательной среде с добавлением 10% бычьей фетальной сыворотки и антибиотиков. Заражение клеток проводили вариантами Delta (В. 1.617.2), Wuhan и Omicron (В. 1.1.529) вируса SARS-CoV-2 в дозе 100 ТЦД50/лунку. Исследуемые образцы сыворотки крови разводили последовательно в среде DMEM (ФБУН ГНЦ ВБ «Вектор» Роспотребнадзора, Россия) с глутамином и антибиотиками с 2-кратным шагом, начиная с разведения 1:10 до 1:2560. К разведениям сыворотки добавляли вирус в равной пропорции 1:1 и инкубировали в течение 1 ч при 37°С, затем смесь вируса и сыворотки наносили в дублях на монослой культуры клеток в объеме 100 мкл/лунку. Планшеты инкубировали в течение 4 суток при 37°С во влажной атмосфере 5% СО2. Для окрашивания в каждую лунку планшета вносили 100 мкл 0,2%-го раствора генцианвиолета. Через 4 сутки жидкость из лунок удаляли и промывали лунки водой. Учет результатов проводили визуально.Determination of neutralizing serum titers was carried out by counting an intact monolayer of Vero E6 cell culture in the wells of a 96-well plate (Corning, USA). The cell culture was grown in 96-well culture plates in growth medium supplemented with 10% bovine fetal serum and antibiotics. Cells were infected with the Delta (B. 1.617.2), Wuhan and Omicron (B. 1.1.529) variants of the SARS-CoV-2 virus at a dose of 100 TCD50/well. The blood serum samples under study were diluted sequentially in DMEM medium (FBUN State Scientific Center for VB "Vector" of Rospotrebnadzor, Russia) with glutamine and antibiotics in 2-fold steps, starting from a dilution of 1:10 to 1:2560. The virus was added to the serum dilutions in an equal proportion of 1:1 and incubated for 1 hour at 37°C, then the mixture of virus and serum was applied in duplicate to a cell culture monolayer in a volume of 100 μl/well. The plates were incubated for 4 days at 37°C in a humidified atmosphere of 5% CO 2 . For staining, 100 μl of a 0.2% gentian violet solution was added to each well of the plate. After 4 days, the liquid was removed from the wells and the wells were washed with water. The results were recorded visually.
Любое специфическое поражение культуры клеток в лунке учитывали как цитопатическое действие (ЦПД). Титром считали последнее разведение, при котором регистрировали защиту монослоя культуры клеток в лунках от ЦПД вируса. В качестве положительного контроля использовали 20-кратное разведение образца сыворотки крови реконвалесцента COVID-19 с ранее установленным титром 1:80. В качестве отрицательного контроля использовали питательную среду.Any specific damage to the cell culture in the well was counted as a cytopathic effect (CPE). The titer was considered the last dilution at which the protection of the cell culture monolayer in the wells from the virus CPE was recorded. A 20-fold dilution of a COVID-19 convalescent blood serum sample with a previously established titer of 1:80 was used as a positive control. Nutrient medium was used as a negative control.
Расчет титра нейтрализующих антител проводили по формуле Рида-Менча. Результаты эксперимента (фиг. 4) подтверждают, что заявленный рекомбинантного RBDdelta обеспечивает гуморальный ответ в отношении в SARS-CoV-2 вариантов Delta (В. 1.617.2), Wuhan, Omicron (В. 1.1.529). На фиг. 4 представлены результаты исследования Анализ сывороточных IgG у мышей иммунизированных дозой 50 мкг RBD Delta SARS-CoV-2 с гидроокисью алюминия в тесте на ингибирование цитопатического действия вариантов Delta(B. 1.617.2), Wuhan и Omicron (В. 1.1.529) вируса SARS-CoV-2 (100 ТЦД50) на культуре клеток Vero Е6.The titer of neutralizing antibodies was calculated using the Reed-Moench formula. The results of the experiment (Fig. 4) confirm that the claimed recombinant RBDdelta provides a humoral response against the SARS-CoV-2 variants Delta (B. 1.617.2), Wuhan, Omicron (B. 1.1.529). In fig. 4 presents the results of the study Analysis of serum IgG in mice immunized with a dose of 50 μg of RBD Delta SARS-CoV-2 with aluminum hydroxide in a test for inhibition of the cytopathic effect of variants Delta (B. 1.617.2), Wuhan and Omicron (B. 1.1.529) of the virus SARS-CoV-2 (100 TCD 50 ) on Vero E6 cell culture.
На фиг.4 представлены данные анализа сывороточных IgG у мышей иммунизированных дозой 50 мкг RBD Delta SARS-CoV-2 с гидроокисью алюминия в тесте на ингибирование цитопатического действия вариантов Delta(B. 1.617.2), Wuhan и Omicron (В. 1.1.529) вируса SARS-CoV-2 (100 ТЦД50) на культуре клеток Vero Е6. Представлены средние геометрические значения ± SD. Статистический анализ выполнен с использованием U критерия Манна-Уитни и критерия Краскела-Уоллиса.Figure 4 presents data from the analysis of serum IgG in mice immunized with a dose of 50 μg of RBD Delta SARS-CoV-2 with aluminum hydroxide in a test for inhibition of the cytopathic effect of variants Delta (B. 1.617.2), Wuhan and Omicron (B. 1.1.529 ) SARS-CoV-2 virus (100 TCD 50 ) on Vero E6 cell culture. Geometric means ± SD are presented. Statistical analysis was performed using the Mann-Whitney U test and the Kruskal-Wallis test.
Таким образом, группа заявленных изобретений обеспечивает получение иммунологически корректной формы белка RBD delta SARS-CoV-2, который может быть использован как платформа для создания вакцины против COVID-19. В примерах 1-4 подтверждается достижение технического результата заявляемого изобретения, а именно: выход рекомбинантного белка RBD delta SARS-CoV-2 после хроматографической очистки составляет 150 мг с литра культуральной среды, что превосходит в 15 раз выход белка RBD, представленный в аналоге по патенту РФ №2754930 (продукция белка RBD SARS-CoV-2 в аналоге составляет от 5 мг/л до 10 мг/л). В прототипе по патенту РФ №2752858 выход рекомбинантного белка RBD SARS-CoV-2 после хроматографической очистки составляет 50-100 мг с литра культуральной среды, что в 1,5-3 раза ниже, чем в предлагаемом изобретении. Источники научно-технической информации:Thus, the group of claimed inventions ensures the production of an immunologically correct form of the SARS-CoV-2 RBD delta protein, which can be used as a platform for creating a vaccine against COVID-19. Examples 1-4 confirm the achievement of the technical result of the claimed invention, namely: the yield of the recombinant RBD delta SARS-CoV-2 protein after chromatographic purification is 150 mg per liter of culture medium, which is 15 times higher than the yield of the RBD protein presented in the patent analogue RF No. 2754930 (production of the SARS-CoV-2 RBD protein in the analogue ranges from 5 mg/l to 10 mg/l). In the prototype according to RF patent No. 2752858, the yield of the recombinant SARS-CoV-2 RBD protein after chromatographic purification is 50-100 mg per liter of culture medium, which is 1.5-3 times lower than in the proposed invention. Sources of scientific and technical information:
1. Perlman S., Dandekar A.A. Immunopathogenesis of coronavirus infections: Implications for SARS//Nat. Rev. Immunol. - 2005. - V. 5 - №12. - P. 917-27.1. Perlman S., Dandekar A.A. Immunopathogenesis of coronavirus infections: Implications for SARS//Nat. Rev. Immunol. - 2005. - V. 5 - No. 12. - P. 917-27.
2. Bolles M, Deming D., Long K., Agnihothram S., Whitmore A., Ferris M., Funkhouser W., Gralinski L., Totura A., Heise M., et al. A Double-Inactivated Severe Acute Respiratory Syndrome Coronavirus Vaccine Provides Incomplete Protection in Mice and Induces Increased Eosinophilic Proinflammatory Pulmonary Response upon Challenge//J. Virol. - 2011. - V. 85-№23. -P. 12201-15.2. Bolles M, Deming D, Long K, Agnihothram S, Whitmore A, Ferris M, Funkhouser W, Gralinski L, Totura A, Heise M, et al. A Double-Inactivated Severe Acute Respiratory Syndrome Coronavirus Vaccine Provides Incomplete Protection in Mice and Induces Increased Eosinophilic Proinflammatory Pulmonary Response upon Challenge//J. Virol. - 2011. - V. 85-No. 23. -P. 12201-15.
3. Jaume M., Yip M.S., Kam Y.W., Cheung C.Y., Kien F., Roberts A., Li P.H., Dutry I., Escriou N., Daeron M., et al. SARS CoV subunit vaccine: antibody-mediated neutralisation and enhancement.//Hong Kong Med. J. = Xianggang yi xue zazhi. - 2012. - V. 18Suppl2 - №1. - P. 31-6.3. Jaume M., Yip M.S., Kam Y.W., Cheung C.Y., Kien F., Roberts A., Li P.H., Dutry I., Escriou N., Daeron M., et al. SARS CoV subunit vaccine: antibody-mediated neutralization and enhancement.//Hong Kong Med. J. = Xianggang yi xue zazhi. - 2012. - V. 18Suppl2 - No. 1. - P. 31-6.
4. Xia S., Yan L., Xu W., Agrawal A.S., Algaissi A., Tseng C.T.K., Wang Q., Du L., Tan W., Wilson I.A., et al. A pan-coronavirus fusion inhibitor targeting the HR1 domain of human coronavirus spike//Sci. Adv. - 2019. - V. 5 - №4. - P 45-34.4. Xia S., Yan L., Xu W., Agrawal A.S., Algaissi A., Tseng C.T.K., Wang Q., Du L., Tan W., Wilson I.A., et al. A pan-coronavirus fusion inhibitor targeting the HR1 domain of human coronavirus spike//Sci. Adv. - 2019. - V. 5 - No. 4. - P 45-34.
5. Gui M., Song W., Zhou H., Xu J., Chen S., Xiang Y., Wang X. Cryo-electron microscopy structures of the SARS-CoV spike glycoprotein reveal a prerequisite conformational state for receptor binding//Cell Res. - 2017. - V. 27 - №1. - P. 119-29.5. Gui M., Song W., Zhou H., Xu J., Chen S., Xiang Y., Wang X. Cryo-electron microscopy structures of the SARS-CoV spike glycoprotein reveal a prerequisite conformational state for receptor binding/ /Cell Res. - 2017. - V. 27 - No. 1. - P. 119-29.
6. He Y., Zhou Y., Liu S., Kou Z., Li W., Farzan M., Jiang S. Receptor-binding domain of SARS-CoV spike protein induces highly potent neutralizing antibodies: Implication for developing subunit vaccine//Biochem. Biophys. Res. Commun. - 2004. - V. 324 - №2. - P. 773-81.6. He Y., Zhou Y., Liu S., Kou Z., Li W., Farzan M., Jiang S. Receptor-binding domain of SARS-CoV spike protein induces highly potent neutralizing antibodies: Implication for developing subunit vaccine //Biochem. Biophys. Res. Commun. - 2004. - V. 324 - No. 2. - P. 773-81.
7. Du L., Zhao G., Yang Y., Qiu H., Wang L., Kou Z., Tao X., Yu H., Sun S., Tseng C.T.K., et al. A Conformation-Dependent Neutralizing Monoclonal Antibody Specifically Targeting Receptor-Binding Domain in Middle East Respiratory Syndrome Coronavirus Spike Protein//J. Virol. - 2014. - V. 88 - №12. - P. 7045-53.7. Du L., Zhao G., Yang Y., Qiu H., Wang L., Kou Z., Tao X., Yu H., Sun S., Tseng C.T.K., et al. A Conformation-Dependent Neutralizing Monoclonal Antibody Specifically Targeting Receptor-Binding Domain in Middle East Respiratory Syndrome Coronavirus Spike Protein//J. Virol. - 2014. - V. 88 - No. 12. - P. 7045-53.
8. Walls A.C., Xiong X., Park Y.J., Tortorici M.A., Snijder J., Quispe J., Cameroni E., Gopal R., Dai M., Lanzavecchia A., et al. Unexpected Receptor Functional Mimicry Elucidates Activation of Coronavirus Fusion//Cell. - 2019. - V. 176 - №5. - P. 1026-1039.el5.8. Walls A.C., Xiong X., Park Y.J., Tortorici M.A., Snijder J., Quispe J., Cameroni E., Gopal R., Dai M., Lanzavecchia A., et al. Unexpected Receptor Functional Mimicry Elucidates Activation of Coronavirus Fusion//Cell. - 2019. - V. 176 - No. 5. - P. 1026-1039.el5.
9. Chen W.H., Chag S.M., Poongavanam M.V., Biter A.B., Ewere E.A., Rezende W., Seid C.A., Hudspeth E.M., Pollet J., McAtee C.P., et al. Optimization of the Production Process and Characterization of the Yeast-Expressed SARS-CoV Recombinant Receptor-Binding Domain (RBD219-N1), a SARS Vaccine Candidate//J. Pharm. Sci. - 2017. - V. 106 - №8. - P. 1961-70.9. Chen W.H., Chag S.M., Poongavanam M.V., Biter A.B., Ewere E.A., Rezende W., Seid C.A., Hudspeth E.M., Pollet J., McAtee C.P., et al. Optimization of the Production Process and Characterization of the Yeast-Expressed SARS-CoV Recombinant Receptor-Binding Domain (RBD219-N1), a SARS Vaccine Candidate//J. Pharm. Sci. - 2017. - V. 106 - No. 8. - P. 1961-70.
10. Zang J., Gu C, Zhou В., Zhang C, Yang Y., Xu S., Bai L., Zhang R., Deng Q., Yuan Z., et al. Immunization with the receptor-binding domain of SARS-CoV-2 elicits antibodies cross-neutralizing SARS-CoV-2 and SARS-CoV without antibody-dependent enhancement//Cell Discov. - 2020. - V. 6 - №1. - P. 4-7.10. Zang J, Gu C, Zhou W, Zhang C, Yang Y, Xu S, Bai L, Zhang R, Deng Q, Yuan Z, et al. Immunization with the receptor-binding domain of SARS-CoV-2 elicits antibodies cross-neutralizing SARS-CoV-2 and SARS-CoV without antibody-dependent enhancement//Cell Discov. - 2020. - V. 6 - No. 1. - P. 4-7.
11. Yang J., Wang W., Chen Z., Lu S., Yang F., Bi Z., Bao L., Mo F., Li X., Huang Y., et al. A vaccine targeting the RBD of the S protein of SARS-CoV-2 induces protective immunity//Nature. - 2020. - V. 586 - №7830. - P. 572-7.11. Yang J., Wang W., Chen Z., Lu S., Yang F., Bi Z., Bao L., Mo F., Li X., Huang Y., et al. A vaccine targeting the RBD of the S protein of SARS-CoV-2 induces protective immunity//Nature. - 2020. - V. 586 - No. 7830. - P. 572-7.
12. Malladi S.K., Singh R., Pandey S., Gayathri S., Kanjo K., Ahmed S., Khan M.S., Kalita P., Girish N., Upadhyaya A., et al. Design of a highly thermotolerant, immunogenic SARS-CoV-2 spike fragment//J. Biol. Chem. - 2021. -V. 296100025.12. Malladi S.K., Singh R., Pandey S., Gayathri S., Kanjo K., Ahmed S., Khan M.S., Kalita P., Girish N., Upadhyaya A., et al. Design of a highly thermotolerant, immunogenic SARS-CoV-2 spike fragment//J. Biol. Chem. - 2021. -V. 296100025.
13. Маниатис Т., Фрич Э, Сэмбрук Дж. Молекулярное клонирование, М.: Мир, 1984; Клонирование ДНК. Методы. Под ред. Д.Гловера, Пер. с англ., Москва, Мир, 1988; Saiki R.K. et al. Science. 1988, 239(4839):487-491; Sanger F. et al. Proc. Nat. Acad. Sci. 1977, 74:5463-5467.13. Maniatis T., Fritsch E, Sambrook J. Molecular cloning, M.: Mir, 1984; DNA cloning. Methods. Ed. D. Glover, Trans. from English, Moscow, Mir, 1988; Saiki R.K. et al. Science. 1988, 239(4839):487-491; Sanger F. et al. Proc. Nat. Acad. Sci. 1977, 74:5463-5467.
--->--->
<?xml version="1.0" encoding="UTF-8"?><?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE ST26SequenceListing PUBLIC "-//WIPO//DTD Sequence Listing <!DOCTYPE ST26SequenceListing PUBLIC "-//WIPO//DTD Sequence Listing
1.3//EN" "ST26SequenceListing_V1_3.dtd">1.3//EN" "ST26SequenceListing_V1_3.dtd">
<ST26SequenceListing dtdVersion="V1_3" <ST26SequenceListing dtdVersion="V1_3"
fileName="RBDdelta_05.07.2023.xml" softwareName="WIPO Sequence" fileName="RBDdelta_05.07.2023.xml" softwareName="WIPO Sequence"
softwareVersion="2.3.0" productionDate="2023-07-05">softwareVersion="2.3.0" productionDate="2023-07-05">
<ApplicationIdentification> <ApplicationIdentification>
<IPOfficeCode>RU</IPOfficeCode> <IPOfficeCode>RU</IPOfficeCode>
<ApplicationNumberText>1234567</ApplicationNumberText> <ApplicationNumberText>1234567</ApplicationNumberText>
<FilingDate>2023-07-05</FilingDate> <FilingDate>2023-07-05</FilingDate>
</ApplicationIdentification> </ApplicationIdentification>
<ApplicantFileReference>1234567</ApplicantFileReference> <ApplicantFileReference>1234567</ApplicantFileReference>
<EarliestPriorityApplicationIdentification> <EarliestPriorityApplicationIdentification>
<IPOfficeCode>RU</IPOfficeCode> <IPOfficeCode>RU</IPOfficeCode>
<ApplicationNumberText>1234567</ApplicationNumberText> <ApplicationNumberText>1234567</ApplicationNumberText>
<FilingDate>2023-07-05</FilingDate> <FilingDate>2023-07-05</FilingDate>
</EarliestPriorityApplicationIdentification> </EarliestPriorityApplicationIdentification>
<ApplicantName languageCode="ru">Федеральное бюджетное учреждение <ApplicantName languageCode="ru">Federal budgetary institution
науки «Государственный научный центр вирусологии и биотехнологии science "State Scientific Center of Virology and Biotechnology
«Вектор» Федеральной службы по надзору в сфере защиты прав "Vector" of the Federal Service for Supervision of Rights Protection
потребителей и благополучия человека (ФБУН ГНЦ ВБ «Вектор» consumers and human well-being (FBU SSC VB “Vector”
Роспотребнадзора)</ApplicantName>Rospotrebnadzor)</ApplicantName>
<ApplicantNameLatin>Federalnoe byudzhetnoe uchrezhdenie nauki <ApplicantNameLatin>Federalnoe byudzhetnoe uchrezhdenie nauki
"Gosudarstvennyj nauchnyj tsentr virusologii i biotekhnologii "Gosudarstvennyj nauchnyj tsentr virusologii i biotekhnologii
"Vektor" Federalnoj sluzhby po nadzoru v sfere zashchity "Vektor" Federalnoj sluzhby po nadzoru v sfere zashchity
prav potrebitelej i blagopoluchiya cheloveka (FBUN GNTS VB prav potrebitelej i blagopoluchiya cheloveka (FBUN GNTS VB
"Vektor" Rospotrebnadzora) (RU)</ApplicantNameLatin>"Vektor" Rospotrebnadzora) (RU)</ApplicantNameLatin>
<InventionTitle languageCode="ru">Интегративный плазмидный вектор <InventionTitle languageCode="en">Integrative plasmid vector
pVEAL3- RBDdel, обеспечивающий синтез и секрецию рекомбинантного pVEAL3-RBDdel, which ensures the synthesis and secretion of recombinant
рецепторсвязывающего домена RBDdelta коронавируса SARS-CoV-2 в receptor binding domain RBDdelta of coronavirus SARS-CoV-2 in
клетках млекопитающих, рекомбинантный штамм клеточной линии CHO-K1- mammalian cells, recombinant cell line strain CHO-K1-
RBDdelta и рекомбинантный белок RBDdelta SARS-CoV-2, продуцируемый RBDdelta and recombinant SARS-CoV-2 RBDdelta protein produced
указанным штаммом клеточной линии </InventionTitle>the specified cell line strain </InventionTitle>
<SequenceTotalQuantity>3</SequenceTotalQuantity> <SequenceTotalQuantity>3</SequenceTotalQuantity>
<SequenceData sequenceIDNumber="1"> <SequenceData sequenceIDNumber="1">
<INSDSeq> <INSDSeq>
<INSDSeq_length>5160</INSDSeq_length> <INSDSeq_length>5160</INSDSeq_length>
<INSDSeq_moltype>DNA</INSDSeq_moltype> <INSDSeq_moltype>DNA</INSDSeq_moltype>
<INSDSeq_division>PAT</INSDSeq_division> <INSDSeq_division>PAT</INSDSeq_division>
<INSDSeq_feature-table> <INSDSeq_feature-table>
<INSDFeature> <INSDFeature>
<INSDFeature_key>source</INSDFeature_key> <INSDFeature_key>source</INSDFeature_key>
<INSDFeature_location>1..5160</INSDFeature_location> <INSDFeature_location>1..5160</INSDFeature_location>
<INSDFeature_quals> <INSDFeature_quals>
<INSDQualifier> <INSDQualifier>
<INSDQualifier_name>mol_type</INSDQualifier_name> <INSDQualifier_name>mol_type</INSDQualifier_name>
<INSDQualifier_value>other DNA</INSDQualifier_value> <INSDQualifier_value>other DNA</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
<INSDQualifier id="q2"> <INSDQualifier id="q2">
<INSDQualifier_name>organism</INSDQualifier_name> <INSDQualifier_name>organism</INSDQualifier_name>
<INSDQualifier_value>synthetic construct</INSDQualifier_value> <INSDQualifier_value>synthetic construct</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
</INSDFeature_quals> </INSDFeature_quals>
</INSDFeature> </INSDFeature>
</INSDSeq_feature-table> </INSDSeq_feature-table>
<INSDSeq_sequence>cgaagaaaggcccacccgtgaaggtgagccagtgagttgattgcagtcc <INSDSeq_sequence>cgaagaaaggcccacccgtgaaggtgagccagtgagttgattgcagtcc
agttacgctggagtctgaggctcgtcctgaatggatccctatacagttgaagtcggaagtttacatacacagttacgctggagtctgaggctcgtcctgaatggatccctatacagttgaagtcggaagtttacatacac
ttaagttggagtcattaaaactcgtttttcaactactccacaaatttcttgttaacaaacaatagttttgttaagttggagtcattaaaactcgtttttcaactactccacaaatttcttgttaacaaacaatagttttg
gcaagtcagttaggacatctactttgtgcatgacacaagtcatttttccaacaattgtttacagacagatgcaagtcagttaggacatctactttgtgcatgacacaagtcatttttccaacaattgtttacagacagat
tatttcacttataattcactgtatcacaattccagtgggtcagaagtttacatacactaagttcgactcctatttcacttataattcactgtatcacaattccagtgggtcagaagtttacatacactaagttcgactcc
tctgcagaatgcggcgatgtttcggtaaggggtccgctactagttattaatagtaatcaattacggggtctctgcagaatgcggcgatgtttcggtaaggggtccgctactagttattaatagtaatcaattacggggtc
attagttcatagcccatatatggagttccgcgttacataacttacggtaaatggcccgcctggctgaccgattagttcatagcccatatatggagttccgcgttacataacttacggtaaatggcccgcctggctgaccg
cccaacgacccccgcccattgacgtcaataatgacgtatgttcccatagtaacgccaatagggactttcccccaacgacccccgcccattgacgtcaataatgacgtatgttcccatagtaacgccaatagggactttcc
attgacgtcaatgggtggagtatttacggtaaactgcccacttggcagtacatcaagtgtatcatatgccattgacgtcaatgggtggagtatttacggtaaactgcccacttggcagtacatcaagtgtatcatatgcc
aagtacgccccctattgacgtcaatgacggtaaatggcccgcctggcattatgcccagtacatgaccttaaagtacgccccctattgacgtcaatgacggtaaatggcccgcctggcattatgcccagtacatgacctta
tgggactttcctacttggcagtacatctacgtattagtcatcgctattaccatggtgatgcggttttggctgggactttcctacttggcagtacatctacgtattagtcatcgctattaccatggtgatgcggttttggc
agtacatcaatgggcgtggatagcggtttgactcacggggatttccaagtctccaccccattgacgtcaaagtacatcaatgggcgtggatagcggtttgactcacggggatttccaagtctccaccccattgacgtcaa
tgggagtttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaacaactccgccccattgacgtgggagtttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaacaactccgccccattgacg
caaatgggcggtaggcgtgtacggtgggaggtctatataagcagagctctctggctaactagagaacccacaaatgggcggtaggcgtgtacggtgggaggtctatataagcagagctctctggctaactagagaaccca
ctgcttactggcttatcgaaattaatacgactcactatagggagacccaagctggctagccatgtttgttctgcttactggcttatcgaaattaatacgactcactatagggagacccaagctggctagccatgtttgtt
tttcttgttttattgccactagtctctagtcagtgtgtggaaaagggcatctaccagaccagcaacttcctttcttgttttattgccactagtctctagtcagtgtgtggaaaagggcatctaccagaccagcaacttcc
gggtgcagcccaccgaatccatcgtgcggttccccaatatcaccaatctgtgccccttcggcgaggtgttgggtgcagcccaccgaatccatcgtgcggttccccaatatcaccaatctgtgccccttcggcgaggtgtt
caatgccaccagattcgcctctgtgtacgcctggaaccggaagcggatcagcaattgcgtggccgactaccaatgccaccagattcgcctctgtgtacgcctggaaccggaagcggatcagcaattgcgtggccgactac
tccgtgctgtacaactccgccagcttcagcaccttcaagtgctacggcgtgtcccctaccaagctgaacgtccgtgctgtacaactccgccagcttcagcaccttcaagtgctacggcgtgtcccctaccaagctgaacg
acctgtgcttcacaaacgtgtacgccgacagcttcgtgatccggggagatgaagtgcggcagattgccccacctgtgcttcacaaacgtgtacgccgacagcttcgtgatccggggagatgaagtgcggcagattgcccc
tggacagacaggcaagatcgccgactacaactacaagctgcccgacgacttcaccggctgtgtgattgcctggacagacaggcaagatcgccgactacaactacaagctgcccgacgacttcaccggctgtgtgattgcc
tggaacagcaacaacctggactccaaagtcggcggcaactacaattaccggtaccggctgttccggaagttggaacagcaacaacctggactccaaagtcggcggcaactacaattaccggtaccggctgttccggaagt
ccaatctgaagcccttcgagcgggacatctccaccgagatctatcaggccggcagcaagccttgtaacggccaatctgaagcccttcgagcgggacatctccaccgagatctatcaggccggcagcaagccttgtaacgg
cgtggaaggcttcaactgctacttcccactgcagtcctacggctttcagcccacaaatggcgtgggctatcgtggaaggcttcaactgctacttcccactgcagtcctacggctttcagcccacaaatggcgtgggctat
cagccctacagagtggtggtgctgagcttcgaactgctgcatgcccctgccacagtgtgcggccctaagacagccctacagagtggtggtgctgagcttcgaactgctgcatgcccctgccacagtgtgcggccctaaga
aaagcaccaatctcgtgaagaacaaatgcgtgaacttccatcaccaccatcatcaccatcaccaccactaaaagcaccaatctcgtgaagaacaaatgcgtgaacttccatcaccaccatcatcaccatcaccaccacta
agcttaagtttaaaccgctgatcagcctcgtcgaccgagcggttcccgcccctctccctcccccccccctagcttaagtttaaaccgctgatcagcctcgtcgaccgagcggttcccgcccctctccctcccccccccct
aacgttactggccgaagccgcttggaataaggccggtgtgcgtttgtctatatgttattttccaccatataacgttactggccgaagccgcttggaataaggccggtgtgcgtttgtctatatgttattttccaccatat
tgccgtcttttggcaatgtgagggcccggaaacctggccctgtcttcttgacgagcattcctaggggtcttgccgtcttttggcaatgtgagggcccggaaacctggccctgtcttcttgacgagcattcctaggggtct
ttcccctctcgccaaaggaatgcaaggtctgttgaatgtcgtgaaggaagcagttcctctggaagcttctttcccctctcgccaaaggaatgcaaggtctgttgaatgtcgtgaaggaagcagttcctctggaagcttct
tgaagacaaacaacgtctgtagcgaccctttgcaggcagcggaaccccccacctggcgacaggtgcctcttgaagacaaacaacgtctgtagcgaccctttgcaggcagcggaaccccccacctggcgacaggtgcctct
gcggccaaaagccacgtgtataagatacacctgcaaaggcggcacaaccccagtgccacgttgtgagttggcggccaaaagccacgtgtataagatacacctgcaaaggcggcacaaccccagtgccacgttgtgagttg
gatagttgtggaaagagtcaaatggctcacctcaagcgtattcaacaaggggctgaaggatgcccagaaggatagttgtggaaagagtcaaatggctcacctcaagcgtattcaacaaggggctgaaggatgcccagaag
gtaccccattgtatgggatctgatctggggcctcggtgcacatgctttacatgtgtttagtcgaggttaagtaccccattgtatgggatctgatctggggcctcggtgcacatgctttacatgtgtttagtcgaggttaa
aaaacgtctaggccccccgaaccacggggacgtggttttcctttgaaaaacacgatgataatatggccacaaaacgtctaggccccccgaaccacggggacgtggttttcctttgaaaaacacgatgataatatggccac
aaccatgaccgagtacaagcccacggtgcgcctcgccacccgcgacgacgtccccagggccgtacgcaccaaccatgaccgagtacaagcccacggtgcgcctcgccacccgcgacgacgtccccagggccgtacgcacc
ctcgccgccgcgttcgccgactaccccgccacgcgccacaccgtcgatccggaccgccacatcgagcgggctcgccgccgcgttcgccgactaccccgccacgcgccacaccgtcgatccggaccgccacatcgagcggg
tcaccgagctgcaagaactcttcctcacgcgcgtcgggctcgacatcggcaaggtgtgggtcgcggacgatcaccgagctgcaagaactcttcctcacgcgcgtcgggctcgacatcggcaaggtgtgggtcgcggacga
cggcgccgcggtggcggtctggaccacgccggagagcgtcgaagcgggggcggtgttcgccgagatcggccggcgccgcggtggcggtctggaccacgccggagagcgtcgaagcgggggcggtgttcgccgagatcggc
ccgcgcatggccgagttgagcggttcccggctggccgcgcagcaacagatggaaggcctcctggcgccgcccgcgcatggccgagttgagcggttcccggctggccgcgcagcaacagatggaaggcctcctggcgccgc
accggcccaaggagcccgcgtggttcctggccaccgtcggcgtctcgcccgaccaccagggcaagggtctaccggcccaaggagcccgcgtggttcctggccaccgtcggcgtctcgcccgaccaccagggcaagggtct
gggcagcgccgtcgtgctccccggagtggaggcggccgagcgcgccggggtgcccgccttcctggagaccgggcagcgccgtcgtgctccccggagtggaggcggccgagcgcgccggggtgcccgccttcctggagacc
tccgcgccccgcaacctccccttctacgagcggctcggcttcaccgtcaccgccgacgtcgaggtgcccgtccgcgccccgcaacctccccttctacgagcggctcggcttcaccgtcaccgccgacgtcgaggtgcccg
aaggaccgcgcacctggtgcatgacccgcaagcccggtgcctgattcgcatatgggttaatgcttcgagcaaggaccgcgcacctggtgcatgacccgcaagcccggtgcctgattcgcatatgggttaatgcttcgagc
agacatgataagatacattgatgagtttggacaaaccacaactagaatgcagtgaaaaaaatgctttattagacatgataagatacattgatgagtttggacaaaccacaactagaatgcagtgaaaaaaatgctttatt
tgtgaaatttgtgatgctattgctttatttgtaaccattataagctgcaataaacaagttcctcgacctctgtgaaatttgtgatgctattgctttatttgtaaccattataagctgcaataaacaagttcctcgacctc
tagctagagctactcgggaccccttaccgaaacatcgccgcattctgcagaggagtcgagtgtatgtaaatagctagagctactcgggaccccttaccgaaacatcgccgcattctgcagaggagtcgagtgtatgtaaa
cttctgacccactgggaatgtgatgaaagaaataaaagctgaaatgaatcattctctctactattattctcttctgacccactgggaatgtgatgaaagaaataaaagctgaaatgaatcattctctctactattattct
gatatttcacattcttaaaataaagtggtgatcctaactgacctaagacagggaatttttactaggattagatatttcacattcttaaaataaagtggtgatcctaactgacctaagacagggaatttttactaggatta
aatgtcaggaattgtgaaaaagtgagtttaaatgtatttggctaaggtgtatgtaaacttccgacttcaaaatgtcaggaattgtgaaaaagtgagtttaaatgtatttggctaaggtgtatgtaaacttccgacttcaa
ctgtatagggatccgctcaatactgaccatttaaatcatacctgacctccatagcagaaagtcaaaagccctgtatagggatccgctcaatactgaccatttaaatcatacctgacctccatagcagaaagtcaaaagcc
tccgaccggaggcttttgacttgatcggcacgtaagaggttccaactttcaccataatgaaataagatcatccgaccggaggcttttgacttgatcggcacgtaagaggttccaactttcaccataatgaaataagatca
ctaccgggcgtattttttgagttatcgagattttcaggagctaaggaagctaaaatgagccatattcaacctaccgggcgtattttttgagttatcgagattttcaggagctaaggaagctaaaatgagccatattcaac
gggaaacgtcttgctcgaggccgcgattaaattccaacatggatgctgatttatatgggtataaatgggcgggaaacgtcttgctcgaggccgcgattaaattccaacatggatgctgatttatatgggtataaatgggc
tcgcgataatgtcgggcaatcaggtgcgacaatctatcgattgtatgggaagcccgatgcgccagagttgtcgcgataatgtcgggcaatcaggtgcgacaatctatcgattgtatgggaagcccgatgcgccagagttg
tttctgaaacatggcaaaggtagcgttgccaatgatgttacagatgagatggtcaggctaaactggctgatttctgaaacatggcaaaggtagcgttgccaatgatgttacagatgagatggtcaggctaaactggctga
cggaatttatgcctcttccgaccatcaagcattttatccgtactcctgatgatgcatggttactcaccaccggaatttatgcctcttccgaccatcaagcattttatccgtactcctgatgatgcatggttactcaccac
tgcgatcccagggaaaacagcattccaggtattagaagaatatcctgattcaggtgaaaatattgttgattgcgatcccagggaaaacagcattccaggtattagaagaatatcctgattcaggtgaaaatattgttgat
gcgctggcagtgttcctgcgccggttgcattcgattcctgtttgtaattgtccttttaacggcgatcgcggcgctggcagtgttcctgcgccggttgcattcgattcctgtttgtaattgtccttttaacggcgatcgcg
tatttcgtctggctcaggcgcaatcacgaatgaataacggtttggttggtgcgagtgattttgatgacgatatttcgtctggctcaggcgcaatcacgaatgaataacggtttggttggtgcgagtgattttgatgacga
gcgtaatggctggcctgttgaacaagtctggaaagaaatgcataagcttttgccattctcaccggattcagcgtaatggctggcctgttgaacaagtctggaaagaaatgcataagcttttgccattctcaccggattca
gtcgtcactcatggtgatttctcacttgataaccttatttttgacgaggggaaattaataggttgtattggtcgtcactcatggtgatttctcacttgataaccttatttttgacgaggggaaattaataggttgtattg
atgttggacgagtcggaatcgcagaccgataccaggatcttgccatcctatggaactgcctcggtgagttatgttggacgagtcggaatcgcagaccgataccaggatcttgccatcctatggaactgcctcggtgagtt
ttctccttcattacagaaacggctttttcaaaaatatggtattgataatcctgatatgaataaattgcagttctccttcattacagaaacggctttttcaaaaatatggtattgataatcctgatatgaataaattgcag
tttcacttgatgctcgatgagtttttctaatgagggcccaaatgtaatcacctggctcaccttcgggtggtttcacttgatgctcgatgagtttttctaatgagggcccaaatgtaatcacctggctcaccttcgggtgg
gcctttctgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgatgctcgcctttctgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgatgctc
aagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgtgaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgtg
cgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcccttcgggaagcgtggcgccgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcccttcgggaagcgtggcgc
tttctcatagctcacgctgtaggtatctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcatttctcatagctcacgctgtaggtatctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgca
cgaaccccccgttcagcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacgaaccccccgttcagcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaaga
cacgacttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacacgacttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgcta
cagagttcttgaagtggtggcctaactacggctacactagaagaacagtatttggtatctgcgctctgctcagagttcttgaagtggtggcctaactacggctacactagaagaacagtatttggtatctgcgctctgct
gaagccagttacctcggaaaaagagttggtagctcttgatccggcaaacaaaccaccgctggtagcggtggaagccagttacctcggaaaaagagttggtagctcttgatccggcaaacaaaccaccgctggtagcggtg
gtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctcaagaagatcctttgattttctagtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctcaagaagatcctttgattttcta
c</INSDSeq_sequence>c</INSDSeq_sequence>
</INSDSeq> </INSDSeq>
</SequenceData> </SequenceData>
<SequenceData sequenceIDNumber="2"> <SequenceData sequenceIDNumber="2">
<INSDSeq> <INSDSeq>
<INSDSeq_length>732</INSDSeq_length> <INSDSeq_length>732</INSDSeq_length>
<INSDSeq_moltype>DNA</INSDSeq_moltype> <INSDSeq_moltype>DNA</INSDSeq_moltype>
<INSDSeq_division>PAT</INSDSeq_division> <INSDSeq_division>PAT</INSDSeq_division>
<INSDSeq_feature-table> <INSDSeq_feature-table>
<INSDFeature> <INSDFeature>
<INSDFeature_key>source</INSDFeature_key> <INSDFeature_key>source</INSDFeature_key>
<INSDFeature_location>1..732</INSDFeature_location> <INSDFeature_location>1..732</INSDFeature_location>
<INSDFeature_quals> <INSDFeature_quals>
<INSDQualifier> <INSDQualifier>
<INSDQualifier_name>mol_type</INSDQualifier_name> <INSDQualifier_name>mol_type</INSDQualifier_name>
<INSDQualifier_value>other DNA</INSDQualifier_value> <INSDQualifier_value>other DNA</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
<INSDQualifier id="q4"> <INSDQualifier id="q4">
<INSDQualifier_name>organism</INSDQualifier_name> <INSDQualifier_name>organism</INSDQualifier_name>
<INSDQualifier_value>synthetic construct</INSDQualifier_value> <INSDQualifier_value>synthetic construct</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
</INSDFeature_quals> </INSDFeature_quals>
</INSDFeature> </INSDFeature>
</INSDSeq_feature-table> </INSDSeq_feature-table>
<INSDSeq_sequence>gtggaaaagggcatctaccagaccagcaacttccgggtgcagcccaccg <INSDSeq_sequence>gtggaaaagggcatctaccagaccagcaacttccgggtgcagcccaccg
aatccatcgtgcggttccccaatatcaccaatctgtgccccttcggcgaggtgttcaatgccaccagattaatccatcgtgcggttccccaatatcaccaatctgtgccccttcggcgaggtgttcaatgccaccagatt
cgcctctgtgtacgcctggaaccggaagcggatcagcaattgcgtggccgactactccgtgctgtacaaccgcctctgtgtacgcctggaaccggaagcggatcagcaattgcgtggccgactactccgtgctgtacaac
tccgccagcttcagcaccttcaagtgctacggcgtgtcccctaccaagctgaacgacctgtgcttcacaatccgccagcttcagcaccttcaagtgctacggcgtgtcccctaccaagctgaacgacctgtgcttcacaa
acgtgtacgccgacagcttcgtgatccggggagatgaagtgcggcagattgcccctggacagacaggcaaacgtgtacgccgacagcttcgtgatccggggagatgaagtgcggcagattgcccctggacagacaggcaa
gatcgccgactacaactacaagctgcccgacgacttcaccggctgtgtgattgcctggaacagcaacaacgatcgccgactacaactacaagctgcccgacgacttcaccggctgtgtgattgcctggaacagcaacaac
ctggactccaaagtcggcggcaactacaattaccggtaccggctgttccggaagtccaatctgaagccctctggactccaaagtcggcggcaactacaattaccggtaccggctgttccggaagtccaatctgaagccct
tcgagcgggacatctccaccgagatctatcaggccggcagcaagccttgtaacggcgtggaaggcttcaatcgagcgggacatctccaccgagatctatcaggccggcagcaagccttgtaacggcgtggaaggcttcaa
ctgctacttcccactgcagtcctacggctttcagcccacaaatggcgtgggctatcagccctacagagtgctgctacttcccactgcagtcctacggctttcagcccacaaatggcgtgggctatcagccctacagagtg
gtggtgctgagcttcgaactgctgcatgcccctgccacagtgtgcggccctaagaaaagcaccaatctcggtggtgctgagcttcgaactgctgcatgcccctgccacagtgtgcggccctaagaaaagcaccaatctcg
tgaagaacaaatgcgtgaacttccatcaccaccatcatcaccatcaccaccac</INSDSeq_sequenctgaagaacaaatgcgtgaacttccatcaccaccatcatcaccatcaccaccac</INSDSeq_sequenc
e>e>
</INSDSeq> </INSDSeq>
</SequenceData> </SequenceData>
<SequenceData sequenceIDNumber="3"> <SequenceData sequenceIDNumber="3">
<INSDSeq> <INSDSeq>
<INSDSeq_length>215</INSDSeq_length> <INSDSeq_length>215</INSDSeq_length>
<INSDSeq_moltype>AA</INSDSeq_moltype> <INSDSeq_moltype>AA</INSDSeq_moltype>
<INSDSeq_division>PAT</INSDSeq_division> <INSDSeq_division>PAT</INSDSeq_division>
<INSDSeq_feature-table> <INSDSeq_feature-table>
<INSDFeature> <INSDFeature>
<INSDFeature_key>source</INSDFeature_key> <INSDFeature_key>source</INSDFeature_key>
<INSDFeature_location>1..215</INSDFeature_location> <INSDFeature_location>1..215</INSDFeature_location>
<INSDFeature_quals> <INSDFeature_quals>
<INSDQualifier> <INSDQualifier>
<INSDQualifier_name>mol_type</INSDQualifier_name> <INSDQualifier_name>mol_type</INSDQualifier_name>
<INSDQualifier_value>protein</INSDQualifier_value> <INSDQualifier_value>protein</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
<INSDQualifier id="q6"> <INSDQualifier id="q6">
<INSDQualifier_name>organism</INSDQualifier_name> <INSDQualifier_name>organism</INSDQualifier_name>
<INSDQualifier_value>synthetic construct</INSDQualifier_value> <INSDQualifier_value>synthetic construct</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
</INSDFeature_quals> </INSDFeature_quals>
</INSDFeature> </INSDFeature>
</INSDSeq_feature-table> </INSDSeq_feature-table>
<INSDSeq_sequence>VEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRK <INSDSeq_sequence>VEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRK
RISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLP
DDFTGCVIAWNSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSKPCNGVEGFNCYFPLQSYGDDFTGCVIAWNSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSKPCNGVEGFNCYFPLQSYG
FQPTNGVGYQPYRVVVHHHHHHHHHH</INSDSeq_sequence>FQPTNGVGYQPYRVVVHHHHHHHHHH</INSDSeq_sequence>
</INSDSeq> </INSDSeq>
</SequenceData> </SequenceData>
</ST26SequenceListing></ST26SequenceListing>
<---<---
Claims (14)
Publications (1)
| Publication Number | Publication Date |
|---|---|
| RU2816175C1 true RU2816175C1 (en) | 2024-03-26 |
Family
ID=
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2752858C1 (en) * | 2021-02-04 | 2021-08-11 | Федеральное бюджетное учреждение науки "Государственный научный центр вирусологии и биотехнологии "Вектор" Федеральной службы по надзору в сфере защиты прав потребителей и благополучия человека (ФБУН ГНЦ ВБ "Вектор" Роспотребнадзора) | Integrative plasmid vector pveal2-s-rbd, providing the expression and secretion of the recombinant receptor-binding domain (rbd) of the sars-cov-2 coronavirus in mammalian cells, the recombinant cho-k1-rbd cell line strain and the recombinant sars-cov-2 rbd protein produced by the specified strain of the cell line cho-k1-rbd |
| WO2022045935A1 (en) * | 2020-08-28 | 2022-03-03 | Joint Stock Company "Biocad" | Aav5-based vaccine against sars-cov-2 |
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022045935A1 (en) * | 2020-08-28 | 2022-03-03 | Joint Stock Company "Biocad" | Aav5-based vaccine against sars-cov-2 |
| RU2752858C1 (en) * | 2021-02-04 | 2021-08-11 | Федеральное бюджетное учреждение науки "Государственный научный центр вирусологии и биотехнологии "Вектор" Федеральной службы по надзору в сфере защиты прав потребителей и благополучия человека (ФБУН ГНЦ ВБ "Вектор" Роспотребнадзора) | Integrative plasmid vector pveal2-s-rbd, providing the expression and secretion of the recombinant receptor-binding domain (rbd) of the sars-cov-2 coronavirus in mammalian cells, the recombinant cho-k1-rbd cell line strain and the recombinant sars-cov-2 rbd protein produced by the specified strain of the cell line cho-k1-rbd |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7362819B2 (en) | Stabilized soluble prefusion RSV F protein | |
| WO2022218272A1 (en) | Novel coronavirus mutant strain s protein and novel coronavirus mutant strain subunit vaccine | |
| AU2018249533C1 (en) | Self-assembling protein nanostructures displaying paramyxovirus and/or pneumovirus f proteins and their use | |
| CN102481359B (en) | Restructuring RSV antigen | |
| CA2627105A1 (en) | Influenza combinatorial antigen vaccine | |
| EP2614072A2 (en) | Human cytomegalovirus vaccine | |
| CA2673373A1 (en) | Rsv f-protein and its use | |
| Du et al. | Antigenicity and immunogenicity of SARS-CoV S protein receptor-binding domain stably expressed in CHO cells | |
| US20170119874A1 (en) | Human cytomegalovirus vaccine compositions and method of producing the same | |
| US20150344529A1 (en) | Vaccine for hpv infection and/or hepatitis b comprising hpv/hbs chimeric protein as active ingredient | |
| KR101832610B1 (en) | Soluble recombinant antigen protein of porcine epidemic diarrhea virus and vaccine composition for preventing or treating porcine epidemic diarrhea comprising the same | |
| RU2816175C1 (en) | INTEGRATIVE PLASMID VECTOR pVEAL3-RBDdel, PROVIDING SYNTHESIS AND SECRETION OF RECOMBINANT PROTEIN OF RECEPTOR-BINDING DOMAIN RBDdelta OF CORONAVIRUS SARS-CoV-2 IN MAMMALIAN CELLS, RECOMBINANT CELL LINE STRAIN CHO-K1-RBDdelta AND RECOMBINANT PROTEIN RBDdelta SARS-CoV-2 PRODUCED BY CELL LINE STRAIN | |
| US20240009294A1 (en) | HPV Therapeutic Nucleic Acid Vaccine | |
| KR20150036685A (en) | Attenuated swine influenza vaccines and methods of making and use thereof | |
| TW202206598A (en) | A vaccine against sars-cov-2 and preparation thereof | |
| CN115073565B (en) | Recombinant novel coronavirus S protein trimer and preparation method and application thereof | |
| CN108503697B (en) | Zika virus subunit vaccine expressed by drosophila cells | |
| CN109851678A (en) | A kind of inferior stable state bovine respiratory syncytial virus of improvement merges DNA molecular and its application of precursor F protein matter and coding | |
| CN116240222A (en) | Codon-optimized bovine viral diarrhea virus type 1E2 protein gene and application thereof | |
| CN117003885A (en) | Development and application of H5N8 avian influenza broad-spectrum vaccine | |
| CN107746848B (en) | Recombinant classical swine fever virus E2 protein and expression cell line, preparation method, application and classical swine fever virus subunit vaccine thereof | |
| JP2023519837A (en) | Vaccine composition for treating coronavirus | |
| Villarraza et al. | A COVID-19 vaccine candidate based on SARS-CoV-2 spike protein and immune-stimulating complexes | |
| CN114057846B (en) | Polypeptide and immunogenic conjugate for preventing novel coronavirus infection COVID-19 and application thereof | |
| AU2022202787B2 (en) | Self-assembling protein nanostructures displaying paramyxovirus and/or pneumovirus F proteins and their use |