NZ789514A - Horizontal transfer of fungal genes into plants (2) - Google Patents
Horizontal transfer of fungal genes into plants (2)Info
- Publication number
- NZ789514A NZ789514A NZ789514A NZ78951418A NZ789514A NZ 789514 A NZ789514 A NZ 789514A NZ 789514 A NZ789514 A NZ 789514A NZ 78951418 A NZ78951418 A NZ 78951418A NZ 789514 A NZ789514 A NZ 789514A
- Authority
- NZ
- New Zealand
- Prior art keywords
- plant
- nucleic acid
- species
- gene
- sequence
- Prior art date
Links
- 230000002538 fungal Effects 0.000 title description 58
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 139
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 86
- 206010034133 Pathogen resistance Diseases 0.000 claims abstract description 10
- 230000002708 enhancing Effects 0.000 claims abstract description 10
- 230000031068 symbiosis, encompassing mutualism through parasitism Effects 0.000 claims abstract description 7
- 241000196324 Embryophyta Species 0.000 claims description 228
- 240000004296 Lolium perenne Species 0.000 claims description 62
- 241000894007 species Species 0.000 claims description 49
- 241000209082 Lolium Species 0.000 claims description 43
- 230000014509 gene expression Effects 0.000 claims description 42
- 230000002068 genetic Effects 0.000 claims description 33
- 241000234642 Festuca Species 0.000 claims description 32
- 102000004169 proteins and genes Human genes 0.000 claims description 32
- 108090000623 proteins and genes Proteins 0.000 claims description 32
- 239000002773 nucleotide Substances 0.000 claims description 23
- 125000003729 nucleotide group Chemical group 0.000 claims description 23
- 229920001850 Nucleic acid sequence Polymers 0.000 claims description 19
- 150000001413 amino acids Chemical class 0.000 claims description 15
- 239000002253 acid Substances 0.000 claims description 13
- 239000003550 marker Substances 0.000 claims description 11
- 240000006022 Lolium multiflorum Species 0.000 claims description 9
- 230000000692 anti-sense Effects 0.000 claims description 9
- 230000001717 pathogenic Effects 0.000 claims description 8
- 230000000295 complement Effects 0.000 claims description 7
- 244000052769 pathogens Species 0.000 claims description 4
- 241000221752 Epichloe Species 0.000 claims description 3
- 229920001184 polypeptide Polymers 0.000 abstract description 6
- 238000003752 polymerase chain reaction Methods 0.000 description 57
- 229920003013 deoxyribonucleic acid Polymers 0.000 description 34
- 241000234643 Festuca arundinacea Species 0.000 description 24
- 241001329978 Poeae Species 0.000 description 24
- 210000004027 cells Anatomy 0.000 description 24
- 238000004458 analytical method Methods 0.000 description 22
- 240000004585 Dactylis glomerata Species 0.000 description 20
- 108090000790 Enzymes Proteins 0.000 description 20
- 102000004190 Enzymes Human genes 0.000 description 20
- 230000000875 corresponding Effects 0.000 description 20
- 241000209210 Dactylis Species 0.000 description 19
- 210000002421 Cell Wall Anatomy 0.000 description 18
- 241001457463 Loliinae Species 0.000 description 18
- 241000238357 Mya Species 0.000 description 18
- 240000008529 Triticum aestivum Species 0.000 description 18
- 229920002287 Amplicon Polymers 0.000 description 17
- 241000233866 Fungi Species 0.000 description 17
- 230000000593 degrading Effects 0.000 description 17
- 238000000034 method Methods 0.000 description 17
- 210000001519 tissues Anatomy 0.000 description 17
- 241001494504 Epichloe festucae Species 0.000 description 16
- 240000005979 Hordeum vulgare Species 0.000 description 16
- 235000007340 Hordeum vulgare Nutrition 0.000 description 16
- 240000007594 Oryza sativa Species 0.000 description 16
- 235000007164 Oryza sativa Nutrition 0.000 description 16
- 125000003275 alpha amino acid group Chemical group 0.000 description 16
- 150000002500 ions Chemical class 0.000 description 15
- 235000009566 rice Nutrition 0.000 description 14
- 235000021307 wheat Nutrition 0.000 description 14
- 241001329985 Triticeae Species 0.000 description 13
- 238000006467 substitution reaction Methods 0.000 description 13
- 210000004436 Chromosomes, Artificial, Bacterial Anatomy 0.000 description 12
- 241000221760 Claviceps Species 0.000 description 12
- 241000824650 Dactylis marina Species 0.000 description 12
- 241000234645 Festuca pratensis Species 0.000 description 12
- 230000001105 regulatory Effects 0.000 description 12
- 244000075850 Avena orientalis Species 0.000 description 11
- 229920002459 Intron Polymers 0.000 description 11
- 241000745991 Phalaris Species 0.000 description 11
- 241001136123 Phalaris aquatica Species 0.000 description 11
- 239000000203 mixture Substances 0.000 description 11
- 229920000160 (ribonucleotides)n+m Polymers 0.000 description 10
- 235000007319 Avena orientalis Nutrition 0.000 description 10
- 240000000218 Cannabis sativa Species 0.000 description 10
- 241001456482 Dactylidinae Species 0.000 description 10
- 241001522995 Deschampsia cespitosa Species 0.000 description 10
- 241000410074 Festuca ovina Species 0.000 description 9
- 241000209504 Poaceae Species 0.000 description 9
- 230000003321 amplification Effects 0.000 description 9
- 238000003199 nucleic acid amplification method Methods 0.000 description 9
- 241000218922 Magnoliophyta Species 0.000 description 8
- 239000004459 forage Substances 0.000 description 8
- 235000007558 Avena sp Nutrition 0.000 description 7
- 241000238631 Hexapoda Species 0.000 description 7
- 241000209510 Liliopsida Species 0.000 description 7
- 240000002667 Lolium temulentum Species 0.000 description 7
- 241000957301 fungal endophyte Species 0.000 description 7
- 210000000349 Chromosomes Anatomy 0.000 description 6
- 229920001405 Coding region Polymers 0.000 description 6
- 108020004705 Codon Proteins 0.000 description 6
- 229920002676 Complementary DNA Polymers 0.000 description 6
- 241000060091 Deschampsia antarctica Species 0.000 description 6
- 241000190478 Neotyphodium Species 0.000 description 6
- 241000209048 Poa Species 0.000 description 6
- 241000303715 Trichoderma lixii Species 0.000 description 6
- 239000002299 complementary DNA Substances 0.000 description 6
- 238000002856 computational phylogenetic analysis Methods 0.000 description 6
- 201000010099 disease Diseases 0.000 description 6
- 238000003753 real-time PCR Methods 0.000 description 6
- 241000894006 Bacteria Species 0.000 description 5
- 239000002028 Biomass Substances 0.000 description 5
- 229920002024 GDNA Polymers 0.000 description 5
- 238000002944 PCR assay Methods 0.000 description 5
- 241000223260 Trichoderma harzianum Species 0.000 description 5
- 240000008042 Zea mays Species 0.000 description 5
- 238000004166 bioassay Methods 0.000 description 5
- 230000035784 germination Effects 0.000 description 5
- 238000000126 in silico method Methods 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 230000002028 premature Effects 0.000 description 5
- 241001535157 Cynodon <characin> Species 0.000 description 4
- 241001265118 Epichloe festucae var. lolii Species 0.000 description 4
- 241000206602 Eukaryota Species 0.000 description 4
- 241000508723 Festuca rubra Species 0.000 description 4
- 241000209046 Pennisetum Species 0.000 description 4
- 235000007238 Secale cereale Nutrition 0.000 description 4
- 240000002057 Secale cereale Species 0.000 description 4
- 240000006394 Sorghum bicolor Species 0.000 description 4
- 235000011684 Sorghum saccharatum Nutrition 0.000 description 4
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 4
- 239000011543 agarose gel Substances 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- 244000053095 fungal pathogens Species 0.000 description 4
- 241001522110 Aegilops tauschii Species 0.000 description 3
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 3
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- 108020004999 Messenger RNA Proteins 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 240000003433 Miscanthus floridulus Species 0.000 description 3
- 241000209117 Panicum Species 0.000 description 3
- 241001330453 Paspalum Species 0.000 description 3
- 241000219000 Populus Species 0.000 description 3
- 241000700605 Viruses Species 0.000 description 3
- 230000001580 bacterial Effects 0.000 description 3
- 235000006442 blackseeded proso millet Nutrition 0.000 description 3
- 230000001488 breeding Effects 0.000 description 3
- 235000006443 broomcorn panic Nutrition 0.000 description 3
- 235000013339 cereals Nutrition 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 201000009910 diseases by infectious agent Diseases 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 238000010195 expression analysis Methods 0.000 description 3
- 235000013312 flour Nutrition 0.000 description 3
- 230000001965 increased Effects 0.000 description 3
- 235000021374 legumes Nutrition 0.000 description 3
- 229920002106 messenger RNA Polymers 0.000 description 3
- 239000002207 metabolite Substances 0.000 description 3
- 244000005700 microbiome Species 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000006011 modification reaction Methods 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 108091007521 restriction endonucleases Proteins 0.000 description 3
- 230000002103 transcriptional Effects 0.000 description 3
- 238000011144 upstream manufacturing Methods 0.000 description 3
- 241000208140 Acer Species 0.000 description 2
- 102000007469 Actins Human genes 0.000 description 2
- 108010085238 Actins Proteins 0.000 description 2
- 241000589158 Agrobacterium Species 0.000 description 2
- 241001083841 Aquatica Species 0.000 description 2
- 241000219194 Arabidopsis Species 0.000 description 2
- 241000219195 Arabidopsis thaliana Species 0.000 description 2
- 241000743774 Brachypodium Species 0.000 description 2
- 235000006008 Brassica napus var napus Nutrition 0.000 description 2
- 240000000385 Brassica napus var. napus Species 0.000 description 2
- 235000006618 Brassica rapa subsp oleifera Nutrition 0.000 description 2
- 235000004977 Brassica sinapistrum Nutrition 0.000 description 2
- 240000000464 Cicer arietinum Species 0.000 description 2
- 235000010523 Cicer arietinum Nutrition 0.000 description 2
- JVNVHNHITFVWIX-WBHAVQPBSA-N Cinnamoyl-CoA Natural products S(C(=O)/C=C/c1ccccc1)CCNC(=O)CCNC(=O)[C@@H](O)C(CO[P@](=O)(O[P@@](=O)(OC[C@H]1[C@@H](OP(=O)(O)O)[C@@H](O)[C@H](n2c3ncnc(N)c3nc2)O1)O)O)(C)C JVNVHNHITFVWIX-WBHAVQPBSA-N 0.000 description 2
- 241000218631 Coniferophyta Species 0.000 description 2
- 240000007842 Glycine max Species 0.000 description 2
- 235000010469 Glycine max Nutrition 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N L-serine Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 2
- 240000001307 Myosotis scorpioides Species 0.000 description 2
- 240000008962 Nicotiana tabacum Species 0.000 description 2
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 2
- 235000005205 Pinus Nutrition 0.000 description 2
- 241000218602 Pinus <genus> Species 0.000 description 2
- 240000003443 Poa annua Species 0.000 description 2
- 241000384858 Poa infirma Species 0.000 description 2
- 241000295637 Poa poiformis Species 0.000 description 2
- 241000855713 Poa supina Species 0.000 description 2
- 235000016976 Quercus macrolepis Nutrition 0.000 description 2
- 244000305267 Quercus macrolepis Species 0.000 description 2
- 235000007201 Saccharum officinarum Nutrition 0.000 description 2
- 240000000111 Saccharum officinarum Species 0.000 description 2
- 241000216735 Satsuma dwarf virus Species 0.000 description 2
- 235000007230 Sorghum bicolor Nutrition 0.000 description 2
- 229920001949 Transfer RNA Polymers 0.000 description 2
- 108090000848 Ubiquitin Proteins 0.000 description 2
- 102400000757 Ubiquitin Human genes 0.000 description 2
- 241000607479 Yersinia pestis Species 0.000 description 2
- 235000016383 Zea mays subsp huehuetenangensis Nutrition 0.000 description 2
- 230000036579 abiotic stress Effects 0.000 description 2
- 229930013930 alkaloids Natural products 0.000 description 2
- 230000033228 biological regulation Effects 0.000 description 2
- 230000004790 biotic stress Effects 0.000 description 2
- 235000008984 brauner Senf Nutrition 0.000 description 2
- 230000002759 chromosomal Effects 0.000 description 2
- 235000005822 corn Nutrition 0.000 description 2
- 235000005824 corn Nutrition 0.000 description 2
- 238000007405 data analysis Methods 0.000 description 2
- 230000003247 decreasing Effects 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 230000003828 downregulation Effects 0.000 description 2
- 210000002257 embryonic structures Anatomy 0.000 description 2
- 241001233957 eudicotyledons Species 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 230000005714 functional activity Effects 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 238000009396 hybridization Methods 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 230000004301 light adaptation Effects 0.000 description 2
- 235000009973 maize Nutrition 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 229920001239 microRNA Polymers 0.000 description 2
- 239000002679 microRNA Substances 0.000 description 2
- 238000009304 pastoral farming Methods 0.000 description 2
- 210000001938 protoplasts Anatomy 0.000 description 2
- 239000002096 quantum dot Substances 0.000 description 2
- 230000001850 reproductive Effects 0.000 description 2
- 238000003559 rna-seq method Methods 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- 238000002864 sequence alignment Methods 0.000 description 2
- 230000001568 sexual Effects 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 230000035882 stress Effects 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 230000001131 transforming Effects 0.000 description 2
- 238000004450 types of analysis Methods 0.000 description 2
- 230000003827 upregulation Effects 0.000 description 2
- 238000001262 western blot Methods 0.000 description 2
- GQWWGRUJOCIUKI-UHFFFAOYSA-N 2-[3-(2-methyl-1-oxopyrrolo[1,2-a]pyrazin-3-yl)propyl]guanidine Chemical compound O=C1N(C)C(CCCN=C(N)N)=CN2C=CC=C21 GQWWGRUJOCIUKI-UHFFFAOYSA-N 0.000 description 1
- 102100017808 ABCB5 Human genes 0.000 description 1
- 101700063348 ABCB5 Proteins 0.000 description 1
- 241000589155 Agrobacterium tumefaciens Species 0.000 description 1
- 240000002922 Armillaria mellea Species 0.000 description 1
- 241000235349 Ascomycota Species 0.000 description 1
- 241001426059 Aveneae Species 0.000 description 1
- 229920000195 Bacterial small RNA Polymers 0.000 description 1
- 241001329982 Brachypodieae Species 0.000 description 1
- 241000743776 Brachypodium distachyon Species 0.000 description 1
- 241000195940 Bryophyta Species 0.000 description 1
- 241000701489 Cauliflower mosaic virus Species 0.000 description 1
- LZZYPRNAOMGNLH-UHFFFAOYSA-M Cetrimonium bromide Chemical compound [Br-].CCCCCCCCCCCCCCCC[N+](C)(C)C LZZYPRNAOMGNLH-UHFFFAOYSA-M 0.000 description 1
- 241000195628 Chlorophyta Species 0.000 description 1
- 241000511343 Chondrostoma nasus Species 0.000 description 1
- 210000001106 Chromosomes, Artificial, Yeast Anatomy 0.000 description 1
- 241000221751 Claviceps purpurea Species 0.000 description 1
- 241001480006 Clavicipitaceae Species 0.000 description 1
- 210000001072 Colon Anatomy 0.000 description 1
- 238000007400 DNA extraction Methods 0.000 description 1
- 238000000018 DNA microarray Methods 0.000 description 1
- 239000003155 DNA primer Substances 0.000 description 1
- 101700011961 DPOM Proteins 0.000 description 1
- 241000721047 Danaus plexippus Species 0.000 description 1
- 235000019749 Dry matter Nutrition 0.000 description 1
- 108010066133 EC 1.5.1.11 Proteins 0.000 description 1
- 108010067661 EC 2.1.1.68 Proteins 0.000 description 1
- 241000464742 Epichloe gansuensis Species 0.000 description 1
- 229940083253 Ergot alkaloid peripheral vasodilators Drugs 0.000 description 1
- 240000001200 Eucalyptus globulus Species 0.000 description 1
- 235000004694 Eucalyptus leucoxylon Nutrition 0.000 description 1
- 235000010705 Eucalyptus maculata Nutrition 0.000 description 1
- 235000009683 Eucalyptus polybractea Nutrition 0.000 description 1
- 235000009687 Eucalyptus sargentii Nutrition 0.000 description 1
- 241000032240 Festuca filiformis Species 0.000 description 1
- OPMNROCQHKJDAQ-FKSUSPILSA-N Festucine Chemical class C1C[C@@H]2O[C@H]3[C@H](NC)[C@@H]2N1C3 OPMNROCQHKJDAQ-FKSUSPILSA-N 0.000 description 1
- 108010023832 Florigen Proteins 0.000 description 1
- 241000223221 Fusarium oxysporum Species 0.000 description 1
- 102100004985 GUSB Human genes 0.000 description 1
- 108010056771 Glucosidases Proteins 0.000 description 1
- 102000004366 Glucosidases Human genes 0.000 description 1
- 108010060309 Glucuronidase Proteins 0.000 description 1
- ZEKANFGSDXODPD-UHFFFAOYSA-N Glyphosate-isopropylammonium Chemical compound CC(C)N.OC(=O)CNCP(O)(O)=O ZEKANFGSDXODPD-UHFFFAOYSA-N 0.000 description 1
- 241000209219 Hordeum Species 0.000 description 1
- 241000221930 Hypomyces chrysospermus Species 0.000 description 1
- 108020004391 Introns Proteins 0.000 description 1
- 108010025815 Kanamycin Kinase Proteins 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-N L-arginine Chemical compound OC(=O)[C@@H](N)CCCN=C(N)N ODKSFYDXXFIFQN-BYPYZUCNSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 101710029649 MDV043 Proteins 0.000 description 1
- 240000004658 Medicago sativa Species 0.000 description 1
- HGCNKOLVKRAVHD-RYUDHWBXSA-N Met-Phe Chemical compound CSCC[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 HGCNKOLVKRAVHD-RYUDHWBXSA-N 0.000 description 1
- 108020004388 MicroRNAs Proteins 0.000 description 1
- 229920000460 Mitochondrial DNA Polymers 0.000 description 1
- 108020005196 Mitochondrial DNA Proteins 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 210000003463 Organelles Anatomy 0.000 description 1
- 101700061424 POLB Proteins 0.000 description 1
- 244000271379 Penicillium camembertii Species 0.000 description 1
- 235000002245 Penicillium camembertii Nutrition 0.000 description 1
- 241001310793 Podium Species 0.000 description 1
- 241001330029 Pooideae Species 0.000 description 1
- 241000218976 Populus trichocarpa Species 0.000 description 1
- 101700054624 RF1 Proteins 0.000 description 1
- 230000025458 RNA interference Effects 0.000 description 1
- 235000002912 Salvia officinalis Nutrition 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 229940035295 Ting Drugs 0.000 description 1
- 231100000765 Toxin Toxicity 0.000 description 1
- 241001136486 Trichocomaceae Species 0.000 description 1
- 241000223259 Trichoderma Species 0.000 description 1
- 241000209140 Triticum Species 0.000 description 1
- 101700073917 UP01 Proteins 0.000 description 1
- 108020004417 Untranslated RNA Proteins 0.000 description 1
- 241000372906 Vahlodea Species 0.000 description 1
- 235000007244 Zea mays Nutrition 0.000 description 1
- 230000002378 acidificating Effects 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000003044 adaptive Effects 0.000 description 1
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 1
- 235000017585 alfalfa Nutrition 0.000 description 1
- 235000017587 alfalfa Nutrition 0.000 description 1
- 150000003797 alkaloid derivatives Chemical class 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 230000000843 anti-fungal Effects 0.000 description 1
- 229940051869 antimigraine Ergot alkaloids Drugs 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 244000052616 bacterial pathogens Species 0.000 description 1
- 101710022772 bgc Proteins 0.000 description 1
- 230000000975 bioactive Effects 0.000 description 1
- 230000003115 biocidal Effects 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 101710015579 chi01 Proteins 0.000 description 1
- 101710015575 cht-1 Proteins 0.000 description 1
- 238000004140 cleaning Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 230000002860 competitive Effects 0.000 description 1
- 244000038559 crop plants Species 0.000 description 1
- 238000009402 cross-breeding Methods 0.000 description 1
- 235000013365 dairy product Nutrition 0.000 description 1
- 230000004059 degradation Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000001419 dependent Effects 0.000 description 1
- 230000001627 detrimental Effects 0.000 description 1
- 235000019621 digestibility Nutrition 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000002255 enzymatic Effects 0.000 description 1
- 229960003133 ergot alkaloids Drugs 0.000 description 1
- 235000001612 eucalyptus Nutrition 0.000 description 1
- 235000001617 eucalyptus Nutrition 0.000 description 1
- 235000001621 eucalyptus Nutrition 0.000 description 1
- 235000006356 eucalyptus Nutrition 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 230000001261 florigenic Effects 0.000 description 1
- 238000006062 fragmentation reaction Methods 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 125000000267 glycino group Chemical group [H]N([*])C([H])([H])C(=O)O[H] 0.000 description 1
- 244000038280 herbivores Species 0.000 description 1
- 230000001744 histochemical Effects 0.000 description 1
- 108010002685 hygromycin-B kinase Proteins 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 238000009114 investigational therapy Methods 0.000 description 1
- 230000001404 mediated Effects 0.000 description 1
- 108010068488 methionylphenylalanine Proteins 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 230000004660 morphological change Effects 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 229920001894 non-coding RNA Polymers 0.000 description 1
- 235000016709 nutrition Nutrition 0.000 description 1
- 230000035764 nutrition Effects 0.000 description 1
- 210000000056 organs Anatomy 0.000 description 1
- 108010082527 phosphinothricin N-acetyltransferase Proteins 0.000 description 1
- 230000001402 polyadenylating Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 235000005227 red mallee Nutrition 0.000 description 1
- 230000003362 replicative Effects 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 235000002020 sage Nutrition 0.000 description 1
- 239000001296 salvia officinalis l. Substances 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 230000002588 toxic Effects 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 108020003112 toxins Proteins 0.000 description 1
- 108060008606 traP Proteins 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- 238000010200 validation analysis Methods 0.000 description 1
- 230000003612 virological Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Abstract
The present invention relates to methods of creating or enhancing symbiotic relationships between plants and symbionts, in particular symbionts carrying domain-of-unknown-function (DUF) genes. The present invention also relates to methods for selecting plants for symbiosis with symbionts and methods of modifying pathogen resistance in plants. The present invention also relates to new organisms and symbiota developed by the methods of the invention and to related nucleic acids, polypeptides and constructs including vectors. of modifying pathogen resistance in plants. The present invention also relates to new organisms and symbiota developed by the methods of the invention and to related nucleic acids, polypeptides and constructs including vectors.
Description
Patent No. # - Complete Specification
No. Date:
HORIZONTAL TRANSFER OF FUNGAL GENES INTO PLANTS (2)
We, Agriculture Victoria Services Pty Ltd, of AgriBio Centre for AgriBioscience, 5 Ring
Road, Bundoora VIC 3083, Australia, hereby declare the invention, for which we pray
that a patent may be granted to us, and the method by which it is to be performed, to
be particularly bed in and by the following statement
HORIZONTAL TRANSFER OF FUNGAL GENES INTO PLANTS (2)
Divisional Application status
Pursuant to Section 34 of the New d Patents Act 2013, this application is intended to
be filed as a divisional of New Zealand application no 760713 filed on 27 July 2018.
Pursuant to Regulation 52 of the New Zealand Patents Regulations 2014, it is requested that
this divisional application is given the earlier filing date of 27 July 2018.
Field of the ion
The present invention relates to methods of ing and breeding organisms, in particular
organisms which exhibit symbiotic behaviour with symbionts such as fungal endophytes or
epiphytes or bacterial microbiome in plants, methods of creating or enhancing symbiotic
relationships between plants and symbionts, and new organisms and symbiota developed
thereby.
The invention also relates to nucleic acids ed in the methods, vectors including the
nucleic acids, plant cells, plants, seeds and other plant parts ormed with the nucleic
acids and vectors, and methods of using the nucleic acids and vectors.
ound of the Invention
Important plants, including forage s, legumes, trees, shrubs, and vines are commonly
found in association with endophytes ing fungi, bacteria, viruses and microbes. Both
beneficial and detrimental horticultural and agronomic properties result from such
associations, including improved tolerance to water and nt stress and ance to
insect pests. For e, in grasses, insect resistance may be provided by specific
metabolites ed by the endophyte, in particular loline alkaloids and peramine. Other
metabolites produced by the endophyte, for example lolitrems and ergot alkaloids, may be
toxic to grazing animals and reduce herbivore feeding. Considerable variation is known to
exist in the metabolite profile of endophytes. Endophyte strains that lack either or both of the
animal toxins have been introduced into commercial cultivars.
However, there remains a need for methods of using organisms which exhibit tic
our with endophytes. Difficulties in artificially breeding of these symbiota limit their
usefulness. For example, many of the endophytes known to be beneficial to pasture-based
agriculture exhibit low inoculation frequencies and are less stable in elite germplasm.
Moreover, in traditional breeding techniques, for e in forage grasses such as perennial
ryegrass and tall fescue, grass varieties are bred using classic cross-breeding techniques
and grass genotypes are selected for their superior characteristics, after monitoring their
performance over a period of multiple years. The selected grass genotypes that form the
experimental variety are then inoculated with a single endophyte and the resulting grassendophyte
associations are evaluated for any able characteristics such as insect
resistance. The individual experimental synthetic varieties deploying a single yte in
them are then evaluated for agronomic performance and resulting animal performance by
grazing animals over a period of years. This tion process may reveal that the single
endophyte being deployed in the ent experimental synthetic varieties may not show
vegetative and/or intergenerational stability in some of these varieties or the desired alkaloid
profile conferred by the single endophyte may vary n different synthetic varieties
failing to confer riate levels of insect resistance or causing animal toxicoses. It would
be a significant development in the art if this time-consuming process could be accelerated
or otherwise improved.
The Poeae tribe of the Poaceae family is composed of a range of eason turf and forage
grass species, including those of sub-tribes Loliinae and Dactylidinae. ial ryegrass
(Lolium perenne L.; sub-tribe Loliinae) is one of the most ant pasture crop s for
the dairy industry, and it has consequently been a primary target for improvement using
molecular biology and genetic technologies. Asexual fungal endophyte species of the genus
Epichloë (syn. Neotyphodium) are nts of species ing to the Poeae tribe genera
Lolium and Festuca.
The fungal endophyte species rely on the plant host for nutrition, reproduction, and protection
from abiotic and biotic stress. Benefits to the host plant include enhanced competitive
abilities, tolerance to pathogens, and resistance to animal and insect herbivory. Due to its
agronomic importance, the molecular basis of the symbiosis has been investigated, and
deterrence of insect herbivory is largely due to the production of bioactive alkaloids, as well
as makes caterpillars floppy-like (mcf-like) gene products.
Horizontal gene transfer (HGT) has been a source of evolutionary y in both prokaryotes
and eukaryotes. In flowering plant species, organelle genomes have served as both donors
and recipients of gene er events. In st to organellar genes, transfer of nuclear
genes to perms appears to have been rare, and has been confined to date to genes
originating from prokaryotes or other plant species such as green algae, mosses and other
angiosperms. A previous systematic in silico study, from investigation of four completely
sequenced angiosperm genomes (those of Arabidopsis thaliana L., rice [Oryza sativa L.],
sorghum [Sorghum bicolor L.], and poplar [Populus trichocarpa Torr. & A.Gray ex. Hook.]),
found no evidence for HGT from fungal species, despite two and three highly reliable events
for moss and lycophyte lineages, respectively [Richards, T. A. et al.]. It was consequently
concluded that gene transfer from fungi into angiosperms must be exceedingly infrequent.
It is accordingly an object of the present invention to overcome, or at least alleviate, one or
more of the difficulties or deficiencies associated with the prior art.
Summary of the Invention
The applicant has found evidence for ancient horizontal transfer of a number of fungal genes
into angiosperm lineages. In particular the applicant has found ce for multiple events
of horizontal gene transfer (HGT) from ancestral species of fungal endophytes (of the
Epichloë genus) into grass species. In ial ryegrass (Lolium perenne L.), three fungus-
originating genes were identified. One was specific to the Poeae subtribes Loliinae, ae
and Dactylidinae. The gene has an enzymatic activity for degradation of components
commonly found in cell walls of fungi. The gene may be previously ered to be specific
to fungi. For example, the gene may be a ß-1,6-glucanase gene. The ß-1,6-glucanase genes
may be isolated from fungal species such as Epichloë festucae, for example strains such as
Leuchtm., Schardl and M.R. Siegel (the sexual counterpart to the perennial ryegrass
endophyte), ea lixii Pat., and Trichoderma harzianum Rifai. r gene was specific
to the Loliinae subtribe, and the other was conserved within the Triticeae and Poeae tribes,
including common wheat (Triticum aestivum L.), barley (Hordeum vulgare L.), and oat (Avena
sativa L.). This is the first report of horizontal er of a nuclear gene from a taxonomically
distant eukaryote to modern ing plants and provides evidence for a novel adaptation
mechanism in angiosperms.
In a first aspect, the present invention provides a substantially ed or isolated nucleic acid
or nucleic acid fragment encoding a fungal cell wall degrading enzyme, preferably a
glucanase, more preferably a β-1, 6-glucanase (BGNL), wherein the nucleic acid or nucleic
acid fragment is isolated from a plant species.
In a preferred embodiment, the plant is a Loliinae or Dactylidnae species. In a more red
embodiment the plant is from a Lolium, Festuca or Dactylis species.
The Lolium or Festuca species may be of any suitable type, including Italian or annual
ryegrass, perennial ryegrass, tall fescue, meadow fescue and red fescue. Preferably the
ryegrass or fescue species is a Lolium s such as Lolium perenne or Lolium
arundinaceum which is otherwise known as Festuca nacea.
The Dactylis species may be of any suitable type. Preferably the Dactylis species is a
Dactylis marina or Dactylis glomerata.
In a second aspect, the present invention provides a substantially purified or isolated c
acid or nucleic acid fragment of a domain-of-unknown-function (DUF) gene, wherein the
nucleic acid or nucleic acid fragment is isolated from a plant species.
In a preferred embodiment, the plant is a Loliinae species. In a more red embodiment
the plant is from a Lolium or Festuca s.
The Lolium or Festuca species may be of any suitable type, including Italian or annual
ss, perennial ss, tall fescue, meadow fescue and red fescue. Preferably the
ryegrass or fescue species is a Lolium species such as Lolium e or Lolium multiflorum
which is otherwise known as Festuca perennis.
In a third aspect, the present invention es a substantially purified or isolated nucleic
acid or nucleic acid nt encoding a fungal riptional regulatory-like (FTR) protein,
wherein the nucleic acid or nucleic acid fragment is isolated from a plant species.
In a preferred embodiment, the plant is a Triticeae and Poeae species. In a more preferred
embodiment the plant is from a Triticeae or Aveneae species.
The Triticeae or e species may be of any suitable type, including barley, wheat and
oat. Preferably the ryegrass or fescue species is a Triticum, Hordeum or Avena species such
as Triticum aestivum, Hordeum vulgare and Avena sativa.
Thus, the present invention provides a substantially purified or isolated nucleic acid or nucleic
acid fragment:
encoding a fungal cell wall degrading enzyme;
of a DUF gene; or
encoding a FTR protein,
wherein the nucleic acid or nucleic acid fragment is isolated from a plant species.
In other words, the t invention provides a substantially purified or isolated nucleic acid
or nucleic acid fragment from a plant species, the nucleic acid or nucleic acid fragment being
horizontally transferred from a fungal species, wherein the nucleic acid or nucleic acid
fragment encodes a fungal cell wall degrading , is a DUF gene, or encodes a FTR
protein.
By ‘nucleic acid’ is meant a chain of nucleotides capable of carrying genetic information. The
term generally refers to genes or functionally active fragments or variants thereof and or other
sequences in the genome of the organism that influence its phenotype. The term ‘nucleic
acid’ includes DNA (such as cDNA or genomic DNA) and RNA (such as mRNA or microRNA)
that is single- or double-stranded, optionally containing synthetic, tural or altered
nucleotide bases, synthetic nucleic acids and combinations thereof.
The c acid or nucleic acid fragment may be of any suitable type and includes DNA
(such as cDNA or genomic DNA) and RNA (such as mRNA) that is single- or doublestranded
, ally containing synthetic, non-natural or altered nucleotide bases, and
combinations thereof.
By ‘substantially purified’ is meant that the nucleic acid or nucleic acid fragment is free of the
genes, which, in the naturally-occurring genome of the organism from which the nucleic acid
or c acid fragment of the ion is derived, flank the nucleic acid or nucleic acid
fragment. The term therefore includes, for example, a nucleic acid or nucleic acid nt
which is incorporated into a vector; into an autonomously replicating plasmid or virus; or into
the genomic DNA of a prokaryote or eukaryote; or which exists as a separate molecule (e.g.
a cDNA or a c or cDNA fragment produced by PCR or restriction endonuclease
ion) independent of other sequences. It also es a nucleic acid or nucleic acid
fragment which is part of a hybrid gene. ably, the ntially purified nucleic acid or
nucleic acid fragment is at least approximately 90% pure, more preferably at least
approximately 95% pure, even more preferably at least approximately 98% pure.
The term “isolated” means that the material is removed from its original environment (e.g. the
natural environment if it is naturally occurring). For example, a naturally occurring nucleic
acid present in a living plant is not isolated, but the same nucleic acid separated from some
or all of the coexisting materials in the natural system, is isolated. Such nucleic acids could
be part of a vector and/or such c acids could be part of a composition, and still be
isolated in that such a vector or composition is not part of its natural environment.
In preferred embodiments, the substantially purified or isolated nucleic acid or nucleic acid
fragment encoding a fungal cell wall degrading enzyme includes a nucleotide sequence
selected from the group consisting of the sequences shown in Sequence ID Nos: 1 to 4; and
onally active fragments and variants thereof.
Also in preferred embodiments, the substantially purified or isolated nucleic acid or nucleic
acid fragment of the DUF gene includes a nucleotide ce selected from the group
ting of the sequence shown in Sequence ID No: 28 and sequences encoding the
ptide shown in Sequence ID No: 29; and onally active fragments and variants
thereof.
Also in preferred embodiments, the substantially purified or ed nucleic acid or nucleic
acid fragment encoding a FTR protein includes a nucleotide ce ed from the
group consisting of the sequence shown in Sequence ID No: 30 and ces encoding
the polypeptide shown in Sequence ID No: 31; and functionally active fragments and variants
thereof.
The substantially purified or isolated nucleic acid or nucleic acid of the present invention also
es sequences complementary or nse to a sequence encoding a fungal cell wall
degrading enzyme, to a DUF gene or to a sequence ng a FTR protein, and preferably
sequences selected from the group consisting of sequences complementary or antisense to
Sequence ID Nos: 1–4, 28 and 30; or complementary or antisense to the sequences
encoding the polypeptides shown in Sequence ID Nos: 29 and 31.
In a preferred embodiment, the t invention provides a substantially purified or isolated
nucleic acid or nucleic acid fragment
of a DUF gene or a mentary or antisense sequence to a nucleic acid or nucleic acid
fragment of a DUF gene, said nucleic acid or nucleic acid fragment including a nucleotide
sequence selected from the group consisting of:
(a) the sequence shown in Sequence ID No: 28;
(b) complement of the ce recited in (a);
(c) sequences antisense to the sequence recited in (a); and
(d) functionally active fragments and variants of the sequences recited in (a), (b)
and (c).
By “functionally ” is meant that the fragment or variant (such as an analogue, derivative
or mutant) is capable of modifying pathogen resistance in a plant, or creating or enhancing a
symbiotic relationship between a plant and a symbiont. Such variants e naturally
occurring allelic variants and non-naturally occurring variants. Additions, deletions,
substitutions and derivatizations of one or more of the nucleotides are contemplated so long
as the modifications do not result in loss of functional activity of the fragment or variant.
Preferably the functionally active fragment or variant has at least imately 80% identity
to the relevant part of the above-mentioned sequence to which the fragment or variant
corresponds, more preferably at least approximately 90% identity, even more preferably at
least approximately 95% ty, most preferably at least approximately 98% identity. Such
functionally active variants and fragments include, for example, those having conservative
nucleic acid s. By ‘conservative c acid changes’ is meant nucleic acid
substitutions that result in conservation of the amino acid in the encoded protein, due to the
degeneracy of the genetic code. Such functionally active variants and fragments also
include, for example, those having c acid changes which result in vative amino
acid substitutions of one or more residues in the corresponding amino acid sequence. By
‘conservative amino acid substitutions’ is meant the substitution of an amino acid by r
one of the same class, the classes being as follows:
Nonpolar: Ala, Val, Leu, Ile, Pro, Met Phe, Trp
ged polar: Gly, Ser, Thr, Cys, Tyr, Asn, Gln
Acidic: Asp, Glu
Basic: Lys, Arg, His
Other conservative amino acid substitutions may also be made as follows:
Aromatic: Phe, Tyr, His
Proton Donor: Asn, Gln, Lys, Arg, His, Trp
Proton Acceptor: Glu, Asp, Thr, Ser, Tyr, Asn, Gln
Preferably the fragment has a size of at least 20 nucleotides, more preferably at least 50
nucleotides, more preferably at least 100 nucleotides, more preferably at least 200
nucleotides, more preferably at least 500 nucleotides.
In a fourth aspect of the present invention there is provided a c uct or a vector
including a nucleic acid or c acid fragment according to the present invention.
In other words, the present invention provides a genetic construct or a vector including a
nucleic acid or nucleic acid fragment according to the present invention, or sequences
complementary or antisense thereto. Preferably the nucleic acid or nucleic acid fragment
has a sequence selected from the group consisting of Sequence ID Nos: 1–4, 28, 30, and
nucleic acids encoding the polypeptides shown in Sequence ID Nos: 29 and 31.
In a preferred embodiment of this aspect of the invention, the vector may include a regulatory
element such as a promoter, a nucleic acid or nucleic acid fragment according to the t
ion and a ator; said regulatory t, nucleic acid or nucleic acid fragment and
terminator being operatively linked.
By ‘genetic construct’ is meant a recombinant c acid molecule.
By a ‘vector’ is meant a genetic construct used to transfer genetic material to a target cell.
By ‘operatively linked’ is meant that the nucleic acid(s) and a regulatory sequence, such as
a promoter, are linked in such a way as to permit expression of said nucleic acid under
appropriate conditions, for example when appropriate molecules such as transcriptional
activator proteins are bound to the regulatory sequence. Preferably an operatively linked
er is upstream of the associated nucleic acid.
The vector may be of any suitable type and may be viral or ral. The vector may be an
expression . Such vectors include chromosomal, non-chromosomal and synthetic
nucleic acid sequences, e.g. derivatives of plant viruses; bacterial plasmids; derivatives of
the Ti plasmid from Agrobacterium tumefaciens; derivatives of the Ri plasmid from
Agrobacterium enes; phage DNA; yeast artificial chromosomes; bacterial artificial
chromosomes; binary bacterial artificial chromosomes; vectors derived from combinations of
plasmids and phage DNA. However, any other vector may be used as long as it is replicable
or integrative or viable in the plant cell.
The regulatory t and ator may be of any suitable type and may be endogenous
to the target plant cell or may be exogenous, provided that they are functional in the target
plant cell.
Preferably the regulatory element is a promoter. A variety of promoters which may be
employed in the vectors of the present invention are well known to those skilled in the art.
Factors influencing the choice of promoter include the desired tissue specificity of the vector,
and whether tutive or ble expression is desired and the nature of the plant cell to
be transformed (e.g. monocotyledon or ledon). Particularly le promoters include
the Cauliflower Mosaic Virus 35S (CaMV 35S) promoter, the maize Ubiquitin promoter, the
rice Actin er, and ryegrass endogenous OMT, 4CL, CCR or CAD promoters.
A variety of terminators which may be employed in the vectors of the present ion are
also well known to those skilled in the art. The terminator may be from the same gene as the
promoter sequence or a different gene. Particularly suitable terminators are polyadenylation
signals, such as the CaMV 35S polyA and other terminators from the ne synthase (nos)
and the octopine synthase (ocs) genes.
The vector, in addition to the tory element, the nucleic acid or nucleic acid fragment of
the present invention and the terminator, may include further elements necessary for
expression of the nucleic acid or nucleic acid fragment, in different ations, for example
vector backbone, origin of replication (ori), multiple cloning sites, spacer sequences,
enhancers, introns (such as the maize Ubiquitin Ubi intron), antibiotic resistance genes and
other selectable marker genes [such as the neomycin phosphotransferase (npt2) gene, the
hygromycin phosphotransferase (hph) gene, the phosphinothricin acetyltransferase (bar or
pat) gene], and reporter genes (such as beta-glucuronidase (GUS) gene ]. The vector
may also contain a ribosome binding site for translation initiation. The vector may also include
appropriate sequences for amplifying expression.
As an alternative to use of a able marker gene to provide a phenotypic trait for selection
of transformed host cells, the presence of the vector in transformed cells may be determined
by other techniques well known in the art, such as PCR (polymerase chain reaction),
Southern blot hybridisation analysis, histochemical GUS , northern and Western blot
hybridisation analyses.
Those skilled in the art will appreciate that the various components of the vector are
operatively linked, so as to result in expression of said nucleic acid or nucleic acid fragment.
Techniques for operatively linking the components of the vector of the present ion are
well known to those skilled in the art. Such techniques include the use of linkers, such as
tic linkers, for example including one or more restriction enzyme sites.
The nucleic acids and vectors of the present invention may be used to up-regulate or downregulate
expression of corresponding genes in plants.
By ‘up-regulating’ expression of said gene is meant increasing expression of said gene and,
as a result, the protein encoded by the gene, in a plant relative to a control plant.
By regulating’ expression of said gene is meant decreasing expression of said gene
and, as a result, the protein encoded by the gene, in a plant relative to a control plant.
The up-regulation or down-regulation may be carried out by methods known to those skilled
in the art. For example, a gene may be up-regulated by orating additional copies of a
sense copy of the gene. A gene may be down-regulated, for example, by incorporating an
antisense c acid, a frame-shifted or otherwise modified sense copy of the gene, or a
nucleic acid encoding ering RNA .
The up- or down-regulation may be carried out by introducing into said plant an effective
amount of a genetic construct including the gene or a modified form thereof, such as an
antisense nucleic acid, a frame shifted copy of the gene or a nucleic acid ng RNAi.
The vectors of the present invention may be orated into a variety of plants, including
monocotyledons (such as s from the genera Lolium, Festuca, Dactylis, Cynodon,
Bracharia, Paspalum, Panicum, thus, Pennisetum, Phalaris, and other forage, turf and
bioenergy grasses, corn, oat, sugarcane, rice, wheat and barley), dicotyledons (such as
Arabidopsis, tobacco, legumes, Alfalfa, oak, ptus, maple, Populus, canola, soybean
and chickpea) and gymnosperms (such as Pinus). In a preferred embodiment, the vectors
are used to transform monocotyledons, preferably grass s such as Lolium, Festuca,
Dactylis, Cynodon, Bracharia, Paspalum, Panicum, Miscanthus, Pennisetum, Phalaris, and
other forage, turf and bioenergy grasses, more preferably a Lolium species such as Lolium
perenne or Lolium arundinaceum, including cultivars for forage and turf applications, or a
Dactylis species.
Techniques for orating the vectors of the present invention into plant cells (for example
by transduction, transfection or transformation) are well known to those d in the art.
Such techniques include Agrobacterium mediated introduction, electroporation to tissues,
cells and protoplasts, protoplast fusion, injection into reproductive organs, injection into
immature embryos and high velocity projectile introduction to cells, tissues, calli, re
and mature embryos. The choice of technique will depend largely on the type of plant to be
transformed.
Cells incorporating the vector of the t ion may be selected, as described above,
and then ed in an appropriate medium to regenerate transformed plants, using
techniques well known in the art. The culture conditions, such as temperature, pH and the
like, will be apparent to the person skilled in the art. The resulting plants may be reproduced,
either sexually or asexually, using s well known in the art, to produce successive
generations of transformed plants.
In a fifth aspect of the present ion there is provided a transformed plant cell, plant, plant
seed or other plant part, or plant biomass, ing digestible biomass such as hay,
including, e.g. transformed with, a nucleic acid, genetic construct or vector of the present
invention. ably the transgenic plant cell, plant, plant seed or other plant part is
produced by a method according to the present invention.
The present invention also provides a transgenic plant, plant seed or other plant part, or plant
biomass, derived from a plant cell of the present ion and including a nucleic acid,
genetic construct or vector of the t invention.
The present invention also provides a transgenic plant, plant seed or other plant, part or plant
biomass, derived from a plant of the present invention and including a nucleic acid, genetic
construct or vector of the present invention.
The nucleic acid, genetic construct or vector of the present ion may be stably integrated
into the genome of the plant, plant seed, other plant part or plant biomass.
The plant cell, plant, plant seed or other plant part may be from any suitable species, including
monocotyledons (such as grasses from the genera Lolium, Festuca, Dactylis, Cynodon,
Bracharia, Paspalum, m, Miscanthus, Pennisetum, Phalaris, and other forage, turf and
bioenergy grasses, corn, oat, sugarcane, rice, wheat and ), dicotyledons (such as
Arabidopsis, tobacco, legumes, a, oak, Eucalyptus, maple, Populus, canola, soybean
and chickpea) and gymnosperms (such as Pinus). In a preferred embodiment the plant cell,
plant, plant seed or other plant part may be from a monocotyledon, preferably a grass
species, such as Lolium, Festuca, Dactylis, Cynodon, Bracharia, um, Panicum,
Miscanthus, Pennisetum, Phalaris, and other , turf and bioenergy grasses, more
preferably a Lolium species such as Lolium perenne or Lolium arundinaceum or a Dactylis
species.
In a sixth aspect of the present ion there is ed a method of modifying pathogen
resistance in a plant, said method including introducing into said plant an effective amount of
a nucleic acid or nucleic acid fragment, c construct and/or a vector according to the
present invention.
By “modifying pathogen resistance” is meant ing a plant’s y to protect itself from,
or reduce the extent of, pathogen growth on or in the plant. Such pathogen resistance may
subsequently protect the plant from, or reduce the extent of, fungal diseases generated by
such fungal pathogens. Fungal diseases may include leaf spot, stalk rot, root rot, dying-off,
choke disease and seedling wilt. Modifying pathogen resistance includes creating resistance
to a pathogen in a plant, or sing or decreasing existing levels of resistance in a plant.
In a seventh aspect of the t invention there is provided use of a nucleic acid or nucleic
acid fragment according to the t invention, and/or nucleotide ce information
thereof, and/or single nucleotide polymorphisms thereof, as a molecular genetic marker.
More particularly, nucleic acids or nucleic acid fragments according to the present invention,
and/or nucleotide sequence information thereof, and/or single nucleotide rphisms
thereof, may be used as a molecular c marker for qualitative trait loci (QTL) tagging,
mapping, DNA fingerprinting and in marker assisted selection, and may be used as candidate
genes or perfect markers, particularly in ryegrasses and fescues. Even more particularly,
nucleic acids or nucleic acid fragments according to the present invention, and/or nucleotide
sequence information thereof, may be used as molecular genetic markers in forage and turf
grass improvement, e.g. tagging QTLs for dry matter digestibility, e quality,
mechanical stress tolerance, disease resistance, insect pest ance, plant stature and
leaf and stem colour.
In an eighth aspect of the present invention there is provided a method of creating or
enhancing a symbiotic relationship between a plant and a symbiont carrying:
a fungal cell wall degrading enzyme
a DUF gene; or
a FTR n,
said method including introducing into said plant an effective amount of a nucleic acid or
nucleic acid fragment encoding the fungal cell wall degrading enzyme, of the DUF gene or
encoding the FTR protein, or a functionally active fragment or variant thereof, wherein the
nucleic acid or nucleic acid fragment is isolated from a plant species.
In a preferred embodiment, the t invention es a method of ng or enhancing
a symbiotic relationship between a plant and a symbiont carrying a domain-of-unknownfunction
(DUF) gene; said method including introducing into said plant an effective amount of
a nucleic acid or nucleic acid fragment of the DUF gene, wherein the nucleic acid or nucleic
acid fragment is ed from a plant species.
In a ninth aspect of the present invention there is provided a method of creating or enhancing
a symbiotic relationship between a plant and a symbiont carrying:
a fungal cell wall degrading enzyme;
a DUF gene; or
a FTR protein,
said method including introducing into said plant an effective amount of a nucleic acid or
c acid fragment, genetic construct and/or a vector according to the present invention
and introducing said symbiont into said plant.
The present invention also provides a plant endophyte symbiota ed by a method of
the present invention.
Preferably, the fungal cell wall degrading enzyme is a ase, more ably a BGNL
as hereinbefore described.
By “symbiont” is meant one or more sms that live within the body or cells of another
organism, such as fungal endophytes or epiphytes or a ial microbiome in plants.
By “creating or enhancing a symbiotic relationship” is meant enabling a plant which otherwise
would not form a tic relationship with a selected symbiont to form said symbiotic
relationship or increasing the stability of the symbiotic relationship. For e, the nucleic
acid or nucleic acid fragment, genetic construct and/or a vector according to the present
ion may be introduced into plants such as rice, wheat and barley, which do not naturally
contain an ortholog of the gene of the present invention, to faciliate establishment of symbiotic
relationships n these plants and symbionts.
By “an effective amount” is meant an amount sufficient to result in an identifiable phenotypic
change in said plant cells or a plant, plant seed or other plant part derived rom. Such
amounts can be readily determined by an appropriately d person, taking into account
the type of plant cell, the route of administration and other relevant factors. Such a person
will readily be able to determine a suitable amount and method of administration. See, for
example, Maniatis et al, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor
Laboratory, Cold Spring Harbor, the entire disclosure of which is incorporated herein by
reference.
In a tenth aspect, the present invention provides a method for selecting a plant for symbiosis
with a symbiont carrying a fungal cell wall degrading gene, a DUF gene or a FTR gene, said
method comprising
a) determining the presence of a fungal cell wall degrading gene, a DUF gene or a
FTR gene in said plant,
b) measuring the level of expression of the gene identified in a), and
c) using the expression level measured in b) to determine if the plant will form a
symbiotic relationship with said symbiont.
ably, the fungal cell wall degrading enzyme is a glucanase, more ably a BGNL
as hereinbefore described.
In another red embodiment, the present invention provides a method for selecting a
plant for symbiosis with a symbiont carrying a DUF gene;
said method comprising
a) determining the presence of a DUF gene in said plant,
b) measuring the level of expression of the gene identified in a), and
c) using the expression level measured in b) to determine if the plant will form a
symbiotic relationship with said symbiont.
Techniques for ing the presence of a specific gene in a plant are well known to those
skilled in the art. Such techniques may involve one or more of rase chain reaction
(PCR), sequencing of PCR products, sequencing of c and/or mitochondrial DNA, and
performing sequence analysis and comparisons to assess genetic variation.
Techniques for ing the level of gene expression in plant tissues are well known to
those skilled in the art. Such techniques may involve one or more of e transcription
polymerase chain reaction (RT-PCR), quantitative polymerase chain reaction (qPCR),
northern ng, DNA microarray, Western blotting, 2D-Gel Electrophoresis, and
Immunoassays.
In an eleventh aspect of the present invention there is provided a substantially purified or
isolated fungal cell wall degrading enzyme, DUF or FTR protein, n said fungal cell wall
degrading enzyme, DUF or FTR protein is isolated from a plant species.
In a red embodiment the fungal cell wall degrading enzyme is a glucanase, more
ably a BGNL, and the plant is a Loliinae or Dactylidnae species. In a more preferred
embodiment the plant is from the Lolium, Festuca or Dactylis s.
The Lolium or Festuca s may be of any suitable type, including Italian or annual
ryegrass, perennial ss, tall fescue, meadow fescue and red fescue. Preferably the
ryegrass or fescue species is a Lolium species such as Lolium perenne or Lolium
arundinaceum which is otherwise known as Festuca arundinacea.
The Dactylis species may be of any suitable type. Preferably the Dactylis species is a
Dactylis marina or Dactylis glomerata.
In a preferred embodiment, the present invention provides a substantially purified or isolated
DUF protein, n said DUF protein is isolated from a plant species.
In a preferred embodiment, the plant from which the DUF protein is isolated is a Loliinae
species. In a more preferred embodiment the plant is from a Lolium or Festuca species.
The Lolium or Festuca species may be of any suitable type, including Italian or annual
ryegrass, perennial ss, tall fescue, meadow fescue and red fescue. Preferably the
ryegrass or fescue species is a Lolium species such as Lolium perenne or Lolium multiflorum
which is otherwise known as Festuca perennis.
In a preferred embodiment, the plant from which the FTR protein is isolated is a Triticeae, or
e species, preferably Triticum aestivum, Hordeum vulgare or Avena sativa.
In a preferred embodiment, the substantially purified or isolated fungal cell wall degrading
enzyme includes an amino acid sequence shown in Sequence ID No: 7; or a functionally
active fragment or variant f.
In a preferred embodiment, the ntially purified or isolated DUF protein includes an
amino acid ce shown in Sequence ID No: 29; or a functionally active fragment or
variant thereof.
Thus, in a preferred embodiment, the present invention provides a substantially purified or
isolated DUF protein, said protein including an amino acid sequence selected from the group
consisting of:
(a) the sequence shown in Sequence ID No: 29; and
(b) functionally active fragments and variants of the sequence recited in (a).
In a preferred embodiment, the substantially purified or isolated FTR protein includes an
amino acid ce shown in Sequence ID No: 31; or a functionally active fragment or
variant thereof.
By ionally " in this context is meant that the fragment or variant is capable of
modifying pathogen resistance in a plant, or ng or enhancing a tic relationship
between a plant and a symbiont. Preferably, the fragment or variant has one or more of the
biological properties of the fungal cell wall degrading , DUF or FTR protein. Additions,
deletions, tutions and derivatizations of one or more of the amino acids are
contemplated so long as the modifications do not result in loss of functional activity of the
fragment or variant. Preferably the fragment or variant has at least approximately 60%
identity to the relevant part of the above-mentioned sequence, more preferably at least
approximately 80% identity, most preferably at least approximately 90% identity. Such
onally active variants and nts include, for example, those having conservative
amino acid tutions of one or more residues in the ponding amino acid sequence.
Preferably the fragment has a size of at least 10 amino acids, more preferably at least 15
amino acids, most preferably at least 20 amino acids.
In a further embodiment of this aspect of the invention, there is provided a polypeptide
recombinantly produced from a nucleic acid or nucleic acid fragment according to the present
invention. Techniques for recombinantly producing ptides are well known to those
skilled in the art.
The present invention will now be more fully described with reference to the accompanying
Examples and drawings. It should be understood, however, that the ption following is
illustrative only and should not be taken in any way as a restriction on the generality of the
invention described above.
Brief ption of the Drawings/Figures
Figure 1: Amino acid sequence alignment of LpBGNL -glucanase gene; Sequence ID
No 7) and fungus ß-1,6-glucanase gene products [Neotyphodium sp. (Sequence ID No 5),
Epichloë festucae (Sequence ID No 6), Trichoderma harzianum (Sequence ID No 8),
ea lixii (Sequence ID No 9)]. The aryl-phospho-beta-D-glucosidase domain is shown
in boxes (Sequence ID Nos 10-14). Dash (-) in the amino acid sequences shows a gap.
Following the CLUSTAL W format, sk (*), colon (:) and dot (.) under the alignment
denote ‘conserved amino acid residues’, ‘including conserved substitution(s)’ and ‘including
semi-conserved substitution(s)’. NCBI UI is shown at the end of each sequence.
Figure 2: Genome structure of the LpBGNL and E. festucae ß-1,6-glucanase genes and
genetic linkage analysis for LpBGNL. (a) Alignment of genome sequences from perennial
ryegrass and Epichloë species. The filled and striped boxes in the upper part of Fig 2 (a)
show the location of LpBGNL and the plant genome-related sequence, respectively. The
black-filled box represents the BAC . The filled and empty boxes in the lower part of
Fig 2 (a) show the location of the ß-1,6-glucanase gene and flanking gene, respectively. The
transcription direction of the genes is indicated with the arrow. ponding gene
sequences are connected with black dashed lines. (b) Alignment of coding regions of the
LpBGNL and Epichloë ß-1,6-glucanase genes. The solid lines represent non-gene coding
region of perennial ryegrass (upper part of Fig 2 (b)) and Epichloë (lower part of Fig 2 (b))
species. The location of the intron and aryl-phospho-beta-D-glucosidase domain (breaking
line) are shown. (c) Genetic linkage map of perennial ryegrass LG5 with the LpBGNL-related
locus. The LpBGNL-related marker locus is indicated with the arrow. Genetic distance (cM)
is shown on the right side of the c markers.
Figure 3: The expression levels of LpBGNL and the E. festucae var. lolii ß-1,6-glucanase
gene. (a) The sion level of LpBGNL in each tissue of perennial ryegrass. The y-axis
shows normalised read count number (CPM). (b and c) The sion levels of the genes
in E- and E+ perennial ryegrass genotypes. The x-axis shows time since the germination
treatment, and y-axis shows CPM for LpBGNL (b) and the E. festucae var. lolii ß-1,6-
glucanase gene (c).
Figure 4. Phylogenetic tree of LpBGNL orthologues and fungal ß-1,6-glucanase genes. The
phylogram was generated based on amino acid sequence of the aryl-phospho-beta-D-
glucosidase domain. S equences from angiosperm species are indicated in a dashed box;
the remainder are fungal species. Asterisk (*) denotes species from which gene products
have been med to have the ß-1,6-glucanase activity. For cocksfoot, three contigs
(haplotypes 1-3) were generated, and amino acid sequences from those contigs were used.
For Dactylis marina, the contig without a putative premature stop codon was used. Strain
and sequence contig (scaffold) fiers of the Genome Project at the University of ky
website are shown in brackets. For the other fungal ces, NCBI UI is shown in
brackets. The clade including the sequences from derma and eaas species
were selected as an outer group to obtain a root of the phylogenic tree.
Figure 5. PCR screening for the LpBGNL sequence, and taxonomic classification of plant
species described in the current study (a) PCR amplicons from perennial ryegrass genotype
Impact04, cooksfoot, Dactylis marina, coast tussock-grass and harding grass, and a strain of
E. festucae are visualised on the 2200 TapeStation instrument (Agilent Technologies, CA,
USA). The target fragments are indicated with the large . Two genotypes of coast
tussock-grass were subjected to the screening. The uppermost and lowermost bands show
the position of upper and lower markers, respectively, of the D1000 Kit (Agilent). NTC
denotes no-template control for the PCR assay. The small arrows indicate the positions of
400 and 500-bp fragments of the ladder. (b) Species classified into perms, the tribe
Poeae, and sub-tribes Loliinae and Dactylidinae are indicated by the boxes on the right side
of the phylogenetic tree. The species which were ve and negative in the PCR screening
step are indicated by the plus (+) and minus (-) signs, respectively. The divergent points of
plant species from other s (>1,000 MYA) and the clade monocotyledon from other plant
species (ca. 150 MYA) are indicated with dashed arrows. The divergent points of sub-tribes
Loliinae and Dactylidinae from the remaining Poeae species, especially from genus Poa,
which is a closely related taxon (ca. 13 MYA), and fine-leaved fescue (Sheep fescue) from
broad-leaved fescues (tall fescue and meadow fescue) (ca. 9 MYA) are ted with black
. The triangle represents the putative period of HGT in the evolutionary lineage.
Figure 6. DNA sequence alignment of the two ypes from the C3 genotype (Sequence
ID Nos 15 and 16). Dash (-) in the DNA sequence shows a gap, and asterisk (*) under the
alignment denotes ‘conserved nucleotide’. DNA sequence ponding to the PCR primers
for the indel-based genotyping assay is underlined.
Figure 7. Result of the indel-based genotyping assay. The PCR amplicons were visualised
on an agarose gel including the SYBR™ Safe DNA Gel stain (Thermo Fisher Scientific,
Waltham, Massachusetts, USA). EasyLadder I NE) was used as a size standard, and
the 250 and 500 bp fragments are indicated with arrows. The genotype UI of the genetic
mapping population is indicated in each lane. C3 and NTC stand for ‘the C3 genotype’ and
‘no-template control’.
Figure 8. PCR screening for the LpBGNL sequence using the LpBGNL locus-specific primers
(LpBGNL_short). (a) PCR amplicons from perennial ryegrass genotypes Impact04 and C3,
and perennial ryegrass-associated endophyte were ised on the 2200 TapeStation
instrument using the High Sensitivity D1000 Kit nt). The uppermost and lowermost
bands show the position of upper and lower markers, respectively, of the High Sensitivity
D1000 Kit. (b) PCR amplicons from Lolium and a species (sub-tribe ae) were
visualised on an agarose gel containing the SYBR™ Safe stain. Tall fescue genotypes from
two cultivars (Demeter and Quantum) were subjected to the screening. NTC denotes ‘notemplate
control’ for the PCR assay. (c) PCR amplicons from cocksfoot, Dactylis marina,
coast tussock-grass and harding grass were visualised on the 2200 TapeStation instrument
using the D1000 Kit. The uppermost and lowermost bands show the on of upper and
lower markers, respectively, of the D1000 Kit. Two genotypes of coast tussock-grass were
subjected, and the Impact04 genotype was used as a ve control.
Figure 9. DNA ces of the conserved ca. 750-bp region from plant species (Sequence
ID Nos 17-27). Putative premature stop codons were found in is marina haplotypes 2
and 3.
Figure 10. PCR assay for confirmation of a cross-species amplification ty. PCR
amplicons from cooksfoot, is marina, coast tussock-grass and harding grass were
visualised on the 2200 TapeStation instrument using the D1000 Kit. The uppermost and
lowermost bands show the position of upper and lower markers, respectively, of the D1000
Kit. The position of the target amplicons is indicated with a solid arrow. Size markers are
indicated with outlined arrows. The Impact04 genotype was used as a positive l, and
NTC denotes ‘no-template control’ for the PCR assay.
Figure 11. Genomic sequence of LpBGNL gene (Sequence ID No 1). The coding sequence
is underlined (Sequence ID No 2), and the region in bold is a single intron (Sequence ID No
Figure 12. LpBGNL cDNA ce (Sequence ID No 4).
Figure 13. Taxonomic relationships of plant and fungal species and phylogenetic tree of
Epichloë-Triticeae/Poeae HGT candidates and corresponding fungal genes. (a) mic
relationships of plant and fungal species and the presence/absence status of the LpFTRL
and 632-like sequences. The ent point of plant species from other species
(fungi and animals) is ted with the filled hexagon (>1,000 MYA), and the filled circle
indicate the divergent point of s belonging to the Triticeae and Poeae tribes from other
Poaceae species. The triangles ent species belonging to the Loliinae subtribe, or
Epichloë or Claviceps genera. The presence/absence status of putative homologous
(orthologous) sequence for each gene is shown on the right side of species (subtribe/genius)
name, in which ‘In silico’ and ‘PCR’ denote the database and PCR-based screening s,
tively. The plus (+) and minus (-) indicate presence and absence, respectively, and
‘N/A’ stands for ‘not analyzed’. The ancient Epichloë-Poeae/Triticeae HGT events are shown
with curved arrows. The phylograms for LpFTRL(b) and LpDUF3632(c) generated based on
predicted amino acid sequences. Sequences from plant species are Barley, Tausch’s
goatgrass and perennial ryegrass. For LpFTRL, the sequence from Trichoderma was
selected as an outer group to obtain a root of the phylogenic tree (b). The DUF3632-like
sequence was specific to Epichloë and Claviceps species, and no corresponding sequence
was found in other related species of the Clavicipitaceae family, except for andula
ipomoeae, which is shown with an asterisk. No sequence was, therefore, selected as an
outer group in the phylogram for LpDUF3632 (c). For fungus sequences, strain and
sequence identifiers of the Genome Project at the University of Kentucky are shown in
brackets. For plant sequences, NCBI UI is shown in brackets.
Figure 14. The expression levels of HGT candidates and corresponding fungal endophyte
genes in perennial ryegrass. (a) The sion levels of LpFTRL and LpDUF3632 in each
tissues of the perennial ryegrass Impact04 genotype. (b) The expression levels of the HGT
ates and corresponding fungal genes in E+ and E- perennial ryegrass genotypes. (c)
A time course gene expression analysis for the HGT candidates and corresponding fungal
genes in perennial ryegrass seeds and young seedlings. The x-axis shows tissue types (c
and d) or period after a germination treatment (e and f), and normalised read count s
[counts per million (CPM)] are indicated on the y-axis. The bars or lines show the expression
levels of the HGT candidates in E- and E+ plants, respectively, and the expression levels of
corresponding fungal genes in E+ . Note that the scales of the y-axes are not
uniformed.
Figure 15. PCR-based detection of the oë-Poeae/Triticeae HGT candidate from retail
products. PCR assay results using the primers designed for LpFTRL. The PCR products
were visualised on an agarose gel, using the SYBR™ Safe DNA Gel Stain (Thermo Fisher
Scientific). The size (bp) of PCR amplicons is indicated on the right side of each image. As
a control ment, PCR primers for the florigen candidate gene (Hd3a in rice, and FT in
wheat and barley) were used. For tration of e of Epichloë and Claviceps
species in the retail products, PCR primers specific to the fungal species were used. The
gDNA samples from the perennial ryegrass genotype Impact04 and E. festuca were used, as
positive controls for amplification with the plant and fungus-specific primers, respectively.
With the PCR primers specific to Claviceps species, amplification from E. festucae gDNA
template was observed, presumably due to sequence similarity between Epichloë and
eps species. ‘NTC’ stands for ‘no DNA template control’.
Figure 16. Nucleotide sequence of Lolium perenne DUF3632-like protein gene.
Figure 17. Amino acid sequence of Lolium e DUF3632-like protein gene.
Figure 18. Nucleotide sequence of Lolium e fungal transcriptional regulatory (FTR)
gene.
Figure 19. Amino acid sequence of Lolium e fungal transcriptional regulatory (FTR)
gene.
Detailed ption of the Embodiments
Example 1: Identification of a putative plant ß-1,6-glucanase gene
A single genotype of perennial ryegrass (Impact04) was subjected to whole-genome shotgun
and transcriptome sequencing using the Illumina HiSeq platform (NCBI BioProject
Accession: PRJNA379202) . De novo assembly of sequencing reads generated a 7.2 kb
genomic DNA sequence contig [NCBI GenBank unique identifier (UI): KY771173], which
contained a putative ß-1,6-glucanase gene. The gene-like sequence was designated
LpBGNL m perenne ß-1,6-Glucanase-Like). LpBGNL showed 74-90% and 72-82%
identity at the DNA and amino acid sequence levels, respectively, to ß-1,6-glucanase genes
of fungal taxa, such as E. festucae, H. lixii, and T. num (Fig. 1, Table 1). The full
genomic sequence of LpBGNL is shown in Figure 11. No matching sequence, however, was
identified in the full genome sequences of plants such as A. na, rice, podium
distachyon (L.) P. Beauv., barley (Hordeum vulgare L.) or wheat (Triticum aestivum L.), based
on database searches.
T. harzianum (1103 bp) - 74% 73% (1112 bp) 73% (1288 bp) 96% (1320 bp) ce identity (length of homologus sequence) H. lixii 75% (1101 bp) 74% (1101 bp) 74% (1283 bp) - - Neotyphodium 89% (1140 bp) 98% (1164 bp) - - - E. festucae 90% (1140 bp) - - - - NCB UI Lp BGNL) KY771173 ( EF015481.1 31.1 EU747838 X79197.1
Species Perennial ryegrass Table 1
Epichloe festucae Neotyphodium sp. Hypocrea lixii Trichoderma harzianum 5
Example 2: Genomic and genetic characterisation of LpBGNL
Methods
Plant materials and DNA extraction
Details of plant genotypes are summarised in Table 2. Genomic DNA was extracted from
young leaves of plants and fungal endophyte mycelium using the DNeasy plant mini kit
(QIAGEN, Hilden, Germany).
PCR amplification
Locus-specific primers were designed using the Sequencher software (GENECODE, MI,
USA) and the PCR primers are listed in Table 4. PCR amplification was performed with MyFi
polymerase kit (BIOLINE, London, UK). PCR amplicons were visualised on the 2200
TapeStation ment.
Short-read sequencing of BAC clones and amplicons
The BAC-based genomic library was screened h use of PCR. For the phylogenomic
is, PCR s were designed to obtain genomic nts from Loliinae and
idinae species (Table 4). Sequencing libraries for the MiSeq platform (Illumina, San
Diego, California, USA) were prepared from the BAC clones and PCR amplicons, following
the previously described based method [Shinozuka et al]. The library was
characterised with the TapeStation and Qubit instruments (Thermo Fisher Scientific). The
outcome reads were assembled with the Sequencher and SOAPdenovo programs.
Genetic linkage analysis
PCR primers were designed to detect the indel polymorphism within the LpBGNL sequence
(Table 3). Genetic e analysis was performed through use of the p150/112 reference
genetic mapping population of perennial ss using the P 3.0 ation.
PCR amplification
Locus-specific primers were designed using the Sequencher software (GENECODE, MI,
USA) and the PCR primers are listed in Table 4 PCR amplification was performed with MyFi
polymerase kit (BIOLINE, London, UK). PCR amplicons were visualised on the 2200
TapeStation instrument.
Short-read cing of BAC clones and amplicons
The BAC-based genomic library was screened through use of PCR. For the phylogenomic
analysis, PCR primers were designed to obtain genomic fragments from Loliinae and
Dactylidinae species (Table 4). cing libraries for the MiSeq platform (Illumina, San
Diego, California, USA) were prepared from the BAC clones and PCR amplicons, following
the previously described MspJI-based method. The library was characterised with the
TapeStation and Qubit instruments (Thermo Fisher Scientific). The outcome reads were
assembled with the Sequencher and SOAPdenovo ms.
Genetic linkage analysis
PCR primers were ed to detect the indel polymorphism within the LpBGNL sequence
(Table 3). c linkage analysis was performed through use of the p150/112 reference
genetic mapping population of perennial ryegrass using the JoinMAP 3.0 application.
., Reference Shinozuka et al 2010 2010 2010 2010 2017 Hand et al., Hand et al., Hand et al., Hand et al., UI IBERS: BA13157 IBERS: BF1199 IBERS: BL2643 SARDI: 778 SARDI: 38013 SARDI: 41525
Genotype or cultivar Impact04 Genotype from Aberystwyth (Great Britain) Genotype from Tadham Moor (Great Britain) Demeter m Genotype from Ponterwyd (Great n) Currie Wild genotype from Algeria Wild genotype from Australia Landmaster
Huds.
Scientific name Lolium perenne L. Lolium temulentum L. Festuca sis a arundinacea Schreb. Festuca arundinacea . Festuca ovina Dactylis glomerata L. Dactylis marina Borrill Poa poiformis (Labill.) Druce Phalaris aquatica L. )
Species Table 2 Common name Perennial ryegrass Darnel Meadow fescue Tall fescue Tall fescue Sheep fescue Cocksfoot (Orchard grass) (Dactylis marina Coast tussock- grass Harding grass (Phalaris)
Sichuan Agricultural University INSTITUTE Auburn University Teagasc Auburn University Auburn University Subm itted by KOREA POLAR CH 1 run, 162.8M spots, 32.6G 31G G 10.2G 25.9G 8.9G bases bases bases M spots, 9.3 bases bases bases Data size 1 run, 153.38M spots, 1 run, 129.3M spots, 1 run, 46.3 1 run, 50.4M spots, 1 run, 44.4M spots, Illumina HiSeq Instrument 2000 Illumina HiSeq 2000 Illumina HiSeq Illumina HiSeq 2000 Illumina HiSeq 2000 2000 na HiSeq 2000
UI SRX738187 SRX465632 SRX745831 SRX745855 SRX745858 SRX669405
Dactylis ata L. (orchardgrass) Deschampsia antarctica Poa annua Poa supina Poa infirma Phalaris aquatica
Table 3 Species
, , , is Phalaris DNA template perennial ryegrass, darnel, meadow fescue, tall fescue, sheep fescue, cocksfoot, Dactylis marina Phalaris aquatica, perennial darnel sheep fescue aquatica ryegrass- associated endophyte coast tussock- grass, ryegrass- associated endophyte, perennial ryegrass genomic library p150/112 genetic mapping population perennial ryegrass, tall fescue, meadow fescue ial ryegrass, cocksfoot, Dactylis marina coast tussock- grass, cocksfoot, Dactylis marina perennial ryegrass, cocksfoot, Dactylis marina coast tussock- grass, aquatica, perennial on size* 178 bp 253/306 bp 1452 bp 1590 bp 1067 bp 248 bp 235 bp 1147 bp 415 bp 126 bp**
Reverse ACTGCACATGGAGCTTGTTG CGTCGCTCATCATCCATGGC CAGATATCTTGATACACATTCC CAGATATCTTGATACACATTCC CTGCCCGTTCACGGTGCGAT TTTGTCGTCCGGGCTCACGC TGGATGCGCYTCGTCATCC ATCCTCCTGGCAAGCTGAATG ATGATGGTGTTGGCCGCGTT CCGATGATGGTGTT
GCCCGTCTGACGGGGCACAG CATCAACAAGATCAGGGGCG CACGACTTGGCTGCTTTCAA CCGAGTTCGACTG 3’) Sequence (5’ Forward GTCGGCATGATTGAGGTTCT AGGGCATCAACAAGATCAGG CGCGCCTAATCCTCTCCTCT TGCTTGCCCTTCAGGAGGCT AAGGAGAGCCTCCA TAACGCTCAACGGGGACG LpHistone** LpABCG5 LpABCG6 Table 4 Primer name LpBGNL_short LpBGNL_indel _long1 LpBGNL_long2 LpBGNL_long3 LpBGNL_long4 LpBGNL_cons * Length of DNA fragment based on the perennial ryegrass genome sequence
-Reductase Genes from ial Ryegrass Cinnamoyl- CoA . 2010 Functional Analyses of Caffeic Acid O- Methyltransferase and –3373. (doi:10.1105/tpc.109.072827) ** Reference: Tu, Y. et al
). The Plant Cell 22, 3357
(Lolium perenne
An in-house bacterial artificial chromosome (BAC)-based c library of ial
ryegrass had previously been constructed from endophyte-devoid (E-) individuals of the
cultivar Grasslands Nui. sed screening of the y identified two positive clones,
designated LpBAC94-B20 and LpBAC125-N24. De novo sequence analysis and assembly
identified the presence of LpBGNL in both clones. The gene was located within 39 kb- and
24 kb-contigs (NCBI UI: KY771171 and KY771172) of LpBAC94-B20 and LpBAC125-N24,
respectively, along with a sequence (ca. 2 kb in length) showing similarity at a DNA sequence
identity of 82% to a Zea mays transposon-related gene (NCBI UI: 92.1) (Fig. 2a). A
11 kb-contig of E. festucae genome sequence (NCBI UI: EF015481), which includes the
corresponding ß-1,6-glucanase gene, was obtained from the NCBI database and was shown
to contain three other genes located within a 5 kb ce from the ß-1,6-glucanase gene.
In the BAC clone-derived contigs, however, no sequences similar to these flanking genes
were identified. Putative coding regions for the E. festucae ß-1,6-glucanase and LpBGNL
genes were identified (Fig. 2b). A single intron was found in both ces, and comparison
of the exonic and ic regions identified 4 insertion-deletion ) variations between
them. Although the position of the intron was conserved, it seemed that almost all intron
sequence was replaced in perennial ryegrass, due to insertion and deletion events. Although
the coding regions were relatively highly conserved, no sequence similarity was found in the
flanking sequence of the coding regions. A BLAST search of 1.5-kb upstream and
downstream sequences of LpBGNL identified partial sequence similarity to the genomes of
wheat and rice, while the ponding upstream and downstream sequences of the E.
festucae ß-1,6-glucanase gene included partial sequences of the flanking genes (Fig. 2b).
Sequencing of PCR products generated using -specific s identified a 51-bp
intron-located rphism between haplotypes of the heterozygous parent (C3 genotype)
of the perennial ryegrass p150/112 genetic linkage g population (Figure 6), which
facilitated development of an indel-based DNA marker. From the p150/112 population, 48
individuals were genotyped (Figure 7), and the LpBGNL-related marker locus was assigned
to a distal region of perennial ryegrass linkage group (LG) 5 (Fig. 2c).
Example 3: LpBGNL gene expression analysis
Methods
Gene sion analysis
The transcriptome sequencing reads from Impact04 tissues were mapped against Impact04
genome contigs (>999 bp) for filtering. The number of reads which contained LpBGNL
ce (no sequence mismatch for 60 bp or longer) were counted as LpBGNL-derived
reads. For gene expression in seedlings, E+ and E- seeds of perennial ryegrass cultivar Alto
were subjected to germination ent by placement on wet filter paper in the dark for 2
days followed by seedling growth under full-light conditions [44]. RNA was extracted with a
CTAB extraction method, and sequencing libraries were prepared using the SureSelect
-specific RNA library preparation kit (Agilent). Sequencing analysis was performed on
the Illumina HiSeq 3000 platform. The full LpBGNL cDNA sequence is shown in Figure 12.
Results
Expression of LpBGNL was determined using data from the transcriptome sequence of the
Impact04 genotype (NCBI BioProject Accession: PRJNA379202) . Sequencing reads
ponding to LpBGNL were identified from leaf, root and flower s, and higher
sion levels [based on counts per million reads (CPM)] were detected in root and flower
than in leaf (Fig. 3a, Table 6). Specificity of gene expression was examined using endophyteinfected
(E+) and E- perennial ryegrass seeds and seedlings. Due to sequence divergence,
sequencing reads corresponding to the plant and fungal gene could be reliably discriminated
(Table 7). Read counts were very low for both E+ and E- seeds immediately after the
germination treatment (Fig. 3b). Although no scale morphological change was
ed during the following two days, the read counts substantially increased in both
s. The counts remained at relatively high levels in young seedlings at 5 and 10 days
after treatment. As similar trends were observed for both E+ and E- genotypes, presence of
yte did not significantly affect LpBGNL expression pattern. Expression of the
endogenous E. festucae var. lolii ß-1,6-glucanase gene was observed in E+ seedlings, but
the read count approach revealed relatively low levels throughout the 10 days, in contrast to
LpBGNL (Fig. 3c, Table 7).
glucanase gene CPM 0.14 0.17 0.44 0.43 0.16 0.41 - β 1,6 - Epichloe Counts 5 7 28 25 9 22 CPM 0.11 2.59 12.47 49.38 32.26 72.58 CPM 32.7 55.0 3.7 2.5 3.7 12.1 5.9 9.2 66.5 Lp BGNL Counts 4 109 802 2838 1847 3901
Counts 479 798 87 49 54 272 113 154 767 E+ individual 36,389,285 42,014,889 64,295,493 57,472,563 57,259,134 53,748,829
Total reads ,730 14,515,287 23,613,687 19,292,712 14,752,797 22,525,848 13,271,284 16,738,932 11,536,030 Total reads glucanase gene CPM 0.00 0.02 0.04 0.01 0.02 0.00
Library Root tip Root e) Leaf middle 1 Leaf middle 2 Leaf middle 3 Leaf tip 1 Leaf tip 2 Leaf tip 3 1,6
Flower Epichloe - β Counts 0 1 3 1 1 0 BGNL CPM 0.35 0.48 36.77 87.56 57.32 64.31 Lp Counts 19 30 2751 6285 3391 6565 - individual E Total reads 54,109,844 62,109,304 74,819,980 71,779,944 59,159,973 102,085,102 0 h 4 h 1 day Table 6 Table 7 2 days 5 days 10 days
[Link]
http://www.megasoftware.net/
Example 4: Phylogenetic analysis of plant and fungal ß-1,6-glucanase(-like) genes
Method
In silico analysis
The DNA sequences of fungal ß-1,6-glucanase genes were obtained from the NCBI
(http://www.ncbi.nlm.nih.gov/) database and the Genome Project at the University of
Kentucky e. Putative ogous sequences were sought in the NCBI, Brachypodium
hyon (http://www.brachypodium.org/) and Ensembl
(http://plants.ensembl.org/index.html) databases. Non-synonymous and synonymous
nucleotide substitution rates (Ka and Ks, respectively) were calculated using the
Synonymous Non-synonymous Analysis Program (SNAP; http://www.hiv.lanl.gov/).
Alignment of DNA sequences was performed with the CLUSTALW program
(http://www.genome.jp/tools/clustalw/) with the default parameters. eny was
generated with the MEGA7 program (http://www.megasoftware.net/).
The presence of LpBGNL orthologues in other Poeae species was determined by PCR-based
screening. LpBGNL-specific primers were designed and short DNA fragments (178 bp in
length) were amplified from genomic DNA templates of darnel (Lolium temulentum L.),
meadow fescue (Festuca pratensis Huds.), tall fescue (Festuca arundinacea Schreb.), sheep
fescue ca ovina) (Table 2, Figure 8). Products were also obtained from those of
oot/orchard grass (Dactylis glomerata L.) and is marina Borrill, but not from those
of coast tussock-grass [Poa poiformis (Labill.) Druce] or harding grass/phalaris (Phalaris
aquatica L.). DNA fragments were not amplified from genomic DNA templates of E. festucae
var. lolii., confirming the specificity of the oligonucleotide primers that were used . Alignment
of LpBGNL and the fungal genes identified a conserved region ca. 750 bp in length,
corresponding to the hospho-beta-D-glucosidase domain. For a phylogenetic analysis,
DNA fragments, ing the aryl-phospho-beta-D-glucosidase , were ied from
the selected Loliinae and Dactylidinae species. De novo amplicon sequence analysis and
ly obtained a single sequence contig of the 750 bp region for each Lolium and
Festuca species (Figure 9). For each Dactylis species, three contigs (haplotypes) were
generated. A putative premature stop codon was found in two haplotypes of is marina,
and the haplotypes with the premature stop codon were excluded from the further analysis.
Fungal ß-1,6-glucanase gene-like sequences were ed from the NCBI database and
the Genome Project at the University of Kentucky website. Phylogenetic analysis with the
m likelihood method was performed, and the plant species-derived sequences were
found to be clustered in the phylogram with those from Epichloë (Neotyphodium) species (Fig
4). The sequences from other fungi were more distantly related to the plant sequences.
Synonymous and non-synonymous nucleotide substitution (Ks/Ka) ratios were calculated
using the 750 bp sequences. Both Ks and Ka values between the oë and plant species
were substantially lower than those between the Epichloë species and other fungi (H. lixii and
T. harzianum) (Table 2). The Ks/Ka ratios for candidate LpBGNL orthologues were between
0.027-0.221, lower or equivalent to values from the fungal ß-1,6-glucanase genes (0.057-
0.275).
In order to verify presence/absence boundaries, a set of PCR primers was designed to
amplify 415 bp fragments within a region highly conserved between plant and fungal ß-1,6-
glucanase(-like) genes. This assay confirmed the e of the gene in the Poa and
Phalaris species samples (Fig. 5). As a control experiment for capacity to amplify cross-
species, PCR was med with primers specific to perennial ryegrass histone H3 and
ate plant architecture genes, such as the ATP -binding cassette protein mily G 5
and 6 genes (LpABCG5 and LpABCG6, respectively). Although all primers were ed
based on perennial ryegrass sequence, PCR amplification from coast k-grass and
harding grass/phalaris was observed, except for the combination of ABCG 5 primers and one
of the Poa genotypes (Figure 10). Database searches were performed using published shortread
sequencing data on the NCBI Sequence Read Archive (SRA;
https://www.ncbi.nlm.nih.gov/sra). Sequences significantly matching the LpBGNL and E.
festucae ß-1,6-glucanase genes were found from Dactylis s, but not from Poa or
Phalaris species (Table 9, Figure 9). No significantly matching sequence was obtained from
Antarctic hair grass (Deschampsia antarctica É. Desv.), which is believed to be taxonomically
closer than Poa species to members of the sub-tribes Loliinae and Dactylidinae (Fig 5b). As
a control analysis, sequences similar to the LpABCG 5 and 6 genes were , g to
identification of matching sequences from all tested Poeae species, including those
belonging to both Poa and Phalaris.
um ) ia n 2 7 T. r z 5 h a 0.6396, 0.1469 (0.2297) (0.2304) 0.1186, 0.0068 . 0 ( 0 0.6383, 0.1453 (0.2276) 0.6563, 0.1432 (0.2182) 0.6494, 0.1449 (0.2231) , 0.1407 0.6424, 0.1492 (0.2323) 0.6670, 0.1537 (0.2068) H. lixii 0.6116, 0.1507 (0.2341) - (0.2464) 0.6041, 0.1491 (0.2468) , 0.1470 (0.2339) 0.6093, 0.1487 (0.2441) 0.6598, 0.1442 0.6363, 0.1488 (0.2339) 0.6546, 0.1533 (0.2186) hodium sp. 0.2539, 0.0629 (0.2477) - 0.2533, 0.0646 0) 0.2369, 0.0655 (0.2766) 0.2305, 0.0638 (0.2770) 0.2969, 0.051 0.0896, 0.0247 (0.2751) - (0.1717) nase gene ß- 1,6 E. festucae 0.1961, 0.0501 (0.2553) - 0.1957, 0.0518 (0.2647) 0.1887, 0.0535 (0.2838) , 0.0519 5) 0.2207, - - 0.0433 (0.1961) Sheep fescue 0.3333, 0.0416 (0.1247) 0.3575, 0.0433 (0.1211) , 0.0467 (0.1411) 0.3247, 0.045 (0.1387) - - - -
BGNL Meadow Fescue 0.0991, 0.0102 (0.1029) 0.1359, 0.0085 (0.0625) 0.0308, 0.0068 (0.2213) - - - - -
Candidate orthologue of Lp Tall fescue 0.1302, 0.0102 (0.0783) 0.1670, 0.0085 (0.0509) - - - - - -
ryegrass Darnel 0.0622, 0.0017 (0.0273) - - - - - - - Perennial ryegrass Darnel ryegrass Tall fescue Meadow Fescue Sheep Fescue Epichloe festucae Neotyphodium sp. Hypocrea lixii Table 8 Ks, Ka (Ka/Ks)
Results
The high level of DNA sequence rity to the fungal genes, and absence of LpBGNL-like
sequences from other representative perm species ted that LpBGNL was
obtained from a fungal species through HGT. Genomic and genetic characterisation was
consequently performed in order to demonstrate that LpBGNL is located on a perennial
ryegrass chromosome. Furthermore, LpBGNL orthologues were found to be present in other
Loliinae and Dactylidinae species. It is hence unlikely that LpBGNL was an assembly or
annotation artefact, even though LpBGNL shows unusually high DNA sequence similarity
(ca. 90%) to the ß-1,6-glucanase genes of contemporary species descended from the
putative donor, when compared to other horizontally transferred genes in eukaryotes.
The PCR-based screening and database searches suggested that the ß-1,6-glucanase-like
gene is present in only a limited number of Poeae s including the genera Lolium,
Festuca and Dactylis, which are confined to the sub-tribes Loliinae and Dactylidinae. The
phylogenetic analysis suggested a common origin of the oë-derived ß-1,6-glucanase
genes and LpBGNL orthologues, and the close relationship between the LpBGNL
orthologues of contemporary Loliinae and Dactylidinae grasses suggests that the gene may
have been introduced into the genome of a common ancestor of the sub-tribes by a single
transfer event. The HGT event may consequently have occurred between ca. 9 to 13 n
years ago (MYA), based on the ted time of divergence of the two ibes from other
Poeae lineages (Fig. 5b).
The Ks/Ka ratios between plant ß-1,6-glucanase-like genes (0.027-0.221) were not
substantially different from those of the fungal ß-1,6-glucanase genes, and those of
LpABCG5 and LpABCG6 (0.166 and 0.238). This suggests that LpBGNL may have been
subjected to selection pressures. Although similar Ks/Ka ratios were obtained from the
perm and fungus groups, DNA mutation rates between those two groups may not be
equivalent. From cocksfoot/orchard grass and is marina, three haplotypes of the aryl-
phospho-beta-D-glucosidase domain were identified, and two haplotypes obtained from
Dactylis marina contained a putative premature stop codon. As these Dactylis species have
autopolyploid s, the ß-1,6-glucanase-like genes in these species may have been
subjected to unique selection pressures due to c redundancy, when compared with
genes in the other plant species.
As asexual symbiotic Epichloë species grow as hyphae between cells of vegetative aerial
tissues in Poeae species, it is likely that the close physical proximity of both partners in the
sis may have facilitated an HGT event, similar to the physical contacts n
tic and host plants. The conservation of the intron position between the LpBGNL and
Epichloë ß-1,6-glucanase genes suggests that a part of the endophyte genome including the
ß-1,6-glucanase gene, rather than a reverse-transcription product of yte gene mRNA,
was incorporated into the recipient genome. In prokaryotes, transformation is a prevalent
mechanism of gene exchange, in which HGT occurs through uptake of exogenous doublestranded
DNA by the recipient cell.
4) G6 -38) -26) C e- 3 (4 pA B % L 94% (5e- 32) 97% (1e 95% (1e- 33) 90% (6e- 27) 92% (2e 4 9 LpABCG5 99% (3e- 41) 99% (7e- 42) 100% (5e- 43) 99% (8e- 42) 100% (2e- 43) 97% (5e- 39) -glucanase gene E. festucae ß -1,6 99% (6e- 41) N.S. N.S. N.S. N.S. N.S. LpBGNL 95% (8e- 35) N.S. N.S. N.S. N.S. N.S. Data size 32.6G bases 31G bases 25.9G bases 8.9G bases 9.3G bases 10.2G bases Source Transcriptome Genome Transcriptome Transcriptome Transcriptome Transcriptome
UI SRX738187 632 SRX745831 SRX745855 SRX745858 SRX669405
Table 9 s Dactylis glomerata (orchardgrass) Deschampsia antarctica Poa annua Poa supina Poa infirma Phalaris aquatica
Example 5: Loss of function of LpBGNL
Given the role of plant-encoded ß-1,6-glucanase enzyme in the establishment of a stable
symbiotic relationship with an endophyte, a loss of function is is carried out. A
LpBGNL-like gene is removed from the genome of a ryegrass plant which normally forms a
stable onship with an Epichloë endophyte. The stability of the plant-endophyte
association is then evaluated in such plants compared with unmodified control plants.
Example 6: Gain of on of LpBGNL
Given the role of plant-encoded ß-1,6-glucanase enzyme in the establishment of a stable
tic relationship with an endophyte, a gain of function analysis is carried out. A
LpBGNL-like gene is introduced into plants such as rice and wheat that do not normally form
stable symbiotic relationship with Epichloë endophytes. The stability of the plant-endophyte
association is then evaluated in such plants compared with unmodified control plants.
Example 7: LpBGNL as a promoter of natural stable associations with asexual
Epichloë
Fungal glucanases have been reported to be specifically secreted into plant apoplasts
during endophyte ion, and may play a role in provision of ion to the infecting
endophyte, l of branching of the endophyte hyphae, and protection of plant tissues
from infection of other fungal pathogens. The plant-encoded enzyme may participate in one
or more of these processes, and so contribute to establishment of a stable symbiotic
relationship.
Although oë endophytes do not colonise root tissues, a relatively high level of
expression of LpBGNL was observed in root tissues. Hence, the plant-encoded enzyme may
function to protect against infection by orne fungal pathogens. Similarly, active
expression in flowers may suggest the capacity to protect against fungal pathogens such as
Epichloë a, which causes choke disease. However, some Festuca and Dactylis
species are relatively susceptible to infection by E. typhina, even though those species
presumably also possess the ß-1,6-glucanase-like gene. As natural stable associations with
asexual Epichloë ytes are confined to the Poeae lineages that possess LpBGNL-like
genes, the ancestral HGT event (which might have occurred from a sexual pathogenic
Epichloë-like s) may have provided pre-adaptive conditions for the contemporary
symbiosis. The evidence for selective pressure on the gene is suggestive.
As major symbionts, the asexual Epichloë species provide abiotic and biotic stress tolerance
to grass species of the Poeae tribe. Tolerance to ebrate herbivory is a wellcharacterised
benefit to the host, partially attributable to the effects of a makes caterpillers
floppy-like (mcf-like) gene. The ke gene was horizontally transferred into the endophyte
genome from a bacterial species 7.2-58.8 MYA. Hence, multiple horizontal transfer events,
including transfer of the LpBGNL-like gene as described in the present study, may have been
involved in the establishment of the t stable symbiotic relationship.
Given the role of plant-encoded LpBGNL enzyme in the establishment of a stable symbiotic
relationship with an endophyte, a stable symbiotic onship with a plant and an yte
may be created, which otherwise may not occur. The introduction of BGNL into plants which
do not contain BGNL and are thus not able to form a stable symbiotic onship with
endophytes, may enable the establishment of such a relationship.
Example 8: A role for LpBGNL in pathogenic resistance
The potential role of a ß-1,6-glucanase-like gene in protection against other, pathogenic,
fungal species is of particular interest. Species such as T. num are mycoparasites of
fungal phytopathogens, and this property is d to glucanase activity. Fungal-derived
genes for anti-fungal enzymes such as endochitinases and glucanases have also been used
for generation of transgenic plants with enhanced pathogen resistance.
To generate transgenic plants with enhanced en resistance using the LpBGNL-like
gene the LpBGNL-like gene is transferred into the genomes of crop plants such as rice and
wheat and then the resistance of the transformed plants to a range of fungal diseases is
evaluated.
Example 9: ß-1,6-glucanase as an indicator of stable associations with asexual
Epichloë
Given the role of the encoded ß-1,6-glucanase enzyme in the ishment of a stable
symbiotic relationship with the endophyte, the presence and level of expression of a plant-
encoded glucanase may be used to predict the likelihood of the plant forming a stable
association with an endophyte carrying the ß-1,6-glucanase, such as Epichloë.
The method involves ing a plant for screening for symbiosis with a symbiont such as
an Epichloë yte. The first step requires determining whether the plant to be screened
contains the BGNL gene, through genetic analysis. If the plant selected for screening
contains the BGNL gene, the second step is to determine the level and location of expression
of the gene. The expression level of BGNL measured is then used to determine if the said
plant screened would form a symbiotic relationship with the Epichloë endophyte.
High levels of expression in the root tissues and in the flowers of the plant are indicative of
the plant screened being able to form a stable association with the endophyte.
Example 10: Identification of putative plant FTRL and DUF genes
Using non-polyadenylated RNA from an endophyte-absent (E-) perennial ryegrass individual,
a sequencing library was ed. A single Illumina MiSeq run generated a total of
014 reads from the library. A dataset of unique RNA reads, ing 1,424,274
sequences, was generated. A BLAST search of the perennial ryegrass (E-) transcriptome
shotgun assembly (TSA) and unique RNA read datasets against the Epichloë festucae
transcriptome data identified 88 and 123 sequence rity hits, respectively. Sequences
putatively derived from microbiome, highly conserved genes between fungi and plants, such
as actin and ubiquitin genes, and low ent matches were excluded through a manual
examination, and 2 novel HGT candidates were identified.
From the TSA data, a sequence [unique identifier (UI): ID_150936_C1449060_17.0] showing
a relatively high similarity (85%) to an E. festucae unknown protein gene (UI:
EfM3.066060.partial-2.mRNA-1) was identified. Due to a similarity of predicted amino acid
sequence to a fungal transcriptional regulatory (FTR) protein nk UI: CRL18938;
identity: 48%, e-value: 2e-150) of Penicillium camemberti ycota, Trichocomaceae),
one identified gene was designed LpFTRL (FTR-like).
The other candidate, ated LpDUF3632, showing a higher similarity (96%) to the E.
festucae DUF3632 (domain of unknown function 3632)-like gene (UI: EfM3.028800. mRNA-
1) was identified from the unique reads nce UI: 734684-1).
Genome sequence contigs containing LpFTRL and LpDUF3632 from an in-house shotgun
sequencing assembly data of the perennial ryegrass 04 genotype (E-) were subject to
a BLASTN search t nucleotide sequences catalogued in the NCBI GenBank database.
Relatively high sequence similarity matches against LpFTRL were identified from Tausch's
goatgrass (Aegilops tauschii L., UI: XM_020322891.1) and barley (UI: AK375773.1), followed
by ascomycota s, while only fungal genes showed significant sequence similarity to
LpDUF3632. Putative orthologues of LpFTRL were identified in barley chromosomes 1H and
7H (Ensembl UI: HORVU1Hr1G009870 and Hr1G108080, respectively), while the
corresponding ces were only found from chromosome 7 of each sub-genome of
oid wheat (Ensembl UI: TRIAE_CS42_7AL_TGACv1_557369_AA1780460,
_AA1881100, and _AA1997520), and from cereal rye (Secale cereal L.) chromosome 7
(NCBI short read e (SRA) UI: ERX140518), suggesting that the fungal gene was
transferred into the chromosome 7 of a common ancestor of Triticeae and Poeae species.
No significant match was obtained from the genome sequences of Brachypodium [B.
distachyon (L.) P.Beauv.], rice (Oryza sativa L.), sorghum [Sorghum bicolor (L.) Conrad
], Zea Mays (L.) and Arabidopsis thaliana (L.).
The LpDUF3632 sequence was subjected to a BLASTN search against NCBI SRA data from
eason grass species, to find significant hits from Italian ryegrass (L. multiflorum L.) and
tall fescue (Festuca arundinacea L.), but not from orchard grass (Dactylis ata L.) or
tic hairgrass (Deschampsia Antarctica É.Desv.). The gene presence/absence status
of the DUF3632-like sequence in Poeae species was confirmed with a PCR-based assay
(Fig. 13a).
The presence of LpFTRL-like sequence in all tested Poeae species was confirmed. A
phylogenetic analysis revealed close relationships of LpFTRL and LpDUF3632 between
corresponding oë sequences (Fig. 13b and c), suggesting that the two genes were
transferred from the fungus lineage into plant species, but not vice versa, after ification
[59 n years ago (MYA)] of ancestral Epichloë species from the Claviceps lineage. Based
on the ence ages of the Brachypodieae tribe from other Pooideae species, the FTRL
gene was predicted to have been transferred into plants after 32-39 MYA. An LpDUF3632-
derived DNA-based marker was assigned into perennial ryegrass linkage group (LG) 3, which
ponds to the chromosome 3 of Triticeae species. The DUF3632-like sequence is likely
to have been transferred independently of the β-glucanase(-like) gene, of which DNA-based
marker has been assigned into perennial ryegrass LG 5, indicating a possibility of at least
three independent HGT events since 32-39 MYA. Comparison of genomic sequences
ing DUF3632-like genes suggested transformation-like ancestral HGT events, due to
conservation of the position of the putative intron between plant and Epichloë species, similar
to LpBGNL. No intron was predicted for LpFTRL and corresponding sequences in Epichloë
species.
From the E- perennial ryegrass transcriptome data, a leaf ecific expression n of
LpFTRL was proposed (Fig. 14a). Although the counts per n reads (CPM) values were
relatively low, LpDUF3632 was ubiquitously expressed (Fig. 14b). An analysis of the SRA
data from Massay University, which did not include a leaf tip sample, indicated that the
expression levels of LpFTRL and the corresponding Epichloë gene (EfM3.066060) were
below the limit of detection in most tested tissues, regardless of the endophyte-infected (E+)
/E- plants (Fig. 14c). Expression patterns of LpDUF3632 were similar between E+ and E-
plants, and the Epichloë DUF3632 gene (EfM3.028800) was expressed in all tested tissues
of the E+ plant (Fig. 14d). From the E+ and E- young seedlings, an ent of
LpDUF3632 expression level was observed in E+ seeds after a germination-treatment,
although the expression levels of LpFTRL, EfM3.066060, and EfM3.028800 stayed low
throughout the tested 10 days (Fig. 14e and f). Although the LpDUF3632 sequence was
identified from the non-polyadenylated RNA sequencing library, it is likely that the gene is
also expressed as polyadenylated RNA, due to identification of corresponding reads from the
SRA data.
Identification of LpFTRL provided a unique unity to compare nucleotide tution
rates n fungus and plant lineages, using the sequences diverged only less than 40
MYA. The synonymous (Ks) substitution rate of the plant FTRL sequences was not
substantially different from those from fungus sequences. Although some variation was
observed in the non-synonymous (Ka) substitution rates, the Ka/MYA rate from the plant
sequences was between those from Claviceps-Epichloë and E. gansuensis-other Epichloë
combinations (Table 1).
Ka/Ks 0.2174 0.1657 0.3760 9 1 . 3 6 0 Rate (Ka/MYA) Claviceps were Claviceps and 0.0040 0.0024 0.0050 ations are shown as 0.0072 SDV 0.0064 0.0073 Epichloë Epichloë and 0.0008 0.0055 Non- synonymous Ka (average) 0.2307 0.1412 0.1041 0.0519 Rate (Ks/MYA) and the rest of lineage (from 58.8 MYA to the HGT event), while the ecies. Epichloë, respectively. As 0.0183 0.0147 E. gansuensis Epichloë 0.0132 0.0199 Claviceps genes. The ratios calculated from the and Synonymous SDV 0.2560 0.1745 E. gansuensis- other 0.0231 0.0112 Ks (AVE) 1.0612 0.8517 (plants), and Poeae, and Poeae 0.2767 0.1435 Diverged age (MYA) and
58 58
Triticeae-
21 7.2 FTRL orthologues and corresponding Epichloë and Plants,Triticeae
Epichloë -Plants, , Claviceps Claviceps and Plants combination include the diversification period in the Poeae combination merely represent ification between plant sp
Table 10. Claviceps- plants Claviceps- oë Triticeae- Poeae E. gansuensis- other Ka and Ks rates for Lp Epichloë, Claviceps- Epichloë ed around 58.8 MYA followed by horizontal transfer of the FTRL sequence into plant species after 39 MYA, the ison of the Claviceps Triticeae and 5
The Ka/Ks ratio for the plant FTRL and corresponding E. gansuensis-other Epichloë
ces (0.376 and 0.3619, respectively) were relatively close, suggesting that the plant
genes have been subjected to selection pressures since HGT. A comparison with E. ae
2 suggested a similar level (Ka/Ks = 0.31) of ion pressures for LpDUF3632.
These results proposed that plant FTRL and DUF3632 genes retain functionalities at the
protein level, and have contributed to natural adaptation of the plant s. Similar to
LpBGNL, the intron sequences of LpDUF3632 were less conserved than the exon
sequences, likely due to lower levels of the pressure, which implies that the selective
res have been an important factor for retaining of ce similarity to the
corresponding Epichloë sequences. The close physical contacts between the host plants
and symbiotic and/or pathogenic fungi could have facilitated the relatively frequent transfer
events. As both Epichloë and Claviceps species infect to plant reproductive tissues, the
presence close to germ cells might have been an important factor of the multiple HGT .
Comparison of codon usage of LpFTRL orthologues from diploid plant species and
corresponding Epichloë sequences revealed a similar usage ratio for each amino acid, except
for the termination codons. Only ‘TGA’ was used in the plant genes as termination codon,
the ratio of ‘TGA’ was only 38.5% in the Epichloë sequences.
Pearl barley, wheat plain flour, rolled oat, and rice flour products were ed from retail
shops, and DNA was extracted from the retail products. PCR primers for the LpFTRL
sequence within a conserved region between plant and Epichloë species were designed.
Through PCR, the sequences ponding to LpFTRL were amplified from barley, wheat,
oat, and E. festuca gDNA templates, but not from rice, confirming the presence of the ‘natural’
transgene in Triticeae and Poeae cereal species (Fig. 15). A control experiment with fungus-
specific primers confirmed absence of gDNA of Epichloë and Claviceps species, especially
the rye ergot fungus, C. ea, in the retail products.
Materials and Methods
sRNA sequencing
Fresh young leaves of an individual of perennial ryegrass cultivar Trojan were ted.
Total RNA including small molecules was extracted using the RNeasy Plant mini kit
(QIAGEN) following the ed protocol of related products (Purification of miRNA from
animal cells using the RNeasy® Plus Mini Kit and RNeasy MinElute® p Kit). A
sequencing library was prepared using the Small RNA sequencing library preparation kit
(NEB), and a fraction containing non-coding RNA molecules (bp in length) was purified using
the BluePippin platform (Sage Science). The products were characterised on the 2200
TapeStation instrument using the D1000 kit (Agilent). The library was loaded on the MiSeq
platform (Illumina), following the manufacture’s ction, and a sequencing analysis was
performed with the MiSeq Reagent Kit v3 (150-cycle) kit (Illumina). The outcome data was
processed with the FastX-tool-kit package, to remove r sequence and generate a
unique read dataset.
based screening
The transcriptome dataset of E. festucae (file name: M3 transcript ces) was obtained
from the website of Kentucky university //www.endophyte.uky.edu). The TSA
1000001-GFSR01044773) and sRNA unique read datasets of perennial ryegrass
were prepared for a DNA sequence homology search. The homology search was performed
with the megablast function of the BLAST+ package, and the threshold E value was set at
1e-10. The resulting data was imported into the Microsoft Excel software for a manual
examination. The manual examination was performed using the NCBI BLAST tools.
The homologues sequence in representative flowering plant species were performed on the
Ensembl Plants website (http://plants.ensembl.org/index.html). The LpFTRL ce was
subjected to BLAST-based search against cereal rye SRA dataset (SRA UI: DRP000390).
The LpDUF3632 sequence were subjected to the search against the following SRA datasets;
Italian ryegrass (SRX1604870 and SRX1604871), tall fescue (SRX1056957), orchard grass
(ERX1842528), and Antarctic hairgrass 5632), from which significant homology hits
against the perennial ss architecture candidate genes, LpABCG5 and 6 (GenBank UIs:
JN051254.1 and JN051255.1) were obtained, but no significantly similar sequence to an
oë-specific gene, makes caterpillars floppy (mcf)-like gene (GenBank UI: KJ502561.1),
was identified. This screening method was validated through a BLAST search of the LpFTRL,
LpDUF3632, and Epichloë mcf sequences against E+ and E- ial ryegrass SRA
datasets (SRA UIs: SRX1167577-SRX1167590).
DNA sample preparation
Plant seeds were obtained from the Genetic Resources Unit of Institute for Biological
Environmental and Rural Studies (IBERS; Aberystwyth, Wales, UK) and the South Australian
Research and Development Institute (SARDI). The plants were germinated on a filter paper
in a petri dish. Total DNA was extracted from fresh leaf of each plant genotype using the
DNeasy Plant mini kit (QIAGEN) ing the cture’s instruction. Total DNA was also
extracted from barley (pearled grains), wheat (plain , oat (rolled grains) and rice (flour)
using the DNeasy Plant mini kit.
PCR-based screening
PCR s were designed using the Oligo Calc tools. For cross-species amplification,
primers were designed to generate short DNA fragments (< 251 bp in length) within highly
conserved regions of the target sequences. The PCR was performed on the CFX Real-Time
PCR Detection Systems (Bio-Rad), with the Luna® Universal qPCR Master Mix (NEB), and
data analysis was performed using the CFX Manager™ Software (Bio-Rad). isation of
PCR products was performed on the 2200 TapeStation instrument or on an agarose gel
(2.0% w/v) stained with SYBR Green (Thermo Fisher) through electrophoresis.
Validation of the PCR-based screening method
PCR primers were designed based on perennial ryegrass sequences to amplify larger
fragments (> 900 bp), for use as DNA tes of a standard curve assay (SCA). The PCR
amplicons were amplified from the Impact04 genotype, using the MyTaq™ DNA Polymerase
kit, and the ons were cleaned using the Monarch® PCR & DNA Cleanup Kit (NEB).
DNA concentration was adjusted to 1 pg/μl, and a dilution series was prepared. For fungus-
specific primers, a dilution series of E. festucas gDNA was prepared. The SCA was
performed on the CFX Real-Time PCR Detection Systems, with the Luna® Universal qPCR
Master Mix, followed by data analysis with the CFX Manager™ Software.
In silico analysis
Amino acid and DNA ces were prepared for in silico analysis. Gene structure
tion was performed using the FGENESH program of the Softberry website using the
‘Monocot plants’ parameter. Alignments of amino acid sequences were generated with the
CLUSTALW program with the default parameters. Sequence homology search was
performed with the NCBI and PredictProtein websites. Phylogenetic analysis was med
with the MEGA7 program. Non-synonymous and synonymous nucleotide substitution rate
(Ka and Ks, respectively) was ated using the Synonymous nonymous Analysis
Program . For gene expression analysis, an in-house transcriptome read dataset
was prepared through filtering of the transcriptome sequencing reads from Impact04 tissues
using Impact04 genome s (>999 bp). The number of reads which contained LpFTRL or
LpDUF3632 sequences (no sequence mismatch for 60 bp or ) were counted.
Finally, it is to be understood that various alterations, modifications and/or additions may be
made without departing from the spirit of the present invention as outlined herein.
References
Hand, M. L., Cogan, N. O., Stewart, A. V. & Forster, J. W. Evolutionary history of tall fescue
morphotypes inferred from molecular phylogenetics of the Lolium-Festuca s complex.
BMC Evolutionary Biology 10, 303 (2010).
Richards, T. A. et al. Phylogenomic analysis trates a pattern of rare and ancient
horizontal gene transfer between plants and fungi. The Plant Cell 21, 1897–1911 (2009).
uka, H. et al. A simple method for semi-random DNA amplicon fragmentation using
the methylation-dependent restriction enzyme MspJI. BMC Biotechnology 15, 25 (2015).
Claims (24)
1. A method of creating or ing a symbiotic onship between a plant and a symbiont carrying a domain-of-unknown-function (DUF) gene; said method including 5 introducing into said plant an effective amount of a nucleic acid or nucleic acid nt of the DUF gene, wherein the nucleic acid or nucleic acid fragment is isolated from a plant species.
2. A method according to claim 1, wherein said plant is from a Lolium or Festuca species.
3. A method according to claim 2, wherein said plant species is Lolium perenne or Lolium multiflorum. 15
4. A plant endophyte symbiota produced by a method according to any one of claims 1 to 3.
5. A method for selecting a plant for symbiosis with a symbiont carrying a DUF gene; said method comprising 20 a) determining the presence of a DUF gene in said plant, b) measuring the level of expression of the gene identified in a), and c) using the expression level measured in b) to determine if the plant will form a symbiotic relationship with said symbiont. 25
6. A method according to claim 5, wherein the symbiont is an yte from an Epichloe species.
7. A ntially purified or isolated nucleic acid or nucleic acid fragment of a DUF gene; wherein the c acid or nucleic acid fragment is isolated from a plant species.
8. A nucleic acid or nucleic acid fragment according to claim 7, n said plant is from a Lolium or a species.
9. A nucleic acid or nucleic acid fragment according to claim 8, wherein said plant 35 species is Lolium perenne or Lolium multiflorum.
10. A ntially purified or isolated nucleic acid or nucleic acid fragment of a DUF gene or a complementary or antisense sequence to a c acid or nucleic acid fragment of a DUF gene, said nucleic acid or nucleic acid fragment including a nucleotide 5 ce selected from the group consisting of: (a) the sequence shown in ce ID No: 28; (b) complement of the sequence recited in (a); (c) sequences antisense to the sequence recited in (a); and (d) functionally active fragments and variants of the ces recited in (a), (b) 10 and (c).
11. A nucleic acid or nucleic acid fragment according to claim 10, wherein one of the following applies i) said functionally active fragment or variant has a size of at least 20 nucleotides 15 and has at least imately 90% identity to the relevant part of the sequence recited in (a), (b) or (c), upon which the fragment or variant is based; or ii) said functionally active fragment or variant has a size of at least 100 nucleotides and has at least approximately 95% identity to the relevant part of the sequence recited in (a), (b) or (c), upon which the fragment or variant is based.
12. A vector ing a nucleic acid or c acid fragment according to any one of claims 7 to 11.
13. A vector according to claim 12 further including a promoter and a terminator, said 25 er, nucleic acid or nucleic acid fragment and terminator being operatively linked.
14. A plant cell, plant, plant seed or other plant part, including vector according to claim 12 or 13. 30
15. A method of modifying pathogen resistance in a plant, said method including introducing into said plant an effective amount of a nucleic acid or nucleic acid fragment according to any one of claims 7 to 11, or a vector according to claim 12 or 13.
16. Use of a nucleic acid or nucleic acid fragment according to any one of claims 7 to 11 for modifying pathogen ance in a plant.
17. Use of a nucleic acid or nucleic acid fragment according to any one of claims 7 to 11, 5 or nucleotide sequence information thereof, or single nucleotide polymorphisms thereof, as a molecular genetic marker.
18. A method of creating or enhancing a symbiotic relationship between a plant and a symbiont carrying a DUF gene; said method including introducing into said plant an effective 10 amount of a nucleic acid or nucleic acid fragment according to any one of claims 7 to 11, or a vector according to claim 12 or 13.
19. A plant endophyte symbiota produced by a method according to claim 18. 15
20. A substantially purified or isolated DUF protein, wherein said DUF protein is isolated from a plant species.
21. A DUF protein ing to claim 20, wherein said plant from which the DUF protein is isolated is a Lolium or Festuca species.
22. A DUF protein according to claim 21, wherein the plant species is Lolium perenne or Lolium multiflorum.
23. A substantially purified or isolated DUF n, said protein including an amino acid 25 sequence ed from the group consisting of: (b) the sequence shown in Sequence ID No: 29; and (c) functionally active fragments and ts of the sequence recited in (a).
24. A protein according to claim 23, n one of the following applies: 30 i) the functionally active fragment or variant has a size of at least 20 amino acids and has at least approximately 90% identity to the nt part of the sequence recited in (a) upon which the nt or variant is based; ii) the onally active fragment or variant has a size of at least 100 amino acids and has at least approximately 95% identity to the relevant part of the sequence recited in (a) upon which the fragment or variant is based. EPWMMSDEWNNVMGCNGAPSEFDCMQNIYGGSKR NFGGWLICEPWMMSDEWNNVRGCNGAASEFDCMRNNYGGSKR KGINKIRGVNFGGWLICEPWMMSDEWNNVMGCNGAASEFDCMLNNYMGSNR EPWMMSNEWNNNMGCNNAASEFDCMRNNYMGSKR ALNVPSNKKLHVQFMSSKWDSGDPR SPGMDGWIYWTWKTELNDPR .*:.************.******:**** ***.*.****** * * **:* PGALKAVRDAEASLGVADGKKLHVQFMSQKWDSGNPR ADFFKKFFTAQQQLYEAPGMSGWVYWTWKTQLNDPR ***** :******:***** D DKDFFKKFFTAQQQLYEAPGMSGWVYWTWKTQLNDPR KFFTAQQQLYEEPGMSGWIYWTWKTQLNDPR DGNFFTKFFTAQQQLYESPGMDGWIYWTWKTELNDPR
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU2017902978 | 2017-07-28 |
Publications (1)
Publication Number | Publication Date |
---|---|
NZ789514A true NZ789514A (en) | 2022-07-01 |
Family
ID=
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Su et al. | A deletion mutation in TaHRC confers Fhb1 resistance to Fusarium head blight in wheat | |
Qu et al. | The broad-spectrum blast resistance gene Pi9 encodes a nucleotide-binding site–leucine-rich repeat protein and is a member of a multigene family in rice | |
Sweeney et al. | Caught red-handed: Rc encodes a basic helix-loop-helix protein conditioning red pericarp in rice | |
CN111247244B (en) | Genes conferring resistance to fungal pathogens | |
AU2019276382B2 (en) | Use of Yr4DS gene of Aegilops tauschii in stripe rust resistance breeding of Triticeae plants | |
US9688984B2 (en) | SPL16 compositions and methods to increase agronomic performance of plants | |
DK3011037T3 (en) | Resistance gene against rhizomania. | |
Zhang et al. | Fine mapping of fw3. 2 controlling fruit weight in tomato | |
CN112375130B (en) | Corn ear length gene and molecular marker and application thereof | |
CN111741969B (en) | Corn gene KRN2 and application thereof | |
WO2017013409A2 (en) | Modified plants | |
CN112626040A (en) | ZmRBOHB gene and application of encoding protein thereof in resistance to maize ear rot | |
Perry et al. | A comparison of the molecular organization of genomic regions associated with resistance to common bacterial blight in two Phaseolus vulgaris genotypes | |
Cao et al. | Molecular characterization of a transcriptionally active Ty1/copia-like retrotransposon in Gossypium | |
Berg et al. | The amino acid permease (AAP) genes CsAAP2A and SlAAP5A/B are required for oomycete susceptibility in cucumber and tomato | |
CN101484465A (en) | Maize genes for controlling plant growth and organ size and their use in improving crop plants | |
Blume et al. | Genome-wide identification and analysis of the cytokinin oxidase/dehydrogenase (ckx) gene family in finger millet (Eleusine coracana) | |
Fang et al. | Analysis of allelic variants of RhMLO genes in rose and functional studies on susceptibility to powdery mildew related to clade V homologs | |
Song et al. | Genome-wide analysis of nucleotide-binding site disease resistance genes in Medicago truncatula | |
EP1641921B1 (en) | Nod-factor perception | |
WO2011046202A1 (en) | Gene controlling flowering habit/cleistogamy in plants, and use thereof | |
AU2018305727A1 (en) | Horizontal transfer of fungal genes into plants | |
WO2012006866A1 (en) | BOTANICAL YELLOW DWARF DISEASE RESISTANT PROTEIN TiSTKI, CODING GENE AND APPLICATION THEREOF | |
Morozov et al. | Structural evolution of the 4/1 genes and proteins in non-vascular and lower vascular plants | |
CN112813067B (en) | Method for reducing tetraploid wild rice plant height by inhibiting expression of SD1 gene |