RU2457862C1 - Method of treating high-grade gliomas - Google Patents
Method of treating high-grade gliomas Download PDFInfo
- Publication number
- RU2457862C1 RU2457862C1 RU2011112433/15A RU2011112433A RU2457862C1 RU 2457862 C1 RU2457862 C1 RU 2457862C1 RU 2011112433/15 A RU2011112433/15 A RU 2011112433/15A RU 2011112433 A RU2011112433 A RU 2011112433A RU 2457862 C1 RU2457862 C1 RU 2457862C1
- Authority
- RU
- Russia
- Prior art keywords
- glioma
- antibodies
- grade gliomas
- preparation
- rats
- Prior art date
Links
Images
Abstract
Description
Изобретение относится к области медицины, а именно к экспериментальной и прикладной нейробиологии и нейроонкологии, и может быть использовано для терапии низкодифференцированных глиом и профилактики послеоперационных рецидивов.The invention relates to medicine, namely to experimental and applied neurobiology and neurooncology, and can be used for the treatment of low-grade gliomas and the prevention of postoperative relapses.
Низкодифференцированные глиомы составляют 40-45% от нейроонкологических заболеваний. В большинстве случаев прогноз для пациентов со злокачественными глиомами крайне неблагоприятен. Активная миграция глиомных клеток исключает радикальную хирургию глиобластомы, в результате чего рецидив опухолевого роста после хирургического лечения неизбежен, несмотря на агрессивное послеоперационное применение адъювантной лучевой терапии и/или химиотерапии.Low-grade gliomas account for 40-45% of neuro-oncological diseases. In most cases, the prognosis for patients with malignant gliomas is extremely unfavorable. Active migration of glioma cells precludes radical surgery of glioblastoma, resulting in a relapse of tumor growth after surgical treatment is inevitable, despite the aggressive postoperative use of adjuvant radiation therapy and / or chemotherapy.
Внедрение в терапию онкологических заболеваний препаратов на основе моноклональных антител привело к увеличению продолжительности жизни на фоне проводимой терапии.The introduction of drugs based on monoclonal antibodies into cancer therapy has led to an increase in life expectancy during therapy.
Одним из белков выбора в качестве антигена-мишени для проведения терапии низкодифференцированных глиом является белок щелевых контактов (Huang R., et al., 2002, Oliveira R., et al. 2005) - коннексин-43. Коннексин-43 (Cx43, CXA1_RAT) - интегральный мембранный белок, образующий щелевые межклеточные контакты (gap-junction) между астроцитами в дефинитивной нервной ткани, а также между кардиомиоцитами и клетками проводящей системы сердца. Существуют экспериментальные данные, показывающие активирующее влияние Сх43 на процессы инвазии мультиформной глиобластомы человека и ее аналога у крыс - экспериментальной глиомы С6 (Fu СТ, et al., 2004). В этой связи весьма актуальным является проведение терапии низкодифференцированных глиом с помощью анти-Сх43 антител.One of the proteins of choice as the target antigen for the treatment of low-grade gliomas is the gap junction protein (Huang R., et al., 2002, Oliveira R., et al. 2005) - connexin-43. Connexin-43 (Cx43, CXA1_RAT) is an integral membrane protein that forms gap junction between astrocytes in the definitive nervous tissue, as well as between cardiomyocytes and cells of the cardiac conduction system. There are experimental data showing the activating effect of Cx43 on the processes of invasion of human glioblastoma multiforme and its analogue in rats - experimental C6 glioma (Fu ST, et al., 2004). In this regard, the treatment of low-grade gliomas with anti-Cx43 antibodies is highly relevant.
При анализе существующего технического уровня не выявлены решения, аналогичные заявляемому способу лечения низкодифференцированных глиом с помощью анти-Сх43 антител.When analyzing the existing technical level, no solutions were found that were similar to the claimed method for the treatment of low-grade gliomas with anti-Cx43 antibodies.
Целью изобретения является разработка способа лечения низкодифференцированных глиом путем применения стандартизованного препарата анти-Сх43 антител.The aim of the invention is to develop a method for the treatment of low-grade gliomas by using a standardized preparation of anti-Cx43 antibodies.
Технический результат заключается в том, что на фоне проводимой терапии низкодифференцированных глиом замедляется рост опухоли и увеличивается продолжительность жизни пациента.The technical result consists in the fact that against the background of the therapy of low-grade gliomas, tumor growth slows down and the patient's lifespan increases.
Технический результат достигается в заявленном способе лечения низко-дифференцированных глиом, включающем введение стандартизированного препарата анти-Сх43 антител (константа диссоциации [Kd]=9×10-10 М), полученного к рекомбинантному фрагменту коннексина-43 Е2 Сх43 Q173 - I208 с аминокислотной последовательностью QWYIYGFSLSAVYTCKRDPCPHQVDCFLSRPTEKTI (36 а.о., M.w. 4,28 кДа, pl=7,87), при котором препарат анти-Сх43 антител вводят в количестве не менее 5 мг/кг веса реципиента один раз каждые 5-7 дней до достижения терапевтического эффекта.The technical result is achieved in the claimed method of treatment of low-differentiated gliomas, including the introduction of a standardized preparation of anti-Cx43 antibodies (dissociation constant [Kd] = 9 × 10 -10 M) obtained for the recombinant fragment of connexin-43 E2 Cx43 Q173 - I208 with the amino acid sequence QWYIYGFSLSAVYTCKRDPCPHQVDCFLSRPTEKTI (36 a.a., Mw 4.28 kDa, pl = 7.87), in which the anti-Cx43 antibody preparation is administered in an amount of at least 5 mg / kg of the recipient's weight once every 5-7 days until the therapeutic effect is achieved .
Стандартизованный препарат анти-Сх43 антител вводят с момента обнаружения низкодифференцированной глиомы или после оперативного удаления глиомы.The standardized anti-Cx43 antibody preparation is administered from the moment a low-grade glioma is detected or after surgical removal of the glioma.
Стандартизованный препарат анти-Сх43 антител вводят путем внутривенной инфузии.The standardized anti-Cx43 antibody preparation is administered by intravenous infusion.
Способ осуществляют следующим образом.The method is as follows.
Моноклональные антитела получают с помощью традиционной гибридомной технологии с некоторыми модификациями [Чехонин В.П., 2007] в результате иммунизации препаратом рекомбинантного экстраклеточного фрагмента Сх43 (Q173-I208) [Баклаушев В.П. и соавт. 2009]. Сх43-позитивные клоны гибридом продуцирующие анти-Сх43 антитела отбирают с помощью иммуноцитохимического анализа на живой (нефиксированной) культуре клеток линии глиомы С6.Monoclonal antibodies are obtained using traditional hybridoma technology with some modifications [Chekhonin VP, 2007] as a result of immunization with a preparation of a recombinant extracellular fragment Cx43 (Q173-I208) [Baklaushev V.P. et al. 2009]. Cx43-positive hybridoma clones producing anti-Cx43 antibodies are selected by immunocytochemical analysis on a live (unfixed) culture of C6 glioma cell line.
Препарат анти-Сх43 антител, подготовленный для терапии низкодифференцированных глиом, охарактеризовывают следующим образом.An anti-Cx43 antibody preparation prepared for the treatment of low-grade gliomas is characterized as follows.
При изучении свойств анти-Сх43 антител, выделенных из среды культивирования in vitro и из асцитных жидкостей при выращивании продуцентов in vivo, установлено, что они принадлежат к классу IgG. Изотипирование анти-Сх43 антител методом непрямого иммуноферментного анализа с применением коммерческих антисывороток, коньюгированных с пероксидазой хрена (Sigma, USA) показало, что они относятся к субклассу lgG2b.When studying the properties of anti-Cx43 antibodies isolated from in vitro culture medium and from ascites liquids when growing producers in vivo, it was found that they belong to the IgG class. Isotyping of anti-Cx43 antibodies by indirect enzyme-linked immunosorbent assay using commercial antisera conjugated to horseradish peroxidase (Sigma, USA) showed that they belong to the IgG2b subclass.
Константу аффинности анти-Сх43 антител при связывании с очищенным фрагментом Сх43 определяют по методу J. David Beatty («Measurement of monoclonal antibody affinity by non-competitive enzyme immunoassay» 1987). Вычисляют по формуле Kaff=1/(4[Ab']-2[Ab]), где [Ab'] - концентрация антител, соответствующая 50% связыванию от максимального при внесении в лунку планшета очищенного рекомбинантного фрагмента коннексина 43 в концентрации [Ag], а [Ab] - концентрация антител, соответствующая их 50% связыванию от максимального при внесении белка в концентрации 2×[Ад] в лунку. Константа диссоциации, обратно пропорциональная Kaff, составила [Kd]=9×10-10 М.The affinity constant of anti-Cx43 antibodies when binding to a purified Cx43 fragment is determined by J. David Beatty (Measurement of monoclonal antibody affinity by non-competitive enzyme immunoassay 1987). Calculated by the formula K aff = 1 / (4 [Ab '] - 2 [Ab]), where [Ab'] is the concentration of antibodies corresponding to 50% binding of the maximum when a purified recombinant fragment of connexin 43 is added to the plate well at a concentration of [Ag ], and [Ab] - the concentration of antibodies corresponding to their 50% binding of the maximum when introducing protein at a concentration of 2 × [Ad] in the hole. The dissociation constant, inversely proportional to K aff , was [Kd] = 9 × 10 -10 M.
С целью определения специфичности к антигену Сх43, их функциональной активности и рабочей концентрации очищенные анти-Сх43 антитела из отобранного клона гибридных клеток тестируют иммуногистохимически на срезах головного мозга крыс с глиомой С6.In order to determine the specificity for Cx43 antigen, their functional activity and working concentration, purified anti-Cx43 antibodies from a selected clone of hybrid cells are tested immunohistochemically on sections of rat brain with C6 glioma.
Для определения способности полученных анти-Сх43 антител распознавать белок щелевых контактов Сх43 в нативной конформации их тестируют на живой (нефиксированной) культуре клеток глиомной линии С6 крысы и человека U2581 с целью визуализации плакоидных структур на мембране клеток глиомной линии.To determine the ability of the obtained anti-Cx43 antibodies to recognize Cx43 gap junction protein in the native conformation, they are tested on a live (non-fixed) culture of rat and human U681 glioma line C6 glioma line in order to visualize placoid structures on the membrane of glioma line cells.
С целью определения способности полученных анти-Сх43 антител длительно циркулировать в крови, а также взаимодействовать с антигеном-мишенью при внутривенном введении, анти-Сх 43 антитела коньюгируют с радиоизотпной или флюоресцентной меткой Alexa 660 (Invitrogen. USA) и вводят в системный кровоток крысы с имплантированной глиомой С6 или U251. Регистрируют либо накопление радиоактивной метки в зонах экспрессии нужного антигена мишени, либо визуализируют флюоресценцию антител, связавшихся антигеном-мишенью, презентированным в структурах периопухолевого пространства.In order to determine the ability of the obtained anti-Cx43 antibodies to circulate for a long time in the blood, as well as to interact with the target antigen when administered intravenously, the anti-Cx 43 antibodies are conjugated with the Alexa 660 radioisotope or fluorescent label (Invitrogen. USA) and introduced into the rat systemic bloodstream implanted glioma C6 or U251. Either radioactive label accumulation is recorded in the expression zones of the desired target antigen, or the fluorescence of antibodies bound by the target antigen presented in the structures of the peritumor space is visualized.
Только суммарный иммунохимический анализ препаратов анти-Сх43 антител позволяет сделать вывод об их специфичности и пригодности для применения in vivo.Only a summary immunochemical analysis of anti-Cx43 antibody preparations allows us to conclude that they are specific and suitable for in vivo use.
Препарат анти-Сх43 антител перед применением разводят в физиологическом буфере до конечной концентрации не менее чем 1 мг/мл. Для достижения терапевтического эффекта в лечении низкодифференцированных глиом препарат назначают в количестве не менее чем 5 мг/кг веса реципиента. Повторяют инъекции препарата каждые 5-7 дней до наступления терапевтического эффектаThe anti-Cx43 antibody preparation is diluted before use in physiological buffer to a final concentration of not less than 1 mg / ml. To achieve a therapeutic effect in the treatment of low-grade gliomas, the drug is prescribed in an amount of not less than 5 mg / kg of the recipient's weight. Repeat injections of the drug every 5-7 days until the therapeutic effect
Терапевтический эффект оценивают, базируясь на двух основных параметрах: 1) по уменьшению объема глиомы (по результатам контрольного МРТ сканирования головного мозга с морфометрией объема опухоли) и 2) по увеличению продолжительности жизни на фоне проводимой терапии.The therapeutic effect is evaluated based on two main parameters: 1) by reducing the volume of glioma (according to the results of a control MRI scan of the brain with morphometry of the tumor volume) and 2) by increasing the life expectancy during therapy.
Изобретение поясняется фигурами. На фиг.1 показан анализ выживаемости по методу Каплан Мейера. На фиг.2 показаны суммарные данные морфометрии. На фиг.3 изображена глиома С26 на 25 сутки после имплантации, на фиг.4 - глиома С6 на 42 сутки после имплантации, после терапии стандартизованным препаратом анти-Сх43 антител.The invention is illustrated by figures. Figure 1 shows the analysis of survival by the method of Kaplan Meyer. Figure 2 shows the total morphometry data. Figure 3 shows glioma C26 on the 25th day after implantation, figure 4 - glioma C6 on 42 days after implantation, after treatment with a standardized anti-Cx43 antibody preparation.
Для доказательств возможности осуществления предложенного способа с достижением заявленного назначения и указанного технического результата приводим следующие примеры.To prove the feasibility of the proposed method with the achievement of the stated purpose and the specified technical result, we give the following examples.
ПРИМЕР 1EXAMPLE 1
Широко известно, что по морфологии, характеру инвазивного роста и спектру экспрессируемых белков глиома С6 очень близка мультиформной глиобластоме человека, чем объясняется ее широкое применение для моделирования глиобластомы человека на крысах (Auer RN., et al. A simple and reproducible experimental in vivo glioma model. Can J Neurol Sci 1981; 8:325-331). Спектр экспрессируемых клетками глиомы С6 белков включает белки базальной мембраны, белки клеточной адгезии и тканевые протеолитические ферменты, обеспечивающие деградацию межклеточного матрикса в процессе инвазии, сигнальные белки, факторы роста и их рецепторы, поддерживающие высокий уровень пролиферации опухолевых клеток и стимулирующие ангиогенез (Grobben В., De Deyn (2002) Rat С6 glioma as experimental model system for the study of glioblastoma growth and invasion. // Cell Tissue Res. 310, p.257-270).It is widely known that the morphology, nature of invasive growth, and the spectrum of expressed proteins of C6 glioma are very close to human glioblastoma multiforme, which explains its widespread use for modeling human glioblastoma in rats (Auer RN., Et al. A simple and reproducible experimental in vivo glioma model Can Can Neurol Sci 1981; 8: 325-331). The range of proteins expressed by glioma C6 cells includes proteins of the basement membrane, cell adhesion proteins and tissue proteolytic enzymes that ensure the degradation of the intercellular matrix during invasion, signal proteins, growth factors and their receptors that maintain high levels of tumor cell proliferation and stimulate angiogenesis (Grobben B., De Deyn (2002) Rat C6 glioma as experimental model system for the study of glioblastoma growth and invasion. // Cell Tissue Res. 310, p. 257-270).
Для моделирования глиобластомы применили методику стереотаксической имплантации предварительно культивированных глиомных клеток в стриатум мозга крысы (Чехонин В.П., Баклаушев В.П., Юсубалиева Г.М., 2007) (фиг.4).To simulate glioblastomas, the stereotactic implantation of pre-cultured glioma cells into the rat brain striatum was applied (Chekhonin V.P., Baklaushev V.P., Yusubalieva G.M., 2007) (Fig. 4).
Тридцати крысам имплантировали методом стереотаксиса глиомные клетки линии С6 крысы в количестве 5*105. Из них 10-ти крысам на 5-е сутки после имплантации глиомы С6 под кетаминовым наркозом в кровеносное русло вводили препарат анти-Сх43 антител, подготовленный для терапии низкодифференцированных глиом (5 мг препарата на 1 кг веса).Thirty rats were implanted with the method of stereotaxis glioma cells of rat C6 line in the amount of 5 * 10 5 . Of these, 10 rats on the 5th day after implantation of C6 glioma under ketamine anesthesia were injected with the anti-Cx43 antibody preparation prepared for the treatment of low-grade gliomas (5 mg of the drug per 1 kg of weight) into the bloodstream.
Десять крыс с имплантированной глиомой С6 (контрольная группа) получили препарат неспецифических иммуноглобулинов IgGm в том же количестве. Оставшиеся 10 крыс не получали никакой терапии. Проводилось еженедельное введение препарата в той же дозировке до момента гибели контрольных животных.Ten rats with implanted C6 glioma (control group) received the same amount of non-specific IgGm immunoglobulins. The remaining 10 rats did not receive any therapy. The drug was administered weekly in the same dosage until the death of control animals.
Терапевтический эффект препарата анти-Сх43 антител оценили по уменьшению объема опухоли на фоне проводимой терапии.The therapeutic effect of the anti-Cx43 antibody preparation was assessed by a decrease in tumor volume during therapy.
Опытные группа и группа контроля и сравнения крыс с экспериментальной глиомой в ходе проведения эксперимента были подвергнуты еженедельному МРТ сканированию головного мозга с последующей морфометрией растущей опухоли. Результаты динамической морфометрии и статистический анализ полученных данных свидетельствуют о достоверном замедлении роста глиомы на фоне проведенной терапии анти-Сх43 антителами (фиг.1). Объем экспериментальной глиомы крыс, получивших терапию анти-Сх43 антителами в два раза меньше по сравнению с объемом опухоли крыс в контрольных группах.The experimental group and the control and comparison group of rats with experimental glioma during the experiment were subjected to weekly MRI scans of the brain, followed by morphometry of the growing tumor. The results of dynamic morphometry and statistical analysis of the obtained data indicate a significant slowdown in glioma growth against the background of anti-Cx43 antibody therapy (Fig. 1). The volume of experimental glioma in rats treated with anti-Cx43 antibody is two times less than the tumor volume in rats in the control groups.
В ходе исследования, по данным полученной морфометрии, отмечено, что крысы с экспериментальной глиомой С6, получавшие внутривенные инъекции препарата неспецифических иммуноглобулинов и крысы с глиомой без терапии (группы контроля и сравнения) не отличаются по размерам внутримозговой глиомы, что исключает какое-либо неспецифическое влияние введенных в кровоток крыс с глиомой неспецифических иммуноглобулинов.In the course of the study, according to the obtained morphometry, it was noted that rats with experimental C6 glioma receiving intravenous injections of the drug of non-specific immunoglobulins and rats with glioma without therapy (control and comparison groups) did not differ in the size of intracerebral glioma, which excludes any nonspecific effect non-specific immunoglobulins introduced into the bloodstream of rats with glioma.
ПРИМЕР 2EXAMPLE 2
Тридцати крысам имплантировали методом стереотаксиса глиомные клетки линии С6 крысы в количестве 5*105 (моделирование глиобластомы).Thirty rats were implanted with the method of stereotaxis glioma cells of rat C6 line in the amount of 5 * 10 5 (modeling of glioblastoma).
Стандартизованный препарат анти-Сх43 антител, подготовленный для терапии низкодифференцированных глиом (5 мг препарата на 1 кг веса), под кетаминовым наркозом вводили в кровеносное русло 10-ти крысам на 5-е сутки после имплантации глиомы С6.The standardized anti-Cx43 antibody preparation, prepared for the treatment of low-grade gliomas (5 mg of the drug per 1 kg of body weight), was injected into the bloodstream under 10 conditions after ketamine anesthesia on the 5th day after implantation of C6 glioma.
Десять крыс с имплантированной глиомой С6 (контрольная группа) получили препарат неспецифических иммуноглобулинов IgGm в том же физиологическом растворе и аналогичной дозировке. Оставшиеся 10 крыс не получали никакой терапии. Проводилось еженедельное введение препарата в той же дозировке до момента гибели контрольных животных.Ten rats with implanted C6 glioma (control group) received a preparation of non-specific IgGm immunoglobulins in the same physiological saline and the same dosage. The remaining 10 rats did not receive any therapy. The drug was administered weekly in the same dosage until the death of control animals.
Терапевтический эффект препарата анти-Сх43 антител оценили по увеличению продолжительности жизни крыс с глиомой С6 на фоне проводимой терапии в опытной по сравнению с крысами с глиомой С6 контрольных групп.The therapeutic effect of the anti-Cx43 antibody preparation was evaluated by increasing the life expectancy of rats with C6 glioma against the background of the therapy in the experimental control groups compared with rats with C6 glioma.
Для анализа выживаемости крыс с экспериментальной глиомой на фоне терапии анти-Сх43 антителами и в контрольной группе была применена процедура Каплан Майера (определение функции выживаемости крыс с глиомой в опытной и контрольных группах с использование статистического пакета Statica 6,0).To analyze the survival of rats with experimental glioma during anti-Cx43 antibody therapy and in the control group, the Kaplan Meier procedure was used (determination of the survival function of rats with glioma in the experimental and control groups using the Statica 6.0 statistical package).
Как видно из приведенного графика (фиг.2), отражающего функцию выживаемости крыс с глиомой, крысы опытной группы, получавшие терапию анти-Сх43 антителами в дозе 5 мг на кг веса, достоверно переживали крыс с глиомой обеих контрольных групп. Несколько крыс с глиомой С6 полностью выздоровели и по истечению времени воспроизвели новое потомство. У этих крыс имплантированная глиома регрессировала на фоне проведенной терапии анти-Сх43 антителами, без рецидивирования, несмотря на последующие после выздоровления перенесенную беременность, роды и вскармливание.As can be seen from the graph (figure 2), which reflects the survival function of rats with glioma, rats of the experimental group who received anti-Cx43 antibody therapy at a dose of 5 mg per kg of weight reliably experienced rats with glioma of both control groups. Several rats with C6 glioma fully recovered and, after the lapse of time, reproduced new offspring. In these rats, the implanted glioma regressed against the background of anti-Cx43 antibody therapy, without recurrence, despite the subsequent pregnancy, birth and feeding after recovery.
Во всех случаях, системное введение анти-Сх43 антител в вышеуказанной дозировке приводило либо к достоверному увеличению продолжительности жизни, по сравнению с контрольными животными, либо к полному выздоровлению крысы (исчезновение опухоли) (фиг.3, 4).In all cases, the systemic administration of anti-Cx43 antibodies in the above dosage led either to a significant increase in life expectancy compared to control animals, or to the complete recovery of the rat (tumor disappearance) (Figs. 3, 4).
Claims (4)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| RU2011112433/15A RU2457862C1 (en) | 2011-07-07 | 2011-07-07 | Method of treating high-grade gliomas |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| RU2011112433/15A RU2457862C1 (en) | 2011-07-07 | 2011-07-07 | Method of treating high-grade gliomas |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| RU2457862C1 true RU2457862C1 (en) | 2012-08-10 |
Family
ID=46849505
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| RU2011112433/15A RU2457862C1 (en) | 2011-07-07 | 2011-07-07 | Method of treating high-grade gliomas |
Country Status (1)
| Country | Link |
|---|---|
| RU (1) | RU2457862C1 (en) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3036005A4 (en) * | 2013-08-21 | 2017-04-26 | The Board Of Regents Of The University Of Texas System | Compositions and methods for targeting connexin hemichannels |
| US10889637B2 (en) | 2016-02-26 | 2021-01-12 | The Board Of Regents Of The University Of Texas System | Methods of treating an osteolytic tumor and spinal cord injury by administering connexin (Cx) 43 hemichannel-binding antibodies |
| EP4037703A4 (en) * | 2019-10-02 | 2023-12-06 | Alamab Therapeutics, Inc. | Anto-connexin antibody formulations |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20070042964A1 (en) * | 2002-01-29 | 2007-02-22 | Wyeth | Compositions and methods for modulating connexin hemichannels |
| RU2408728C1 (en) * | 2009-07-28 | 2011-01-10 | Федеральное государственное учреждение "Государственный Научный Центр Социальной и Судебной Психиатрии им. В.П. Сербского" (ФГУ "ГНЦССП Росздрава") | Method to produce immunogenic recombinant extracellular fragment connexin-43 |
-
2011
- 2011-07-07 RU RU2011112433/15A patent/RU2457862C1/en not_active IP Right Cessation
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20070042964A1 (en) * | 2002-01-29 | 2007-02-22 | Wyeth | Compositions and methods for modulating connexin hemichannels |
| RU2408728C1 (en) * | 2009-07-28 | 2011-01-10 | Федеральное государственное учреждение "Государственный Научный Центр Социальной и Судебной Психиатрии им. В.П. Сербского" (ФГУ "ГНЦССП Росздрава") | Method to produce immunogenic recombinant extracellular fragment connexin-43 |
Non-Patent Citations (1)
| Title |
|---|
| БАКЛАУШЕВ В.П. Иммунофлюоресцентный анализ коннексина-43 на основе моноклональных антител к его экстраклеточному домену. Клеточные технологии в биологии и медицине. 2009, 236-241. PONSAERTS R. ET AL. Intramolecular loop/tail interactions are essential for connexin 43-hemichannel activity, The FASEB Journal, 2010, v.24, №11, p.4378-4395. * |
Cited By (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3036005A4 (en) * | 2013-08-21 | 2017-04-26 | The Board Of Regents Of The University Of Texas System | Compositions and methods for targeting connexin hemichannels |
| CN106659909A (en) * | 2013-08-21 | 2017-05-10 | 德克萨斯州大学系统董事会 | Compositions and methods for targeting connexin hemichannels |
| US9914775B2 (en) | 2013-08-21 | 2018-03-13 | The Board Of Regents Of The University Of Texas System | Methods for treating inflammatory disorders or cancer metastasis by administering antibodies to connexin 43 (Cx43) hemichannels |
| US10633442B2 (en) | 2013-08-21 | 2020-04-28 | Board Of Regents Of The University Of Texas System | Antibodies to connexin 43 (Cx43) hemichannels and methods of use thereof to inhibit Cx43 hemichannel opening |
| US11208479B2 (en) | 2013-08-21 | 2021-12-28 | Board Of Regents, The University Of Texas System | CX43 hemichannel antibodies and methods of use |
| CN106659909B (en) * | 2013-08-21 | 2022-01-11 | 德克萨斯州大学系统董事会 | Compositions and methods for targeting connexin hemichannels |
| CN114621346A (en) * | 2013-08-21 | 2022-06-14 | 德克萨斯州大学系统董事会 | Compositions and methods for targeting connexin hemichannels |
| US11912762B2 (en) | 2013-08-21 | 2024-02-27 | Board Of Regents Of The University Of Texas System | Method of treating osteoarthritis by administering an anti-connexin 43 antibody |
| US10889637B2 (en) | 2016-02-26 | 2021-01-12 | The Board Of Regents Of The University Of Texas System | Methods of treating an osteolytic tumor and spinal cord injury by administering connexin (Cx) 43 hemichannel-binding antibodies |
| US11912758B2 (en) | 2016-02-26 | 2024-02-27 | The Board Of Regents Of The University Of Texas System | Methods of treating metastasis, including inhibiting bone cancer metastasis, by administering an antibody which binds connexin 43 (Cx43) hemichannel |
| EP4037703A4 (en) * | 2019-10-02 | 2023-12-06 | Alamab Therapeutics, Inc. | Anto-connexin antibody formulations |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Schwab et al. | Spinal cord injury‐induced lesional expression of the repulsive guidance molecule (RGM) | |
| US20210024893A1 (en) | Medical uses of exosomes | |
| EP3424498B1 (en) | Tumour therapeutic monoclonal antibody nano-capsule and preparation method and use thereof | |
| Wang et al. | The use of a gold nanoparticle-based adjuvant to improve the therapeutic efficacy of hNgR-Fc protein immunization in spinal cord-injured rats | |
| US10232025B2 (en) | Method for minimising progression of cancer in companion animals | |
| Yu et al. | Immunization with recombinant Nogo-66 receptor (NgR) promotes axonal regeneration and recovery of function after spinal cord injury in rats | |
| US20140017264A1 (en) | Dosage and administration of bispecific scfv conjugates | |
| JP5646617B2 (en) | Compositions and methods for the treatment of multiple sclerosis | |
| Charan et al. | Tumor secreted ANGPTL2 facilitates recruitment of neutrophils to the lung to promote lung pre-metastatic niche formation and targeting ANGPTL2 signaling affects metastatic disease | |
| Tsai et al. | Targeting epidermal growth factor receptor/human epidermal growth factor receptor 2 signalling pathway by a dual receptor tyrosine kinase inhibitor afatinib for radiosensitisation in murine bladder carcinoma | |
| RU2457862C1 (en) | Method of treating high-grade gliomas | |
| Tormoen et al. | Targeting MerTK enhances adaptive immune responses after radiation therapy | |
| US20200046779A1 (en) | Anti-inflammatory exosomes from inflamed cells or tissues | |
| CA3020418A1 (en) | Diagnosis of immune_activation using clever-1, tnf-alpha and hla-dr binding agents | |
| JP4982377B2 (en) | Compositions and methods for the treatment and prevention of hyperproliferative diseases | |
| Li et al. | Promising alternatives of CD47 monoclonal antibody: An injectable degradable hydrogel loaded with PQ912 for postoperative immunotherapy effectively blocks CD47-SIRPα signal | |
| Albert et al. | Modulation of radiation-induced oral mucositis (mouse) by selective inhibition of β1 integrin | |
| Jasiewicz et al. | ZipperCells Exhibit Enhanced Accumulation and Retention at the Site of Myocardial Infarction | |
| Kim et al. | Over-expression of laminin correlates to recovery of vasogenic edema following status epilepticus | |
| You et al. | Passive immunization with tenascin-R (TN-R) polyclonal antibody promotes axonal regeneration and functional recovery after spinal cord injury in rats | |
| WO2022256420A1 (en) | Methods, compositions and uses for targeting sema7a in the diagnosis and treatment of health conditions | |
| US11634496B2 (en) | C-MET agonistic antibody and use thereof | |
| Zurita et al. | Perilesional intrathecal administration of autologous bone marrow stromal cells achieves functional improvement in pigs with chronic paraplegia | |
| CN110177552A (en) | For adjusting the composition of PD-1 signal transduction | |
| RU2437159C1 (en) | Method of imaging of astroglial bank in diagnosing of high-grade gliomas |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| MM4A | The patent is invalid due to non-payment of fees |
Effective date: 20200708 |