RU2786706C2 - Composition based on hybrid recombinant polypeptide for protecting plants from diseases caused by oomycetes - Google Patents
Composition based on hybrid recombinant polypeptide for protecting plants from diseases caused by oomycetes Download PDFInfo
- Publication number
- RU2786706C2 RU2786706C2 RU2021117089A RU2021117089A RU2786706C2 RU 2786706 C2 RU2786706 C2 RU 2786706C2 RU 2021117089 A RU2021117089 A RU 2021117089A RU 2021117089 A RU2021117089 A RU 2021117089A RU 2786706 C2 RU2786706 C2 RU 2786706C2
- Authority
- RU
- Russia
- Prior art keywords
- protein
- oomycetes
- nsd2
- plant
- trx
- Prior art date
Links
- 230000002633 protecting Effects 0.000 title claims abstract description 9
- 241000233654 Oomycetes Species 0.000 title abstract description 16
- 201000010099 disease Diseases 0.000 title abstract description 9
- 239000000203 mixture Substances 0.000 title description 7
- 229920001184 polypeptide Polymers 0.000 title description 5
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 26
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 26
- 108060002187 Def1 Proteins 0.000 claims abstract description 17
- 102000002933 thioredoxin family Human genes 0.000 claims abstract description 17
- 108060008226 thioredoxin family Proteins 0.000 claims abstract description 17
- 229940094937 Thioredoxin Drugs 0.000 claims abstract description 16
- 230000001580 bacterial Effects 0.000 claims abstract description 10
- 241000233622 Phytophthora infestans Species 0.000 claims abstract description 9
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract description 5
- 230000000855 fungicidal Effects 0.000 claims abstract description 4
- 244000038559 crop plants Species 0.000 claims 1
- 230000000694 effects Effects 0.000 abstract description 7
- 239000000126 substance Substances 0.000 abstract description 6
- 239000011814 protection agent Substances 0.000 abstract description 5
- 241000196324 Embryophyta Species 0.000 description 34
- 235000018102 proteins Nutrition 0.000 description 20
- 238000002360 preparation method Methods 0.000 description 12
- 240000005871 Nigella sativa Species 0.000 description 10
- 241000233614 Phytophthora Species 0.000 description 10
- 240000001016 Solanum tuberosum Species 0.000 description 10
- 230000003032 phytopathogenic Effects 0.000 description 10
- 239000000725 suspension Substances 0.000 description 10
- 235000016698 Nigella sativa Nutrition 0.000 description 9
- 235000002595 Solanum tuberosum Nutrition 0.000 description 9
- 230000000845 anti-microbial Effects 0.000 description 9
- 210000004027 cells Anatomy 0.000 description 9
- 101710004799 sm-amp-x Proteins 0.000 description 9
- 239000003814 drug Substances 0.000 description 8
- 229940079593 drugs Drugs 0.000 description 8
- 108020001507 fusion proteins Proteins 0.000 description 8
- 102000037240 fusion proteins Human genes 0.000 description 8
- 230000002401 inhibitory effect Effects 0.000 description 8
- 241000588724 Escherichia coli Species 0.000 description 7
- 241000233866 Fungi Species 0.000 description 7
- 102000000541 Defensins Human genes 0.000 description 6
- 108010002069 Defensins Proteins 0.000 description 6
- 239000002609 media Substances 0.000 description 6
- 239000003910 polypeptide antibiotic agent Substances 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 240000002436 Echinochloa crus-galli Species 0.000 description 5
- 238000000338 in vitro Methods 0.000 description 5
- 102000004196 processed proteins & peptides Human genes 0.000 description 5
- 108090000765 processed proteins & peptides Proteins 0.000 description 5
- RAXXELZNTBOGNW-UHFFFAOYSA-N Imidazole Chemical compound C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 4
- 241000233647 Phytophthora nicotianae var. parasitica Species 0.000 description 4
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 4
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 4
- 201000009910 diseases by infectious agent Diseases 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 241000894006 Bacteria Species 0.000 description 3
- 210000000170 Cell Membrane Anatomy 0.000 description 3
- 238000000034 method Methods 0.000 description 3
- 244000005700 microbiome Species 0.000 description 3
- 229910000403 monosodium phosphate Inorganic materials 0.000 description 3
- 235000019799 monosodium phosphate Nutrition 0.000 description 3
- 239000001711 nigella sativa Substances 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- AJPJDKMHJJGVTQ-UHFFFAOYSA-M sodium dihydrogen phosphate Chemical compound [Na+].OP(O)([O-])=O AJPJDKMHJJGVTQ-UHFFFAOYSA-M 0.000 description 3
- 238000005507 spraying Methods 0.000 description 3
- 239000002028 Biomass Substances 0.000 description 2
- 229940095731 Candida albicans Drugs 0.000 description 2
- 241000222122 Candida albicans Species 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 241000223221 Fusarium oxysporum Species 0.000 description 2
- 241000427940 Fusarium solani Species 0.000 description 2
- 244000043158 Lens esculenta Species 0.000 description 2
- 229920001850 Nucleic acid sequence Polymers 0.000 description 2
- 235000011999 Panicum crusgalli Nutrition 0.000 description 2
- 240000006694 Stellaria media Species 0.000 description 2
- 240000001949 Taraxacum officinale Species 0.000 description 2
- 238000000540 analysis of variance Methods 0.000 description 2
- 230000000843 anti-fungal Effects 0.000 description 2
- UIIMBOGNXHQVGW-UHFFFAOYSA-M buffer Substances [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 108091006028 chimera Proteins 0.000 description 2
- 235000009242 dandelion Nutrition 0.000 description 2
- 239000000706 filtrate Substances 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 230000001408 fungistatic Effects 0.000 description 2
- 230000002068 genetic Effects 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 239000000411 inducer Substances 0.000 description 2
- 238000011081 inoculation Methods 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl β-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 2
- 239000006166 lysate Substances 0.000 description 2
- 239000012139 lysis buffer Substances 0.000 description 2
- 230000001717 pathogenic Effects 0.000 description 2
- 244000052769 pathogens Species 0.000 description 2
- 238000010149 post-hoc-test Methods 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 230000001681 protective Effects 0.000 description 2
- 210000001938 protoplasts Anatomy 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- UDMBCSSLTHHNCD-KQYNXXCUSA-N Adenosine monophosphate Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@H]1O UDMBCSSLTHHNCD-KQYNXXCUSA-N 0.000 description 1
- 229950006790 Adenosine phosphate Drugs 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 108010037365 Arabidopsis Proteins Proteins 0.000 description 1
- 241000228197 Aspergillus flavus Species 0.000 description 1
- 241001225321 Aspergillus fumigatus Species 0.000 description 1
- 229940091771 Aspergillus fumigatus Drugs 0.000 description 1
- 241000222178 Candida tropicalis Species 0.000 description 1
- 229920002101 Chitin Polymers 0.000 description 1
- DJHJJVWPFGHIPH-OODMECLYSA-N Chitin Chemical compound O[C@@H]1C(NC(=O)C)[C@H](O)OC(CO)[C@H]1COC[C@H]1C(NC(C)=O)[C@@H](O)[C@H](COC[C@H]2C([C@@H](O)[C@H](O)C(CO)O2)NC(C)=O)C(CO)O1 DJHJJVWPFGHIPH-OODMECLYSA-N 0.000 description 1
- 108010049994 Chloroplast Proteins Proteins 0.000 description 1
- 241001529387 Colletotrichum gloeosporioides Species 0.000 description 1
- 235000019750 Crude protein Nutrition 0.000 description 1
- 101700011961 DPOM Proteins 0.000 description 1
- 241000192484 Diutina catenulata Species 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 241000221778 Fusarium fujikuroi Species 0.000 description 1
- 241000223195 Fusarium graminearum Species 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 235000014647 Lens culinaris subsp culinaris Nutrition 0.000 description 1
- 235000010666 Lens esculenta Nutrition 0.000 description 1
- 240000000389 Leymus arenarius Species 0.000 description 1
- 235000015892 Leymus arenarius Nutrition 0.000 description 1
- 101710029649 MDV043 Proteins 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 229920000272 Oligonucleotide Polymers 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- 101700082982 PAT0 Proteins 0.000 description 1
- 101700061424 POLB Proteins 0.000 description 1
- 241000233645 Phytophthora nicotianae Species 0.000 description 1
- 241000235645 Pichia kudriavzevii Species 0.000 description 1
- 101700054624 RF1 Proteins 0.000 description 1
- 102000007312 Recombinant Proteins Human genes 0.000 description 1
- 108010033725 Recombinant Proteins Proteins 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 101700074864 TDX Proteins 0.000 description 1
- 235000006754 Taraxacum officinale Nutrition 0.000 description 1
- 241000223260 Trichoderma harzianum Species 0.000 description 1
- 241000223261 Trichoderma viride Species 0.000 description 1
- 241001672648 Vieira Species 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 238000007792 addition Methods 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 235000001014 amino acid Nutrition 0.000 description 1
- 150000001413 amino acids Chemical class 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- 230000001488 breeding Effects 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 235000013339 cereals Nutrition 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 238000007906 compression Methods 0.000 description 1
- 235000014079 dandelion Nutrition 0.000 description 1
- 230000004059 degradation Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000001687 destabilization Effects 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N edta Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 230000002900 effect on cell Effects 0.000 description 1
- 239000012149 elution buffer Substances 0.000 description 1
- 238000000855 fermentation Methods 0.000 description 1
- 230000004151 fermentation Effects 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- 230000002538 fungal Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 239000002054 inoculum Substances 0.000 description 1
- 108010053156 lipid transfer protein Proteins 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 230000004660 morphological change Effects 0.000 description 1
- 230000001338 necrotic Effects 0.000 description 1
- 230000031787 nutrient reservoir activity Effects 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 239000006877 oatmeal agar Substances 0.000 description 1
- 238000000399 optical microscopy Methods 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 239000004476 plant protection product Substances 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 230000002797 proteolythic Effects 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000011506 response to oxidative stress Effects 0.000 description 1
- 108091007521 restriction endonucleases Proteins 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 235000011008 sodium phosphates Nutrition 0.000 description 1
- 239000002689 soil Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 230000004936 stimulating Effects 0.000 description 1
- 238000004381 surface treatment Methods 0.000 description 1
- 230000002195 synergetic Effects 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- 230000017613 viral reproduction Effects 0.000 description 1
- 230000003612 virological Effects 0.000 description 1
- 230000001018 virulence Effects 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Images
Abstract
Description
Изобретение относится к области биотехнологии и защиты растений и направлено на разработку средства биологической защиты растений против специфических болезней, вызываемых спектром грибоподобных микроорганизмов оомицетов. Предложены композиция и способ защиты культурных растений от поражения фитопатогенными оомицетами с применением рекомбинантного полипептида, основой функциональной активности которого является взаимодействие с оболочкой клеток-мишеней с последующей интеграцией в клеточную мембрану и ее разрушением (контактный тип действия).The invention relates to the field of biotechnology and plant protection and is directed to the development of a biological plant protection agent against specific diseases caused by a spectrum of fungi-like microorganisms of oomycetes. A composition and a method for protecting cultivated plants from damage by phytopathogenic oomycetes using a recombinant polypeptide, the basis of the functional activity of which is the interaction with the shell of target cells, followed by integration into the cell membrane and its destruction (contact type of action), is proposed.
Постоянно растущее население Земли и сокращающийся фонд сельскохозяйственных пахотных земель стимулируют исследования, направленные на повышение эффективности сельского хозяйства. Урожай и качество сельскохозяйственных культур зависят не только от погодных условий, места выращивания и качества семенного материала, но также от степени заражения различными патогенами, которые наносят значительный ущерб растениеводству, снижая урожайность, качество и срок хранения сельскохозяйственной продукции.The ever-growing population of the Earth and the declining stock of agricultural arable land are stimulating research aimed at improving the efficiency of agriculture. The yield and quality of agricultural crops depend not only on weather conditions, the place of cultivation and the quality of the seed material, but also on the degree of infection with various pathogens that cause significant damage to crop production, reducing the yield, quality and shelf life of agricultural products.
Наряду с подходами генетики и селекции, которые позволяют создавать культуры, характеризующиеся различными улучшенными агротехническими признаками, в том числе и устойчивостью к патогенам, актуальной остается разработка экологически чистых средств защиты растений, которые используют подходы, основанные на естественных механизмах иммунитета растений.Along with the approaches of genetics and breeding, which allow the creation of crops characterized by various improved agrotechnical traits, including resistance to pathogens, the development of environmentally friendly plant protection products that use approaches based on the natural mechanisms of plant immunity remains relevant.
Задача настоящего изобретения состояла в разработке технически простого средства защиты культурных растений на основе антимикробного полипептида, обеспечивающего ингибирование развитие фитопатогенных оомицетов на поверхности растения. Действующее вещество по изобретению представляет из себя рекомбинантный гибридный белок, состоящий из двух компонентов - бактериального тиоредоксина и растительного антимикробного пептида из структурного семейства дефензинов. Препарат может применяться для обработки растений путем опрыскивания их наземной биомассы с целью защиты сельскохозяйственных культур от заражения болезнями, вызываемыми оомицетами.The objective of the present invention was to develop a technically simple means of protecting cultivated plants based on an antimicrobial polypeptide that inhibits the development of phytopathogenic oomycetes on the plant surface. The active substance according to the invention is a recombinant hybrid protein consisting of two components - a bacterial thioredoxin and a plant antimicrobial peptide from the structural family of defensins. The product can be used to treat plants by spraying their ground biomass in order to protect crops from infection with diseases caused by oomycetes.
Антимикробные пептиды (АМП) растительного происхождения представляют собой эффективные агенты, обладающие прямым ингибирующим действием по отношению к широкому спектру фитопатогенным микроорганизмов, преимущественно эукариотам (мицелиальным грибам) (Srivastava et al., 2020). Первые публикации по наличию антимикробных свойств у пептидов растений датируются началом 1990х гг. (Terras et al., 1992, 1995). Оомицеты как группа, включающая в себя целый ряд видов, вызывающих экономически значимые (в том числе носящие характер эпифитотий) болезни сельскохозяйственных культур, в плане восприимчивости/устойчивости к природным АМП растений исследованы достаточно фрагментарно. Так, было установлено подавляющее влияние на Phytophthora infestans дефензинов семян ряда дикорастущих и культурных злаковых и двудольных растений: ежовник обыкновенный (Echinochloa crusgalli), звездчатка средняя (Stellariamedia), картофель (Solanum tuberosum), колосняк песчаный {Leymus arenarius) (Odintsova et al., 2008; Slavokhotova et al., 2011; Bartova et al, 2019) в тестах in vitro; установлено фунгицидное и фунгистатическое действие на данный оомицет представителей некоторых других структурных групп (липид-переносящие белки, харпино-подобные пептиды, гевеино-подобные пептиды) (Odintsova et al., 2009; Уткина и др., 2010; Rogozhin et al., 2012, 2015; Ryazantsev et al., 2014, 2019). Кроме того, установлено защитное действие некоторых запасных белков семян одуванчика лекарственного (Taraxacum officinale), клубней картофеля (Solanum tuberosum) (Sharma et al., 2004; Odintsova et al., 2010), а также фрагментов ограниченного протеолиза некоторых хлоропластных белков (Rogozhin et al., 2020). Из уровня техники известны генетические конструкции для экспрессии в Escherichiacoli рекомбинантного дефензина чечевицы (Lens culinaris), обладающего ингибирующим действием на ряд фитопатогенных мицелиальных грибов (RU 2456345).Antimicrobial peptides (AMPs) of plant origin are effective agents that have a direct inhibitory effect on a wide range of phytopathogenic microorganisms, mainly eukaryotes (filamentous fungi) (Srivastava et al., 2020). The first publications on the presence of antimicrobial properties in plant peptides date back to the early 1990s. (Terras et al., 1992, 1995). Oomycetes as a group that includes a number of species that cause economically significant (including epiphytotic) diseases of agricultural crops, in terms of susceptibility/resistance to natural plant AMPs, have been studied rather fragmentarily. Thus, the overwhelming effect on Phytophthora infestans of seed defensins of a number of wild and cultivated cereals and dicotyledonous plants was established: common barnyard grass (Echinochloa crusgalli), medium chickweed (Stellariamedia), potato (Solanum tuberosum), sandy grate {Leymus arenarius) (Odintsova et al. , 2008; Slavokhotova et al., 2011; Bartova et al., 2019) in in vitro tests; the fungicidal and fungistatic effect on this oomycete of representatives of some other structural groups (lipid-transfer proteins, harpin-like peptides, hevein-like peptides) was established (Odintsova et al., 2009; Utkina et al., 2010; Rogozhin et al., 2012 , 2015; Ryazantsev et al., 2014, 2019). In addition, the protective effect of some storage proteins of dandelion seeds (Taraxacum officinale), potato tubers (Solanum tuberosum) (Sharma et al., 2004; Odintsova et al., 2010), as well as fragments of limited proteolysis of some chloroplast proteins (Rogozhin et al., 2020). The prior art genetic constructs for expression in Escherichia coli recombinant lentil defensin (Lens culinaris), which has an inhibitory effect on a number of phytopathogenic filamentous fungi (RU 2456345).
Также существуют сведения об активности тиоредоксинов растений против группы фитопатогенных грибов. Белок арабидопсиса AtTrx-h5 проявляет активность против Aspergillus flavus (КСТС 6905), Aspergillus fumigatus (KCTC 6145), Fusarium moniliforme (KCTC 6149), F. solani (KCTC 6326), Phytophthora nicotianae (KCTC 40164), Trichoderma harzianum (KCTC 6043), Trichoderma viride (KCTC 6047), Candida albicans (KCTC 7270), Candida catenulate (KCTC 7642), Candida tropicalis (KCTC 7221) (Pari et al., 2017). Белок риса OsTDX показал активность против грибов и дрожжей (Candida albicans, Candida krusei, или Colletotrichum gloeosporioides, Fusarium graminearum, F. oxysporum, F. solani) (Park et al., 2019). Предположительный механизм их действия основан на дестабилизации клеточной мембраны. Также есть данные о том, что тиоредоксин растений является ключевым элементом ответа на окислительный стресс (Vieira Dos Santos et al., 2006). Единственным примером антифунгальной активности по отношению к мицелиальным фитопатогенным грибам является упоминание о действии гибридного рекомбинантного белка, содержащего тиоредоксин и фунгистатическийгевеино-подобный пептид WAMP-3 с хитин-связывающим доменом по отношению к мицелиальным формам Fusarium oxysporum и Bipolar is sorokiniana (Истомина и др., 2017).There is also information about the activity of plant thioredoxins against a group of phytopathogenic fungi. Arabidopsis protein AtTrx-h5 is active against Aspergillus flavus (KCTC 6905), Aspergillus fumigatus (KCTC 6145), Fusarium moniliforme (KCTC 6149), F. solani (KCTC 6326), Phytophthora nicotianae (KCTC 40164), Trichoderma harzianum (KCTC 6043) , Trichoderma viride (KCTC 6047), Candida albicans (KCTC 7270), Candida catenulate (KCTC 7642), Candida tropicalis (KCTC 7221) (Pari et al., 2017). Rice protein OsTDX has shown activity against fungi and yeasts (Candida albicans, Candida krusei, or Colletotrichum gloeosporioides, Fusarium graminearum, F. oxysporum, F. solani) (Park et al., 2019). The proposed mechanism of their action is based on the destabilization of the cell membrane. There is also evidence that plant thioredoxin is a key element in the response to oxidative stress (Vieira Dos Santos et al., 2006). The only example of antifungal activity in relation to filamentous phytopathogenic fungi is the mention of the action of a hybrid recombinant protein containing thioredoxin and fungistatic hevein-like peptide WAMP-3 with a chitin-binding domain in relation to mycelial forms of Fusarium oxysporum and Bipolar is sorokiniana (Istomina et al., 2017).
В соответствии с заявленным изобретением получена препаративная форма, включающая в себя основное действующее вещество - рекомбинантный гибридный белок, состоящий из двух компонентов - бактериального тиоредоксина, который обеспечивает корректное сворачивание молекулы в пространстве и замыкание дисульфидных связей, и растительного антимикробного пептида из структурного семейства дефензинов, определяющего непосредственно мембрано-активный эффект. Авторы изобретения обнаружили, что данное соединение обладает высокой эффективностью в отношении фитопатогенных оомицетов и может быть использовано для контактной обработки сельскохозяйственных растений с целью их защиты от фитофтороза, вызываемого Phytophthora infestans. В уровне техники отсутствуют публикации о применении рекомбинантных гибридных белков, содержащих тиоредоксин бактериального происхождения и растительный антимикробный пептид группы дефензинов как средства защиты растений от фитопатогенных микроорганизмов, таких как бактерии, грибы, оомицеты. Известные документы относятся к ингибирующему действию отдельно используемых природных и/или рекомбинантных растительных пептидов против фитопатогенных грибов и оомицетов. Ранее был раскрыт ингибирующий эффект одного из двух компонентов заявляемого действующего вещества - природного дефензина№02 семян нигеллы посевной (Nigella sativa L.) по отношению к оомицету Phythophthora infestans (Mont.) deBary в лабораторных условиях (Rogozhin Е.А., Oshchepkova Y.I., Odintsova Т. I., Khadeeva N.V., Veshkurova O.N., Egorov T.A., Grishin E.V., Salikhov S.I.Novel antifungal defensins from Nigella sativa L. seeds. // Plant Physiol Biochem., 2011, V. 49 (2), P. 131-137).In accordance with the claimed invention, a preparative form has been obtained, which includes the main active ingredient - a recombinant hybrid protein, consisting of two components - bacterial thioredoxin, which ensures the correct folding of the molecule in space and the closure of disulfide bonds, and a plant antimicrobial peptide from the structural family of defensins, which determines direct membrane-active effect. The inventors have found that this compound is highly effective against phytopathogenic oomycetes and can be used for contact treatment of agricultural plants in order to protect them from late blight caused by Phytophthora infestans. There are no publications in the prior art on the use of recombinant hybrid proteins containing thioredoxin of bacterial origin and a plant antimicrobial peptide of the defensins group as a plant protection agent against phytopathogenic microorganisms such as bacteria, fungi, oomycetes. Known documents refer to the inhibitory effect of separately used natural and/or recombinant plant peptides against phytopathogenic fungi and oomycetes. Previously, the inhibitory effect of one of the two components of the claimed active substance - natural defensin No. 02 of the seeds of Nigella sativa L. was disclosed in relation to the oomycete Phythophthora infestans (Mont.) deBary in laboratory conditions (Rogozhin E.A., Oshchepkova Y.I., Odintsova T. I., Khadeeva N. V., Veshkurova O. N., Egorov T. A., Grishin E. V., Salikhov S. I. Novel antifungal defensins from Nigella sativa L. seeds // Plant Physiol Biochem., 2011, V. 49 (2), P. 131- 137).
В качестве основного компонента для нового средства защиты растений авторы изобретения предлагают использовать антимикробный пептид дефензин, ассоциированый в составе химерной конструкции с оригинальным белком Е. coli - тиоредоксином, способствующим, в частности, правильному процессу фолдирования пептидной части. SEQ ID NO: 1 описывает аминокислотную последовательность химерного белка trx-NsD2:As the main component for a new plant protection agent, the authors of the invention propose to use the antimicrobial peptide defensin, which is associated as part of a chimeric construct with the original E. coli protein - thioredoxin, which contributes, in particular, to the correct process of folding the peptide part. SEQ ID NO: 1 describes the amino acid sequence of the trx-NsD2 chimeric protein:
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAK LDIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHH HHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTMKFCEKPSGTWSGVCQNSGACKDQCIRLE GAKHGSCNYKLPAHRCICYYECMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAK LDIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHH HHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTMKFCEKPSGTWSGVCQNSGACKDQCIRLE GAKHGSCNYECKLPAHRCICYY
Полипептид может быть получен с использованием биотехнологических подходов. В частности, возможного получения в прокариотической системе гетерологичной экспрессии в виде препарата гибридного белка, включающего тиоредоксин и растительный антимикробный пептид из семейства дефензинов NsD2. Эффективность синтезированного препарата была подтверждена в опытах in vitro и вегетационных экспериментах на растениях картофеля. Экспериментально продемонстрирован синергический эффект дефензина и бактериального тиредоксина: гибридный белок значительно превосходит по эффективности отдельно взятые препараты дефензина и тиоредоксина, что является новым техническим результатом. Данный препарат является биологическим средством защиты растений и, в отличие от химических средств не опасен для млекопитающих, насекомых и других групп организмов.The polypeptide can be obtained using biotechnological approaches. In particular, the possibility of obtaining heterologous expression in a prokaryotic system in the form of a hybrid protein preparation, including thioredoxin and a plant antimicrobial peptide from the NsD2 defensin family. The effectiveness of the synthesized drug was confirmed in experiments in vitro and vegetation experiments on potato plants. The synergistic effect of defensin and bacterial thioredoxin has been experimentally demonstrated: the hybrid protein is significantly superior in efficiency to individual preparations of defensin and thioredoxin, which is a new technical result. This preparation is a biological plant protection agent and, unlike chemical agents, is not dangerous for mammals, insects and other groups of organisms.
Описание чертежейDescription of drawings
Фигура 1. Аминокислотная последовательность рекомбинантного гибридного белка trx-NsD2.Figure 1. Amino acid sequence of the recombinant trx-NsD2 fusion protein.
Фигура 2. Профиль очистки рекомбинантного гибридного белка trx-NsD2 из препаративной формы. Целевой пик отмечен черной звездочкой.Figure 2. Purification profile of the recombinant trx-NsD2 fusion protein from the formulation. The target peak is marked with a black asterisk.
Фигура 3. Антимикробная активность рекомбинантного гибридного белка trx-NsD2 по отношению к оомицету Phytophthorainfestansnocne инкубации суспензии зооспорангиев с препаратами в течение 4 часов при температуре 4°С (влияние на клеточные структуры): TRX-тиоредоксин; NsD2 - рекомбинантный дефензин семян черного тмина (Nigella sativa); trx-NsD2 рекомбинантный гибридный белок. Концентрация по вариантам - 10 мкМ. Данные представлены в виде средних значений 2 биологических повторностей (±SE). Значимые отличия между контролем и вариантами обозначены * (р<0,05) (ANOVA withTukey's HSD post-hoctest).Figure 3. Antimicrobial activity of the recombinant fusion protein trx-NsD2 in relation to the oomycete Phytophthorainfestansnocne of incubation of a suspension of zoosporangia with drugs for 4 hours at a temperature of 4°C (effect on cell structures): TRX-thioredoxin; NsD2 - recombinant black cumin seed defensin (Nigella sativa); trx-NsD2 recombinant fusion protein. The concentration according to the variants is 10 μM. Data are presented as means of 2 biological replicates (±SE). Significant differences between control and variants are indicated by * (p<0.05) (ANOVA withTukey's HSD post-hoctest).
Фигура 4. Антимикробная активность рекомбинантного гибридного белка trx-NsD2 по отношению к оомицету Phytophthora infestans на 6 день после инфицирования (дпи) суспензией фитофторы, предварительно инкубированной 4 часа при 4°С совместно с препаратами (оценка площади поражения отделенных листьев картофеля): TRX-тиоредоксин; NsD2 - рекомбинантный дефензин семян черного тмина (N. sativa); trx-NsD2 рекомбинантный гибридный белок. Концентрация по вариантам - 10 мкМ. Данные представлены в виде средних значений 2 биологических повторностей (±SE). Значимые отличия между контролем и вариантами обозначены * (р<0,05) (ANOVA withTukey's HSD post-hoctest).Figure 4. Antimicrobial activity of the recombinant fusion protein trx-NsD2 against the oomycete Phytophthora infestans on the 6th day after infection (dpi) with a phytophthora suspension previously incubated for 4 hours at 4°C together with drugs (assessment of the affected area of separated potato leaves): TRX- thioredoxin; NsD2 - recombinant black cumin (N. sativa) seed defensin; trx-NsD2 recombinant fusion protein. The concentration according to the variants is 10 μM. Data are presented as means of 2 biological replicates (±SE). Significant differences between control and variants are indicated by * (p<0.05) (ANOVA withTukey's HSD post-hoctest).
Осуществление изобретенияImplementation of the invention
В заявленном изобретении предложен гибридный белок trx-NsD2 и содержащая его препаративная форма для поверхностной обработки сельскохозяйственных растений с целью защиты от болезней, вызываемых фитопатогенными оомицетами. Препаративная форма включает: рекомбинантный гибридный белок, в составе которого последовательно расположены аминокислотные последовательности, кодирующие бактериальный тиоредоксин и антимикробный пептид (дефензин); расчетная чистота действующего вещества должна составлять не менее 95% (по ВЭЖХ); расчетная чистота препаративной формы должна составлять не менее 75% (по ВЭЖХ). Опыты показали, что фунгицидной активностью обладает также неочищенный белок, содержащийся в бактериальном лизате (см. пример 3). Для эффективного действия предложенного препарата достаточно привести его в контакт с поверхностью листа растения посредством опрыскивания с помощью автоматического или ручного опрыскивания, что обеспечивает прямой контакт препарата с надземной поверхностью растений. Удерживание препарата на надземной поверхности растений обеспечивает ингибирование развития оомицетов на растении в течение не менее 10 дней после обработки препаратом. Приведенные примеры иллюстрируют возможные варианты получения препарата, а также демонстрируют сравнительную эффективность препаратов дефензина, тиоредоксина и гибридного белка по изобретению.The claimed invention proposes a hybrid protein trx-NsD2 and a preparative form containing it for the surface treatment of agricultural plants in order to protect against diseases caused by phytopathogenic oomycetes. The preparative form includes: a recombinant hybrid protein, which contains sequentially located amino acid sequences encoding bacterial thioredoxin and antimicrobial peptide (defensin); the calculated purity of the active substance must be at least 95% (according to HPLC); the calculated purity of the formulation should be at least 75% (by HPLC). Experiments have shown that the crude protein contained in the bacterial lysate also has fungicidal activity (see example 3). For the effective action of the proposed drug, it is enough to bring it into contact with the surface of the plant leaf by spraying using automatic or manual spraying, which ensures direct contact of the drug with the above-ground surface of the plants. Retention of the drug on the aerial surface of plants provides inhibition of the development of oomycetes on the plant for at least 10 days after treatment with the drug. The given examples illustrate possible options for obtaining the drug, and also demonstrate the comparative effectiveness of defensin, thioredoxin and hybrid protein preparations according to the invention.
Пример 1. Получение штамма-продуцента рекомбинантного гибридного белка контактного действия trx-NsD2.Example 1. Obtaining strain-producer of recombinant hybrid protein of contact action trx-NsD2.
Нуклеотидная последовательность, кодирующая целевой белок, была получена из аминокислотной методом обратной трансляции с использованием таблицы частоты использования кодонов для Е. coli, на 5'-конец полученных последовательностей сайт узнавания эндонуклеазы рестрикции KpnI и кодон ATG, кодирующий метионин, на 3'-конце - стоп-кодон и сайт узнавания эндонуклеазы рестрикции Hindlll. Фрагмент, кодирующий целевой полипептид был собран из олигонуклеотидов (Евроген, Россия) с помощью высокоточной полимеразы PhusionHotStart II DNA Polymerase (ThermoFisher Scientific, США) и клонирован в вектор pJET12blunt (Invitrogen, США). После отбора клонов методом ПЦР и подтверждения идентичности последовательности нуклеотидов запланированной методом дидезоксисеквенирования (Евроген, Россия), фрагмент, кодирующий целевой АМП дефензинбыл переклонирован в вектор pET32b и в итоге была проведена трансформация клеток Е. coli штамма Origami. Дефензин был ассоциирован в составе химерной конструкции с оригинальным белком Е. coli - тиоредоксином, способствующим, в частности, правильному процессу фолдирования пептидной части.The nucleotide sequence encoding the target protein was obtained from the amino acid reverse translation method using the E. coli codon frequency table; stop codon and restriction endonuclease recognition site Hindll. The fragment encoding the target polypeptide was assembled from oligonucleotides (Evrogen, Russia) using high-precision PhusionHotStart II DNA Polymerase (ThermoFisher Scientific, USA) and cloned into the pJET12blunt vector (Invitrogen, USA). After selecting clones by PCR and confirming the identity of the nucleotide sequence planned by dideoxy sequencing (Evrogen, Russia), the fragment encoding the target AMP defensin was recloned into the pET32b vector and, as a result, E. coli cells of the Origami strain were transformed. Defensin was associated as part of a chimeric construct with the original E. coli protein, thioredoxin, which, in particular, contributes to the correct folding of the peptide part.
Пример 2. Получение очищенного рекомбинантного гибридного белка контактного действия trx-NsD2.Example 2. Obtaining a purified recombinant trx-NsD2 contact fusion protein.
Полученным штаммом Е. coli, несущим плазмиду, кодирующую гибридный белок trx-NsD2, была инокулирована среда LB. Полученной ночной культурой бактерий (50 мл) была инокулирована свежая среда LB (1 л), культура была подращена до OD600=0.6, после чего добавляли индуктор экспрессии (ИПТГ, до концентрации 1 мМ). После выращивания еще на протяжении 5 ч, клетки были собраны центрифугированием и лизированы буфером для лизиса в нативных условиях (50 mM дигидрофосфат натрия, 300 mM хлорид натрия, 10 m Мимдазол, рН 8.0). Для выделения гибридного белка осветленный лизат наносили на Ni-NTA агарозу, после промывки лизирующим и промывочным буферами (50 mM дигидрофосфат натрия, 300 mM хлорид натрия, 20 mM имидазол, рН 8.0), гибридный белок был элюирован элюирующим буфером (50 mМ дигидрофосфат натрия, 300 mM хлорид натрия, 250 mM имидазол, рН 8.0). В результате путем ферментации в колбах было наработано примерно по 7,5 г сырой массы бактериальных клеток и TRX-NS-D2. В дальнейшем все количество имеющихся клеток было лизировано посредством ультразвукового дезинтегратора, целевой белок очищен методом металл-аффинной хроматографии на Ni-NTA посредством взаимодействия поли-His-tag и обессолен путем обращенно-фазовой ВЭЖХ на полупрепаративной колонке Jupiter С5 10 × 250 мм 300 Анг (Phenomenex, США). Для структурного подтверждения данные фракции были визуализированы с помощью ДСН ПААГ ЭФ, а изначальные (до разделения) образцы проанализированы путем автоматической деградации по Эдману на приборе PPSQ-33A (Shimadzu Corp., Япония). В итоге было сделано заключение, что данные фракции представляют собой пространственные изомеры, что не повлияет на процесс дальнейшей работы с ними.The resulting strain of E. coli carrying the plasmid encoding the fusion protein trx-NsD2 was inoculated with LB medium. The resulting overnight culture of bacteria (50 ml) was inoculated with fresh LB medium (1 L), the culture was grown to OD600=0.6, after which the expression inducer (IPTG, to a concentration of 1 mM) was added. After growing for another 5 hours, the cells were harvested by centrifugation and lysed with native lysis buffer (50 mM sodium dihydrogen phosphate, 300 mM sodium chloride, 10 m Mimdazole, pH 8.0). To isolate the fusion protein, the clarified lysate was applied to Ni-NTA agarose, after washing with lysis and washing buffers (50 mM sodium dihydrogen phosphate, 300 mM sodium chloride, 20 mM imidazole, pH 8.0), the fusion protein was eluted with an elution buffer (50 mM sodium dihydrogen phosphate, 300 mM sodium chloride, 250 mM imidazole, pH 8.0). As a result, approximately 7.5 g wet weight of bacterial cells and TRX-NS-D2 were produced by fermentation in flasks. Subsequently, the entire number of available cells was lysed using an ultrasonic disintegrator, the target protein was purified by metal-affinity chromatography on Ni-NTA through the interaction of poly-His-tag and desalted by reverse-phase HPLC on a Jupiter C5
Пример 3. Получение препарата рекомбинантного гибридного белка контактного действия trx-NsD2.Example 3. Obtaining a preparation of a recombinant hybrid protein of contact action trx-NsD2.
Полученным штаммом Е. coli, несущим плазмиду, кодирующую гибридый белок (дефензин с тиоредоксином) была инокулирована среда LB. Полученной ночной культурой бактерий (50 мл) была инокулирована свежая среда LB (1 л), культура была подращена до OD600=0.6, после чего добавляли индуктор экспрессии (ИПТГ, до концентрации 1 мМ). Клетки выращивали на протяжении 5 ч. Клеточную массу дезентегрировали и ресуспендировали в буфере 200 мМ фосфат натрия рН 9 с добавлением 1 мМ ЭДТА (из расчета 25 мл буфера на 1 г биомассы). Затем суспензию инкубировали 1 ч при 60 градусов и отделяли клеточный дебрис от фильтрата. Фильтрат напрямую использовали для обработки растений.The resulting strain of E. coli carrying a plasmid encoding a hybrid protein (defensin with thioredoxin) was inoculated with LB medium. The resulting overnight culture of bacteria (50 ml) was inoculated with fresh LB medium (1 L), the culture was grown to OD600=0.6, after which the expression inducer (IPTG, to a concentration of 1 mM) was added. The cells were grown for 5 hours. The cell mass was disintegrated and resuspended in 200 mM sodium phosphate pH 9 buffer with the addition of 1 mM EDTA (based on 25 ml of buffer per 1 g of biomass). Then the suspension was incubated for 1 h at 60°C and the cell debris was separated from the filtrate. The filtrate was directly used for plant treatment.
Пример 4. Антимикробная активность рекомбинантногоExample 4 Antimicrobial activity of recombinant
гибридного белка trx-NsD2 по отношению к оомицету Pbytopbtborainfestans (влияние на клеточные структуры).hybrid protein trx-NsD2 in relation to the oomycete Pbytopbtborainfestans (influence on cell structures).
Тестирование антимикробной активности белка trx-NsD2 проводилось в условиях in vitro на высоко агрессивном штамме 161.1 из коллекции РГАУ-МСХА им. К.А. Тимирязева оомицета Phytophthora infestans, который обладает наиболее широким набором генов вирулентности среди изолятов, выделенных в Нечерноземной зоне РФ, и сохраняет свои свойства на протяжении ряда лет. Культуру фитофторы выращивали на агаризованной питательной среде (овсяный агар). Для подготовки инокулюма фитофторы использовали 2-недельную культуру фитофторы с хорошо развитым мицелием. Суспензию готовили путем смыва зооспорангиев с мицелия стерильной водой, с последующим пипетированием для отделения зооспорангиев от мицелия, подсчетом в микроскопе концентрации зрелых зооспорангиев и разведением суспензии до концентрации 2,5 - 5,0×104 зооспорангиев/мл. Тестирование проводили в 24-луночных культуральных стерильных плашках, где в каждую лунку вносили суспензию зооспорангиев фитофторы и растворы следующих препаратов: 1) TRX-тиоредоксин; 2) NsD2 -рекомбинантный дефензин семян черного тмина (Nigella sativa); 3) trx-NsD2 - рекомбинантный гибридный белок. Конечная концентрация вещества в растворе составляла не более 10 мкМ. На каждый вариант - по 6 лунок (6 повторностей). После тщательного перемешивания суспензии фитофторы с препаратами плашку помещали на инкубацию на 4 часа при температуре 4°С. После инкубации из каждой лунки отбирали аликвоту (по 30-4 0 мкл) для оптического микроскопирования в проходящем свете (увеличение 10х и 40х, ZEISS, Германия) и проводили оценку морфологических изменений развития зооспорангиев. В каждой повторности оценивали не менее 10-15 полей зрения микроскопа. Количество подсчитываемых зооспорангиев в каждом варианте - 500-600 шт. Эффект ингибирования культуры фитофторы препаратами контактного действия в условиях in vitro оценивали по количеству разрушенных зооспорангиев, в которых наблюдалось вытекание протопласта наружу из-за разрывов в оболочке клетки или сжатие протопласта внутри зооспорангия. Количество разрушенных зооспорангиев выражали в процентах от общего количества оцененных зооспорангиев. Эксперимент был проведен дважды. В результате было показано, что более 20% зооспорангиев фитофторы оказались разрушенными под действием рекомбинантного гибридного белка trx-NsD2, что в 6 раз больше, чем в контроле, а также в 5 раз и в 2 раза больше, чем в вариантах с TRX и NsD2 соответственно.Testing of the antimicrobial activity of the trx-NsD2 protein was carried out under in vitro conditions on a highly aggressive strain 161.1 from the collection of the Russian State Agrarian University-Moscow Agricultural Academy. K.A. Timiryazev oomycete Phytophthora infestans, which has the widest set of virulence genes among isolates isolated in the Non-Chernozem zone of the Russian Federation, and retains its properties for a number of years. Phytophthora culture was grown on agar nutrient medium (oatmeal agar). Phytophthora inoculum was prepared using a 2-week-old Phytophthora culture with a well-developed mycelium. The suspension was prepared by washing the zoosporangia from the mycelium with sterile water, followed by pipetting to separate the zoosporangia from the mycelium, counting the concentration of mature zoosporangia in a microscope, and diluting the suspension to a concentration of 2.5 - 5.0×10 4 zoosporangia/ml. Testing was carried out in 24-well sterile culture plates, where a suspension of phytophthora zoosporangia and solutions of the following preparations were added to each well: 1) TRX-thioredoxin; 2) NsD2 - recombinant black cumin seed defensin (Nigella sativa); 3) trx-NsD2 - recombinant hybrid protein. The final concentration of the substance in the solution was no more than 10 μM. For each option - 6 holes (6 repetitions). After thorough mixing of the phytophthora suspension with preparations, the plate was placed for incubation for 4 hours at a temperature of 4°C. After incubation, an aliquot (30-40 µl) was taken from each well for optical microscopy in transmitted light (10x and 40x magnification, ZEISS, Germany) and the morphological changes in the development of zoosporangia were assessed. In each repetition, at least 10-15 fields of view of the microscope were evaluated. The number of countable zoosporangia in each variant is 500-600 pcs. The effect of phytophthora culture inhibition by contact preparations under in vitro conditions was assessed by the number of destroyed zoosporangia, in which the protoplast leaked out due to ruptures in the cell membrane or protoplast compression inside the zoosporangium was observed. The number of destroyed zoosporangia was expressed as a percentage of the total number of assessed zoosporangia. The experiment was carried out twice. As a result, it was shown that more than 20% of phytophthora zoosporangia were destroyed under the action of the recombinant hybrid protein trx-NsD2, which is 6 times more than in the control, as well as 5 times and 2 times more than in the variants with TRX and NsD2 respectively.
Пример 5. Антимикробная активность рекомбинантного гибридного белка trx-NsD2 по отношению к оомицету Phytophthora infestans (оценка площади поражения листьев картофеля).Example 5 Antimicrobial activity of the recombinant trx-NsD2 fusion protein against the oomycete Phytophthora infestans (assessment of the affected area of potato leaves).
Тестирование антимикробной активности белка trx-NsD2 проводилось в условиях in vivo на листьях восприимчивого к фитофторозу сортообразца картофеля 12-12-8 (селекция ООО «Дока-Генные Технологии»). Растения сортообразца 12-12-8, предварительно прошедшие процедуру оздоровления от вирусных, бактериальных, грибковых заболеваний, поддерживались в культуре in vitro. Для проведения опытов пробирочные растения сортообразца 12-12-8 высаживали в почву и выращивали в контролируемых условиях до стадии 6-7 настоящих листьев. Для проведения тестирования хорошо развитые листья среднего яруса срезали с растения, помещали во влажный бокс и охлаждали при +11°С в течение 1 часа перед заражением. Для заражения листьев готовили смесь суспензии фитофторы (концентрации 2,5-5,0×104 зооспорангиев/мл) и препаратов (конечная концентрация - 10 мкМ): 1) TRX-тиоредоксин; 2) NsD2 рекомбинантный дефензин семян черного тмина (Nigella sativa); 3) trx-NsD2 - рекомбинантный гибридный белок. Смесь суспензии зооспорангиев и препаратов инкубировали в течение 4 часов при температуре 4°С, после чего ею инокулировали отделенные, предварительно охлажденные листья картофеля. Для этого на обратную сторону каждого листа с помощью атомайзера (пульверизатор объемом 5 мл) наносили по 50 мкл смеси зооспорангиев и препаратов. После инокуляции листья помещалив термостат во влажном боксе на 1 сутки при температуре +11°С, после чего их переносили в условия комнатной температуры до появления симптомов заболевания. Эффект ингибирования культуры фитофторы препаратами контактного действия в условиях in vivo оценивали по площади некротических пятен, которую выражали в процентах от общей площади поверхности листа. Учет развития болезни проводили на 6 день после инокуляции (дпи). На каждый вариант - по 18-20 листьев. Эксперимент был проведен дважды. В результате было показано значительное ингибирование развития фитофтороза на отделенных листьях картофеля, которые были заражены суспензией зооспорангиев фитофторы, предварительно инкубированной с рекомбинантным гибридным белком с trx-NsD2 4 часа при 4°С.The antimicrobial activity of the trx-NsD2 protein was tested under in vivo conditions on the leaves of potato variety 12-12-8 susceptible to late blight (selected by Doka-Gennye Tekhnologii LLC). Plants of variety 12-12-8, which had previously passed the procedure of recovery from viral, bacterial, fungal diseases, were maintained in culture in vitro. For experiments, test-tube plants of variety 12-12-8 were planted in the soil and grown under controlled conditions to the stage of 6-7 true leaves. For testing, well-developed leaves of the middle tier were cut from the plant, placed in a wet box and cooled at +11°C for 1 hour before infection. To infect the leaves, a mixture of phytophthora suspension (concentration 2.5-5.0×10 4 zoosporangia/ml) and preparations (final concentration - 10 μM) was prepared: 1) TRX-thioredoxin; 2) NsD2 recombinant black cumin seed defensin (Nigella sativa); 3) trx-NsD2 - recombinant hybrid protein. The mixture of suspension of zoosporangia and preparations was incubated for 4 hours at 4°C, after which it was inoculated with separated, pre-cooled potato leaves. To do this, 50 μl of a mixture of zoosporangia and preparations was applied to the reverse side of each leaf using an atomizer (spray bottle with a volume of 5 ml). After inoculation, the leaves were placed in a thermostat in a wet box for 1 day at a temperature of +11°C, after which they were transferred to room temperature until symptoms of the disease appeared. The effect of phytophthora culture inhibition by contact preparations under in vivo conditions was evaluated by the area of necrotic spots, which was expressed as a percentage of the total leaf surface area. The disease development was recorded on the 6th day after inoculation (DPI). For each option - 18-20 leaves. The experiment was carried out twice. As a result, a significant inhibition of the development of late blight on detached potato leaves, which were infected with a suspension of late blight zoosporangia, previously incubated with a recombinant hybrid protein with trx-NsD2 for 4 hours at 4°C, was shown.
Список литературы:Bibliography:
1. Srivastava S, Dashora K, Ameta KL, Singh NP, El-Enshasy HA, Pagano MC, Hesham AE, Sharma GD, Sharma M, Bhargava A. Cysteine-rich antimicrobial peptides from plants: The future of antimicrobial therapy. Phytother Res. 2020.1. Srivastava S, Dashora K, Ameta KL, Singh NP, El-Enshasy HA, Pagano MC, Hesham AE, Sharma GD, Sharma M, Bhargava A. Cysteine-rich antimicrobial peptides from plants: The future of antimicrobial therapy. Phytother Res. 2020.
2. Terras FR, Goderis I J, Van Leuven F, Vanderleyden J, Cammue BP, Broekaert WF. In Vitro Antifungal Activity of a Radish (Raphanus sativus L.)Seed Protein Homologous to Nonspecific Lipid Transfer Proteins. Plant Physiol. 1992. 100(2): 1055-8.2. Terras FR, Goderis I J, Van Leuven F, Vanderleyden J, Cammue BP, Broekaert WF. In Vitro Antifungal Activity of a Radish (Raphanus sativus L.)Seed Protein Homologous to Nonspecific Lipid Transfer Proteins. Plant Physiol. 1992. 100(2): 1055-8.
3. Terras FR, Eggermont K, Kovaleva V, Raikhel NV, Osborn RW, Kester A, Rees SB, Torrekens S, Van Leuven F, Vanderleyden J, et al. Small cysteine-rich antifungal proteins from radish: their role in host defense. Plant Cell. 1995, 7(5):573-88.3. Terras FR, Eggermont K, Kovaleva V, Raikhel NV, Osborn RW, Kester A, Rees SB, Torrekens S, Van Leuven F, Vanderleyden J, et al. Smalleine-rich antifungal cyst proteins from radish: their role in host defense. plant cell. 1995, 7(5):573-88.
4. Bartova V, Barta J, Jarosova M. Antifungal and antimicrobial proteins and peptides of potato (Solanum tuberosum L.) tubers and their applications. Appl Microbiol Biotechnol. 2019 Jul; 103(14): 5533-5547.4. Bartova V, Barta J, Jarosova M. Antifungal and antimicrobial proteins and peptides of potato (Solanum tuberosum L.) tubers and their applications. Appl Microbiol Biotechnol. 2019 Jul; 103(14): 5533-5547.
5. Sharma N, Gruszewski HA, Park SW, Holm DG, Vivanco JM. Purification of an isoform of patatin with antimicrobial activity against Phytophthora infestans. Plant Physiol Biochem. 2004 Jul-Aug; 42(7-8): 647-55.5. Sharma N, Gruszewski HA, Park SW, Holm DG, Vivanco JM. Purification of an isoform of patatin with antimicrobial activity against Phytophthora infestans. Plant Physiol Biochem. 2004 Jul-Aug; 42(7-8): 647-55.
6. Odintsova T.I., Rogozhin E.A., Baranov Yu.V., MusolyamovA.Kh., Yalpani N., Egorov Ts.A., Grishin E.V. Seed defensins of barnyard grass Echinochloa crusgalli (L.) Beauv. // Biochimie, 2008, V. 90, P. 1667-1673.6. Odintsova T.I., Rogozhin E.A., Baranov Yu.V., MusolyamovA.Kh., Yalpani N., Egorov Ts.A., Grishin E.V. Seed defensins of barnyard grass Echinochloa crusgalli (L.) Beauv. // Biochimie, 2008, V. 90, P. 1667-1673.
7. Odintsova T.I., Vassilevski A.A., Slavokhotova A. A., MusolyamovA.Kh., Finkina E.I., Khadeeva N.V., Rogozhin E.A., Korostyleva T.V., Pukhalsky V.A., EgorovTs.A., Grishin E.V. A novel antifungal hevein-type peptide from Triticum kiharae seeds with a unique 10-cysteine motif // FEBS J. 2009, V. 276 (15), P. 4266-4275.7. Odintsova T.I., Vassilevski A.A., Slavokhotova A.A., MusolyamovA.Kh., Finkina E.I., Khadeeva N.V., Rogozhin E.A., Korostyleva T.V., Pukhalsky V.A., EgorovTs.A., Grishin E.V. A novel antifungal hevein-type peptide from Triticum kiharae seeds with a unique 10-cysteine motif // FEBS J. 2009, V. 276 (15), P. 4266-4275.
8. Odintsova T.I., Rogozhin E.A., Sklyar I.V., Musolyamov A.K., Kudryavtsev A.M., Pukhalsky V.A., Smirnov A.N., Grishin E.V. and Egorov T.A. Antifungal activity of storage 2S albumins from seeds of the invasive weed dandelion Taraxacum officinale Wigg. Protein & Peptide Letters.2010, V. 17, P. 522-529.8. Odintsova T.I., Rogozhin E.A., Sklyar I.V., Musolyamov A.K., Kudryavtsev A.M., Pukhalsky V.A., Smirnov A.N., Grishin E.V. and Egorov T.A. Antifungal activity of storage 2S albumins from seeds of the invasive weed dandelion Taraxacum officinale Wigg. Protein & Peptide Letters. 2010, V. 17, P. 522-529.
9. Уткина Л.Л., Жабон Е.О., Славохотова А.А., Рогожин Е.А., ШиянА.А., Гришин Е.В., Егоров Ц.А., Одинцова Т.И., Пухальский В.А. Гетерологическая экспрессия синтетического гена нового гевеиноподобного пептида Leymus arenarius в клетках Escherichia coli. Генетика, 2010, Т. 46, №12, С. 1-7.9. Utkina L.L., Zhabon E.O., Slavohotova A.A., Rogozhin E.A., Shiyan A.A., Grishin E.V., Egorov Ts.A., Odintsova T.I., Pukhalsky V.A. Heterologous expression of a synthetic gene for a new Leymus arenarius hevein-like peptide in Escherichia coli cells. Genetics, 2010, vol. 46, no. 12, pp. 1-7.
10. Slavokhotova А.А., Odintsova T.I., Rogozhin Е.А., Musolyamov А.К., Andreev Y.A., Grishin E.V., Egorov T.A. Isolation, molecular cloning and antimicrobial activity of novel defensins from common chickweed (Stellaria media L.) seeds. // Biochimie, 2011, V. 93 (3), P. 450-456.10. Slavokhotova A.A., Odintsova T.I., Rogozhin E.A., Musolyamov A.K., Andreev Y.A., Grishin E.V., Egorov T.A. Isolation, molecular cloning and antimicrobial activity of novel defensins from common chickweed (Stellaria media L.) seeds. // Biochimie, 2011, V. 93 (3), P. 450-456.
11. Rogozhin E.A., Ryazantsev D.Y., Grishin E.V., Egorov T.A., Zavriev S.K. Defense peptides from barnyard grass (Echinochloa crusgalli L.) seeds // Peptides, 2012, V. 38 (1), P. 33-40.11. Rogozhin E.A., Ryazantsev D.Y., Grishin E.V., Egorov T.A., Zavriev S.K. Defense peptides from barnyard grass (Echinochloa crusgalli L.) seeds // Peptides, 2012, V. 38 (1), P. 33-40.
12. D.Yu. Ryazantsev, E.A. Rogozhin, T.V. Dimitrieva, P.E. Drobyazina, N.V. Khadeeva, T.A. Egorov, E.V. Grishin, S.K. Zavriev. A novel hairpin-like antimicrobial peptide from barnyard grass (Echinochloa crusgalli L.) seeds: Structure-functional and molecular-genetics characterization // Biochimie, 2014, V. 99, P. 63-70.12.D.Yu. Ryazantsev, E.A. Rogozhin, T.V. Dimitrieva, P.E. Drobyazina, N.V. Khadeeva, T.A. Egorov, E.V. Grishin, S.K. Zavriev. A novel hairpin-like antimicrobial peptide from barnyard grass (Echinochloa crusgalli L.) seeds: Structure-functional and molecular-genetics characterization // Biochimie, 2014, V. 99, P. 63-70.
13. Rogozhin E.A., Slezina M.P.,Slavokhotova A.A., Istomina E.A., Korostyleva T.V., Smirnov A.N., Grishin E.V., Egorov T.A., Odintsova T.I. A novel antifungal peptide from leaves of the weed Stellaria media L. // Biochimie, 2015, V. 116, P. 125-32.13. Rogozhin E.A., Slezina M.P., Slavokhotova A.A., Istomina E.A., Korostyleva T.V., Smirnov A.N., Grishin E.V., Egorov T.A., Odintsova T.I. A novel antifungal peptide from leaves of the weed Stellaria media L. // Biochimie, 2015, V. 116, P. 125-32.
14. Рязанцев Д.Ю., Рогожин E.A., Цветков В.О., Яруллина Л.Г., Смирнов А.Н., Завриев С.К. Разнообразие харпино-подобных защитных пептидов семян ежовника (Echinochloa crusgalliL.) // Доклады Академии Наук, 2019, Т. 484, №1, С. 104-106.14. Ryazantsev D.Yu., Rogozhin E.A., Tsvetkov V.O., Yarullina L.G., Smirnov A.N., Zavriev S.K. Diversity of harpin-like protective peptides in barnyard grass (Echinochloa crusgalli L.) seeds // Reports of the Academy of Sciences, 2019, vol. 484, no. 1, pp. 104-106.
15. Rogozhin E.A., Vasilchenko A.S., Barashkova A.S., Smirnov A.N., Zavriev S.K. and Demushkin V.P. Peptide Extract from Seven Medicinal Plants Discovered to Inhibit Oomycete Phytophthora infestans, a Causative Agent of Potato Late Blight Disease // Plants (Basel), 2020, V. 9(10), E. 1294.15. Rogozhin E.A., Vasilchenko A.S., Barashkova A.S., Smirnov A.N., Zavriev S.K. and Demushkin V.P. Peptide Extract from Seven Medicinal Plants Discovered to Inhibit Oomycete Phytophthora infestans, a Causative Agent of Potato Late Blight Disease // Plants (Basel), 2020, V. 9(10), E. 1294.
16. Истомина E.A., Славохотова A.A., Коросытлева Т.В., Семина Ю.В., Щербакова Л.А., Пухальский В.А., Одинцова Т.И. Гены гевеиноподобных антимикробных пептидов семейства WAMP видов рода Aegilops // Генетика, 2017, Т. 53, №12, С. 1402-1410.16. Istomina E.A., Slavohotova A.A., Korosytleva T.V., Semina Yu.V., Shcherbakova L.A., Pukhalsky V.A., Odintsova T.I. Genes of hevein-like antimicrobial peptides of the WAMP family of species of the genus Aegilops // Genetika, 2017, vol. 53, no. 12, pp. 1402-1410.
17. Vieira Dos Santos С, Rey P. Plant thioredoxins are key actors in the oxidative stress response. Trends Plant Sci. 2006 Jul; 11(7): 329-34. doi: 10.1016/j.tplants.2006.05.005. Epub 2006 Jun 16. PMID: 16782394.17. Vieira Dos Santos C, Rey P. Plant thioredoxins are key actors in the oxidative stress response. Trends Plant Sci. 2006 Jun; 11(7): 329-34. doi: 10.1016/j.tplants.2006.05.005. Epub 2006 Jun 16. PMID: 16782394.
18. Park SC, Kim IR, Kim JY, et al. Functional Characterization of a Rice Thioredoxin Protein OsTrxm and Its Cysteine Mutant Variant with Antifungal Activity. Antioxidants (Basel). 2019;8(12):598. Published 2019 Nov 29. doi:10.3390/antiox812059818. Park SC, Kim IR, Kim JY, et al. Functional Characterization of a Rice Thioredoxin Protein OsTrxm and Its Cysteine Mutant Variant with Antifungal Activity. Antioxidants (Basel). 2019;8(12):598. Published 2019 Nov 29. doi:10.3390/antiox8120598
19. Park, SC., Jung, Y.J., Kim, I.R. et al. Functional characterization of thioredoxin h type 5 with antimicrobial activity from Arabidopsis thaliana. Biotechnol Bioproc E 22, 129-135 (2017). https://doi.org/10.1007/sl2257-017-0074-719. Park, S.C., Jung, Y.J., Kim, I.R. et al. Functional characterization of thioredoxin h type 5 with antimicrobial activity from Arabidopsis thaliana. Biotechnol Bioproc E 22, 129-135 (2017). https://doi.org/10.1007/sl2257-017-0074-7
SEQ ID NO: 1. Аминокислотная последовательность химерного белка trx-NsD2.SEQ ID NO: 1. Amino acid sequence of trx-NsD2 chimeric protein.
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLDIDQN PGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVP RGSGMKETAAAKFERQHMDSPDLGTMKFCEKPSGTWSGVCQNSGACKDQCIRLEGAKHGSCNYK LPAHRCICYYECMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLDIDQN PGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHSSGLVP RGSGMKETAAAKFERQHMDSPDLGTMKFCEKPSGTWSGVCQNSGACKDQCIRLEGAKHGSCNYEC LPAHRCICYY
Claims (2)
Publications (2)
| Publication Number | Publication Date |
|---|---|
| RU2021117089A RU2021117089A (en) | 2022-12-12 |
| RU2786706C2 true RU2786706C2 (en) | 2022-12-23 |
Family
ID=
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2456345C1 (en) * | 2010-12-30 | 2012-07-20 | Федеральное Государственное Бюджетное Учреждение Науки Институт Биоорганической Химии Им. Академиков М.М. Шемякина И Ю.А. Овчинникова Российской Академии Наук | RECOMBINANT PLASMID DNA pЕ-Trx-Lc-def, Escherichia coli STRAIN FOR EXPRESSION OF ANTIMICROBIAL PEPTIDE OF LENTIL DEFENSIN Lens culinaris AND METHOD FOR PRODUCING SAID PEPTIDE |
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2456345C1 (en) * | 2010-12-30 | 2012-07-20 | Федеральное Государственное Бюджетное Учреждение Науки Институт Биоорганической Химии Им. Академиков М.М. Шемякина И Ю.А. Овчинникова Российской Академии Наук | RECOMBINANT PLASMID DNA pЕ-Trx-Lc-def, Escherichia coli STRAIN FOR EXPRESSION OF ANTIMICROBIAL PEPTIDE OF LENTIL DEFENSIN Lens culinaris AND METHOD FOR PRODUCING SAID PEPTIDE |
Non-Patent Citations (2)
| Title |
|---|
| HUANG L et al. Production of bioactive human beta-defensin 5 and 6 in Escherichia coli by soluble fusion expression. Protein Expression and Purification. 2008, 61: 168-174. * |
| ROGOZHIN Е.А., OSHCHEPKOVA Y.I., ODINTSOVA Т. I., et.al., Novel antifungal defensins from Nigella sativa L. seeds. // Plant Physiol Biochem., 2011, V. 49 (2), P. 131-137. * |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Guo et al. | Phytophthora sojae effector PsAvh240 inhibits host aspartic protease secretion to promote infection | |
| JP4257119B2 (en) | Novel proteins, genes encoding the same, and uses thereof | |
| Astafieva et al. | A novel cysteine-rich antifungal peptide ToAMP4 from Taraxacum officinale Wigg. flowers | |
| US20140090103A1 (en) | Methods and compositions for increasing plant disease resistance and yield | |
| Wu et al. | Functional characterization of the recombinant antimicrobial peptide Trx-Ace-AMP1 and its application on the control of tomato early blight disease | |
| JPH07503845A (en) | Peptides effective in killing insects | |
| Meng et al. | Efficient production of a recombinant Venerupis philippinarum defensin (VpDef) in Pichia pastoris and characterization of its antibacterial activity and stability | |
| MXPA01004318A (en) | Trans-species transfer of apoptotic genes and transgenic plants developed thereby. | |
| US8227573B2 (en) | Utility of phylloplanins as antibiotics, selective fungicides and for enhancing microbial resistance in plants | |
| US20130340124A1 (en) | Chimeric gene for heterologous expression that encodes peptides with antimicrobial activity | |
| Wang et al. | Mutations in the N-terminal coding region of the harpin protein Hpa1 from Xanthomonas oryzae cause loss of hypersensitive reaction induction in tobacco | |
| RU2786706C2 (en) | Composition based on hybrid recombinant polypeptide for protecting plants from diseases caused by oomycetes | |
| US7232673B2 (en) | Antimicrobial protein from Lyophyllum shimeji | |
| Islam et al. | Identification of six transcripts encoding putative receptor-like protein kinase (RLK) and their expression profiles in Vitis flexuosa infected with pathogens | |
| WO2021115392A1 (en) | Fusion protein, amino acid sequence and coding nucleotide sequence thereof, preparation method therefor and use thereof | |
| JP6396330B2 (en) | Polypeptides against phytopathogenic fungi | |
| RU2352580C1 (en) | Peptide with antifungal activity | |
| JP4231865B2 (en) | Pathogen-related proteins and uses thereof | |
| US20130067616A1 (en) | Plant Defensive Peptides | |
| Thanonkeo et al. | Targeted Disruption of sti 35, a Stress-Responsive Gene in Phytopathogenic Fungus Fusarium oxysporum | |
| US8653332B2 (en) | Extracellular plant ferredoxin-like protein and uses thereof | |
| KR101063234B1 (en) | Antifungal Proteins Isolated from Arabidopsis Thaliana | |
| KR100723293B1 (en) | Pathogenesis related protein and use thereof | |
| El-Habbak | Overexpression/silencing of selected soybean genes alters resistance to pathogens | |
| CN116157018A (en) | Biostimulants and biosafety peptides and their use in agriculture |