OA19216A

OA19216A - Methods and compositions for inducing protective immunity against a Marburg virus infection.

Info

Publication number: OA19216A
Application number: OA1201900006
Authority: OA
Inventors: Maria Graz PAU; Benoit Christophe Stephan Callendret; Roland Christian Zahn
Original assignee: Janssen Vaccines & Prevention B.V.
Priority date: 2016-07-15
Filing date: 2017-07-11
Publication date: 2020-04-24

Abstract

Compositions, vaccines and methods using adenovirus vectors for priming and boosting vaccinations for inducing protective immunity against a Marburg virus infection are described.

Description

Janssen Vaccines & Prévention B.V.

METHODS AND COMPOSITIONS FOR INDUCING PROTECTIVE IMMUNITY AGAINST A MARBURG VIRUS INFECTION

STATEMENT OF GOVERNMENT SUPPORT

This invention was made with govemment support under contract HHSN272200800056C, awarded by the National Institute of Health. The govemment has certain rights in the invention.

FIELD OF THE INVENTION

This invention relates to compositions, vaccines and methods for inducing protective immunity against a Marburg virus infection.

BACKGROUND OF THE INVENTION

Ebolaviruses, such as Zaïre ebolavirus (EBOV) and Sudan ebolavirus (SUDV), and the closely related Marburg virus (MARV), are associated with outbreaks of highly léthal Hémorrhagie Fever (HF) in humans and primates, mainly located in Africa with occasional spillover in North America and Europe. These viruses are fïloviruses that are known to infect humans and non- human primates with severe health conséquences, including death. Filovirus infections hâve resulted in case fatality rates of up to 90% in humans. EBOV, SUDV, and MARV infections cause HF with death often occurring within 7 to 10 days post-infection. HF présents as an acute febrile syndrome manifested by an abrupt fever, nausea, vomiting, diarrhea, maculopapular rash, malaise, prostration, generalized signs of increased vascular permeability, coagulation abnormalities, and dysrégulation of the innate immune response. Much of the disease appears to be caused by dysrégulation of innate immune responses to the infection and by réplication of virus in vascular endothélial cells, which induces death of host cells and destruction of the endothélial barrier. Fïloviruses can be spread by small particle aérosol or by direct contact with infected blood, organs, and body fluids of human or NHP origin. Infection with a single virion is reported to be sufficient to cause HF in humans. Presently, there is no therapeutic or vaccine approved for treatment or prévention of HF. Supportive care remains the only approved medical intervention for individuals who become infected with fïloviruses.

As the cause of severe human disease, fïloviruses continue to be of concem as both a source of natural infections, and also as possible agents of bioterrorism. The réservoir for fïloviruses in the wild has not yet been definitively identified. Four subtypes of Ebolaviruses hâve been described to cause HF, i.e., those in the Zaïre, Sudan, Bundibugyo and Ivory Coast épisodes (Sanchez, A. et al. 1996 PNAS USA 93:3602-3607). These subtypes of Ebolaviruses hâve similar genetic organizations, e.g., negative-stranded RNA viruses containing seven linearly arrayed genes. The structural gene products of Ebolaviruses include, for example, the envelope glycoprotein that exists in two alternative forms, a secreted soluble glycoprotein (ssGP) and a transmembrane glycoprotein (GP) generated by RNA editing that médiates viral entry (Sanchez, et al. 1996 PNAS USA 93:3602-3607).

Marburg virus (MARV) causes Marburg virus disease (MVD), also referred to as Marburg hémorrhagie fever (MHF), in humans and nonhuman primates. The disease names are derived from the German city Marburg, where MARV was first discovered in an outbreak in 1967. Comparative analyses of the GP and viral protein (VP) 35 genes of MARV strains showed that there are two distinct lineages within the Marburg marburgvirus species of MARV, the Marburg lineage and Ravn lineage. There are a number ofisolated strains ofthe Marburg lineage, such as the original MARV isolâtes from the 1967 épisodes in Marburg (Popp and Ratayczak strains), the Ozolin strain from a case in 1975 in South Africa, the Musoke strain (MARV-Musoke) from a 1980 case in Kenya, and a seemingly more pathogenic Angola strain (MARV-Angola). The Ravn lineage includes an isolate from Kenya in 1987 (Ravn strain). See Daddario-DiCaprio et al., J. ofVirology, Oct. 2006, p. 9659-9666. The structural proteins of MARV include four proteins (NP, VP35, VP30, and L) that make up the helical nucleocapsid, which is surrounded by a matrix that is composed ofthe viral proteins VP40 and VP24. The surface of MARV virions is coated with spikes that consist of the structural glycoprotein (GP). The MARV GP plays a rôle in virus entry and pathogenesis and serves as a major and logical target for vaccine strategies. Id.

It has been suggested that immunization can be useful in protecting against filovirus infection because there appears to be less nucléotide polymorphism within filovirus subtypes than among other RNA viruses (Sanchez et al. 1996 PNAS USA 93:3602-3607). Until recently, developments of préventive vaccines against fïloviruses hâve had variable results, partly because the requirements for protective immune responses against filovirus infections are poorly understood. Additionally, the large number of fïloviruses circulating within natural réservoirs complicates efforts to design a vaccine that protects against ail species of filoviruses. Currently, there are several vaccine antigen delivery platforms that demonstrated varions levels of protection in non-human primates (NHPs) exposed with high infections doses of filoviruses. Vaccine candidates are in development based on a variety of platform technologies including réplication competent vectors (e.g. Vesicular Stomatitis Virus; Rabies virus; Parainfluenza Virus); réplication incompetent vectors (Adenovirus, Modified Vaccinia Ankara Virus); protein subunits inclusive of Virus Like Particles expressed in bacterial cells, insect cells, mammalian cells, plant cells; DNA vaccines; and /or live and killed attenuated filovirus (Friedrich et al., 2012). The EBOV glycoprotein GP is an essential component of a vaccine that protects against exposures with the same species of EBOV. Furthermore, inclusion of the GP from EBOV and SUDV, the two most virulent species of ebolaviruses, can protect monkeys against EBOV and SUDV intramuscular exposures, as well as exposures with the distantly related Bundibugyo (BDBV), Taï Forest ebolavirus (TAFV; formerly known as Ivory Coast or Cote d’ivoire ) species. Likewise, inclusion of the GP from MARV can protect monkeys against MARV intramuscular and aérosol exposures. The development of medical countermeasures for these viruses is a high priority, in particular the development of a PANfilovirus vaccine - that is one vaccine that protects against ail pathogenic filoviruses.

Replication-defective adenovirus vectors (rAd) arepowerful inducers of cellular immune responses and hâve therefore corne to serve as useful vectors for gene-based vaccines particularly for lentiviruses and filoviruses, as well as other nonviral pathogens (Shiver, et al., (2002) Nature 415(6869): 331-5; (Hill, et al., Hum Vaccin 6(1): 78-83. ; Sullivan, et al., (2000) Nature 408(6812): 605-9; Sullivan et al., (2003) Nature 424(6949): 681-4; Sullivan, et al., (2006) PLoS Med 3(6): el77; Radosevic, et al., (2007); Santra, et al., (2009) Vaccine 27(42): 5837-45.

Adenovirus-based vaccines hâve several advantages as human vaccines since they can be produced to high titers under GMP conditions and hâve proven to be safe and immunogenic in humans (Asmuth, et al., J Infect Dis 201(1): 132-41; Kibuuka, et al., J Infect Dis 201(4): 6007; Koup, et al., PLoS One 5(2): e9015. ; Catanzaro, et al., (2006) J Infect Dis 194(12): 1638-49; Harro, et al., (2009) Clin Vaccine Immunol 16(9): 1285-92. While most of the initial vaccine work was conducted using rAd5 due to its significant potency in eliciting broad antibody and CD8+ T cell responses, pre-existing immunity to rAd5 in humans may limit efficacy (Catanzaro, (2006); Cheng, et al., (2007) PLoS Pathog 3(2): e25.; McCoy, et al., (2007) J Virol

81(12): 6594-604.; Buchbinder, et al., (2008) Lancet 372(9653): 1881-93). This property might restrict the use of rAd5 in clinical applications for many vaccines that are currently in development including Ebolavirus (EBOV) and Marburg virus (MARV).

Replication-defective adenovirus vectors, rAd26 and rAd35, derived from adenovirus serotype 26 and serotype 35, respectively, hâve the ability to circumvent Ad5 pre-existing immunity. rAd26 can be grown to high titers in Ad5 El-complementing cell lines suitable for manufacturing these vectors at a large scale and at clinical grade (Abbink, et al., 2007), and this vector has been shown to induce humoral and cell-mediated immune responses in prime-boost vaccine strategies (Abbink, et al., 2007; Liu, et al., (2009) Nature 457(7225): 87-91). rAd35 vectors grow to high titers on cell lines suitable for production of clinical-grade vaccines (Havenga, et al., (2006) J Gen Virol 87(Pt 8): 2135-43), and hâve been formulated for injection as well as stable inhalable powder (Jin, et al., Vaccine 28(27): 4369-75). These vectors show efficient transduction of human dendritic cells (de Gruijl, et al., (2006) J Immunol 177(4): 220815; Lore, et al., (2007) J Immunol 179(3): 1721-9), and thus hâve the capability to médiate high level antigen delivery and présentation.

There is an unmet need for improved vaccines that elicit immune responses against Marburg viruses.

BRIEF SUMMARY OF THE INVENTION

It is discovered in the présent invention that various prime-boost combinations of réplication incompetent vectors generate effective immune protection against Marburg virus infections.

Accordingly, one general aspect of the présent invention relates to a combination vaccine comprising:

(i) a first composition comprising an immunologically effective amount of an adenovirus vector comprising a nucleic acid encoding an antigenic protein of a Marburg virus, together with a pharmaceutically acceptable carrier; and (ii) a second composition comprising an immunologically effective amount of an adenovirus vector comprising a nucleic acid encoding an antigenic protein of a Marburg virus, together with a pharmaceutically acceptable carrier;

wherein one of the compositions is a priming composition and the other composition is a boosting composition.

Another general aspect of the présent invention relates to the use of:

a first composition comprising an immunologically effective amount of an adenovirus vector comprising a nucleic acid encoding an antigenic protein of a Marburg virus; and a second composition comprising an immunologically effective amount of an adenovirus vector comprising a nucleic acid encoding an antigenic protein of a Marburg virus, for generating a protective immune response against a Marburg virus; wherein the first and second compositions are used for priming and for boosting said immune response, respectively, or vice versa.

The Marburg virus according to the présent invention can be any isolate or strain of the Marburg marburgvirus species, including but not limited to, the Marburg Popp strain, Ratayczak strain, Ozolin strain, Musoke strain (MARV-Musoke), Angola strain (MARVAngola), and the Ravn strain.

The antigenic proteins can be any protein comprising an antigenic déterminant. In a preferred embodiment the antigenic proteins include Marburg virus glycoproteins (GPs) or nucleoproteins (NPs), and the antigenic proteins can fùrther be one or more antigenic protein from at least one additional filovirus, such as Ebola. Other antigenic proteins, such as an NP, VP35, VP30, L, VP40, VP24 or GP of a Marburg virus, can also be used in the invention. The antigenic proteins encoded by the adenovirus vectors comprised in the first and second composition according to embodiments of the présent invention can include any antigenic protein from any isolate of Marburg virus, preferably, GPs of at least one of MARV-Musoke and MARV-Angola.

In a preferred embodiment, the adenovirus vector in the first composition (i) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3, and the adenovirus vector in the second composition (ii) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3 or SEQ ID NO:4.

In a preferred embodiment, the adenovirus vector in the first composition (i) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3, and the adenovirus vector in the second composition (ii) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3.

Preferably the first and/or the second composition can further comprise a nucleic acid encoding an antigenic protein from different filovirus subtypes, such as that having the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 5.

In a preferred embodiment, the first and the second composition both comprise an adenovirus encoding an Ebola antigenic protein having the amino acid sequence of SEQ ID NO: 1, an adenovirus encoding an Ebola antigenic protein having the amino acid sequence of SEQ ID NO: 2 and an adenovirus encoding a Marburg antigenic protein having the amino acid sequence of SEQ ID NO: 3.

In a preferred embodiment, the adenovirus vectors used in the first and second composition is a rAd26 or rAd35 vector.

In an even more preferred embodiment, the first and the second composition both comprise a rAd26 encoding an Ebola antigenic protein having the amino acid sequence of SEQ ID NO: 1, a rAd26 encoding an Ebola antigenic protein having the amino acid sequence of SEQ ID NO: 2 and a rAd26 encoding a Marburg antigenic protein having the amino acid sequence of SEQ ID NO: 3.

In a preferred embodiment, the adenovirus vectors used in the first composition is a rAd26 vector. It is contemplated that the methods, vaccines, and compositions described herein can be embodied in a kit. For example, in one embodiment, the présent invention can include a kit comprising:

Therefore in a preferred embodiment, the présent invention relates to a combination vaccine, a kit or a use wherein the adenovirus vector in composition (i) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 3; and wherein the adenovirus vector in composition (ii) comprises a nucleic acid encoding antigenic protein having the amino acid sequence of SEQ ID NO: 3 or SEQ ID NO: 4.

In a preferred embodiment, the adenovirus vectors comprised in the combination vaccine, kit of the présent invention, or the adenovirus vectors used for generating a protective immune response against at least one Marburg virus are rAd26 or rAd35 vectors. In a preferred embodiment said adenovirus vectors are rAd26 vectors. In a preferred embodiment of this use, the boosting composition is administered I -12 weeks after the priming composition.

One additional general aspect of the présent invention relates to a method of inducing an immune response against a Marburg virus in a subject, the method comprising:

a. administering to the subject a first composition comprising an immunologically effective amount of an adenovirus vector comprising a nucleic acid encoding an antigenic glycoprotein of a Marburg virus; and

b. administering to the subject a second composition comprising an immunologically effective amount of an adenovirus vector comprising a nucleic acid encoding an antigenic protein of a Marburg virus;

wherein steps (a) and (b) are conducted in either order.

In another embodiment, the adenovirus vector in the first composition comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3, and the adenovirus vector in the second composition comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3 or SEQ ID NO:4.

In an even more preferred embodiment, the adenovirus vector in the second composition comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3.

In a preferred embodiment, the first and the second composition both comprise an adenovirus encoding an Ebola antigenic protein having the amino acid sequence of SEQ ID NO: 1, an adenovirus encoding an Ebola antigenic protein having the amino acid sequence of SEQ ID NO: 2 and an adenovirus encoding a Marburg antigenic protein having the amino acid sequence of SEQ ID NO: 3.In a preferred embodiment, the adenovirus vectors used in the method of the présent invention are rAd26 or rAd35 vectors.

In an even more preferred embodiment, the first and the second composition both comprise a rAd26 encoding an Ebola antigenic protein having the amino acid sequence of SEQ ID NO: 1, a rAd26 encoding an Ebola antigenic protein having the amino acid sequence of SEQ ID NO: 2 and a rAd26 encoding a Marburg antigenic protein having the amino acid sequence of SEQIDNO: 3.

In another preferred embodiment of the présent invention, step (a) and step (b) of the method are conducted 1-12 weeks apart. One of the steps (a) and (b) is conducted for priming vaccination and the other step for boosting vaccination.

In another preferred embodiment, the priming vaccination, i.e. step (a), is conducted at week 0, followed by a boosting vaccination, i.e. step (b), at week 1-10, more preferably at week 6-10 and even more preferably at week 8. In another preferred embodiment, the priming vaccination, i.e. step (a), is conducted at week 0, followed by a boosting vaccination, i.e. step (b), at week 1 -4, preferably at week 1, 2 or 4.

In another preferred embodiment, the priming vaccination, i.e. step (b), is conducted at week 0, followed by a boosting vaccination, i.e. step (a), at week 1-10, more preferably at week 6-10 and even more preferably at week 8. In another preferred embodiment, the priming vaccination, i.e. step (b), is conducted at week 0, followed by a boosting vaccination, i.e. step (a), at week 1-4, preferably at week 1, 2 or 4.

In a preferred embodiment of the présent invention, the method comprises a priming vaccination with an immunologically effective amount of an rAd26 vector expressing a Marburg virus antigenic protein, followed by a boosting vaccination with an immunologically effective amount of an rAd26 or rAd35, preferably rAd26 vector, expressing a Marburg virus antigenic protein, preferably a Marburg virus glycoprotein.

The Marburgviruses can be any isolate or strain of the Marburg marburgvirus species, including but not limited to, the Marburg Popp strain, Ratayczak strain, Ozolin strain, Musoke strain (MARV-Musoke), and Angola strain (MARV-Angola), and the Ravn strain. Antigenic proteins from other filoviruses, such as Ebolaviruses including but not limited to, Zaïre ebolavirus (EBOV), Sudan ebolavirus (SUDV), Reston, Bundibugyo, and Taï Forest can be used in combination with the antigenic proteins of Marburg virus according to embodiments of the invention. Exemplary amino acid sequences of suitable filovirus antigenic proteins include, but are not limited to, SEQ ID NO: 1 to SEQ ID NO: 5.

BRIEF DESCRIPTION OF THE DRAWINGS

The foregoing summary, as well as the following detailed description ofthe invention, will be better understood when read in conjunction with the appended drawings. It should be noted that the invention is not limited to the précisé embodiments shown in the drawings.

In the drawings:

Figure 1 shows the Marburg Angola glycoprotein spécifie humoral immune response (assessed by ELISA) observed from the animal study defined in example 1.

Figure 2 shows the outcome of a challenge experiment with the MARV Angola wild-type P3 challenge virus, as defined in example 1.

Figure 3 shows the Marburg Angola glycoprotein spécifie humoral immune response (assessed by ELISA) observed from the animal study defined in example 2.

DETAILED DESCRIPTION OF THE INVENTION

Various publications, articles and patents are cited or described in the background and throughout the spécification; each of these references is herein incorporated by reference in its entirety. Discussion of documents, acts, materials, devices, articles or the like which has been included in the présent spécification is for the purpose of providing context for the présent invention. Such discussion is not an admission that any or ail of these matters form part of the prior art with respect to any inventions disclosed or claimed.

Unless defined otherwise, ail technical and scientific terms used herein hâve the same meaning as commonly understood to one of ordinary skill in the art to which this invention pertains. Otherwise, certain terms used herein hâve the meanings as set forth in the spécification. Ail patents, published patent applications and publications cited herein are incorporated by reference as if set forth fully herein. It must be noted that as used herein and in the appended claims, the singular forms “a,” “an,” and “the” include plural reference unless the context clearly dictâtes otherwise.

Unless otherwise indicated, the term “at least” preceding a sériés of éléments is to be understood to refer to every element in the sériés. Those skilled in the art will recognize, or be able to ascertain using no more than routine expérimentation, many équivalents to the spécifie embodiments of the invention described herein. Such équivalents are intended to be encompassed by the présent invention.

Throughout this spécification and the claims which follow, unless the context requires otherwise, the word “comprise”, and variations such as “comprises” and “comprising”, will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integer or step. When used herein the term “comprising” can be substituted with the term “containing” or “including” or sometimes when used herein with the term “having”. Any of the aforementioned terms (comprising, containing, including, having), whenever used herein in the context of an aspect or embodiment ofthe présent invention can be substituted with the term “consisting of’, though less preferred.

When used herein “consisting of ’ excludes any element, step, or ingrédient not specified in the claim element. When used herein, “consisting essentially of ’ does not exclude materials or steps that do not materially affect the basic and novel characteristics ofthe claim.

As used herein, the conjunctive term “and/or” between multiple recited éléments is understood as encompassing both individual and combined options. For instance, where two éléments are conjoined by “and/or”, a first option refers to the applicability of the first element without the second. A second option refers to the applicability of the second element without the first. A third option refers to the applicability of the first and second éléments together. Any one of these options is understood to fall within the meaning, and therefore satisfy the requirement ofthe term “and/or” as used herein. Concurrent applicability of more than one of the options is also understood to fall within the meaning, and therefore satisfy the requirement of the term “and/or.”

As used herein, “subject” means any animal, preferably a mammal, most preferably a human, to whom will be or has been treated by a method according to an embodiment of the invention. The term “mammal” as used herein, encompasses any mammal. Examples of mammals include, but are not limited to, cows, horses, sheep, pigs, cats, dogs, mice, rats, rabbits, guinea pigs, monkeys, humans, etc., more preferably a human.

As used herein, the term “protective immunity” or “protective immune response” means that the vaccinated subject is able to control an infection with the pathogenic agent against which the vaccination was done. Usually, the subject having developed a “protective immune response develops only mild to moderate clinical symptoms or no symptoms at ail. Usually, a subject having a “protective immune response” or “protective immunity” against a certain agent will not die as a resuit of the infection with said agent.

An ‘adenovirus capsid protein” refers to a protein on the capsid of an adenovirus (e.g., Ad 26 or Ad 35) that is involved in determining the serotype and/or tropism of a particular adenovirus. Adénoviral capsid proteins typically include the fiber, penton and/or hexon proteins. As used herein a “Ad26 capsid protein” or a “Ad35 capsid protein” can be, for example, a chimeric capsid protein that includes at least a part of an Ad26 or Ad35 capsid protein. In certain embodiments, the capsid protein is an entire capsid protein of Ad26 or of Ad35. In certain embodiments, the hexon, penton and fiber are of Ad26 or of Ad35.

The terms “adjuvant” and immune stimulant are used interchangeably herein, and are defined as one or more substances that cause stimulation of the immune system. In this context, an adjuvant is used to enhance an immune response to the adenovirus vectors of the invention.

The term “corresponding to”, when applied to positions of amino acid residues in sequences, means corresponding positions in a plurality of sequences when the sequences are optimally aligned.

The terms identical or percent identity, in the context of two or more nucleic acids or polypeptide sequences, (e.g., glycoproteins of filovirus and polynucleotides that encode them) refer to two or more sequences or subsequences that are the same or hâve a specified percentage of amino acid residues or nucléotides that are the same, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection.

For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculâtes the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.

Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat’l. Acad. Sci. USA 85:2444 (1988), by computerized implémentations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by visual inspection (see generally, Current Protocols in Molecular Biology, F.M. Ausubel et al., eds., Current Protocols, a joint venture between Greene Publishing Associâtes, Inc. and John Wiley & Sons, Inc., (1995 Supplément) (Ausubel)).

Examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1990) J. Mol. Biol. 215: 403-410 and Altschuel et al. (1977) Nucleic Acids Res. 25: 3389- 3402, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al, supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased.

Cumulative scores are calculated using, for nucléotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always < 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zéro or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X détermine the sensitivity and speed of the alignment. The BLASTN program (for nucléotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) of 10, M=5, N=-4, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)).

In addition to calculating percent sequence identity, the BLAST algorithm also perforais a statistical analysis ofthe similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat’l. Acad. Sci. USA 90:5873-5787 (1993)). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication ofthe probability by which a match between two nucléotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001.

A fùrther indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the polypeptide encoded by the second nucleic acid, as described below. Thus, a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions. Another indication that two nucleic acid sequences are substantially identical is that the two molécules hybridize to each other under stringent conditions, as described below.

The term substantially similar in the context of the filovirus antigenic proteins of the invention indicates that a polypeptide comprises a sequence with at least 90%, preferably at least 95% sequence identity to the reference sequence over a comparison window of 10-20 amino acids. Percentage of sequence identity is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide sequence in the comparison window can comprise additions or délétions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or délétions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the resuit by 100 to yield the percentage of sequence identity.

It is discovered in the présent invention that heterologous prime-boost combinations, in particular, Ad26 priming followed by Ad26 or Ad35 boosting, are surprisingly effective in generating protective immune responses against one or more subtypes of Marburg viruses.

Filovirus antigenic proteins

The Ebola viruses, and the genetically-related Marburg virus, are filoviruses associated with outbreaks of highly léthal hémorrhagie fever in humans and primates in North America, Europe, and Africa (Peters, C.J. et al. in: Fields Virology, eds. Fields, B.N. et al. 1161-1176, Philadelphia, Lippincott-Raven, 1996; Peters, C.J. et al. 1994 Semin Virol 5:147-154). Although several subtypes hâve been defmed, the genetic organization of these viruses is similar, each containing seven linearly arrayed genes. Among the viral proteins, the envelope glycoprotein exists in two alternative forms, a 50-70 kilodalton (kDa) secreted protein (sGP) and a 130 kDa transmembrane glycoprotein (GP) generated by RNA editing that médiates viral entry (Peters, C.J. et al. in: Fields Virology, eds. Fields, B.N. et al. 1161-1176, Philadelphia, Lippincott-Raven, 1996; Sanchez, A. et al. 1996 PNAS USA 93:3602-3607). Other structural gene products include the nucleoprotein (NP), matrix proteins VP24 and VP40, presumed nonstructural proteins VP30 and VP35, and the viral polymerase (reviewed in Peters, C.J. et al. in: Fields Virology, eds. Fields, B.N. et al. 1161-1176, Philadelphia, Lippincott-Raven, 1996).

The nucleic acid molécules comprised in the adenovirus vectors can encode structural gene products of any filovirus species, such as subtypes of Zaïre (type species, also referred to herein as ZEBOV), Sudan (also referred to herein as SEBOV), Reston, Bundibugyo, and Ivory Coast. There is a single species of Marburgvirus (also referred to herein as MARV) comprising two genetic lineages, the Marburg lineage and Ravn lineage. The Marburg virus according to the présent invention can be any isolate or strain of the Marburg marburgvirus species, including but not limited to, the Marburg Popp strain, Ratayczak strain, Ozolin strain, Musoke strain (MARV-Musoke), and Angola strain (MARV-Angola), and the Ravn strain. Preferably, the Marburg virus is at least one of MARV-Musoke and MARV-Angola.

According to embodiments of the invention, the adénoviral vectors can be used to express antigenic proteins which are proteins comprising an antigenic déterminant of a wide variety of filovirus antigens. In a typical and preferred embodiment, the vectors of the invention include nucleic acid encoding the transmembrane form of the viral glycoprotein (GP). In other embodiments, the vectors of the invention can encode the secreted form of the viral glycoprotein (ssGP), or the viral nucleoprotein (NP).

One of skill will recognize that the nucleic acid molécules encoding the filovirus antigenic protein can be modified, e.g., the nucleic acid molécules set forth herein can be mutated, as long as the modified expressed protein elicits an immune response against a pathogen or disease. Thus, as used herein, the term “antigenic protein” or “filovirus protein” refers to a protein that comprises at least one antigenic déterminant of a filovirus protein described above. The term encompasses filovirus glycoproteins (i.e., gene products of a filovirus) or filovirus nucleoprotein as well as recombinant proteins that comprise one or more filovirus glycoprotein déterminants. The term antigenic proteins also encompasses antigenic proteins that are substantially similar to the naturally occurring antigenic proteins. For example, as used herein, a GP of a filovirus, such as a GP of a Marburg virus, can be the naturally occurring GP. A GP of a filovirus can also be a protein that is substantially similar to a naturally occurring GP of a filovirus and contains at least one antigenic déterminant of the naturally occurring GP.

In some embodiments, the protein can be mutated so that it is less toxic to cells (see e.g., WO/2006/037038) or can be expressed with increased or decreased level in the cells. The présent invention also includes vaccines comprising a combination of nucleic acid molécules. For example, and without limitation, nucleic acid molécules encoding GP, ssGP and NP of the Zaïre, Sudan, Marburg and Ivory Coast/Taï forest Ebola strains can be combined in any combination, in one vaccine composition.

Adenoviruses

An adenovirus according to the invention belongs to the family of the Adenoviridae and preferably is one that belongs to the genus Mastadenovirus. It can be a human adenovirus, but also an adenovirus that infects other species, including but not limited to a bovine adenovirus (e.g. bovine adenovirus 3, BAdV3), a canine adenovirus (e.g. CAdV2), a porcine adenovirus (e.g. PAdV3 or 5), or a simian adenovirus (which includes a monkey adenovirus and an ape adenovirus, such as a chimpanzee adenovirus or a gorilla adenovirus). Preferably, the adenovirus is a human adenovirus (HAdV, or AdHu; in the présent invention a human adenovirus is meant if referred to Ad without indication of species, e.g. the brief notation “Ad5” means the same as HAdV5, which is human adenovirus serotype 5), or a simian adenovirus such as chimpanzee or gorilla adenovirus (ChAd, AdCh, or SAdV).

Most advanced studies hâve been performed using human adenoviruses, and human adenoviruses are preferred according to certain aspects of the invention. In certain preferred embodiments, the recombinant adenovirus according to the invention is based upon a human adenovirus. In preferred embodiments, the recombinant adenovirus is based upon a human adenovirus serotype 5, 11, 26, 34, 35, 48, 49 or 50. According to a particularly preferred embodiment of the invention, an adenovirus is a human adenovirus of one of the serotypes 26 or

35.

An advantage of these serotypes is a low seroprevalence and/or low pre-existing neutralizing antibody titers in the human population. Préparation of rAd26 vectors is described, for example, in WO 2007/104792 and in Abbink et al., (2007) Virol 81(9): 4654-63, both of which are incorporated by reference herein in their entirety. Exemplary genome sequences of Ad26 are found in GenBank Accession EF 153474 and in SEQ ID NO:1 of WO 2007/104792. Préparation of rAd35 vectors is described, for example, in US Patent No. 7,270,811, in WO 00/70071, and in Vogels et al., (2003) J Virol 77(15): 8263-71, ail of which are incorporated by reference herein in their entirety. Exemplary genome sequences of Ad35 are found in GenBank Accession AC_000019 and in Fig. 6 of WO 00/70071.

Simian adenoviruses generally also hâve a low seroprevalence and/or low pre-existing neutralizing antibody titers in the human population, and a significant amount of work has been reported using chimpanzee adenovirus vectors (e.g. US6083716; WO 2005/071093; WO 2010/086189; WO 2010085984; Farina et al, 2001, J Virol 75: 11603-13; Cohen et al, 2002, J Gen Virol 83: 151-55; Kobinger et al, 2006, Virology 346: 394-401; Tatsis et al., 2007, Molecular Therapy 15: 608-17; see also review by Bangari and Mittal, 2006, Vaccine 24: 84962; and review by Lasaro and Ertl, 2009, Mol Ther 17: 1333-39). Hence, in other preferred embodiments, the recombinant adenovirus according to the invention is based upon a simian adenovirus, e.g. a chimpanzee adenovirus. In certain embodiments, the recombinant adenovirus is based upon simian adenovirus type 1, 7, 8, 21, 22, 23, 24, 25, 26, 27.1, 28.1, 29, 30, 31.1, 32, 33, 34, 35.1, 36, 37.2, 39, 40.1, 41.1,42.1, 43, 44, 45, 46, 48, 49, 50 or SA7P.

Adénoviral Vectors rAd26 and rAd35

In a preferred embodiment according to the présent invention the adénoviral vectors comprise capsid proteins from two rare serotypes: Ad26 and Ad35. In the typical embodiment, the vector is an rAd26 or rAd35 virus.

Thus, the vectors that can be used in the invention comprise an Ad26 or Ad35 capsid protein (e.g., a fiber, penton or hexon protein). One of skill will recognize that it is not necessary that an entire Ad26 or Ad35 capsid protein be used in the vectors of the invention. Thus, chimeric capsid proteins that include at least a part of an Ad26 or Ad35 capsid protein can be used in the vectors of the invention. The vectors of the invention can also comprise capsid proteins in which the fiber, penton, and hexon proteins are each derived from a different serotype, so long as at least one capsid protein is derived from Ad26 or Ad35. In preferred embodiments, the fiber, penton and hexon proteins are each derived from Ad26 or each from Ad35.

One of skill will recognize that éléments derived from multiple serotypes can be combined in a single recombinant adenovirus vector. Thus, a chimeric adenovirus that combines désirable properties from different serotypes can be produced. Thus, in some embodiments, a chimeric adenovirus of the invention could combine the absence of pre-existing immunity of the Ad26 and Ad35 serotypes with characteristics such as température stability, assembly, anchoring, production yield, redirected or improved infection, stability of the DNA in the target cell, and the like.

In certain embodiments the recombinant adenovirus vector useful in the invention is derived mainly or entirely from Ad35 or from Ad26 (i.e., the vector is rAd35 or rAd26). In some embodiments, the adenovirus is réplication déficient, e.g. because it contains a délétion in the El région of the genome. For the adenoviruses of the invention, being derived from Ad26 or Ad35, it is typical to ex change the E4-orf6 coding sequence of the adenovirus with the E4orf6 of an adenovirus of human subgroup C such as Ad5. This allows propagation of such adenoviruses in well-known complementing cell lines that express the El genes of Ad5, such as for example 293 cells, PER.C6 cells, and the like (see, e.g. Havenga et al, 2006, J Gen Virol 87: 2135-43; WO 03/104467). In certain embodiments, the adenovirus is a human adenovirus of serotype 35, with a délétion in the El région into which the nucleic acid encoding the antigen has been cloned, and with an E4 orf6 région of Ad5. In certain embodiments, the adenovirus is a human adenovirus of serotype 26, with a délétion in the El région into which the nucleic acid encoding the antigen has been cloned, and with an E4 orf6 région of Ad5. For the Ad35 adenovirus, it is typical to retain the 3’ end of the E1B 55K open reading frame in the adenovirus, for instance the 166 bp directly upstream of the pIX open reading frame or a fragment comprising this such as a 243 bp fragment directly upstream of the pIX start codon, marked at the 5’ end by a Bsu36I restriction site, since this increases the stability of the adenovirus because the promoter of the pIX gene is partly residing in this area (see, e.g.

Havenga et al, 2006, supra; WO 2004/001032).

The préparation of recombinant adénoviral vectors is well known in the art. Préparation of rAd26 vectors is described, for example, in WO 2007/104792 and in Abbink et al., (2007) Virol 81(9): 4654-63. Exemplary genome sequences of Ad26 are found in GenBank Accession EF 153474 and in SEQ ID NO:1 of WO 2007/104792. Préparation of rAd35 vectors is described, for example, in US Patent No. 7,270,811 and in Vogels et al., (2003) J Virol 77(15): 8263-71. An exemplary genome sequence of Ad35 is found in GenBank Accession AC_000019.

In an embodiment of the présent invention, the vectors useful for the présent invention include those described in WO2012/082918, the disclosure of which is incorporated herein by reference in its entirety.

Typically, a vector useful in the invention is produced using a nucleic acid comprising the entire recombinant adénoviral genome (e.g., a plasmid, cosmid, or baculovirus vector). Thus, the invention also provides isolated nucleic acid molécules that encode the adénoviral vectors of the invention. The nucleic acid molécules of the invention can be in the form of RNA or in the form of DNA obtained by cloning or produced synthetically. The DNA can be double-stranded or single-stranded.

The adenovirus vectors useful the invention are typically réplication defective. In these embodiments, the virus is rendered replication-defective by délétion or inactivation of régions critical to réplication of the virus, such as the El région. The régions can be substantially deleted or inactivated by, for example, inserting the gene of interest (usually linked to a promoter). In some embodiments, the vectors of the invention can contain délétions in other régions, such as the E2, E3 or E4 régions or insertions of heterologous genes linked to a promoter. For E2- and/or E4-mutated adenoviruses, generally E2- and/or E4-complementing cell lines are used to generate recombinant adenoviruses. Mutations in the E3 région of the adenovirus need not be complemented by the cell line, since E3 is not required for réplication.

A packaging cell line is typically used to produce sufficient amount of adenovirus vectors of the invention. A packaging cell is a cell that comprises those genes that hâve been deleted or inactivated in a replication-defective vector, thus allowing the virus to replicate in the cell. Suitable cell lines include, for example, PER.C6, 911, 293, and El A549.

As noted above, a wide variety of filovirus glycoproteins can be expressed in the vectors. If required, the heterologous gene encoding the filovirus glycoproteins can be codonoptimized to ensure proper expression in the treated host (e.g., human). Codon-optimization is a technology widely applied in the art. Typically, the heterologous gene is cloned into the El and/or the E3 région of the adénoviral genome.

The heterologous filovirus gene can be under the control of (i.e., operably linked to) an adenovirus-derived promoter (e.g., the Major Late Promoter) or can be under the control of a heterologous promoter. Examples of suitable heterologous promoters include the CMV promoter and the RSV promoter. Preferably, the promoter is located upstream of the heterologous gene of interest within an expression cassette.

In a preferred embodiment of the présent invention, the rAd vector comprises the GP of a Marburg virus (MARV) or GPs substantially similar thereto.

Immunogenic Compositions

Immunogenic compositions are compositions comprising an immunologically effective amount of purified or partially purified adenovirus vectors for use in the invention. The vector comprises a nucleic acid encoding an antigenic protein of a Marburg virus. The antigenic protein of a Marburg virus encoded by the adenovirus in the first composition can be the same or different antigenic protein of a Marburg that is encoded by the adenovirus in the first composition. The adenovirus in the first composition and the adenovirus in the second composition can be identical or different.

In one embodiment of the invention, the adenovirus vector in the first composition comprises a nucleic acid encoding a GP from a Marburg virus, such as the GP of MARVAngola (e.g., that having the amino acid sequence of SEQ ID NO:3), or MARV- Musoke (e.g., that having the amino acid sequence of SEQ ID NO:4), and the adenovirus vector in the second composition comprises a nucleic acid encoding the same GP from the Marburg virus.

In another embodiment of the invention, the adenovirus vector comprises a nucleic acid encoding a GP from one isolate of Marburg virus, such as the GP of MARV-Angola (e.g., that having the amino acid sequence of SEQ ID NO:3), and the adenovirus vector in the second composition comprises a nucleic acid encoding a GP from a different isolate of Marburg virus, such as the GP of MARV- Musoke (e.g., that having the amino acid sequence of SEQ ID

NO:4), or vice versa.

Said compositions can be formulated as a vaccine (also referred to as an “immunogenic composition”) according to methods well known in the art. Such compositions can include adjuvants to enhance immune responses. The optimal ratios of each component in the formulation can be determined by techniques well known to those skilled in the art in view of the présent disclosure.

The préparation and use of immunogenic compositions are well known to those of skill in the art. Liquid pharmaceutical compositions generally include a liquid carrier such as water, petroleum, animal or vegetable oils, minerai oil or synthetic oil. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol can be included.

In addition to adenovirus vectors comprising a nucleic acid encoding an antigenic protein of a Marburg virus, the compositions of the invention can comprise other filovirus antigen(s) or nucleic acid encoding other filovirus antigen(s), or the priming or boosting inoculations can comprise other filovirus antigens or nucleic acid encoding other filovirus antigen(s). The other antigens and nucleic acids expressing the other antigens can be, for example, from one or more additional filovirus subtypes, such as Ebola. The nucleic acid encoding the other filovirus antigen(s) can be included in the same adenovirus vectors that encode the antigenic protein of a Marburg virus. They can also be présent on other vectors in the compositions or the priming or boosting inoculations.

The immunogenic compositions useful in the invention can comprise adjuvants.

Adjuvants suitable for co-administration in accordance with the présent invention should be ones that are potentially safe, well tolerated and effective in people including QS-21, DetoxPC, MPL- SE, MoGM-CSF, TiterMax-G, CRL- 1005, GERBU, TERamide, PSC97B, Adjumer, PG-026,GSK-I, GcMAF, B-alethine, MPC-026, Adjuvax, CpG ODN, Betafectin, Alum, and MF59.

Other adjuvants that can be administered include lectins, growth factors, cytokines and lymphokines such as alpha-interferon, gamma interferon, platelet derived growth factor (PDGF), granulocyte-colony stimulating factor (gCSF), granulocyte macrophage colony stimulating factor (gMCSF), tumor necrosis factor (TNF), epidermal growth factor (EGF), IL-I,

IL-2, IL-4, IL-6, IL-8, IL-IO, and IL-12 or encoding nucleic acids therefore.

The compositions of the invention can comprise a pharmaceutically acceptable excipient, carrier, buffer, stabilizer or other materials well known to those skilled in the art. Such materials should be non-toxic and should not interfère with the efficacy of the active ingrédient. The précisé nature of the carrier or other material can dépend on the route of administration, e.g., intramuscular, subcutaneous, oral, intravenous, cutaneous, intramucosal (e.g., gut), intranasal or intraperitoneal routes.

Method for Inducing Protective Immunity Against a Marburg virus Infection

The présent invention provides a method of priming and boosting an immune response to a Marburg virus in an individual using one or more adénoviral vectors for priming and boosting administrations.

According to one general aspect of the présent invention, a method of inducing an immune response against a Marburg virus in a subject comprises:

a. administering to the subject a first composition comprising an immunologically effective amount of an adenovirus vector comprising a nucleic acid encoding an antigenic protein of a Marburg virus; and

b. administering to the subject a second composition comprising an immunologically effective amount of an adenovirus vector comprising a nucleic acid encoding an antigenic protein of a Marburg virus, wherein steps (a) and (b) are conducted in either order. In a preferred embodiment the later step is conducted 1-12 weeks after the first step. In a more preferred embodiment the later step is conducted 4 or 8 weeks after the first step.

In one embodiment of the disclosed methods, a first adenovirus vector is used to prime the immune response, and a second adenovirus vector is used to boost the immune response about 1-12 weeks after the priming vaccination. Boosting compositions are generally administered weeks or months after administration of the priming composition, for example, about 1 or 2 weeks or 3 weeks, or 4 weeks, or 6 weeks, or 8 weeks, or 12 weeks, or 16 weeks, or 20 weeks, or 24 weeks, or 28 weeks, or 32 weeks or one to two years after administration of the priming composition. The first and second adenovirus vectors can be identical or different. The vectors can encode the same antigenic proteins or different antigenic proteins of the same or different Marburg virus.

In a preferred embodiment of the présent invention, the adenovirus vectors disclosed herein include a rAd26 or rAd35 vector. In one exemplary embodiment, an rAd26 vector is used to prime the immune response, and an rAd35 vector is used to boost the immune response, or vice versa. In another exemplary embodiment, an rAd26 vector is used to prime the immune response, and the rAd26 vector is used to boost the immune response. In yet another exemplary embodiment, an rAd35 vector is used to prime the immune response, and an rAd26 vector is used to boost the immune response. In yet another exemplary embodiment, an rAd35 vector is used to prime the immune response, and the rAd35 vector is used to boost the immune response.

In a more preferred embodiment according to this method, an rAd26 vector is used for the priming followed by a boosting with an rAd26 vector. Preferably, the boosting composition is administered 1-12 weeks after priming, more preferably 1, 2, 4 or 8 weeks after priming. In a preferred embodiment, the boosting composition is administered 8 weeks after priming. In another preferred embodiment, the boosting composition is administered 4 weeks after priming.

In a more preferred embodiment according to this method, an rAd26 vector is used for the priming followed by a boosting with a rAd35 vector. Preferably, the boosting composition is administered 1-12 weeks after priming, more preferably 1, 2, 4 or 8 weeks after priming. In a preferred embodiment, the boosting composition is administered 8 weeks after priming. In another preferred embodiment, the boosting composition is administered 1 week after priming. In another preferred embodiment, the boosting composition is administered 2 weeks after priming. In another preferred embodiment, the boosting composition is administered 4 weeks after priming.

The présent invention is also related to methods of inducing immune responses against a Marburg virus by priming and boosting the immune responses, with the same adenovirus vector or a combination of different adenovirus vectors.

According to another aspect of the présent invention, a method of inducing an immune response against a Marburg virus in a subject comprises:

a. administering to the subject an immunologically effective amount of a rAd26 or rAd35 vector comprising nucleic acids encoding a glycoprotein of a Marburg virus; and

b. administering to the subject an immunologically effective amount of one or more of rAd26 or rAd35 vectors comprising a plurality of nucleic acids encoding glycoproteins of one or more Marburg virus isolâtes, optionally also encoding NPs of one or more Marburg virus isolâtes, wherein steps (a) and (b) are conducted in either order, with one of steps being used to prime the immune response, and the other being used to boost the immune response, or vice versa.

Preferably, the boosting inoculation is administered 1-12 weeks after priming, more preferably 1, 2, 4 or 8 weeks after priming.

The antigens in the respective priming and boosting compositions (however many boosting compositions are employed) need not be identical, but should share antigenic déterminants or be substantially similar to each other.

Administration of the immunogenic compositions comprising the vectors is typically intramuscular or subcutaneous. However other modes of administration such as intravenous, cutaneous, intradermal or nasal can be envisaged as well. Intramuscular administration of the immunogenic compositions can be achieved by using a needle to inject a suspension of the adenovirus vector. An alternative is the use of a needleless injection device to administer the composition (using, e.g., Biojector(TM)) or a freeze-dried powder containing the vaccine.

For intravenous, cutaneous or subcutaneous injection, or injection at the site of affliction, the vector will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability. Those of skill in the art are well able to préparé suitable solutions using, for example, isotonie vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection. Preservatives, stabilizers, buffers, antioxidants and/or other additives can be included, as required. A slow-release formulation can also be employed. Typically, administration will hâve a prophylactic aim to generate an immune response against a filovirus antigen before infection or development of symptoms. Diseases and disorders that can be treated or prevented in accordance with the présent invention include those in which an immune response can play a protective or therapeutic rôle. In other embodiments, the adenovirus vectors in the first and second compositions can be administered for postexposure prophylactics.

The immunogenic compositions containing the adenovirus vectors are administered to a subject, giving rise to an anti-Marburg virus immune response in the subject. An amount of a composition sufficient to induce a détectable immune response is defined to be an immunologically effective dose. As shown below, the immunogenic compositions of the invention induce a humoral as well as a cell-mediated immune response. In a typical embodiment the immune response is a protective immune response.

The actual amount administered, and rate and time-course of administration, will dépend on the nature and severity of what is being treated. Prescription of treatment, e.g., decisions on dosage etc., is within the responsibility of general practitioners and other medical doctors, or in a veterinary context a veterinarian, and typically takes account of the disorder to be treated, the condition of the individual patient, the site of delivery, the method of administration and other factors known to practitioners. Examples of the techniques and protocols mentioned above can be found in Remington's Pharmaceutical Sciences, 16th édition, Osol, A. ed., 1980.

Following production of adenovirus vectors and optional formulation of such particles into compositions, the vectors can be administered to an individual, particularly human or other primate. Administration can be to humans, or another mammal, e.g., mouse, rat, hamster, guinea pig, rabbit, sheep, goat, pig, horse, cow, donkey, monkey, dog or cat. Delivery to a nonhuman mammal need not be for a therapeutic purpose, but can be for use in an experimental context, for instance in investigation of mechanisms of immune responses to the adenovirus vectors.

In one exemplary regimen, the adenovirus vector is administered (e.g., intramuscularly) in a volume ranging between about 100 μΐ to about 10 ml containing concentrations of about 10⁴ to 10¹² virus particles/ml. Preferably, the adenovirus vector is administered in a volume ranging between 0.25 and 1.0 ml. More preferably the adenovirus vector is administered in a volume of 0.5 ml.

Typically, the adenovirus is administered in an amount of about 10 to about 10 viral particles (vp) to a human subject during one administration, more typically in an amount of about 10¹⁰ to about 10¹² vp. In a preferred embodiment, the adenovirus vector is administered in an amount of about IxlO¹¹ vp. In another preferred embodiment, the adenovirus vector is administered in an amount of about 5x10¹⁰ vp. In another preferred embodiment, the adenovirus vector is administered in an amount of about 0.8xl0¹⁰ vp. In another preferred embodiment, the adenovirus vector is administered in an amount of about 2x10¹⁰ vp. In another preferred embodiment, the adenovirus vector is administered in an amount of about 4x10¹⁰ vp. The human adenovirus vector can be administered in a concentration of about 10 vp/ml, 10 vp/ml,

10⁹ vp/ml, 1O¹⁰ vp/ml, 5xlO¹⁰ vp/ml, 10¹¹ vp/ml, or 10¹² vp/ml.

The composition can, if desired, be presented in a kit, pack or dispenser, which can contain one or more unit dosage forms containing the active ingrédient. The kit, for example, can comprise métal or plastic foil, such as a blister pack. The kit, pack, or dispenser can be accompanied by instructions for administration.

The invention provides also the following non-limiting embodiments:

1. A vaccine combination comprising:

2. The vaccine combination according to embodiment 1, wherein the adenovirus vector in the first composition (i) comprises a GP of a first Marburg virus, and the adenovirus vector in the second composition (ii) comprises a GP of a second Marburg virus.

3. The vaccine combination according to embodiment 2, wherein the first Marburg virus and the second Marburg virus are identical.

4. The vaccine combination according to embodiment 2, wherein the first Marburg virus and the second Marburg virus are different.

5. The vaccine combination according to any of embodiments 1-4, wherein the adenovirus vector in the first composition (i) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3.

6. The vaccine combination according to any of embodiments 1-5, wherein the adenovirus vector in composition (ii) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 3.

7. The vaccine combination according to any of embodiments 1-5, wherein the adenovirus vector in composition (ii) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 4.

8. The vaccine combination according to any one of embodiments 1-7, wherein the adenovirus vectors are rAd26 or rAd35 vectors.

9. A vaccine combination comprising:

(i) a first composition comprising an immunologically effective amount of an rAd26 vector comprising a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3, together with a pharmaceutically acceptable carrier; and (ii) a second composition comprising an immunologically effective amount of an rAd26 or rAd35 vector comprising a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3 or SEQ ID NO:4, together with a pharmaceutically acceptable carrier, together with a pharmaceutically acceptable carrier;

wherein the first compositions is a priming composition and the second composition is a boosting composition.

10. The vaccine combination according to embodiment 9, wherein the rAd26 or rAd35 vector in composition (ii) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:4.

11. The vaccine combination according to embodiment 9, wherein the rAd26 or rAd35 vector in composition (ii) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3.

12. The vaccine combination according to any of embodiments 9-11, wherein composition (ii) comprises an rAd26 having a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3.

13. A vaccine combination according to any one of embodiments 1-12 for use in generating a protective immune response against at least one Marburg virus in a subject, wherein the first composition is used for priming said immune response and the second composition is used for boosting said immune response.

14. A vaccine combination according to any one of embodiments 1-12 for use in generating a protective immune response against at least one Marburg virus in a subject, wherein the second composition is used for priming said immune response and the first composition is used for boosting said immune response.

15. A method of inducing an immune response against a Marburg virus in a subject, the method comprising:

a. administering to the subject a first composition comprising an immunologically effective amount of a first adenovirus vector comprising a nucleic acid encoding an antigenic protein of a Marburg virus; and

b. administering to the subject a second composition comprising an immunologically effective amount of a second adenovirus vector comprising a nucleic acid encoding an antigenic protein of a Marburg virus.

wherein steps (a) and (b) are conducted in either order.

16. The method according to embodiment 15, wherein the adenovirus vector in the first composition (i) comprises a GP of a first Marburg virus, and the adenovirus vector in the second composition (ii) comprises a GP of a second Marburg virus.

17. The method according to embodiment 16, wherein the first Marburg virus and the second Marburg virus are identical.

18. The method according to embodiment 16, wherein the first Marburg virus and the second Marburg virus are different.

19. The method according to any of embodiments 15-18, wherein the adenovirus vector in the first composition (i) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3.

20. The method according to any of embodiments 15-19, wherein the adenovirus vector in composition (ii) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 3.

21. The method according to any of embodiments 15-19, wherein the adenovirus vector in composition (ii) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 4.

22. The method according to any one of embodiments 15-21, wherein the adenovirus vectors are rAd26 or rAd35 vectors.

23. The method according to any one of embodiments 15-22, wherein the adenovirus vectors are rAd26 vector.

24. The method according to any one of embodiments 15-23, wherein step (b) is conducted 1-12 weeks after step (a).

25. A method of inducing an immune response against a Marburg virus in a subject, the method comprising:

a. administering to the subject a first composition comprising an immunologically effective amount of an rAd26 vector comprising a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3; and

b. administering to the subject a second composition comprising an immunologically effective amount of an rAd26 or rAd35 vector comprising a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3 or SEQ ID NO:4.

wherein step (b) is conducted 1-12 weeks after step (a).

26. The method according to embodiment 25, wherein the rAd26 or rAd35 vector in the second composition comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:4.

27. The method according to embodiment 25, wherein the second composition comprises rAd26 having a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:4.

28. . The method according to embodiment 25, wherein the rAd26 or rAd35 vector in the second composition comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3.

29. The method according to embodiment 25, wherein the second composition comprises rAd26 having a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3.

30. A kit comprising:

a. a first composition comprising an immunologically effective amount of an adenovirus vector comprising a nucleic acid encoding an antigenic protein of a Marburg virus, together with a pharmaceutically acceptable carrier; and

b. a second composition comprising an immunologically effective amount of a second adenovirus vector comprising a nucleic acid encoding an antigenic protein of a Marburg virus, together with a pharmaceutically acceptable carrier;

31. The kit according to embodiment 30, wherein the adenovirus vector in the first composition (i) comprises a GP of a first Marburg virus, and the second adenovirus vector in the second composition (ii) comprises a GP of a second Marburg virus.

32. The kit according to embodiment 31, wherein the first Marburg virus and the second Marburg virus are identical.

33. The kit according to embodiment 31, wherein the first Marburg virus and the second Marburg virus are different.

34. The kit according to any of embodiments 30-33, wherein the adenovirus vector in the first composition (i) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3.

35. The kit according to any of embodiments 30-34, wherein the second adenovirus vector in composition (ii) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 3.

36. The kit according to any of embodiments 30-34, wherein the second adenovirus vector in composition (ii) comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 4.

37. The kit according to any one of embodiments 30-36, wherein the adenovirus vectors are rAd26 or rAd35 vectors.

38. A kit comprising:

(i) a first composition comprising an immunologically effective amount of an rAd26 vector comprising a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3, together with a pharmaceutically acceptable carrier; and (ii) a second composition comprising an immunologically effective amount of an rAd26 or aAd35 vector comprising a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:3 or SEQ ID NO:4, together with a pharmaceutically acceptable carrier, together with a pharmaceutically acceptable carrier;

39. The kit according to embodiment 38, wherein the rAd26 or aAd35 vector in the second composition comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:4.

40. The kit according to embodiment 38 or 39, wherein the rAd26 or aAd35 vector in the second composition comprises a nucleic acid encoding antigenic proteins having the amino acid sequences of SEQ ID NO: 3.

41. The kit according to embodiment 38 or 39, wherein the second composition comprises an rAd26 vector having a nucleic acid encoding antigenic proteins having the amino acid sequences of SEQ ID NO: 3.

42. The kit according to any one of embodiments 30-41 for use in generating a protective immune response against at least one Marburg virus in a subject, wherein the first composition is used for priming said immune response and the second composition is used for boosting said immune response.

43. The kit according to any one of embodiments 30-41 for use in generating a protective immune response against at least one Marburg virus in a subject, wherein the second composition is used for priming said immune response and the first composition is used for boosting said immune response.

44. A use of a vaccine combination according to any one of embodiments 1-12 for manufacturing a pharmaceutical composition or médicament for inducing an immune response against a Marburg virus in a subject, wherein the first composition is used for priming said immune response and the second composition is used for boosting said immune response.

45. A use of a vaccine combination according to any one of embodiments 1-12 for manufacturing a pharmaceutical composition or médicament for inducing an immune response against a Marburg virus in a subject, wherein the second composition is used for priming said immune response and the first composition is used for boosting said immune response.

46. A use of a kit according to any one of embodiments 30-41 for manufacturing a pharmaceutical composition or médicament for inducing an immune response against a Marburg virus in a subject, wherein the first composition is used for priming said immune response and the second composition is used for boosting said immune response.

47. A use of a kit according to any one of embodiments 30-41 for manufacturing a pharmaceutical composition or médicament for inducing an immune response against a Marburg virus in a subject, wherein the second composition is used for priming said immune response and the first composition is used for boosting said immune response.

The compositions of the invention can be administered alone or in combination with other treatments, either simultaneously or sequentially dépendent upon the condition to be treated.

EXAMPLES

The following examples are offered to illustrate, but not to limit the claimed invention.

Example 1

A study was performed to assess the immunogenicity and protective efficacy of a homologous prime-boost regimen with a 4 week interval between prime and boost, in Cynomolgus macaques (Macaca fascicularis) (NHPs). The regimen consisted of a trivalent Ad26 vaccine (Ad26.Filo, containing Ad26.MARVA, Ad26.ZEBOV and Ad26.SUDV) as a prime and the same trivalent Ad26 vaccine was administered 4 weeks later as a boost. Ail immunizations were performed intramuscularly.

Vaccine materials

The recombinant Ad26 vectors expressed EBOV Mayinga GP (SEQ ID NO:1), SUDV Gulu GP (SEQ ID NO:2) and MARV Angola GP (SEQ ID NO:3). Each rAd26 vector expressed one single antigenic protein (GP). The trivalent composition was made of 4x10¹⁰vector particles (vp) of each vector, for a total of 1.2x1ο¹¹ vp. In this study 5 NHP were included that were divided over 2 experimental groups (Table 1).

Table 1 : Experimental Grouping of Protection Study in Non-human Primates Challenged

With aerosolized MARV

Group	Prime (Week 0)	Boost (Week 4)	Total dose/ imm	Number ofNHP
A	Buffer	Ad26.empty	1.2xlOⁿvp	2
B	Ad26.ZEBOV Ad26.SUDV Ad26.MARVA	Ad26.ZEBOV Ad26.SUDV Ad26.MARVA	1.2x10¹ ‘vp (4x10¹⁰ vp each)	3

Abbreviations: vp: viral particles.

Immunogenicity

Immune response was assessed using a MARV GP-specific Enzyme Linked Immunosorbent Assay (ELISA) on sérum samples taken at 3 and 4 weeks post prime and 2 and 3 week post boost. This ELISA, performed at Texas Biomed Research Institute, uses lectin coated plates to capture a recombinant MARV Angola GP from crude supematant. As expected, no antibody response was observed in NHP immunized with the control vector (Figure 1, triangles). The prime-immunization with the trivalent Ad26.Filo vectors induced a MARV GP spécifie antibody response in ail animais (Figure 1, circles) as shown in Figure 1. The boost effect was noticeable in 2/3 animais for MARVA GP.

Protective efficacy

Ail animais were challenged 4 weeks after the last immunization with a target of 1000 pfu of MARV Angola wild-type P3 challenge virus via the intramuscular route in a Biosafety Level 4 containment unit. Négative controls (group A) succumbed to the infection by day 9 postchallenge, in line with historical controls. Animais immunized with homologous Ad26 prime/boost immunization survived until the end of the experiment (group B, figure 2B) and had very limited signs of disease as evidenced by low clinical scores (figure 2A)

Example 2

The immunogenicity of the monovalent Ad26.MARVA homologous prime boost was confirmed in a separate experiment, in which 5 NHP were immunized with Ad26.MARVA at IxlO¹¹ vp on day 0 and boosted with the same vaccine dose on day 56. In this study, MARV GP spécifie immune response was determined at 4 and 8 weeks post prime, and at 3 and 5 weeks post boost using a MARV GP-specific ELISA. This ELISA was performed at Battelle Biomédical Research Center using purified recombinant MARV Angola GP directly coated on the ELISA plate. In line with the immunogenicity data from Figure 1 (Example 1), a MARV GP-specific Antibody response was induced in ail animais (5/5) primed with Ad26.MARVA, but not in négative control animais, which were immunized with saline. The response could be boosted in ail animais receiving a second dose of Ad26.MARVA (Figure 3).

Example 3

A study will be performed to assess the immunogenicity and protective efficacy of a homologous prime-boost regimens at 0-8 week intervals in Cynomolgus macaques (Macaca fascicularis) (NHPs). The regimen will comprised a monovalent Ad26.MARVA vaccine as a prime and a monovalent Ad26.MARVA vaccine as a boost. Ail immunizations will be performed intramuscularly.

Vaccine materials

The Ad26.MARVA vector expresses the MARV Angola GP (SEQ ID NO:3).

Ad26.MARVA (IxlO¹¹ vp) will be used as a prime and boost for the 0-8 week regimen (6 NHPs). One additional group of 2 NHPs will be immunized with saline and TBS as négative immunization control for the study. The grouping of this study is summarized in Table 1.A11 animais will be challenged 6 weeks after the last immunization with 1000 pfu of MARV Angola wild-type P3 challenge virus via the aérosol route in a Biosafety Level 4 laboratory.

Table 2: Experimental Grouping of Protection Study in Non-human Primates Challenged With aerosolized MARV

Group	Immunization 1 (Dose 1)	Immunization 2 (Dose 2)	Immunization Schedule (Weeks)	Challenge After 6 Weeks	Group Size N
1	négative control (Saline)	négative	0-8	MARV	2
	control (saline)		(Angola)
2	Ad26.	Ad26.	0-8	MARV	6
	MARVA	MARVA		(Angola)
	(IxlO¹¹ vp)	(IxlO¹¹ vp)

Abbreviations: TBS: Tris-buffered saline; Inf.U.: Infections Unit; vp: viral particles.

Endpoints in this study will be survival/nonsurvival. Nonsurvival is defined by an animal having terminal illness or being moribund and requiring humane termination. Animais’ health will be evaluated on a daily clinical observation score sheet.

Immunogenicity

Blood will be sampled prior to each immunization and 1, 3 and 5 weeks after the last immunization for analyses of the immune response. The immune response in NHP will be characterized with respect to Filovirus GP-binding and neutralizing antibodies (ELISA) as well as cytokine producing T cells (ELISpot and Intracellular Cytokine Staining).

EDTA or heparin whole blood will be collected and processed for PBMC and plasma. PBMC will be used in an IFN-γ ELISPOT and an Intracellular Cytokine Staining assay using Marburg Angola GP peptides (15-mers overlapping by 11, spanning the entire MARV Angola GP) together with a DMSO only négative control and a stimulation positive control. Additionally, whole blood without anticoagulant will be processed for sérum to be assayed in a MARVA GP spécifie ELISA and Virus Neutralization Assay.

Example 4

A clinical study will be performed in humans for evaluating the safety, tolerability and immunogenicity of a regimen using Ad26.MARVA as a homologous prime boost at a dose of IxlO¹¹ vp.

The study will be a randomized, placebo-controlled, observer-blind study being conducted in 18 healthy adult subjects who never received an experimental Filovirus candidate vaccine before and hâve no known exposure to a Filovirus or diagnosis of Filovirus disease. In this study 1 regimen will be tested: Ad26.MARVA as prime and as boost at a 56-day interval.

The study will consist of a vaccination period in which subjects will be vaccinated at baseline (Day 1) followed by a boost on Day 57, and a post-boost follow-up until ail subjects hâve had their 35-day post-boost visit (Day 92) or discontinued earlier.

Subjects will be enrolled into 1 group of 18 healthy subjects. Subjects will be randomized in a 5:1 ratio to receive active vaccine or placebo (0.9% saline) through IM injections (0.5 ml).

The exemplary study vaccination schedules are summarized in Table 2.

Table 3 : Study Vaccination Schedules

Group	N	Day 1	Day 57
1	18	15	Ad26.MARVA lxlO¹¹ vp	Ad26.MARVA lxlO¹¹ vp
3	placebo (0.9% saline)	placebo (0.9% saline)

N: number of subjects to receive study vaccine;

TCID50: 50% Tissue Culture Infective Dose; vp: viral particles

Vaccine materials

The Ad26.MARVA vector expresses the MARV Angola GP (SEQ ID NO:3).

Safety will be assessed by collection of solicited local and systemic adverse events, unsolicited adverse events and serions adverse events, and by physical examination. In addition, standard 10 chemistry, hématologie (including coagulation parameters) and urinalysis parameters will be assessed at multiple time points.

Immunogenicity will be assessed using the immunologie assays summarized in Tables 4 and 5. The exploratory assay package may include, but is not limited to, the listed assays.

Table 4: Summary of Immunologie Assays (Serology)

Assay	Purpose
Secondary endpoints ELISA	Analysis of antibodies binding to MARV GP
Exploratory endpoints Virus neutralization assay Adenovirus neutralization assay	Analysis of neutralizing antibodies to MARV GP Neutralizing antibodies to adenovirus

MARV: Marburg virus; ELIS A: enzyme-linked immunosorbent assay; GP: glycoprotein;

Table 5 : Summary of Immunologie Assays (Cellular)

Assay	Purpose
Exploratory endpoints ELISpot ICS of frozen PBMC	T-cell IFN-γ responses to MARV GP Analysis of T-cell responses to MARV GP (including CD4/8, IL-2, IFN-γ, TNF-α and/or activation markers)
MARV: Marburg virus;	ELISpot: enzyme-linked immunospot; GP: glycoprotein;

ICS: intracellular cytokine staining; IFN: interferon; IL: interleukin; PBMC: peripheral blood mononuclear cells; TNF: tumor necrosis factor

It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims.

SEQUENCE LISTING

SEQ ID NQ:1

Glycoprotein Ebola virus Zaire, strain Mayinga (Amino Acid sequence):

MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLR SVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDG IRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKD FFSSHPLREPVNATEDPSSGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQL NETIYTSGKRSNTTGKLIWKVNPEIDTTIGEWAFWETKKNLTRKIRSEELSFTVVSNGAKNISG QSPARTSSDPGTNTTTEDHKIMASENSSAMVQVHSQGREAAVSHLTTLATISTSPQSLTTKPGP DNSTHNTPVYKLDISEATQVEQHHRRTDNDSTASDTPSATTAAGPPKAENTNTSKSTDFLDPAT TTSPQNHSETAGNNNTHHQDTGEESASSGKLGLITNTIAGVAGLITGGRRTRREAIVNAQPKCN PNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHNQDGLICGLRQLANETTQALQLFLRAT TELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDFVDKTLPDQGD NDNWWTGWRQWIPAGIGVTGVIIAVIALFCICKFVF

SEQ ID NO:2

Glycoprotein Ebola virus Sudan, strain Gulu (Amino Acid sequence):

MGGLSLLQLPRDKFRKSSFFVWVIILFQKAFSMPLGVVTNSTLEVTEIDQLVCKDHLASTDQLK SVGLNLEGSGVSTDIPSATKRWGFRSGVPPKVVSYEAGEWAENCYNLEIKKPDGSECLPPPPDG VRGFPRCRYVHKAQGTGPCPGDYAFHKDGAFFLYDRLASTVIYRGVNFAEGVIAFLILAKPKET FLQSPPIREAVNYTENTSSYYATSYLEYEIENFGAQHSTTLFKIDNNTFVRLDRPHTPQFLFQL NDTIHLHQQLSNTTGRLIWTLDANINADIGEWAFWENKKNLSEQLRGEELSFEALSLNETEDDD AASSRITKGRISDRATRKYSDLVPKNSPGMVPLHIPEGETTLPSQNSTEGRRVGVNTQETITET AATIIGTNGNHMQISTIGIRPSSSQIPSSSPTTAPSPEAQTPTTHTSGPSVMATEEPTTPPGSS PGPTTEAPTLTTPENITTAVKTVLPQESTSNGLITSTVTGILGSLGLRKRSRRQTNTKATGKCN PNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRAT TELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPNQDN DDNWWTGWRQWIPAGIGITGIIIAIIALLCVCKLLC

SEQ ID NO:3

Glycoprotein Marburg virus Angola (Amino Acid sequence):

MKTTCLLISLILIQGVKTLPILEIASNIQPQNVDSVCSGTLQKTEDVHLMGFTLSGQKVADSPL EASKRWAFRAGVPPKNVEYTEGEEAKTCYNISVTDPSGKSLLLDPPTNIRDYPKCKTIHHIQGQ NPHAQGIALHLWGAFFLYDRIASTTMYRGKVFTEGNIAAMIVNKTVHKMIFSRQGQGYRHMNLT STNKYWTSSNGTQTNDTGCFGTLQEYNSTKNQTCAPSKKPLPLPTAHPEVKLTSTSTDATKLNT TDPNSDDEDLTTSGSGSGEQEPYTTSDAATKQGLSSTMPPTPSPQPSTPQQGGNNTNHSQGVVT EPGKTNTTAQPSMPPHNTTTISTNNTSKHNLSTPSVPIQNATNYNTQSTAPENEQTSAPSKTTL LPTENPTTAKSTNSTKSPTTTVPNTTNKYSTSPSPTPNSTAQHLVYFRRKRNILWREGDMFPFL DGLINAPIDFDPVPNTKTIFDESSSSGASAEEDQHASPNISLTLSYFPKVNENTAHSGENENDC DAELRIWSVQEDDLAAGLSWIPFFGPGIEGLYTAGLIKNQNNLVCRLRRLANQTAKSLELLLRV TTEERTFSLINRHAIDFLLARWGGTCKVLGPDCCIGIEDLSRNISEQIDQIKKDEQKEGTGWGL GGKWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG

SEQ ID NO:4

Glycoprotein Marburg virus Musoke (Amino Acid sequence):

MKTTCFLISLILIQGTKNLPILEIASNNQPQNVDSVCSGTLQKTEDVHLMGFTLSGQKVADSPL EASKRWAFRTGVPPKNVEYTEGEEAKTCYNISVTDPSGKSLLLDPPTNIRDYPKCKTIHHIQGQ NPHAQGIALHLWGAFFLYDRIASTTMYRGKVFTEGNIAAMIVNKTVHKMIFSRQGQGYRHMNLT STNKYWTSSNGTQTNDTGCFGALQEYNSTKNQTCAPSKIPPPLPTARPEIKLTSTPTDATKLNT TDPSSDDEDLATSGSGSGEREPHTTSDAVTKQGLSSTMPPTPSPQPSTPQQGGNNTNHSQDAVT ELDKNNTTAQPSMPPHNTTTISTNNTSKHNFSTLSAPLQNTTNDNTQSTITENEQTSAPSITTL PPTGNPTTAKSTSSKKGPATTAPNTTNEHFTSPPPTPSSTAQHLVYFRRKRSILWREGDMFPFL DGLINAPIDFDPVPNTKTIFDESSSSGASAEEDQHASPNISLTLSYFPNINENTAYSGENENDC DAELRIWSVQEDDLAAGLSWIPFFGPGIEGLYTAVLIKNQNNLVCRLRRLANQTAKSLELLLRV TTEERTFSLINRHAIDFLLTRWGGTCKVLGPDCCIGIEDLSKNISEQIDQIKKDEQKEGTGWGL GGKWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG

SEQ ID NO:5

Nucleoprotein Ebola virus Taï Forest / Ivory coast (Amino Acid sequence):

MESRAHKAWMTHTASGFETDYHKILTAGLSVQQGIVRQRVIQVHQVTNLEEICQLIIQAFEAGV DFQESADSFLLMLCLHHAYQGDYKQFLESNAVKYLEGHGFRFEVRKKEGVKRLEELLPAASSGK SIRRTLAAMPEEETTEANAGQFLSFASLFLPKLVVGEKACLEKVQRQIQVHSEQGLIQYPTAWQ SVGHMMVIFRLMRTNFLIKFLLIHQGMHMVAGHDANDAVIANSVAQARFSGLLIVKTVLDHILQ KTEHGVRLHPLARTAKVKNEVNSFKAALSSLAQHGEYAPFARLLNLSGVNNLEHGLFPQLSAIA LGVATAHGSTLAGVNVGEQYQQLREAATEAEKQLQKYAESRELDHLGLDDQEKKILKDFHQKKN EISFQQTTAMVTLRKERLAKLTEAITSTSLLKTGKQYDDDNDIPFPGPINDNENSEQQDDDPTD SQDTTIPDIIVDPDDGRYNNYGDYPSETANAPEDLVLFDLEDGDEDDHRPSSSSENNNKHSLTG TDSNKTSNWNRNPTNMPKKDSTQNNDNPAQRAQEYARDNIQDTPTPHRALTPISEETGSNGHNE DDIDSIPPLESDEENNTETTITTTKNTTAPPAPVYRSNSEKEPLPQEKSQKQPNQVSGSENTDN KPHSEQSVEEMYRHILQTQGPFDAILYYYMMTEEPIVFSTSDGKEYVYPDSLEGEHPPWLSEKE ALNEDNRFITMDDQQFYWPVMNHRNKFMAILQHHK

Claims

1. A vaccine combination comprising

a. a first composition comprising an immunologically effective amount of a first adenovirus vector comprising a nucleic acid encoding a first antigenic protein of a Marburg virus, together with a pharmaceutically acceptable carrier; and

b. a second composition comprising an immunologically effective amount of a second adenovirus vector comprising a nucleic acid encoding a second antigenic protein of a Marburg virus;

2. The vaccine combination according to claim 1, wherein the first adenovirus vector comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO:

3.

’ 3. The vaccine combination according to claim 1 or 2, wherein the second adenovirus vector comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 3 or SEQ ID NO:4.

4. The vaccine combination according to any one of claims 1-3, wherein the second adenovirus vector comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 3.

5. The vaccine combination according to any one of claims 1-4, wherein the adenovirus vectors are rAd26 or rAd35 vectors.

6. The vaccine combination according to any one of claims 1-5 for use in generating a protective immune response against at least one Marburg virus in a subject, wherein the first composition is used for priming said immune response and the second composition is used for boosting said immune response.

7. The vaccine combination according to any one of claims 1-5 for use in generating a protective immune response against at least one Marburg virus in a subject, wherein the second composition is used for priming said immune response and the first composition is used for boosting said immune response.

8. Use of

a. a first composition comprising an immunologically effective amount of a first adenovirus vector comprising a nucleic acid encoding a first antigenic protein of a Marburg virus; and

in the manufacture of an agent for inducing an immune response against a Marburg virus in a subject:

9. The use according to claim 8, wherein the first adenovirus vector comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ IDNO:3.

10. The use according to claim 8 or 9, wherein the second adenovirus vector comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 3 or SEQ ID NO:4.

11. The use according to any one of claims 8-10, wherein the second adenovirus vector comprises a nucleic acid encoding an antigenic protein having the amino acid sequence of SEQ ID NO: 3.

12. The use according to any one of claims 8-11, wherein the adenovirus vectors are rAd26 or rAd35 vectors.

13. The use according to any one of claims 8-12, wherein said second composition is to be administered 1-12 weeks after said first composition.

14. A kit comprising:

15. The kit according to claim 14, wherein the first adenovirus vector comprises a nucleic acid encoding a first antigenic protein having the amino acid sequence of SEQ ID NO:3.

16. The kit according to claim 14 or 15, wherein the second adenovirus vector comprises a nucleic acid encoding a second antigenic protein having the amino acid sequence of SEQ ID NO: 3 or SEQ ID NO:4.

17. The kit according to any one of claims 14-16, wherein the second adenovirus vector comprises a nucleic acid encoding a second antigenic protein having the amino acid sequence of SEQ ID NO: 3.

18. The kit according to any one of claims 14-17, wherein the adenovirus vectors are rAd26 or rAd35 vectors.

19. The kit according to any one of claims 14-18, for use in generating a protective immune response against at least one Marburg virus in a subject, wherein the first composition is used for priming said immune response and the second composition is used for boosting said immune response.

20. The kit according to any one of claims 14-18, for use in generating a protective immune response against at least one Marburg virus in a subject, wherein the second composition is used for priming said immune response and the first composition is used for boosting said immune response.

21. A use of the vaccine combination according to any one of claims 1-5

5 or the kit according to any one of claims 14-18 for manufacturing a pharmaceutical composition or médicament for inducing an immune response against a Marburg virus in a subject, wherein the first composition is used for priming said immune response and the second composition is used for boosting said immune response.

22. A use of the vaccine combination according to any one of claims 1-5 or

10 the kit according to any one of claims 14-18 for manufacturing a pharmaceutical composition or médicament for inducing an immune response against a Marburg virus in a subject, wherein the second composition is used for priming said immune response and the first composition is used for boosting said immune response.