OA19081A - HIV vaccine formulation. - Google Patents
HIV vaccine formulation. Download PDFInfo
- Publication number
- OA19081A OA19081A OA1201800495 OA19081A OA 19081 A OA19081 A OA 19081A OA 1201800495 OA1201800495 OA 1201800495 OA 19081 A OA19081 A OA 19081A
- Authority
- OA
- OAPI
- Prior art keywords
- hiv
- immunogenic composition
- protein
- seq
- gpl40 protein
- Prior art date
Links
Abstract
Immunogenic compositions containing a human immunodeficiency virus (HIV) gpl 40 protein, sorbitol, polysorbate 20, and histidine buffer are described. The described immunogenic compositions are advantageous in that they are stable at refrigerated temperature for extended periods of time, and are compatible with an adjuvant. Also described are methods of using the immunogenic compositions to induce an immune response against an HIV in a subject. The immunogenic compositions can be administered alone, or in combination with one or more additional HIV antigens, or one or more adenovirus vectors encoding the one or more additional HIV antigens.
Description
Janssen Vaccines & Prévention B.V.
HIV Vaccine Formulation
BACKGROUND OF THE INVENTION
[0001] Human Immunodeficiency Virus (HIV) affects millions of people worldwide, and the prévention of HIV through an efficaçious vaccine remains a very high priority, even in an era of widespread antirétroviral treatment. HIV-1 is the most common and pathogenic strain of the virus, with more than 90% of HIV/AIDS cases deriving from infection with HIV-1 group M. The M group is subdivided further into clades or subtypes. An effîcacious vaccine ideally would be capable of eliciting both potent cellular responses and broadly neutralizing antibodies capable of neutralizing HIV-1 strains from different clades.
[0002] The high genetic variability of HIV-1 makes the development of a HIV-1 vaccine an unprecedented challenge. In order to improve coverage of potential T-cell epitopes, and improve cellular responses, “mosaic” HIV-1 Gag,Pol and Env antigens, derived from HIV Group Antigen (Gag), Polymerase (Pol), and Envelope (Env) proteins, were described by others and developed in an attempt to provide maximal coverage of potential T-cell epitopes (e.g., Barouch et al, Nat Med 2010, 16: 319-323). The mosaic antigens are similar in length and domain structure to wild-type, naturally occurring HIV-1 antigens. .
[0003] Sequences encoding mosaic antigens hâve, been cloned in vectors, for example, such as recombinant adenovirus serotype 26 (rAd26), and these recombinant vectors hâve been used in vaccines to generate immune responses against HIV (see e.g. Barouch et al, supra', and WO 2010/059732). Viral vectors expressing such mosaic HIV antigens hâve proven to be effective in eliciting an immune response against HIV infection.
[0004] Another therapeutic strategy that has been explored for inducing immune responses against HIV is the use of trimeric HIV envelope proteins as immunogens in vaccines, such as gpl40. The native envelope spike on the surface of HIV is trimeric. Examples of trimeric envelope proteins include clade C gpl40 protein, and a mosaic envelope trimer:protein,:such as those disclosed in WO 2014/042942 and WO 2014/107744. [0010] CladeC gpT40 protein has previously been described e.g. in WO 2010/042942 and in Nkolola et al. 2010, but there was no focus on any pharmaceutical formulation work in those disclosures. The protein was in phosphate-buffered saline (PBS) in some of the experiments in those disclosures. Mosaic gpl40 has been described previously e.g. in WO 2014/107744 and in Nkolola et al 2014, but again there was no focus on any pharmaceutical formulation work in those disclosures. The protein was in 25 mM Tris pH 7.5 and 150 mM NaCl in some of the experiments in those disclosures.
[0011] Trimeric HIV envelope proteins, such as gpl40, are capable of inducing potent immune responses. Such envelope proteins can also be administered in combination with other HIV antigens, such as mosaic antigens, to provide enhanced immunity against HIV. However, the stability of the HIV envelope proteins as trimers is not optimal under conditions typically used for clinical and commercial manufacturing. The trimeric HIV envelope proteins are susceptible to both chemical and physical dégradation. Moreover, many different factors, such as the buffer formulation, can affect the stability of proteins, and the effects are often unpredictable. For example, the use of HEPES buffer in protein formulations has been shown to resuit in génération of hydrogen peroxide when exposed to ambient light during the manufacturing process, which can impact the stability of the protein as well as other components in the formulation, such as surfactants. See, e.g., Baicu et al. Cryobiology (2002) 45(1) 33-48; Lepe-Zuniga et al. J. Immunol. Methods (1987) 103(1), 145; and Zigler et al. In Vitro Cell. Dev. Biol. (1985) 21(5), 282-287. It is désirable to hâve an HIV vaccine gpl40 formulation that would be suitable for stability of different variants of gpl40 protein, such as Clade C or mosaic gpl40, and preferably with Aluminum Phosphate adjuvant as a single vial drug product (rather than being entirely dépendent upon pharmacy mixing immediately prior to delivery of the vaccine), and in addition would enable drug product manufacturing meeting large late phase and commercial scale demands. It is generally unpredictable which combination of ingrédients will resuit in a formulation that meets ail these requirements.
[0012] Accordingly, there is a need in the art for improved formulations of HIV gpl40 proteins with better stability under conditions used for clinical and commercial manufacturing in order to realize the fiill therapeutic potential of such trimeric envelope proteins. These formulations should also be compatible for use with additional HIV antigen(s), including vectors expressing HIV antigen(s), and/or adjuvants.
BRIEF SUMMARY OF THE INVENTION
[0005] The invention relates to immunogenic compositions of HIV gpl40 proteins that hâve improved stability. The immunogenic compositions of the invention can be stored under refrigerated conditions for extended periods of time, and are more optimal for use in clinical and commercial manufacturing. The immunogenic compositions of the invention can also include an adjuvant. The invention also relates to methods of preparing the immunogenic compositions, and methods of using the immunogenic compositions to induce an immune response against HIV.
[0006] In one general aspect, the invention relates to an immunogenic composition comprising, relative to the total volume of the composition:
a. 0.05 mg/mL to 5 mg/mL of an HIV gpl40 protein;
b. 2% to 15% (w/v) sorbitol;
c. 0.01 to 0.05% (w/v) polysorbate 20; and
d. 5 to 20 mM histidine buffer at a pH of 5.5 to 7.0.
[0010] Preferably, an immunogenic composition according to an embodiment of the invention comprises a stabilized trimeric HIV gpl40 protein, such as an HIV gpl40 protein comprising the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2.
[0011] In particular embodiments of the invention, the immunogenic composition comprises 0.2 mg/mL to 1 mg/mL of an HIV gpl40 protein.
[0012] In particular embodiments, an immunogenic composition according to an embodiment of the invention comprises 5% (w/v) to 12% (w/v) sorbitol.
[0013] In particular embodiments, the immunogenic composition comprises 0.02% (w/v) polysorbate 20.
[0014] In particular embodiments, the immunogenic composition comprises 10 mM histidine buffer at a pH of 6.5.
[0015] According to embodiments of the invention, the immunogenic composition can further comprise an adjuvant, such as aluminum phosphate adjuvant. In certain of such embodiments, aluminum phosphate may be présent in the composition at a concentration of 0.7-5.0 mg/mL, e.g. 0.8-4.0 mg/mL, e.g. 0.85 mg/mL, 1 mg/mL, 1.5 mg/mL, 2.0 mg/mL, 2.5 mg/mL, 3.0 mg/mL, 3.5 mg/mL. 3.84 mg/mL, 4.0 mg/mL. In certain embodiments, aluminum phosphate is présent in the immunogenic compositions at a concentration of 0.85 mg/mL. In certain embodiments, aluminum phosphate is présent in. the immunogenic compositions at a concentration of 3.84 mg/mL.
[0016] In a preferred embodiment of the invention, an immunogenic composition comprises, relative to a total volume of the composition,
a. 0.2 mg/mL to 1 mg/mL of an HIV gpl40 protein comprising the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2
b. 5% to 12% (w/v) sorbitol;
c. 0.02% (w/v) polysorbate 20;
d. 10 mM histidine buffer at a pH of 6.5; and
e. aluminum phosphate adjuvant, preferably at a concentration of 0.7-4.0 mg/mL.
[0017] In another general aspect, the invention relates to a method of preparing an immunogenic composition comprising admixing:
a. 0.05 mg/mL to 5 mg/mL of an HIV gpl40 protein;
b. 2% to 15% (w/v) sorbitol;
c. 0.01 to 0.05% polysorbate 20; and
d. 5 to 20 mM histidine buffer at a pH of 5.5 to 7.0;
to thereby obtain the immunogenic composition.
[0018] In certain embodiments, the immunogenic composition of the invention comprises aluminum phosphate adjuvant, preferably at a concentration of 0.7-4.0 mg/mL, and is stable upon storage at a température of 2-8°C, for at least one month, preferably at least 2, 3, 4, 5, 6 months, more preferably at least 7, 8, 9, 10, 11,12 months, still more preferably at least 13, 14, 15, 16, 17,18,19, 20, 21, 22, 23, 24 months, most preferably at least 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36 months or longer, e.g. 1-72 months, e.g. 6-48 months, e.g. 12-36 months. In certain embodiments, the immunogenic composition of the invention comprises aluminum phosphate adjuvant, preferably at a concentration of 0.7-4.0 mg/mL, and is stable at a température of 25°C for at least 6 months, e.g. 6-12 months, or 6-24 months. In certain embodiments, the immunogenic composition of the invention comprises aluminum phosphate adjuvant, preferably at a concentration of 0.7-4.0 mg/mL, and is stable at a température of 40°C for at least 1 week, e.g. 1-12 weeks, e.g. at least 2 weeks, 3 weeks, 4 weeks, 1 month,
e.g. 1-2 months, 1-3 months, or 3-6 months.
[0019] And in another general aspect, the invention relates to a method of inducing an immune response against a human immunodeficiency virus (HIV) in a subject in need thereof, comprising administering to the subject an effective amount of an immunogenic composition of the invention.
[0020] In a particular embodiment, a method of inducing an immune response against an HIV comprises administering to a subject in need thereof an immunogenic composition comprising, relative to the total volume of the composition,
a. 0.2 mg/mL to 1 mg/mL of an HIV gpl40 protein comprising the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2;
b. 5% to 12% (w/v) sorbitol;
c. 0.02% polysorbate 20;
d. 10 mM histidine buffer at a pH of 6.5; and
e. aluminum phosphate adjuvant, preferably at a concentration of 0.7-4.0 mg/mL.
[0021 ] In certain embodiments of the invention, a method of inducing an immune response against an HIV further comprises administering to the subject an effective amount of a second immunogenic composition comprising or encoding one or more additional HIV antigens, such as those comprising or encoding an amino acid sequence ofSEQ ID NOs: 3-
12. Preferably, the method comprises administering one or more vectors, preferably adenovirus 26 vectors, encoding one or more HIV antigens, such as those comprising an amino acid sequence ofSEQ ID NOs: 3-12. Methods of inducing an immune response against an HIV can also comprise administering one or more MVA vectors encoding one or more HIV antigens, such as those comprising an amino acid sequence of SEQ ID NOs: 3-12. The one or more additional HIV antigens can also comprise SEQ ID NO: 11 having one or more mutations selected from the group consisting of (i) I529P (Ile to Pro at position 529), (ii) K480E (Lys to Glu at position 480), and (iii) a combination of EK479-480RRRR (i.e. replacing GluLys at position 479 and 480 by four consecutive Arg residues), I529P (Ile to Pro at position 529), A471C (Ala to Cys at position 471) and T575C (Thr to Cys at position 575). In one embodiment, the antigen comprising SEQ ID NO: 11 comprises SEQ ID NO: 12. [0022] In another general aspect, the invention relates to a method for preparing a longterm, storage stable immunogenic composition that comprises HIV gpl40 protein, the method comprising:
(i) admixing the following components to create an immunogenic composition comprising these components in amounts relative to the total volume of the composition:
(a) 0.05 mg/mL to 5 mg/mL of an HIV gpl40 protein;
(b) 2% to 15% (w/v) sorbitol;
(c) 0.01 to 0.05% (w/v) polysorbate 20; and (d) 5 to 20 mM histidine buffer at a pH of 5.5 to 7.0, (e) water, (f) aluminum phosphate adjuvant, preferably at a concentration of 0.7-4.0 mg/mL;
and (ii) storing the composition at 2-8°C for at least one month, e.g. 1-72 months, e.g. 6-48 months, e.g. 12-36 months.
BRIEF DESCRIPTION OF THE FIGURES
[0023] The foregoing summary, as well as the following detailed description of the invention, will be better understood when read in conjunction with the appended drawings. It should be understood that the invention is not limited to the précisé embodiments shown in the drawings.
[0024] In the figures:
[0025] Figs. 1A and IB show the results of SolvoVPE analysis of HIV gpl40 protein formulations prepared with acetate buffer, phosphate buffer, and histidine buffer, and dynamic light scattering (DLS) analysis of HIV gpl40 protein formulations prepared with sorbitol and sucrose; in particular:
Fig. IA shows the results of the SolvoVPE analysis; the change in absorbance at 350 nm (turbidity) is plotted against the change in absorbance at 280 nm (concentration); data points indicate the change between samples analyzed at time 0 (To) and after stressing the samples at 40 °C for 24 hours (T24); SolvoVPE analysis was performed as described in Example 1 ;
Fig. IB shows the results of the DLS analysis; the change in radius (Rh) from time 0 (To) at 20°C to time 7 days (T7 days) at 70°C is plotted by sugar (sucrose vs. sorbitol); DLS analysis was performed as described in Example 1 ;
[0026] Figs. 2A-2F show the results of high-performance size exclusion chromatography (HP-SEC) analysis of HIV gpl40 formulations as described in Example 2; the relative amount of hexamer, trimer and high/low molecular weight species of HIV clade C gpl40 protein was determined by HP-SEC of samples analyzed at time 0 (To) and after stressing the samples at 40°C for 24 hours (T24); “Tri +Hex” refers to the relative amount of trimer and hexamer species of HIV clade C gpl40 protein; “LMW” refers to low molecular weight species, e.g., cleavage or dégradation products, in particular:
Fig. 2A shows the relative amount (%) of hexamer and trimer species of HIV clade C gpl40 protein in To samples at different protein concentrations (0.2 mg/rnL and 1.0 mg/mL);
Fig. 2B shows the relative amount (%) of hexamer and trimer species of HIV gpl40 clade C protein in To samples at different concentrations of surfactant (0.02% and 0.1%); the data shown is a combination of data collected from samples containing PS20 and samples containing PS 80;
Fig. 2C shows the relative amount (%) of hexamer and trimer species of HIV clade C gpl40 protein in T24 samples at different protein concentrations (0.2 mg/mL and 1.0 mg/mL);
Fig. 2D shows the relative amount (%) of hexamer and trimer species of HIV gpl40 clade C protein in T24 samples at different concentrations of surfactant (0.02% and 0.1%); the data shown is a combination of data collected from samples containing PS20 and samples containing PS80;
Fig. 2E shows the relative amount (%) of low molecular weight species of HIV clade C gpl40 protein based on surfactant type (PS20 versus PS80) in To samples;
Fig. 2F shows the relative amount (%) of low molecular weight species of HIV gpl40 clade C protein in T24 samples at different concentrations of surfactant;
[0027] Figs. 3A and 3B show the results of stability studies of HIV gpl40 protein formulations according to embodiments of the invention; HIV mosaic gpl40 protein formulations were subjected to multiple freeze-thaw cycles as described in Example 3;
Fig. 3A shows the protein concentration after one, three, and five freeze-thaw cycles as determined by measuring the absorbance at 280 nm; and
Fig. 3 B shows the turbity of the tested formulations after one, three, and five freezethaw cycles as determined by measuring the absorbance at 350 nm; and [0028] Figs. 4A-4C show the results of stability studies of HIV clade C gpl40 protein formulations; HIV clade C gpl40 protein formulations were stored at 25°C and 60% relative humidity (RH), and 40°C and 75% RH, both with and without aluminum phosphate adjuvant, and then tested using a reduced SDS analytical method as described in Example 4;
Fig. 4A shows the relative protein concentration (%) of HIV clade C gpl40 formulations stored at 25°C and 60% RH without any aluminum phosphate adjuvant;
Fig. 4B shows the relative protein concentration (%) of HIV clade C gpl40 formulations stored at 40°C and 75% RH without any aluminum phosphate adjuvant;
Fig. 4C shows the relative protein concentration (%) of HIV clade C gpl40 formulations stored at 25°C and 60% RH with aluminum phosphate adjuvant; and
Fig. 4D shows the relative protein concentration (%) of HIV clade C gpl40 formulations stored at 40°C and 75% RH with aluminum phosphate adjuvant.
DETAILED DESCRIPTION OF THE INVENTION
[0029] Various publications, articles and patents are cited or described in the background and throughout the spécification; each of these référencés is herein incorporated by reference in its entirety. Discussion of documents, acts, materials, devices, articles or the like which has been included in the présent spécification is for the purpose of providing context for the invention. Such discussion is not an admission that any or ail of these matters form part of the prior art with respect to any inventions disclosed or claimed.
[0030] Unless defined otherwise, ail technical and scientific terms used herein hâve the same meaning as commonly understood to one of ordinary skill in the art to which this invention pertains. Otherwise, certain .terms used herein hâve the meanings as set forth in the spécification. Ail patents, published patent applications and publications cited herein are incorporated by reference as if set forth fully herein. It must be noted that as used herein and in the appended daims, the singular forms “a,” “an,” and “the” include plural reference unless the context clearly dictâtes otherwise.
[0031] Unless otherwise stated, any numerical values, such as a concentration or a concentration range described herein, are to be understood as being modified in ail instances by the term “about.” Thus, a numerical value typically includes ± 10% of the recited value. For example, a concentration of 1 mg/mL includes 0.9 mg/mL to 1.1 mg/mL. Lîkewise, a concentration range of 1% to 10% (w/v) includes 0.9% (w/v) to 11% (w/v). As used herein, the use of a numerical range expressly includes ail possible subranges, ail individual numerical values within that range, including integers within such ranges and fractions of the values unless the context clearly indicates otherwise.
[0032] As used herein, “subject” means any animal, preferably a mammal, most preferably a human, to whom will be or has been admînistered an immunogenic composition according to embodiments of the invention. The term “mammal” as used herein, encompasses any mammal. Examples of mammals include, but are not limited to, mice, rats, rabbits, guinea pigs, monkeys, humans, etc., more preferably a human.
[0033] The invention generally relates to immunogenic compositions comprising HIV gpl40 protein and optionally adjuvant, methods of preparing and storing such compositions, and methods of inducing an immune response against HIV in a subject with the immunogenic compositions, alone or in combination with one or more additional HIV antigens, which are preferably expressed by one or more vectors.
[0034] HIV Antigens
[0035] Human immunodeficiency virus (HIV) is a member of the genus Lentivirinae, which is part of the family of Retroviridae. Two species of HIV infect humans: HIV-1 and HFV-2. HIV-1 is the most common strain of HIV virus, and is known to be more pathogenic than HIV-2. As used herein, the terms “human immunodeficiency virus” and “HIV” refer to, but are not limited to, HIV-1 and HIV-2.
[0036] HIV is categorized into multiple clades with a high degree of genetic divergence. As used herein, the term “HIV clade” or “HIV subtype” refers to related human immunodeficiency viruses classified according to their degree of genetic similarity. There are currently three groups of HIV-1 isolâtes: Μ, N, and O. Group M (major strains) consists of at least ten clades, A through J. Group O (outer strains) can consist of a similar number of clades. Group N is a new HIV-1 isolate that has not been categorized in either group M or O. [0037] As used herein, the terms “HIV antigen,” “HIV antigenic protein,” “HIV antigenic polypeptide,” and “HIV immunogen” refer to a polypeptide capable of inducing an immune response, e.g., a humoral and/or cellular mediated response, against HIV in a subject. The HIV antigen can be a protein of HIV, a fragment or epitope thereof, or a combination of multiple HIV proteins or portions thereof, that can induce an immune response or produce an immunity, e.g., protective immunity, against HIV in a subject.
[003 8] Preferably, an antigen is capable of raising in a host a protective immune response, e.g., inducing an immune response against a viral disease or infection, and/or producing an immunity in (i.e., vaccinating) a subject against a viral disease or infection, that protects the subject against the viral disease or infection. For example, the antigen can comprise a protein or fragments thereof from HIV, such as the HIV gag, pol and env gene products.
[0039] An HIV antigen can be any HIV-1 or HIV-2 antigen or fragment thereof. Examples of HIV antigens include, but are not limited to gag, pol, and env gene products, which encode structural proteins and essential enzymes. Gag, pol, and env gene products are synthesized as polyproteins, which are further processed into multiple other protein products. The primary protein product of the gag gene is the viral structural protein Gag polyprotein, which is further processed into MA, CA, SP1, NC, SP2, and P6 protein products. The pol gene encodes viral enzymes (Pol, polymerase), and the primary protein product is further processed into RT, RNase H, IN, and PR protein products. The env gene encodes structural proteins, specifically glycoproteins of the virion envelope. The primary protein product of the env gene is gpl60, which is further processed into gpl20 and gp41.
[0040] In certain embodiments, the HIV antigen comprises an HIV Gag, Env, or Pol antigen, or any antigenic portion or epitope or combination thereof, preferably an HIV-1 Gag, Env, or Pol antigen or any antigenic portion or epitope or combination thereof.
[0041] HIV antigens can also be mosaic HIV antigens. As used herein, “mosaic antigen” refers to a recombinant protein assembled from fragments of natural sequences. Mosaic antigens resemble natural antigens, but are optimized to maximize the coverage of potential
I
T-cell epitopes found in the natural sequences, which improves the breadth and co ver âge of the immune response. Mosaic HIV antigens for use with the invention are preferably mosaic HIV-1 Gag, Pol, and/or Env antigens. Mosaic HIV Gag, Pol, and/or Env antigens are mosaic antigens comprising multiple epitopes derived from one or more of the Gag, Pol, and/or Env polyprotein sequences of HIV. For example, a mosaic GagPol antigen comprises a mosaic Gag sequence and a mosaic Pol sequence.
[0042] Examples of mosaic HIV Gag, Pol, and/or Env antigens that can be used in the invention include those described in, e.g., US20120076812; Barouch et al., Nat Med 2010, 16:319-323; and Barouch et al., Cell 155:1-9, 2013, ail of which are incorporated herein by reference in their entirety. Preferably, mosaic HIV Gag, Pol, and/or Env antigens for use with the invention include, but are not limited to, moslEnv (SEQ ID NO: 3), mos2Env (SEQ ID NO: 4), moslPol (SEQ ID NO: 5), mos2Pol (SEQ ID NO: 6), moslGag (SEQ ID NO: 7), mos2Gag (SEQ ID NO: 8), and combinations thereof, for example moslGagPol (SEQ ID NO: 9) and mos2GagPol (SEQ ID NO: 10). Other examples of mosaic HIV antigens include synthetic HIV Env proteins, which are non-naturally occurring HIV envelope proteins optimized to induce an immune response or provide an immunity against one or more naturally occurring HIV strains, such as that comprising SEQ ID NO: 11, or SEQ ID NO: 11 having one or more mutations selected from the group consisting of (i) I529P (Ile to Pro at position 529), (ii) K480E (Lys to Glu at position 480), and (iii) a combination of EK479480RRRR (i.e. replacing GluLys at position 479 and 480 by four consecutive Arg residues), I529P (Ile to Pro at position 529), A471C (Ala to Cys at position 471) and T575C (Thr to Cys at position 575), or in preferred embodiments, the antigen comprising SEQ ID NO: 11 comprises the amino acid sequence of SEQ ID NO: 12, ail as described in
PCT/EP2016/081159 (filed on 15 December 2016 in the name of Janssen Vaccines & Prévention B.V.), which is herein incorporated by reference in its entirety.
[0043] HIV gpl40 Protein
[0044] As used herein, the term “HIV gpl40 protein” refers to an uncleaved ectodomain of trimeric gpl60 envelope protein, i.e., (gpl60)3. Embodiments of the invention relate to improved formulations of HIV gpl 40, preferably a trimer and/or hexamer ofthe gpl 40 subunits bound to the ectodomain of the gp41 subunits lacking the gp41 transmembrane and cytoplasmic segments. The HIV env gene encodes the precursor protein gpl60, which is proteolytically cleaved into the two mature envelope glycoproteins gpl20 and gp41. First, gpl60 trimerizes to (gpl60)3 and then undergoes cleavage into the two noncovalently associated proteins gpl20 and gp41 via a cleavage reaction mediated by a host cell protease, 10 furin, at a sequence highly conserved in rétro viral envelope glycoprotein precursors. Viral entry is subsequently mediated by a trimer of gpl20/gp41 heterodimers. Gpl20 is the receptor binding fragment, and binds to the CD4 receptor on a target cell that has such a receptor, such as, e.g., a T-helper cell. Gp41, which is non-covalently bound to gpl20, is the fusion fragment and provides the second step by which HIV enters the cell. Gp41 is originally buried within the viral envelope, but when gpl20 binds to a CD4 receptor, gpl20 changes its conformation causing gp41 to become exposed, where it can assist in fusion with the host cell. HIV gp!40 protein has been used as a surrogate for the native state of the cleaved, viral spike.
[0045] Expression of gpl40 proteins has been described in several publications (e.g.
Zhang et al., 2001; Sanders et al., 2002; Harris et al., 2011), and the protein can nowadays also be ordered from service providers, in different variants e.g. based on different HIV strains. A gpl40 protein according to the invention can hâve a cleavage site mutation so that the gpl20 domain and gp41 ectodomain are covalently linked, or altematively the gpl20 domain and gp41 ectodomain can be non-covalently linked (e.g. by a disulphur bridge as for instance in SOSIP variants). Gpl40 proteins hâve been used in various vaccination experiments (e.g. Nkolola et al., 2010, 2014; Kovacs et al., 2012; Barouch et al., 2015; Sanders et al., 2015).
[0046] According to embodiments of the invention, the HIV gpl40 protein can be a homotrimer (e.g., trimers comprising three identical polypeptide units), or a heterotrimer (e.g., trimers comprising three polypeptides that are not ail identical). The HIV gpl40 protein can also be a hexamer. Both trimer species and hexamer species of HIV gpl40 protein hâve immunogenicity against HIV, or can induce immune responses against HIV in vivo. Preferably, the HIV gpl40 protein is a trimer, and more preferably a homotrimer. An HIV gpl40 protein can be a naturally occurring sequence, e.g., a sequence isolated from any HIV clade, such as clade A, clade B, clade C, etc., or a mosaic gpl40 protein. A “mosaic gpl40 protein” contains multiple epitopes derived from one or more gpl40 sequences of one or more HIV clades.
[0047] Preferably, an HIV gpl40 protein is a stabilized trimeric gpl40 protein. A “stabilized trimeric gpl40 protein” is a gpl40 protein that can hâve or can be modified to include a polypeptide sequence, such as a trimerization domain, that increases the stability of the trimeric structure, or it can be a gpl40 protein that is modified to contain mutations (as compared to natural gpl40 sequences) that stabilize a trimeric structure, such as SOSIP and/or other mutations. Examples of trimerization domains include, but are not limited to, the T4-fibritin “foldon” trimerization domain, e.g., that having the amino acid sequence of GSGGYIPEAPRDGQAYVRKDGEWVLLSTFL (SEQ ID NO: 13); the coiled-coil trimerization domain derived from GCN4, e.g., that having the amino acid sequence of MKQIEDKIEEILSKJYHIENEIARIKKLIGEV (SEQ ID NO: 14); and the catalytic subunit of E. coli aspartate transcarbamoylase as a trimer tag. Such trimerization domains can be used to support stable trimer formation (see e.g. WO 2010/042942, Nkolola et al. 2010, WO 2014/107744, and Nkolola et al. 2014, for stabilized trimers of gpl40 proteins). A stabilized trimeric gpl40 protein for use in the invention can also include cleavage site mutations to enhance stability, e.g., in the furin cleavage sites, and/or so-called SOSIP mutations (see, e.g. Sanders et al., 2002, 2015). A stabilized trimeric gpl40 protein can be derived from a gpl40 protein isolated from any HIV clade, e.g., clade A, clade B, clade C, etc. A stabilized trimeric gpl40 protein can also be a stabilized mosaic gpl40 protein.
[0048] Exemplary HIV gpl40 proteins that canbe used in the invention include HIV clade C gpl40 protein (SEQ ID NO: 1), HIV mosaic gpl40 protein (SEQ ID NO: 2), and combinations thereof. Both the HIV clade C gpl40 protein (SEQ ID NO: 1) and HIV mosaic gpl40 protein (SEQ ID NO: 2) are stabilized trimeric gpl40 proteins comprising a T4-fibritin “foldon” trimerization domain.
[0049] Immunogenic Compositions
[0050] In a first aspect, the invention relates to an immunogenic composition comprising an HIV gpl40 protein. An “immunogenic composition” as used herein refers to a composition capable of inducing an immune response in a subject who has been or will be administered the composition. An immunogenic composition can be a vaccine. A “vaccine” refers to a composition that can provide protective immunity or a protective immune response to a subject, or that can be used to vaccinate a subject. According to embodiments of the invention, any HIV gpl40 protein known in the art in view of the present disclosure can be used in an immunogenic composition of the invention. An immunogenic composition can comprise one or more HIV gpl40 proteins, such as one, two, or three HIV gpl40 proteins. [0051] Preferably, the immunogenic composition of the invention comprises a stabilized trimeric gpl40 protein. In one preferred embodiment, an HIV gpl40 protein is an HIV clade C gpl40 protein, such as that comprising the amino acid sequence of SEQ ID NO: 1. In another preferred embodiment, an HIV gpl40 protein is a HIV mosaic gpl40 protein, such as that comprising the amino acid sequence of SEQ ID NO: 2.
[0052] In other embodiments, an immunogenic composition comprises both an HIV clade C gpl40 protein and an HIV mosaic gpl40 protein, such as those comprising SEQ ID NO: 1 and SEQ ID NO: 2. For example, an immunogenic composition can comprise a mixture of an HIV clade C gpl40 protein comprising the amino acid sequence of SEQ ID NO: 1 and an HIV mosaic gpl40 protein comprising the amino acid sequence of SEQ ID NO: 2, e.g., in a 1:1 ratio.
[0053] The immunogenic compositions of the invention also comprise water, preferably water for injection. It is added to the composition in sufficient quantity (q.s.), depending on the volume of the composition heing prepared.
[0054] According to embodiments of the invention, an immunogenic composition comprises 0.05 mg/mL to 5 mg/mL of an HIV gpl40 protein, such as 0.05 mg/mL, 0.1 mg/mL, 0.2 mg/mL, 0.5 mg/mL, 1 mg/mL, 2 mg/mL, 3 mg/mL, 4 mg/mL, or 5 mg/mL. In particular embodiments of the invention, an immunogenic composition comprises 0.2 mg/mL or 1 mg/mL of an HIV gpl40 protein, such as those comprising SEQ ID NO: 1 or SEQ ID NO: 2. In other particular embodiments of the invention, an immunogenic composition comprises a 0.05 mg/mL to 5 mg/mL of a mixture of HIV gpl40 proteins, such as those comprising SEQ ID NO: 1 and SEQ ID NO: 2, e.g., in a 1:1 ratio.
[0055] Immunogenic compositions of the invention further comprise sorbitol (sugar), polysorbate 20 (surfactant), and histidine buffer. The inventors surprisingly discovered that the stability of the HIV gpl40 protein in a composition comprising histidine had improved stability as compared to that in compositions comprising other amino acids. The inventors also surprisingly discovered that inclusion of polysorbate 20 in the composition further improved the stability of the HIV gpl40 protein in the composition. Typically, buffers used for protein formulations contain a combination of acetate and sorbitol, or a combination of histidine and sucrose (see e.g., Uchiyama, Biochimica Biophysica Acta (2014) 1844, 20412052). Histidine and sorbitol are not usually used in combination in a buffer for protein formulations. To the best of the knowledge of the inventors, the combination of histidine and sorbitol with polysorbate 20 (surfactant) has not been used in any commercial protein drug formulations. Therefore, it was surprising to see that the combination of histidine and sorbitol improved the stability of the HIV gpl40 protein.
[0056] According to embodiments of the invention, the concentration of sorbitol can be in a range of 2% to 15% (w/v), such as 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14% or 15% (w/v). In one preferred embodiment, the concentration of sorbitol is 5% (w/v). In another preferred embodiment, the concentration of sorbitol is 12% (w/v).
[0057] According to embodiments of the invention, the concentration of polysorbate 20 canbe in a range of 0.01% to 0.05% (w/v), such as 0.01%, 0.02%, 0.03%, 0.04%, or 0.05% (w/v). In one preferred embodiment, the concentration of polysorbate 20 is 0.02% (w/v). [0058] According to embodiments of the invention, the concentration of histidine buffer is in a range of 5 mM to 20 mM, such as 5 mM, 10 mM, 15 mM or 20 mM, and is preferably 10 mM. The pH of the histidine buffer is in a range of 5.5 to 7.0, such as 5.5, 6.0, 6.5, or 7.0, and is preferably 6.5. In one preferred embodiment, the concentration of the histidine buffer is 10 mM and the pH of the histidine buffer is 6.5. Any pH value described herein, is to be understood as being modified in ail instances by the term “about,” which, when used with reference to a pH value includes ± 0.5 of the recited pH value. Unless specified otherwise, ail pH values refer to the pH of the histidine buffer itself that is included in an immunogenic composition of the invention.
[0059] In certain embodiments of the invention, an immunogenic composition further comprises an adjuvant. The terras “adjuvant” and immune stimulant are used interchangeably herein, and are defined as one or more substances that cause stimulation of the immune System, or enhance an immune response. For example, an adjuvant can be used to enhance an immune response to an HIV gpl40 protein and/or an immunogenic composition of the invention when administered alone or fùrther in combination with one or more adenovirus vectors encoding one or more HIV antigens. Adjuvants suitable for use with the invention should be ones that are potentially safe, well tolerated and effective in people, such as, for instance QS-21, Iscomatrix, Detox-PC, MPL-SE, MoGM-CSF, TiterMax-G, CRL- 1005, GERBU, TERamide, PSC97B, Adjumer, PG-026, GSK-I, GcMAF, B-alethine, MPC-026, Adjuvax, CpG ODN, Betafectin, aiuminum salts (e.g. aiuminum hydroxide, and/or aiuminum phosphate; an example of an aiuminum phosphate adjuvant is AdjuPhos, a sterilized aiuminum phosphate wet gel suspension), Adjuplex, and MF59. Preferably, the adjuvant is an aiuminum phosphate adjuvant.
[0060] According to embodiments of the invention, an aiuminum phosphate adjuvant can be included in an immunogenic composition at concentrations of between about 0.7 and 5.0 mg/mL, for instance 0.7, 0.75, 0.8, 0.85, 0.9, 0.95, or 1 mg/ml, e.g. at a fixed concentration of 0.85 mg/mL, or for instance 1.5, 2.0, 2.5, 3.0, 3.5, 3.6, 3.7, 3.8, 3.85, 3.9, 3.95, 4.0, 4.5, or 5.0 mg/mL, e.g. at a fixed concentration of 3.84 mg/mL. One goal of the invention was to provide long-term stable formulations with aiuminum phosphate adjuvant present together with the gpl40 protein immunogen. It was surprisingly found that the liquid formulations of the invention that comprise HIV gpl40, histidine buffer, sorbitol, and polysorbate 20, are stable for at least 6 months at 2-8°C. These formulations were also found to be stable for at least 6 months at elevated températures of 25°C. In addition, these formulations were even found to be stable for at least 2 weeks, 1 month, or even up to 3 months at 40°C, as measured by reduced SDS PAGE.
[0061 ] In an exemplary embodiment of the invention, an immunogenic composition comprises, relative to the total volume of the composition:
a. 0.2 mg/mL to 1 mg/mL of an HIV gpl40 protein comprising the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2;
b. 5% to 12% (w/v) sorbitol;
c. 0.02% (w/v) polysorbate 20;
d. 10 mM histidine buffcr at a pH of 6.5; and
e. 0.7 to 4.0 mg/mL (e.g. 0.85 mg/mL or 3.84 mg/mL) aluminum phosphate adjuvant.
[0062] Immunogenic compositions of the invention can be formulated in any matter suitable for administration to a subject to facilitate administration and improve efficacy, including, but not limited to, oral (enterai) administration and parentéral injections. The parentéral injections for instance can include subcutaneous injection, intramuscular injection, or intradermal injection. Immunogenic compositions of the invention can also be formulated for other routes of administration, e.g. transmucosal, rectal, sublingual administration, oral, or intranasal. Preferably, an immunogenic composition is formulated for intramuscular injection.
[0063] Immunogenic compositions of the invention are advantageous in that the HIV gpl40 protein can be stably stored in liquid form at refrigerated température, for instance 2°C to 8°C, for extended periods of time, such as about 2 years. In certain embodiments, the immunogenic compositions include an adjuvant, for instance aluminum phosphate adjuvant. The immunogenic compositions containing adjuvant are also compatible with storage in liquid form under refrigerated conditions for extended periods of time. The immunogenic compositions of the invention are also compatible with storage in lyophilized form. However, the compositions of the invention are thus preferably liquid formulations, meaning that they are in liquid form at the preferred storage température, i.e. at 2-8°C. Typically the liquid formulations or compositions according to the invention are aqueous suspensions, meaning that not ail protein and/or particulate material such as aluminum phosphate may be entirely dissolved. In such cases it is advised to mix the composition before use. It is preferred to store the compositions of the invention that comprise aluminum phosphate adjuvant above the freezing point of water, most preferabiy at 2-8°C, e.g. e.g. 2°C, 3°C, 4°C, 5°C, 6°C, 7°C, or 8°C. Advantages are that no resource-intensive and costly lyophilization and assocîated redissolving before use is needed, no bed-side mixing and separate storage of the aluminum phosphate adjuvant is needed but rather the formulations can be stored ‘ready-for-use’. In addition, storage at refrigerated but not ffozen conditions makes that the compositions can be used more easily in resource-limited settings e.g. where no freezing capacity is available. Moreover, the observed maintained stability at elevated températures (e.g. 25°C, and even 40° C) of the compositions of the invention indicates that inadvertent température excursions,
e.g. when temporarily the composition is exposed to room température even in warm climates, should not immediately be detrimental to the vaccine composition of the invention. [0064] The compositions of the invention, surprisingly including the ones comprising aluminum phosphate, are stable upon storage at a température of 2-8°C for at least one day, one week, two weeks, one month, preferabiy at least 2, 3, 4, 5, 6 months. More preferabiy these compositions are stable under these conditions for at least 7, 8, 9,10, 11,12 months, still more preferabiy at least 13,14,15, 16, 17,18, 19, 20, 21, 22, 23, 24 months, most preferabiy at least 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36 months or longer, e.g. 1-72 months, e.g. 6-48 months, e.g. 12-36 months. The invention in certain embodiments thus provides compositions according to the invention, which are stable when stored at 2-8°C for at least one month, at least three months, at least 6 months. Preferabiy such compositions are stable for at least 12 months, at least 18 months, at least 24 months, at least 30 months, at least 36 months. In certain embodiments, the invention provides using the immunogenic compositions of the invention for vaccinating a subject, preferabiy a human subject, after the immunogenic compositions hâve been stored at 2-8°C for at least one day, at least one week, at least two weeks, at least three weeks, at least one month, at least two months, at least three months, at least 4, 5, 6, 7, 8, 9,10, 11, 12, 13,14, 15,16,17,18, 19, 20, 21, 22, 23, 24, 25, 26, 27. 28. 29, 30, 31, 32, 33, 34, 35, 36 months.
[0065] For the purpose of the present invention, an immunogenic composition that comprises HIV gpl40 protein and that after having been stored for at least one week, preferabiy at least one month, at a given température does not show more than 25%, preferabiy not more than 10%, of dégradation of said gpl 40 protein on a reduced SD S PAGE gel, is considered a long-term storage stable immunogenic composition at said température. An immunogenic composition that comprises HIV gpl40 protein is considered “stable” according to the present invention under certain conditions (e.g. 2-8°C) for a specified time (e.g. 6 months), if under these conditions after said specified time said gpl40 protein does not show more than 25%, preferably less than 20%, preferably less than 15%, preferably less than 10%, most preferably less than 5%, of dégradation (compared to initial measurement at t=0) on a reduced SDS PAGE gel. Dégradation is visible as additional bands below the gpl40 band of desired molecular weight. Alternative assays such as ELISA can also be used to measure stability, and in certain embodiments, a composition that is stable as defined above, also does not show more than 50%, preferably less than 25%, dégradation (réduction as compared to initial signal at t=0) in an ELISA assay.
[0066] Methods of Preparing an Immunogenic Composition
[0067] The invention also relates to a method of preparing an immunogenic composition of the invention. According to embodiments of the invention, a method of preparing an immunogenic composition comprises admixing an HIV gpl40 protein, sorbitol, polysorbate 20, and histidine buffer in the appropriate concentration ranges. One of ordinary skill in the art will be familiar with conventional techniques used to préparé such compositions.
[0068] For example, immunogenic compositions can be prepared by mixing histidine buffer, sorbitol, and polysorbate 20 at the desired concentrations. Then, the HIV gpl40 protein can be added. The pH of the composition can be adjusted before or after addition of the HIV gpl40 protein. As another illustrative example, first a buffer solution containing histidine and sorbitol can be prepared. The HIV gpl40 protein is prepared in buffer at the desired concentration, and then added to the buffer solution containing histidine and sorbitol, followed by addition of Polysorbate at the target concentration. Adjuvant can be added last to obtain the final composition. The invention also provides methods for preparing a longterm, storage stable immunogenic composition that comprises HIV gpl40 protein. In certain embodiments, such methods comprise: (i) providing an immunogenic composition according to the invention (i.e. comprising 0.05-5 mg/mL HIV gpl40 protein, 2-15% (w/v) sorbitol, 0.01-0.05% polysorbate 20, 5-20 mM histine buffer pH 5.5-7.0, water, and preferably 0.7-4.0 mg/mL aluminum phosphate), and (iî) storing said composition at 2-8°C for at least one month, e.g. 1-72 months, e.g. 6-48 months, e.g. 12-36 months, e.g. 18-30 months. In certain embodiments, such methods comprise:
(i) admixing the following components to create an immunogenic composition comprising these components in amounts relative to the total volume of the composition:
(a) 0.05 mg/mL to 5 mg/mL of an HIV gpl40 protein;
(b) 2% to 15% (w/v) sorbitol;
(c) 0.01 to 0.05% (w/v) polysorbate 20;
(d) 5 to 20 mM histidine buffer at a pH of 5.5 to 7.0, (e) water (preferably water for injection), (1) aluminum phosphate adjuvant, preferably at a concentration of 0.7-4 mg/mL;
and (ii) storing the composition at 2-8°C for at least one month, e.g. 1-72 months, e.g. 6-48 months, e.g. 12-36 months, e.g. 18-30 months.
Methods of Inducing an Immune Response
[0069] The invention also relates to methods of inducing an immune response against human immunodeficiency virus (HIV) in a subject in need thereof with an immunogenic composition of the invention. The immune response can be against one or more HIV clades. The methods described herein also include administering an immunogenic composition of the invention in combination with one or more additional HIV antigens that are preferably expressed from one or more vectors, such as adenovirus vectors or MVA vectors, including methods of priming and boosting an immune response.
[0070] In one general aspect, a method of inducing an immune response against a human immunodeficiency virus (HIV) in a subject in need thereof comprises administering to the subject an effective amount of an immunogenic composition comprising an HIV gpl40 protein according to an embodiment of the invention. Any of the immunogenic compositions described herein can be used in a method of inducing an immune response against HIV in a subject. Preferably, the composition comprises a stabilized trimeric HIV gpl40 protein, such as an HIV clade C gpl40 protein comprising the amino acid sequence of SEQ ID NO: 1, or an HIV mosaic gpl40 protein comprising the amino acid sequence of SEQ ID NO: 2, or a mixture thereof. The composition can further comprise an adjuvant, such as aluminum phosphate adjuvant. An exemplary embodiment of an immunogenic composition for use in the methods of the invention comprises, relative to the total volume of the composition,
I
a. 0.2 mg/mL to 1 mg/mL of an HIV gpl40 protein comprising the amino acid;
sequence of SEQ ID NO: 1 or SEQ ID NO: 2;|
b. 5% to 12% (w/v) sorbitol;j
c. 0.02% (w/v) polysorbate 20;j
[
d. 10 mM histidine buffer at a pH of 6.5; and!
î
e. 0.7 to 4.0 mg/mL (e.g. 0.85 mg/mL or 3.84 mg/mL) aluminum phosphate adjuvant.
[0071] According to embodiments of the invention, “inducing an immune response” when used with reference to the methods and compositions described herein encompasses providing protective immunity and/or vaccinating a subject against an infection, such as an HIV infection, for prophylactic purposes, as well as causing a desired immune response or effect in a subject in need thereof against an infection, such as an HIV infection, for therapeutic purposes. Preferably, the methods of the invention are for prophylactic purposes, such as for providing protective immunity. The immune response can be a cellular immune response and/or a humoral immune response.
[0072] As used herein, the term “protective immunity” or “protective immune response” means that the vaccinaied subject is able to control an infection with the pathogenic agent against which the vaccination was donc. Usually, the subject having developed a “protective immune response” develops only mild to moderate clinical symptoms or no symptoms at ail. Usually, a subject having a “protective immune response” or “protective immunity” against a certain agent will not die as a resuit of the infection with said agent.
[0073] Typically, administration of immunogenic compositions according to embodiments of the invention will hâve a prophylactic aim to generate an immune response against an HIV antigen before infection or development of symptoms. In other embodiments, the immunogenic compositions can be administered for post-exposure prophylactics. Immunogenic compositions of the invention can also be administered to a non-human mammal, such as for experimental purposes.
[0074] As used herein, “an effective amount” or “immunologically effective amount” means an amount of a composition sufficient to induce a desired immune effect or immune response in a subject in need thereof. In one embodiment, an effective amount means an amount sufficient to induce an immune response in a subject in need thereof. In certain embodiments, an effective amount means an amount sufficient to produce immunity in a subject in need thereof, e.g., provide a protective effect against a disease such as a viral infection. In certain embodiments, an effective amount means an amount sufficient to enhance an immune response in a subject in need thereof. For example, when used in combination with one or more other components or immunogenic compositions capable of effecting an immune response, such as in a prime-boost regimen, an effective amount can be i
i ί
I an amount sufficient to enhance the immune response induced by the one or more other components or immunogenic compositions.
[0075] An effective amount can vary depending upon a variety of factors, such as the physical condition ofthe subject, âge, weight, health, etc.; the particular application, e.g., whether inducing immune response or providing protective immunity; and the particular disease, e.g., viral infection, for which immunity is desired. An effective amount can readily be determined by one of ordinary skill in the art in view of the présent disclosure. As general guidance, when used with reference to an HIV gpl40 protein an effective amount can range from, e.g. about 0.3 to about 3000 microgram (pg), e.g. 1-1000 pg, e.g. 10-500 pg, e.g. about 50,100, 150, 200, 250, 300, 350, 400, 450 or 500 pg.
[0076] An effective amount of an immunogenic composition can be administered in a single composition, or in multiple compositions, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 compositions (e.g., tablets, capsules and/or injectables), wherein the administration of the multiple compositions (e.g., tablets, capsules and/or injectables) collectively provides a subject with the immunogenically effective amount. It îs also possible to administer an effective amount of an immunogenic composition to a subject, and subsequently administer another dose of an effective amount of an immungenic composition to the same subject, in a so-called prime-boost regimen, as described in greater detail below.
[0077] According to embodiments of the invention, an immunogenic composition can be administered to a subject by any means known in the art including, but not limited to, oral (enterai) administration and parentéral injections. The parentéral injections could for instance include subeutaneous injection, intramuscular injection, or intradermal injection. Preferably, the immunogenic composition is administered by intramuscular injection.
[0078] It is also possible to administer immunogenic compositions of the invention together with one or more additional HIV antigens, or one or more vectors, such as adenovirus vectors, encoding one or more additional HIV antigens. As used herein, the terms “co-delivery,” “co-administration,” “administered together with,” or “administered in combination with” refer to simultaneous administration of two or more components, such as an immunogenic composition comprising an HIV gpl40 protein, or multiple viral expression vectors, such as adenovirus vectors. “Simultaneous administration” can be administration of the two or more components at least within the same day. When two components are “administered together with,” they can be administered in separate compositions sequentially within a short time period, such as 24, 20,16, 12, 8, or 4 hours, or within 1 hour or less, or they can be administered in a single composition at the same time. Non-limiting examples of ' 20 administration of immunogenic compositions of gpl40 protein with one or more additional HIV antigens encoded by vectors such as adénoviral vectors, are provided in WO 2016/049287, the disclosure of which is herein incorporated by reference in its entirety. [0079] Thus, in certain embodiments of the invention, a method of inducing an immune response further comprises administering to the subject an effective amount of a second immunogenic composition comprising one or more HIV antigens or one or more vectors encoding the HIV antigens. Any HIV antigen known to those skilled in the art in view of the present disclosure can be used, such as HIV Nef, Gag, Env, or Pol antigens or any antigenic portion or epitope or combination thereof. Mosaic HIV antigens can also be used. Exemplary HIV antigens include, but are not limited to, mosaic Env, Gag, and/or Pol antigens and combinations thereof, such as those comprising the amino acid sequences of SEQ ID NOs: 3-12, or SEQ ID NO: 11 having one or more mutations selected from the group consisting of (i) I529P (Ile to Pro at position 529), (ii) K480E (Lys to Glu at position 480), and (iii) a combination of EK479-480RRRR (i.e. replacing GluLys at position 479 and 480 by four consecutive Arg residues), I529P (Ile to Pro at position 529), A471C (Ala to Cys at position 471) and T575C (Thr to Cys at position 575). The additional HIV antigens can for instance be administered to the subject as isolated proteins or polypeptides or as vectors encoding these proteins or polypeptides.
[0080] Preferably, in the method comprising administering to the subject an effective amount of a second immunogenic composition, the second immunogenic composition comprises one or more vectors encoding one or more HIV antigens.
[0081 ] Any vector known to those skilled in the art in view of the present disclosure can be used. Preferably, the vector is an adenovirus vector, more preferably an adenovirus 26 vector. The préparation of recombinant adénoviral vectors is well known in the art. Préparation of recombinant adenovirus 26 (rAd26) vectors is described, for example, in WO 2007/104792 and in Abbink et al., (2007) Virol 81(9): 4654-63. Exemplary genome sequences of Ad26 are found in GenBank Accession EF 153474 and in SEQ ID NO:1 of WO 2007/104792. Examples of vectors useful for the invention for instance include those described in WO2012/082918, the disclosure of which is incorporated herein by reference in its entirety. Other adenovirus vectors that can be used in combination with immunogenic compositions of the invention include those described in WO 2016/049287 and PCT Application No. PCT/EP2016/081159, the disclosures of which are herein incorporated by reference in their entirety.
[0082] According to embodiments of the invention, adenovirus vectors can comprise one HIV antigen, or more than one HIV antigen, such as two, three, or four or more HIV antigens. Immunogenic compositions can comprise one or more adenovirus vectors, such as two, three, four or more HIV antigens, encoding one or more different HIV antigens. Also according to embodiments of the invention, a second composition can comprise one adenovirus vector, or more than one adenovirus vector, such as two, three, four or more adenovirus vectors. If a second composition comprises more than one adenovirus vector, the adenovirus vectors can encode the same or different HIV antigens.
[0083] Adenovirus vectors encoding one or more HIV antigens for use in the methods of the invention comprise nucleic acid encoding an HIV antigen that is operably linked to a promoter, meaning that the nucleic acid is under the control of a promoter. The promoter can be a homologous promoter (i.e., derived from the same genetic source as the vector) or a heterologous promoter (i.e., derived from a different vector or genetic source). Examples of suitable promoters include the cytomégalovirus (CMV) promoter and the Rous Sarcoma virus (RSV) promoter. Preferably, the promoter is located upstream of the nucleic acid within an expression cassette.
[0084] As general guidance, an “effective amount” when used with reference to adenovirus vectors, can range from about 108 viral particles to about 1012 viral particles, for example 108, 109, ΙΟ10, 1011, or 1012 viral particles. The préparation and use of immunogenic compositions comprising adenovirus vectors, such as adenovirus 26 vectors, are well known to those of ordinary skill in the art. Liquid pharmaceutical compositions generally include a liquid carrier such as water, petroleum, animal or vegetable oils, minerai oil or synthetic oil. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol can also be included.
[0085] For instance recombinant adenovirus vector can be stored in the buffer that is also used for the Adenovirus World Standard (Hoganson et al., 2002, Bioprocessing J1: 43-8): 20 mM Tris pH 8, 25 mM NaCl, and 2.5% glycerol. Another useful adenovirus formulation buffer suitable for administration to humans is 20 mM Tris, 2 mM MgCli, 25 mM NaCl, 10% (w/v) sucrose, and 0.2% (w/v) polysorbate-80. Another formulation buffer that is suitable for recombinant adenovirus comprises 10-25 mM citrate buffer pH 5.9-6.2, 4-6% (w/w) hydroxypropyl-beta-cyclodextrin (HBCD), 70-100 mM NaCl, 0.018-0.035% (w/w) polysorbate-80, and optionally 0.3-0.45% (w/w) éthanol. Other buffers can be used, and several examples of suitable formulations for the storage and for pharmaceutical administration of purified vectors are known.
[0086] Administration of immunogenic compositions comprising the one or more additional HIV antigens or one or more adenovirus vectors encoding the one or more additional HIV antigens is typically intramuscular, intradermal or subeutaneous. However, other modes of administration such as intravenous, rectal, cutaneous, oral, nasal, etc. can be envisaged as well. Intramuscular administration of the immunogenic compositions can be achieved by using a needle to inject a suspension of the expression vectors, e.g. adenovirus vectors, and/or antigenic polypeptides. An alternative is the use of a necdleless injection device to administer the composition (using, e.g., Biojector™) or a freeze-dried powder containing the vaccine.
[0087] In one embodiment, an immunogenic composition comprising a gpl40 protein according to an embodiment ofthe invention is used in combination with an adenovirus vector, preferably an adenovirus 26 vector, encoding a HIV antigen comprising the amino acid sequence of SEQ ID NO: 3.
[0088] In one embodiment, an immunogenic composition comprising an HIV gpl40 protein according to an embodiment of the invention is used in combination with an adenovirus vector, preferably an adenovirus 26 vector, encoding a HIV antigen comprising the amino acid sequence of SEQ ID NO: 4.
[0089] In one embodiment, an immunogenic composition comprising an HIV gpl40 protein according to an embodiment of the invention is used in combination with an adenovirus vector, preferably an adenovirus 26 vector, encoding a HIV antigen comprising the amino acid sequence of SEQ ID NO: 5.
[0090] In one embodiment, an immunogenic composition comprising an HIV gpl40 protein according to an embodiment of the invention is used in combination with an adenovirus vector, preferably an adenovirus 26 vector, encoding a HIV antigen comprising the amino acid sequence of SEQ ID NO: 6.
[0091] In one embodiment, an immunogenic composition comprising an HIV gpl40 protein according to an embodiment of the invention is used in combination with an adenovirus vector, preferably an adenovirus 26 vector, encoding a HIV antigen comprising the amino acid sequence of SEQ ID NO: 7.
[0092] In one embodiment, an immunogenic composition comprising an HIV gpl40 protein according to an embodiment of the invention is used in combination with an adenovirus vector, preferably an adenovirus 26 vector, encoding a HIV antigen comprising the amino acid sequence of SEQ ID NO: 8.
[0093] In one embodiment, an immunogenic composition comprising an HIV gpl40 protein according to an embodiment of the invention is used in combination with an adenovirus vector, preferably an adenovirus 26 vector, encoding a HIV antigen comprising the amino acid sequence of SEQ ID NO: 9.
[0094] In one embodiment, an immunogenic composition comprising an HIV gpl40 protein according to an embodiment of the invention is used in combination with an adenovirus vector, preferably an adenovirus 26 vector, encoding a HIV antigen comprising the amino acid sequence of SEQ ID NO: 10.
[0095] In one embodiment, an immunogenic composition comprising an HIV gpl40 protein according to an embodiment of the invention is used in combination with an adenovirus vector, preferably an adenovirus 26 vector, encoding a HIV antigen comprising the amino acid sequence of SEQ ID NO: 11, SEQ ID NO: 11 having one or more mutations selected from the group consisting of (i) I529P (Ile to Pro at position 529), (ii) K480E (Lys to Glu at position 480), and (iii) a combination of EK479-480RRRR (i.e. replacing GluLys at position 479 and 480 by four consecutive Arg residues), I529P (Ile to Pro at position 529), A471C (Ala to Cys at position 471) and T575C (Thr to Cys at position 575), or SEQ ID NO:
12.
[0096] Upon administration of adenovirus vectors encoding one or more HIV antigens, the adenovirus vector expresses the encoded HIV antigens, such that the HIV antigens are presented to the immune system of the subject, thereby inducing the required response to produce immunity, or induce an immune response. An immunogenic composition comprising an HIV gpl40 protein according to an embodiment of the invention can be administered together with the one or more adenovirus vectors to prime the immune response, and/or subséquent to administration of the one or more adenovirus vectors to boost the immune response.
[0097] Thus, in other embodiments of the invention, a method of inducing an immune response against an HIV in a subject in need thereof comprises (i) administering to the subject an effective amount of an immunogenic composition comprising an HIV gpl40 protein according to an embodiment of the invention, and preferably further comprising an adjuvant, and (ii) administering to the subject an effective amount of a second immunogenic composition comprising one or more adenovirus vectors encoding one or more HIV antigens. Steps (i) and (ii) are conducted in either order, with one of the steps for priming immunization and the other for boosting immunization. Optionally, the method can further comprise administering one or more Modified Vaccinia Ankara (MVA) vectors encoding one or more HIV antigens. MVA vectors can encode any HIV antigen described herein. Preferably, the MVA vectors encode one or more HIV antigens selected from the group consîsting of SEQ ID NOs: 3-12, or SEQ ID NO: 11 having one or more mutations selected from the group consîsting of (i) I529P (Ile to Pro at position 529), (ii) K480E (Lys to Glu at position 480), and (iii) a combination of EK479-480RRRR (i.e. replacing GluLys at position 479 and 480 by four consecutive Arg residues), I529P (Ile to Pro at position 529), A471C (Ala to Cys at position 471) and T575C (Thr to Cys at position 575).
[0098] Examples of adenovirus vectors, MVA vectors, and prime-boost regimens that can be used in combination with an immunogenic composition comprising an HIV gpl40 protein according to an embodiment of the invention include those described in WO 2016/049287, the disclosure of which is herein incorporated by reference in its entirety.
[0099] For example, in one embodiment of the disclosed methods, one or more adenovirus vectors encoding one or more HIV antigens are used to prime the immune response. An immunogenic composition comprising an HIV gpl40 protein according to the invention can be used together with the one or more adenovirus vectors for the priming immunization. The priming immunization can be administered only once, but can optionally also be administered multiple times, for example, initial priming administration at time 0, foliowed by another priming administration about 4-14 weeks, e.g. 10-14 weeks after the initial priming administration. The immunogenic composition comprising an HIV gpl40 protein optionally together with one or more additional adenovirus or MVA vectors encoding one or more additional HIV antigens can be used to boost the immune response. A boosting immunization can also be administered once or multiple times, for example, first at about 2226 weeks after the initial priming administration, followed by another boosting administration at about 46-50 weeks after the initial priming administration. The immune response induced by the immunization is monitored.
[00100] In other general aspects, the invention relates to vaccine combinations for inducing an immune response against a human immunodeficiency virus (HIV) in a subject in need thereof. According to embodiments of the invention, the vaccine combination comprises an immunogenic composition comprising an HIV gpl40 protein, such as that comprising the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2; one or more adenovirus vectors, preferably adenovirus 26 vectors, encoding one or more HIV antigens, such as an HIV antigen comprising an amino acid sequence selected from the group consîsting of SEQ ID NO:s 3 to 12, and SEQ ID NO: 11 having one or more mutations ] selected from the group consîsting of (i) I529P (Ile to Pro at position 529), (ii) K480E (Lys to ;
i ΐ
Glu at position 480), and (iii) a combination of EK479-480RRRR (i.e. replacing GluLys at position 479 and 480 by four consecutive Arg residues), I529P (Ile to Pro at position 529), A471C (Ala to Cys at position 471) and T575C (Thr to Cys at position 575) and optionally one or more MVA vectors encoding one or more HIV antigens, such as an HIV antigen comprising an amino acid sequence selected from the group consisting of SEQ ID NO:s 3 to 12, and SEQ ID NO: 11 having one or more mutations selected from the group consisting of (i) I529P (Ile to Pro at position 529), (ii) K480E (Lys to Glu at position 480), and (iii) a combination of EK479-480RRRR (i.e. replacing GluLys at position 479 and 480 by four consecutive Arg residues), I529P (Ile to Pro at position 529), A471C (Ala to Cys at position 471) and T575C (Thr to Cys at position 575).
[00101] According to embodiments of the invention, the vaccine combinations can be used in any of the methods described herein for inducing an immune response against an HIV in a subject in need thereof, including for priming and boosting an immune response.
EMBODIMENTS
[00102] Embodiment 1 is an immunogenic composition comprising, relative to the total volume of the composition:
a. 0.05 mg/mL to 5 mg/mL of an HIV gpl40 protein;
b. 2% to 15% (w/v) sorbitol;
c. 0.01 to 0.05% (w/v) polysorbate 20; and
d. 5 to 20 mM histidine buffer at a pH of 5.5 to 7.0.
[00103] Embodiment 2 is the immunogenic composition of embodiment 1, wherein the concentration of the HIV gpl40 is 0.2 mg/mL.
[00104] Embodiment 3 is the immunogenic composition of embodiment 1, wherein the concentration of the HIV gpl40 is 1 mg/mL.
[00105] Embodiment 4 is the immunogenic composition of any of embodiments 1 to 3, wherein the concentration of sorbitol is 5% (w/v).
î [00106] Embodiment 5 is the immunogenic composition of any of embodiments 1 to 3, | wherein the concentration of sorbitol is 12% (w/v).
[00107] Embodiment 6 is the immunogenic composition of any of embodiments 1-5, wherein the concentration of polysorbate 20 is 0.02% (w/v). j
[00108] Embodiment 7 is the immunogenic composition of any of embodiments 1-6, wherein the concentration of the histidine buffer is 10 mM, and the pH of the histidine buffer is 6.5.
[00109] Embodiment 8 is the immunogenic composition of any of embodiments 1-7, further comprising aluminum phosphate adjuvant, for instance at a concentration of 0.7-1.0 mg/mL, preferably at a concentration of 0.85 mg/mL.
[00110] Embodiment 9 is the immunogenic composition of any of embodiments 1-8, wherein the HIV gpl40 protein comprises the amino acid sequence of SEQ ID NO: 1.
[00111] Embodiment 10 is the immunogenic composition of any of embodiments 1-8, wherein the HIV gpl40 protein comprises the amino acid sequence of SEQ ID NO: 2. [00112] Embodiment 11 is an immunogenic composition comprising, relative to the total volume of the composition,
a. 0.2 mg/mL to 1 mg/mL of an HIV gpl40 protein comprising the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2;
b. 5% to 12% (w/v) sorbitol;
c. 0.02% (w/v) polysorbate 20;
d. 10 mM histidine buffer at a pH of 6.5; and
e. aluminum phosphate adjuvant, e.g. at a concentration of 0.7-4.0 mg/mL, e.g. 0.85 mg/mL or 3.84 mg/mL.
[00113] Embodiment 12 is the immunogenic composition of embodiment 11, comprising 0.2 mg/mL HIV gpl40 protein comprising the amino acid sequence of SEQ ID NO: 1 and 5% (w/v) sorbitol.
[00114] Embodiment 13 is the immunogenic composition of embodiment 11, comprising 0.2 mg/mL HIV gpl40 protein comprising the amino acid sequence of SEQ ID NO: 2 and 5% (w/v) sorbitol.
[00115] Embodiment 14 is the immunogenic composition of embodiment 11, comprising 0.2 mg/mL HIV gpl40 protein comprising the amino acid sequence of SEQ ID NO: 1 and 12% (w/v) sorbitol.
[00116] Embodiment 15 is the immunogenic composition of embodiment 11, comprising 0.2 mg/mL HIV gpl40 protein comprising the amino acid sequence of SEQ ID NO: 2 and 12% (w/v) sorbitol.
[00117] Embodiment 16 is the immunogenic composition of embodiment 11, comprising 1.0 mg/mL HIV gpl40 protein comprising the amino acid sequence of SEQ ID NO: 1 and 5% (w/v) sorbitol.
[00118] Embodiment 17 is the immunogenic composition of embodiment 11, comprising 1.0 mg/mL HIV gpl40 protein comprising the amino acid sequence of SEQ ID NO: 2 and 5% (w/v) sorbitol.
[00119] Embodiment 18 is the immunogenic composition of embodiment 11, comprising 1.0 mg/mL HIV gpl40 protein comprising the amino acid sequence of SEQ ID NO: 1 and 12% (w/v) sorbitol.
[00120] Embodiment 19 is the immunogenic composition of embodiment 11, comprising 1.0 mg/mL HIV gpl40 protein comprising the amino acid sequence of SEQ ID NO: 2 and 12% (w/v) sorbitol.
[00121] Embodiment 20 is an immunogenic composition according to any of embodiments 1 to 19 formulated for intramuscular injection.
[00122] Embodiment 21 is a method of preparing an immunogenic composition comprising admixing:
a. 0.05 mg/mL to 5 mg/mL of an HIV gpl40 protein;
b. 2% to 15% (w/v) sorbitol;
c. 0.01 to 0.05% polysorbate 20; and
d. 5 to 20 mM histidine buffer at a pH of 5.5 to 7.0;
to thereby obtain the immunogenic composition.
[00123] Embodiment 22 is a method of inducing an immune response against an HIV in a subject in need thereof, comprising administering to the subject an effective amount of an immunogenic composition comprising, relative to the total volume of the composition,
a. 0.05 mg/mL to 5 mg/mL of an HIV gpl40 protein;
b. 2% to 15% (w/v) sorbitol;
c. 0.01 to 0.05% polysorbate 20; and
d. 5 to 20 mM histidine buffer at a pH of 5.5 to 7.0.
[00124] Embodiment 23 is the method of embodiment 22, wherein the immunogenic composition comprises, relative to the total volume ofthe composition,
a. 0.2 mg/mL to 1 mg/mL of an HIV gpl40 protein comprising the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2;
b. 5% to 12% (w/v) sorbitol;
c. 0.02% polysorbate 20;
d. 10 mM histidine buffer at a pH of 6.5 ; and
e. aluminum phosphate adjuvant, e.g. at a concentration of 0.7-4.0 mg/mL, e.g.
0.85 mg/mL or 3.84 mg/mL.
[00125] Embodiment 24 is a method of inducing. an immune response against an HIV in a subject in need thereof, comprising administering to the subject an effective amount of an immunogenic composition according to any one of embodiments 1 to 20, or to any one of embodiments 36-37.
[00126] Embodiment 25 is the method of any one of embodiments 22 to 24, further comprising administering to the subject an effective amount of one or more adenovirus vectors, preferably adenovirus 26 vectors, encoding one or more HIV antigens.
[00127] Embodiment 26 is the method of any one of embodiments 22 to 25 further comprising administering to the subject an effective amount of one or more MVA vectors encoding one or more HIV antigens.
[00128] Embodiment 27 is the method of embodiment 25 or embodiment 26, wherein the one or more HIV antigens comprise an amino acid sequence selected from the group consisting of SEQ ID NOs: 3 to 12, and SEQ ID NO: 11 having one or more mutations selected from the group consisting of (i) I529P (Ile to Pro at position 529), (ii) K480E (Lys to Glu at position 480), and (iii) a combination of EK479-480RRRR (i.e. replacing GluLys at position 479 and 480 by four consecutive Arg residues), I529P (Ile to Pro at position 529), A471C (Ala to Cys at position 471) and T575C (Thr to Cys at position 575).
[00129] Embodiment 28 is an immunogenic composition according to any one of embodiments 1-20, or to any one of embodiments 36-37, which is stable at 2-8°C for at least six months.
[00130] Embodiment 29 is an immunogenic composition according to any one of embodiments 1-20, or to any one of embodiments 36-37, which is stable at 2-8°C for at least 12 months, at least 18 months, at least 24 months, at least 30 months, at least 36 months.
[00131] Embodiment 30 is an immunogenic composition according to any one of embodiments 1-20, or to any one of embodiments 36-37, which is stable at 2-8°C for 6-72 months.
i i ί ï
i
[00132] Embodiment 31 is an immunogenic composition according to any one of embodiments 1-20, or to any one of embodiments 36-37, which is stable at 25°C for at least six months.
[00133] Embodiment 32 is an immunogenic composition according to any one of embodiments 1-20, or to any one of embodiments 36-37, which is stable at 40°C for at least one week, preferably at least two weeks.
[00134] Embodiment 33 is a method for storing an immunogenic composition comprising HIV gpl40 protein, the method comprising providing a immunogenic composition according to any one of embodiments 1-20, or to any one of embodiments 28-32, or to any one of embodiments 36-37, and storing said composition at 2-8°C for at least one day, e.g. at least one week, e.g. at least one month, e.g. 1 day-72 months, e.g. 6-48 months, e.g. 12-36 months,
e.g. 18-30 months.
[00135] Embodiment 34 is a method for preparing a long-term, storage stable immunogenic composition that comprises HIV gpl40 protein, the method comprising: (i) providing an immunogenic composition that comprises 0.05-5 mg/mL HIV gpl40 protein, 215% (w/v) sorbitol, 0.01-0.05% polysorbate 20, 5-20 mM histine buffer pH 5.5-7.0, water, and preferably 0.7-4.0 mg/mL aluminum phosphate), and (ii) storing said composition at 28°C for at least one week, e.g. at least one month, e.g. 1-72 months, e.g. 6-48 months, e.g. 1236 months, e.g. 18-30 months.
[00136] Embodiment 35 is use of an immunogenic composition according to any one of embodiments 1-20, or to any one of embodiments 28-32, or to any one of embodiments 3637, for administering to a subject, preferably a human subject, to induce an immune response against HIV, wherein the immunogenic composition prier to said administering has been stored at 2-8°C for at least one day, e.g. at least one week, e.g. at least two weeks, e.g. at least three weeks, e.g. at least one month, e.g. at least two months, e.g. at least three months, e.g. at least 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21,22, 23, 24, 25, 26, 27. 28. 29, 30, 31, 32, 33, 34, 35, 36 months.
[00137] Embodiment 36 is the immunogenic composition of any one of embodiments 1 -9, wherein the HIV gpl40 protein comprises a mixture of an HIV gpl40 protein comprising the amino acid sequence of SEQ ID NO:1 and an HIV gpl40 protein comprising the amino acid sequence of SEQ NO: 2.
[00138] Embodiment 37 is the immunogenic composition of embodiment 36, wherein the HIV gpl40 protein comprising the amino acid sequence of SEQ ID NO:1 and the HIV gpl40 protein comprising the amino acid sequence of SEQ NO: 2 are present in the mixture at a 1:1 ratio.
EXAMPLES
[00139] Example 1: Formulation Development Study for HIV Clade C gp!40 Protein
[00140] There are numerous possibilities for each component that can be included in a protein formulation, e.g., buffer, sugar, pH value, surfactant etc. For example, different possibilities for buffets can include phosphate, acetate, HEPES, Tris, MOPS, etc.; different possibilities for amino acids can include histidine, arginine, lysine, alanine, etc.; different possibilities for sugars can include sucrose, sorbitol, glycerol, mannitol, trehalose, etc.; and different possibilities for surfactant can include polysorbate 20, polysorbate 80, Tween-20, Tween-80, etc. There are also many other types of excipients, and numerous possibilities for each, that can further be included in a protein formulation, such as osmolytes (e.g., glycine, proline, glycerol, urea, etc.), salts (e.g., sodium chloride, potassium chloride, sodium sulfate, etc.), carbohydrates (e.g., lactose), proteins and polymers (e.g., HSA, gelatin, PVP, PLGA, PEG, etc.), chelators and antioxidants (e.g., EDTA, DTPA, éthanol, etc.), preservatives (e.g., benzyl alcohol, m-cresol, phénol, etc.), etc. See, e.g., Kamerzell et al. Advanced Drug Delivery Reviews (2011) 63,1118-1159. Accordingly, there are many different theoretical combinations of components that could be used to identify a formulation. However, the most suitable formulation is dépendent upon the particular protein in the formulation.
[00141] The inventors therefore set out to find improved formulations that could meet the complex requirements in the unpredictable art of protein formulation, in particular, an improved HIV gpl40 formulation that enables drug product manufacturing meeting large late phase and commercial scale demande, and includes aluminum phosphate adjuvant and gpl40 protein to be stored as drug product in single vials at refrigerated température, and prevents instability associated with certain components present in currently used formulations. The formulations were designed for storage in liquid form, but with the potential to be stored in lyophilized form and reconstituted in liquid prior to injection.
[00142] Formulation screening studies were designed to evaluate different buffers (histidine, phosphate, and acetate), buffer strengths (10 mM to 50 mM), sugars (sucrose and sorbitol from 2% to 12% w/v), surfactants (polysorbate 20 and polysorbate 80 from 0.02% to 1% w/v), and pH values from 4.5 to 7.5 on the stability of HIV clade C gpl40 protein formulations. The parameters were varied as shown in Table 1.
[00143] Table 1: HIV clade C gpl40 protein formulation study design
| Buffer | Histidine (His) | Phosphate (Pho) | Acetate (Ace) |
| pH | 5.5-6.5 | 6.5-7.5 | 4.5-5.5 |
| Buffer Strength | 10 mM, 20 mM, or 50 mM | ||
| Sugar | Sucrose or sorbitol at 2% or 12% (w/v) | ||
| Surfactant | Polysorbate 20 (PS20) or polysorbate 80 (PS80) at 0.02%, 0.05%, or 0.10% (w/v) |
[00144] The formulations were prepared by adding the buffer components at the pH value to be tested, followed by addition of sugar and surfactant. The pH was adjusted as necessary. Then, the clade C gpl40 protein (SEQ ID NO: 1) was added to a concentration of 1 mg/mL or 0.2 mg/mL.
[00145] Formulation stability was analyzed using a SolvoVPE system to evaluate concentration and turbidity. Samples of each formulation were analyzed at time 0 (To), and then after stressing at 40°C for 24 hours (T24). Formulation stability was also analyzed using dynamic light scattering (DLS).
[00146] SolvoVPE Analysis: A SolvoVPE (C Technologies, Inc.; Bridgeport, NJ, USA) was used to détermine protein concentration by measuring the UV absorbance of samples of each formulation at 280 nm and 350 nm. The change in turbidity was determined from the différence in absorbance at 350 nm between To and T24 measurements. For desired formulations, any change in turbidity should preferably be as small as possible. Increases in turbidity indicate that the protein is precipitating out of solution, and that the formulation is thus less stable. The results of the SolvoVPE analysis are shown in Fig. 1.
[00147] The results of the SolvoVPE analysis show that the acetate buffer formulations had the highest increase in turbidity (average change of +0.339), whereas phosphate buffer formulations showed amoderate increase (average change of +0.177), and histidine buffer formulations shows almost no change in turbidity (average change of -0.010). Since a large change in turbidity is undesirable, the turbidity data indicate that histidine buffer is the most optimal buffer of those tested for improving the stability of HIV gpl40 protein.
[00148] Dynamic Light Scattering (DLS) Analysis: DLS was used to evaluate the colloïdal stability, and specifically whether there was any protein aggregation in the protein formulations. The change in radius (Rh) from To at 20°C to T7 days at 70°C was measured. More specifically, the Rh was measured for the initial sample at 20°C. Then, the sample was heated to 70°C, and held at a température of 70°C for 7 days before measuring the final RhThe différence in the initial Rh value and the final Rh values is plotted in Fig. IB. A large change in Rh indicates that there is protein aggregation, and that the formulation is thus less désirable.
[00149] The results of the DLS analysis show that formulations containing sorbitol had a lower change in Rh as compared to formulations containing sucrose. Since a larger change in Rh is undesirable, the DLS data indicate that sorbitol is the most optimal sugar of those tested for improving the stability of HIV gpl40 protein.
[00150] The results of the above described studies also indicated that the sugar, sugar concentration, surfactant, surfactant concentration and protein concentration had an effect on the stability, so these parameters were furtber investigated as described in Example 2 below.
[00151] Example 2: Effect of Sugar, Surfactant, and Protein Concentration on Stability of HIV Clade C gpl40 Formulations
[00152] HIV gpl40 protein immunogenic formulations were prepared in a 10 mM histidine buffer, pH 6.0 ± 0.5, with the following parameters being varied: sugar (sorbitol and sucrose), sugar concentration (2% and 12% w/v), polysorbate (PS20 and P S 80), polysorbate concentration (0.02% and 0.1% w/v), and protein concentration (0.2 mg/mL and 1.0 mg/mL). The formulations were prepared by adding 10 mM histidine buffer, pH 6.0 ± 0.5, followed by addition of sugar and surfactant. The pH was adjusted as necessary. HIV gpl40 clade C protein (SEQ ID NO: 1) was added to the desired concentration. The formulations were then analyzed by Hîgh-Performance Size Exclusion Chromatography (HP-SEC), as described below.
[00153] The formulations prepared and tested are shown below in Table 2.
[00154] Table 2 : HIV gp 140 protein formulations
| Formulation | Sugar | Sugar Concentration (% w/v) | Surfactant | Surfactant Concentration (% w/v) | Protein concentration (mg/mL) |
| 1 | sorbitol | 12 | PS20 | 0.02 | 0.2 |
| 2 | sorbitol | 12 | PS80 | 0.1 | 0.2 |
| 3 | sorbitol | 2 | PS20 | 0.1 | 0.2 |
| 4 | sorbitol | 2 | PS20 | 0.1 | 0.2 |
| 5 | sorbitol | 2 | PS80 | 0.02 | 1 |
| 6 | sorbitol | 12 | PS80 | 0.02 | 1 |
| 7 | sorbitol | 12 | PS20 | 0.02 | 1 |
| 8 | sorbitol | 2 | PS80 | 0.1 | 1 |
| 9 | sorbitol | 12 | PS80 | 0.1 | 1 |
| 10 | sucrose | 12 | PS80 | 0.02 | 0.2 |
| 11 | sucrose | 2 | PS20 | 0.02 | 0.2 |
| 12 | sucrose | 12 | PS80 | 0.1 | 0.2 |
| 13 | sucrose | 2 | PS80 | 0.02 | 0.2 |
| 14 | sucrose | 2 | PS80 | 0.1 | 1 |
| 15 | sucrose | 2 | PS20 | 0.02 | 1 |
| 16 | sucrose | 2 | PS20 | 0.1 | 1 |
| 17 | sucrose | 12 | PS20 | 0.1 | 1 |
| 18 | sucrose | 12 | PS20 | 0.1 | 1 |
[00155] High-Performance Size Exclusion Chromatography (HP-SEC) Analysis: HP-SEC was used to analyze the amount of hexamer, trimer, and high/low molecular weight species in formulation samples by monitoring the absorbance at 280 nm. The HIV gpl40 protein exists predominantly as a trimer. Some HIV gpl40 protein hexamer species is also observed. Although the trimer species is the desired species, immunogenicity against HIV is observed for both the trimer species and the hexamer species. High molecular weight (HMW) and low molecular weight (LMW) species in the formulations are undesired. In particular, the présence of LMW species indicates cleavage and/or dégradation of the gpl40 protein. HMW species may be caused by a number of factors, such as aggregation of the gpl40 protein. Samples of each formulation were analyzed at time 0 (To), and then stressed at 40°C for 24 hours (T24). Formulations containing 1 mg/mL clade C gpl40 protein were diluted two-fold before injection into the HP-SEC system, and formulations containing 0.2 mg/mL clade C gp 140 protein were not diluted prior to inj ection.
[00156] The results of the HP-SEC analysis are shown below in Table 3, and in Figs. 2A2F. The results indicate that amount of trimer and hexamer for both To and T24 samples dépends on the concentration of surfactant and HIV gpl40 protein. Formulations having a lower surfactant concentration (0.02% w/v) had a higher observed value of trimer -i-hexamer species of the HIV gpl40 protein, with less high/low molecular weight species observed (see Figs. 2B, 2D, and 2F), both before and after sample stressing. Formulations having a higher
HIV gpl40 protein concentration (1.0 mg/mL) also had a higher observed value of trimer +hexamer species of the HIV gpl40 protein, with less high/low molecular weight species observed (see Figs. 2B and 2D), both before and after sample stressing (see Figs. 2A and 2C). Formulations containing polysorbate 20, as opposed to polysorbate 80, also had a lower amount of lower molecular weight species present (see Fig. 2E).
[00157] Table 3: Results of HP-SEC Analysis.
| Formulation | High Molecular Weight Species (%) | Hexamer (%) | Trimer (%) | Low Molecular Weight Species (%) | ||||
| To | T24 | To | T24 | To | T24 | To | T24 | |
| 1 | 0.57 | 0 | 10.69 | 10.13 | 88.05 | 89.87 | 0 | 0 |
| 2 | 0.22 | 0 | 8.48 | 9.55 | 80.08 | 85.39 | 11.22 | 5.06 |
| 3 | 0.2 | 0 | 9.15 | 9.51 | 84.47 | 85.77 | 0 | 4.72 |
| 4 | 0 | 0 | 9.26 | 9.56 | 84.63 | 86.71 | 0 | 3.73 |
| 5 | 0 | 0 | 10.72 | 12.27 | 88.41 | 87.73 | 0.86 | 0 |
| 6 | 0 | 0 | 10.78 | 11.6 | 88.44 | 88.4 | 0.78 | 0 |
| 7 | 0 | 0 | 11.08 | 11.7 | 88.6 | 88.3 | 0.32 | 0 |
| 8 | 0 | 0 | 10.46 | 11.67 | 87.33 | 88.33 | 2.21 | 0 |
| 9 | 0 | 0 | 10.6 | 11.57 | 86.91 | 88.43 | 2.48 | 0 |
| 10 | 0 | 0 | 9.79 | 10.02 | 88.17 | 89.98 | 2.05 | 0 |
| 11 | 0 | 0 | 10.52 | 10.54 | 88.75 | 89.46 | 0 | 0 |
| 12 | 0 | 0 | 8.9 | 9.23 | 79.79 | 83.51 | 11.31 | 7.26 |
| 13 | 0 | 0 | 9.74 | 10.58 | 87.58 | 89.42 | 2.68 | 0 |
| 14 | 0 | 0 | 10.37 | 11.82 | 87.38 | 87.98 | 2.25 | 0.2 |
| 15 | 0 | 0 | 10.91 | 12.15 | 88.77 | 87.85 | 0.32 | 0 |
| 16 | 0 | 0 | 10.57 | 11.42 | 87.71 | 87.72 | 1.72 | 0.86 |
| 17 | 0 | 0 | 10.63 | 11.45 | 88.51 | 88.43 | 0 | 0.12 |
| 18 | 0 | 0 | 10.74 | 11.54 | 88.28 | 88.46 | 0 | 0 |
[00158] The data shown in Table 3 indicates that the combination of sorbitol and histidine buffer is préférable to the combination of histidine buffer and sucrose. For examples, the formulations containing histidine buffer and sorbitol, such as formulations 1,4, and 7, showed the least change between To and T24 in the amount of hexamer and trimer species as compared to that observed for the formulations containing histidine buffer and sucrose. This resuit was surprising because histidine buffer and sorbitol are not typically used in combination for protein formulations, whereas histidine buffer and sucrose are often used in combination, It was thus unexpected that the most optimal formulation comprised histidine buffer (pH 6.0 ± 0.5) and sorbitol, rather than histidine buffer and sucrose. The above study also indicates that including polysorbate 20 as a surfactant (see, e.g., Fig. 2E) at a concentration of 0.2% (w/v) (see, e.g., Figs. 2B, 2D, and 2F) provides a formulation in which the stability ofthe HIV gpl40 protein is further improved.
[00159] Advantages of the formulations identified herein over the one that is currently used for gpl40 drug product in clinical trials, include that they use existing qualified compendial grade excipients that are readily available for large scale manufacturing and do not suffer from known issues that might negatively influence stability in the long term, and they enable storage of stable bulk drug substance and antigen drug product. Moreover, these formulations enable storage and stability of adjuvanted drug product as a single vial drug product at refrigerated température. These formulations are suitable for storage in liquid form, but also hâve the potential to be stored in lyophilized form and then reconstituted in liquid prior to injection, which is yet another advantage.
[00160] Example 3: Stability Studies of HIV Mosaic gpl40 Protein Formulations [00161] Two formulations containing HIV mosaic gpl40 protein (SEQ ID NO: 2) were examined for stability in a freeze-thaw and température cycling study. The formulations tested are shown in Table 4.
[00162] Table 4: HIV Mosaic gp!40 Protein Formulations
| Formulation | Protein | Buffer | Sugar | Surfactant |
| Fl | 1.0 mg/mL | 10 mM histidine, pH 6.5 | 12% sorbitol | 0.02% PS20 |
| F2 | 1.0 mg/mL | 10 mM histidine, pH 6.5 | 2% sorbitol | 0.02% PS20 |
[00163] The formulations were subjected to multiple freeze-thaw cycles. One freeze-thaw cycle was conducted by freezing at -80°C or -40°C for 24 hours, followed by thawing at -2°C to 8°C for 24 hours. Samples were analyzed at the end of 1, 3, and 5 cycles of freeze-thaw b y measuring the absorbance at 280 nm (concentration) and 350 nm (turbidity). The results are shown in Fig. 3A and Fig. 3B.
[00164] The results show that the absorbance at 350 nm and 280 nm was largely unchanged for both formulations Fl and F2 after multiple freeze-thaw cycles, indicating that the concentration and turbidity of the formulation were relatively unaffected. This demonstrates that the HIV gpl40 protein in the formulations is stable to freeze-thaw.
[00165] Ëxample 4: Long Term Stability Study of HIV gpl40 protein formulations
[00166] The stability ofHIVgpl40 protein compositions in histidine buffer, both with and without adjuvant according to embodiments of the invention was compared to the stability of an HIV gpl40 protein composition formulated in HEPES buffer, both with and without adjuvant. The compositions tested are shown in Table 5. Ail formulations contained 0.2 mg/mL HIV clade C gpl40 protein (SEQ ID NO: I).
[00167] Table 5: HIV gpl40 protein formulations for long term stability study.
| Formulation | Buffer Composition | Adjuvant? |
| 1 | 20 mM HEPES,pH 6.5 90 m,M NaCl 4% (w/v) sucrose 0.02% polysorbate 80 | No adjuvant |
| 2 | 10 mM histidine buffer, pH 6.5 12% (w/v) sorbitol 0.02% (w/v) polysorbate 20 | No adjuvant |
| 3 | 10 mM histidine buffer, pH 6.5 2% (w/v) sorbitol 0.02% (w/v) polysorbate 20 | No adjuvant |
| 4 | 10 mM histidine buffer, pH 6.5 5% (w/v) sorbitol 0.02% (w/v) polysorbate 20 | No adjuvant |
| 5 | 20 mM HEPES,pH 6.5 90 m,M NaCl 4% (w/v) sucrose 0.02% polysorbate 80 | + aiuminum phosphate adjuvant (0.85 mg/mL) |
| 6 | 10 mM histidine buffer, pH 6.5 12% (w/v) sorbitol 0.02% (w/v) polysorbate 20 | + aiuminum phosphate adjuvant (0.85 mg/mL) |
| 7 | 10 mM histidine buffer, pH 6.5 2% (w/v) sorbitol 0.02% (w/v) polysorbate 20 | + aiuminum phosphate adjuvant (0.85 mg/mL) |
| 8 | 10 mM histidine buffer, pH 6.5 5% (w/v) sorbitol 0.02% (w/v) polysorbate 20 | + aiuminum phosphate adjuvant (0.85 mg/mL) |
[00168] Compositions were stored at 2°C to 8°C; 25°C and 60% relative humidity (RH);
and 40°C and 75% RH. The study is ongoing, and samples are tested after storage for 2 15 weeks, 1, 2, 3, 6, 9, 12,18, 24, 30, and 36 months.
[00169] Samples were tested by reduced SDS after storage for up to three months. Under reducing conditions, as the SDS-PAGE was performed, the trimeric and hexameric forms were reduced to a monomeric form that showed up a single band on the gel. Any dégradation of the protein to lower molecular weight species resulted in a change (decrease) in the monomeric form of the protein observed on the gel. The data for samples stored at 25°C and 60% RH, and at 40°C and 75% RH are shown in Figs. 4A-4D. The data show that ail formulations were stable under storage at 25°C and 60% RH both with and without aluminum phosphate adjuvant for up to three months (Figs. 4A and 4C). However, formulations containing histidine buffer and sorbitol were more stable than the formulation containing HEPES and sucrose (Figs. 4B and 4D) when stored at 40°C and 75% RH, both with and without aluminum phosphate adjuvant. In addition, after six months storage at 25°C the histidine formulated material with 12% sorbitol, without aluminum phosphate adjuvant, showed better stability compared to the HEPES buffered formulation as measured by SDSPAGE (smaller change in % compared to initial measurement; data not shown). Moreover, gpl40 that was formulated with histidine buffer, sorbitol and aluminum phosphate was observed to be stable at 25°C for at least six months (data not shown). Also when formulated with histidine buffer and sorbitol, at higher concentrations of aluminum phosphate adjuvant (3.84 mg/mL), the HIV gpl40 protein was observed to be stable at 25°C for at least six months and at 40°C for at least three months as measured by reduced SDS PAGE (less than 25% réduction, data not shown; while measurements using ELISA showed stability (less than 50% réduction) at 40°C for at least two weeks, data not shown). These data further indicate that HIV gpl40 protein formulations containing histidine buffer and sorbitol hâve enhanced stability, and can thus be stored as an adjuvanted drug product in a single vial at elevated températures, which is an advantage as it is often difficult to formulate adjuvanted protein that is stable to storage at elevated températures. This means that the drug product with adjuvant can be stored in a single vial at a manufacturing or a fill-and-finish site, and does not require separate storage with mixing in a pharmacy or at bed-side just prior to administration. Apart from being economically bénéficiai, this is a huge advantage especially for an HIV vaccine product that is intended to be also used in many places where capacity and facilities may be limited. It is also an advantage of limiting the number of operations to be performed with the drug product on site where a large number of subjects are to be vaccinaied in a single campaign. Thus, the formulations of the invention surprisingly improve the practical properties for use of the final vaccine, especially in resource-limited settings.
[00170] A combination of two HIV gpl40 proteins, one having SEQ ID NO: l and one having SEQ ID NO: 2 is mixed (total protein concentration 0.2-1.0 mg/mL, e.g. 0.1 mg/mL for each protein resulting in a total concentration of gpl40 protein of 0.2 mg/mL) and tested in the preferred formulation, i.e. 2% to 15% (w/v) sorbitol; 0.01 to 0.05% (w/v), e.g. 0.02%, polysorbate 20; and 5 to 20 mM, e.g. 10 mM, histidine buffer at a pH of 5.5 to 7.0, e.g. pH
6.5, and preferably aluminum phosphate, e.g. 0.7-4 mg/mL, e.g. 0.85 or 3.84 mg/mL, using methods as described above. This composition is also expected to be stable for at least six months at 2-8°C, like the individual proteins in this formulation as indicated above.
[00171] It is understood that the examples and embodiments described herein are for illustrative purposes only, and that changes could be made to the embodiments described above without departing from the broad inventive concept thereof. It is understood, therefore, that this invention is not limited to the particular embodiments disclosed, but it is intended to cover modifications within the spirit and scope of the invention as defined by the appended claims.
REFERENCES
LITERATURE
1. Abbink et al., (2007) Virol 81 (9): 4654-63.
2. Baicu et al. Cryobiology (2002) 45(1) 33-48;
3. Barouch et al, Nat Med 2010,16: 319-323
4. Barouch DH et al (2015) Science 349: 320-324.
5. Barouch et al., Cell 155:1-9, 2013
6. Harris A et al (2011). Proc Natl Acad Sci USA 108: 11440-11445.
7. Hoganson et al., 2002, Bioprocessing J1: 43-8
8. Kamerzell et al. Advanced Drug Delivery Reviews (2011)63, 1118-1159
9. Kovacs JM et al (2012) Proc Natl Acac Sci USA 109: 12111-12116
10. Kerzell et al. Advanced Drug Delivery Reviews (2011) 63, 1118-1159
11. Lepe-Zuniga et al. J. Immunol. Methods (1987) 103(1), 145;
12. Nkolola et al. J. Virol. (2014) 88(17), 9538-9552.
13. Nkolola et al. J. Virol. (2010) 84(7), 3270-3279.
14. Sanders RW et al, (2002) J. Virol. 76: 8875-8889.
15. Sanders RW et al (2015) Science 349(6244): aac4223, doi: 10.1126/scîence.aac4223
16. Uchiyama, Biochimica Biophysica Acta (2014) 1844, 2041-2052
17. Zhang C W-H et al (2001) J Biol Chem 276: 39577-39585.
18. Zigler et al. In Vitro Cell. Dev. Biol. (1985) 21(5), 282-287
PATENT DOCUMENTS:
1. WO 2010/042942
2. WO 2014/107744
3. US20120076812;
4. WO 2016/049287
5. WO 2010/059732
6. US20120076812i i
7. WO 2007/104792|
8. PCT/EP2016/081159I
Claims (17)
1. An immunogenic composition comprising, relative to the total volume of the composition:
a. 0.05 mg/mL to 5 mg/mL of an HIV gpl40 protein or of a mixture of at least two HIV gpl40 proteins;
b. 2% to 15% (w/v) sorbitol;
c. 0,01 to 0.05% (w/v) polysorbate 20; and
d. 5 to 20 mM histidine buffer at a pH of 5.5 to 7.0.
2. The immunogenic composition of claim 1, wherein the concentration of the HIV gpl40 protein or of the mixture of HIV gpl40 proteins is 0.2 mg/mL.
3. The immunogenic composition of claim 1, wherein the concentration of the HIV gpl40 protein or of the mixture of HIV gpl40 proteins is 1 mg/mL.
4. The immunogenic composition of any of claims 1 to 3, wherein the concentration of sorbitol is 5% (w/v).
5. The immunogenic composition of any of claims 1 to 3, wherein the concentration of sorbitol is 12% (w/v).
6. The immunogenic composition of any of claims 1-5, wherein the concentration of polysorbate 20 is 0.02% (w/v).
7. The immunogenic composition of any of claims 1-6, wherein the concentration of the histidine buffer is 10 mM, and the pH of the histidine buffer is 6.5.
8. The immunogenic composition of any of claims 1-7, further comprising aluminum phosphate adjuvant, e.g. at 0.7-4.0 mg/mL, e.g. at 0.85 mg/mL or 3.84 mg/mL.
9. The immunogenic composition of any of claims 1-8, wherein the HIV gpl40 protein comprises the amino acid sequence of SEQ ID NO: 1.
10. The immunogenic composition of any of claims 1-8, wherein the HIV gpl40 protein comprises the amino acid sequence of SEQ ID NO: 2.
11. The immunogenic composition of any of claims 1-8, comprising a mixture of an HIV gpl40 protein comprising the amino acid sequence of SEQ ID NO:1 and an HIV gpl40 protein comprising the amino acid sequence of SEQ NO: 2.
12. An immunogenic composition comprising, relative to the total volume ofthe composition,
a. 0.2 mg/mL or 1 mg/mL of an HIV gpl40 protein comprising the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2 or of a mixture of an HIV gpl40 protein comprising the amino acid sequence of SEQ ID NO:1 and an HIV gpl40 protein comprising the amino acid sequence of SEQ NO: 2;
b. 5% or 12% (w/v) sorbitol;
c. 0.02% (w/v) polysorbate 20;
d. 10 mM histidine buffer at a pH of 6.5; and
e. aluminum phosphate adjuvant, e.g. 0.85 mg/mL or 3.84 mg/mL.
13. A method of preparing an immunogenic composition comprising admixing:
a. 0.05 mg/mL to 5 mg/mL of an HIV gpl40 protein or of at least two HIV gpl 40 proteins;
b. 2% to 15% (w/v) sorbitol;
c. 0.01 to 0.05% polysorbate 20; and
d. 5 to 20 mM histidine buffer at a pH of 5.5 to 7.0;
to thereby obtain the immunogenic composition.
14. A method according to claim 13, further comprising admixing:
e.g. 0.7-4.0 mg/mL aluminum phosphate adjuvant.
15. The immunogenic composition of any one of claims 1-12, which is stable upon storage at 2-8°C for at least six months.
16. A method for preparing a long-term, storage stable immunogenic composition that comprises HIV gpl40 protein, the method comprising: (i) providing an immunogenic composition according to any one of claims 1-12 or 15, and (ii) storing said composition at 2-8°C for at least one week, e.g. at least one month, e.g. 1-72 months,
e.g. 6-48 months, e.g. 12-36 months, e.g. 18-30 months.
17. Use of an immunogenic composition according to any one of claims 1-12 or 15 for administering to a subject, preferably a human subject, to induce an immune response against HIV, wherein the immunogenic composition prior to said administering has been stored at 2-8°C for between one day and 36 months.
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US62/350919 | 2016-06-16 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| OA19081A true OA19081A (en) | 2020-01-20 |
Family
ID=
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11603389B2 (en) | HIV vaccine formulation | |
| TWI707039B (en) | Human immunodeficiency virus antigens, vectors, compositions, and methods of use thereof | |
| JP2026040566A (en) | SARS-CoV-2 vaccine | |
| KR102020758B1 (en) | Stabilized human immunodeficiency virus (hiv) envelope (env) trimer vaccines and methods of using the same | |
| CN104619336A (en) | Stabilized proteins for immunity against Staphylococcus aureus | |
| US20250000968A1 (en) | Sars-cov-2 spike fused to a hepatitis b surface antigen | |
| CA3014419A1 (en) | Multivalent hiv vaccine boost compositions and methods of use | |
| CN104736165A (en) | Stabilised proteins for immunising against Staphylococcus aureus | |
| CA3027454C (en) | Hiv vaccine formulation | |
| US20240189413A1 (en) | Compositions and Methods of Manufacturing Trivalent Filovirus Vaccines | |
| US20190231866A1 (en) | Methods for safe induction of cross-clade immunity against hiv infection in humans | |
| US20220305112A1 (en) | Novel methods and uses | |
| CN104582723A (en) | Stabilised proteins for immunising against staphylococcus aureus | |
| CN118119646A (en) | Preparation and application of a recombinant five-component coronavirus trimer protein vaccine that can induce broad-spectrum neutralization activity | |
| EP2987502A1 (en) | Peptide adjuvants | |
| EA039968B1 (en) | COMPOSITION OF THE HIV VACCINE | |
| US11517618B2 (en) | Method of inducing an immune response against human immunodeficiency virus by co-localized administration of vaccine components | |
| Walker et al. | Design and preclinical development of a recombinant protein and DNA plasmid mixed format vaccine to deliver HIV-derived T-lymphocyte epitopes | |
| EA021191B1 (en) | NOVEL gp41 ANTIGENS | |
| CN104684570A (en) | Stabilised proteins for immunising against staphylococcus aureus | |
| CN117999088A (en) | Coronavirus and influenza virus compositions and methods of use thereof | |
| WO2014020205A2 (en) | Improved anti-hiv immunogens |