NZ786906A - Cell-free production of ribonucleic acid - Google Patents
Cell-free production of ribonucleic acidInfo
- Publication number
- NZ786906A NZ786906A NZ786906A NZ78690617A NZ786906A NZ 786906 A NZ786906 A NZ 786906A NZ 786906 A NZ786906 A NZ 786906A NZ 78690617 A NZ78690617 A NZ 78690617A NZ 786906 A NZ786906 A NZ 786906A
- Authority
- NZ
- New Zealand
- Prior art keywords
- rna
- thermostable
- kinase
- cell lysate
- cell
- Prior art date
Links
- 229920002477 rna polymer Polymers 0.000 title claims abstract description 308
- 238000004519 manufacturing process Methods 0.000 title claims abstract description 38
- 238000000034 method Methods 0.000 claims abstract description 118
- 239000000203 mixture Substances 0.000 claims abstract description 49
- 102000004190 Enzymes Human genes 0.000 claims description 257
- 108090000790 Enzymes Proteins 0.000 claims description 257
- 210000004027 cell Anatomy 0.000 claims description 217
- 239000013592 cell lysate Substances 0.000 claims description 194
- 230000000694 effects Effects 0.000 claims description 147
- 108091032973 (ribonucleotides)n+m Proteins 0.000 claims description 98
- 102000040650 (ribonucleotides)n+m Human genes 0.000 claims description 97
- 108091000080 Phosphotransferase Proteins 0.000 claims description 97
- 102000020233 phosphotransferase Human genes 0.000 claims description 96
- 102000053602 DNA Human genes 0.000 claims description 85
- 108020004414 DNA Proteins 0.000 claims description 85
- 241000588724 Escherichia coli Species 0.000 claims description 80
- 108090000638 Ribonuclease R Proteins 0.000 claims description 72
- ZKHQWZAMYRWXGA-KQYNXXCUSA-J ATP(4-) Chemical group C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](COP([O-])(=O)OP([O-])(=O)OP([O-])([O-])=O)[C@@H](O)[C@H]1O ZKHQWZAMYRWXGA-KQYNXXCUSA-J 0.000 claims description 66
- ZKHQWZAMYRWXGA-UHFFFAOYSA-N Adenosine triphosphate Natural products C1=NC=2C(N)=NC=NC=2N1C1OC(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)C(O)C1O ZKHQWZAMYRWXGA-UHFFFAOYSA-N 0.000 claims description 66
- 101710163270 Nuclease Proteins 0.000 claims description 64
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 claims description 63
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 claims description 63
- -1 nucleoside monophosphates Chemical class 0.000 claims description 63
- 239000002777 nucleoside Substances 0.000 claims description 52
- 101710129823 Polyphosphate kinase 2 Proteins 0.000 claims description 46
- 102000001253 Protein Kinase Human genes 0.000 claims description 45
- 108020004999 messenger RNA Proteins 0.000 claims description 37
- 108020000161 polyphosphate kinase Proteins 0.000 claims description 37
- 108060006633 protein kinase Proteins 0.000 claims description 36
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 claims description 32
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 claims description 32
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 31
- 101710137500 T7 RNA polymerase Proteins 0.000 claims description 30
- 102000006382 Ribonucleases Human genes 0.000 claims description 27
- 108010083644 Ribonucleases Proteins 0.000 claims description 27
- 229920000388 Polyphosphate Polymers 0.000 claims description 25
- 239000001205 polyphosphate Substances 0.000 claims description 25
- 235000011176 polyphosphates Nutrition 0.000 claims description 25
- 239000001226 triphosphate Substances 0.000 claims description 25
- 235000011178 triphosphate Nutrition 0.000 claims description 24
- 239000002253 acid Substances 0.000 claims description 22
- 108020004566 Transfer RNA Proteins 0.000 claims description 18
- 108020004418 ribosomal RNA Proteins 0.000 claims description 18
- 230000002255 enzymatic effect Effects 0.000 claims description 17
- 230000004927 fusion Effects 0.000 claims description 17
- 102000002281 Adenylate kinase Human genes 0.000 claims description 13
- 108020000543 Adenylate kinase Proteins 0.000 claims description 13
- 102000013901 Nucleoside diphosphate kinase Human genes 0.000 claims description 13
- 101001066878 Homo sapiens Polyribonucleotide nucleotidyltransferase 1, mitochondrial Proteins 0.000 claims description 12
- 108010057163 Ribonuclease III Proteins 0.000 claims description 12
- 102000003661 Ribonuclease III Human genes 0.000 claims description 12
- 241000920564 Caldilinea aerophila Species 0.000 claims description 11
- 108020004202 Guanylate Kinase Proteins 0.000 claims description 11
- 108010032819 exoribonuclease II Proteins 0.000 claims description 11
- 108010079502 exoribonuclease T Proteins 0.000 claims description 11
- 102000006638 guanylate kinase Human genes 0.000 claims description 11
- 102100038740 Activator of RNA decay Human genes 0.000 claims description 10
- 241000893512 Aquifex aeolicus Species 0.000 claims description 10
- 102100034410 Polyribonucleotide nucleotidyltransferase 1, mitochondrial Human genes 0.000 claims description 10
- 108090000589 ribonuclease E Proteins 0.000 claims description 10
- 108010044790 Nucleoside-Phosphate Kinase Proteins 0.000 claims description 9
- 102000005811 Nucleoside-phosphate kinase Human genes 0.000 claims description 9
- 150000003833 nucleoside derivatives Chemical class 0.000 claims description 9
- 101710149004 Nuclease P1 Proteins 0.000 claims description 8
- 101150045155 adk gene Proteins 0.000 claims description 8
- 239000001177 diphosphate Substances 0.000 claims description 8
- 235000011180 diphosphates Nutrition 0.000 claims description 8
- 108700023477 Nucleoside diphosphate kinases Proteins 0.000 claims description 7
- 230000000415 inactivating effect Effects 0.000 claims description 7
- 230000008929 regeneration Effects 0.000 claims description 7
- 238000011069 regeneration method Methods 0.000 claims description 7
- 101710129824 Polyphosphate kinase 1 Proteins 0.000 claims description 6
- 241001313706 Thermosynechococcus Species 0.000 claims description 6
- 101710100179 UMP-CMP kinase Proteins 0.000 claims description 6
- 101710119674 UMP-CMP kinase 2, mitochondrial Proteins 0.000 claims description 6
- XPPKVPWEQAFLFU-UHFFFAOYSA-J diphosphate(4-) Chemical compound [O-]P([O-])(=O)OP([O-])([O-])=O XPPKVPWEQAFLFU-UHFFFAOYSA-J 0.000 claims description 5
- 101150068008 gmk gene Proteins 0.000 claims description 5
- 241000516659 Roseiflexus Species 0.000 claims description 4
- 108010028263 bacteriophage T3 RNA polymerase Proteins 0.000 claims description 4
- 101150041757 cmk gene Proteins 0.000 claims description 4
- 101150064469 ndk gene Proteins 0.000 claims description 4
- 241000959949 Deinococcus geothermalis Species 0.000 claims description 3
- 101001138544 Homo sapiens UMP-CMP kinase Proteins 0.000 claims description 3
- 102100020797 UMP-CMP kinase Human genes 0.000 claims description 3
- 150000004712 monophosphates Chemical class 0.000 claims description 3
- 101150006862 pyrH gene Proteins 0.000 claims description 3
- 241000633183 Anaerolinea Species 0.000 claims description 2
- 101900333770 Pyrococcus furiosus Uridylate kinase Proteins 0.000 claims description 2
- 241000516658 Roseiflexus castenholzii Species 0.000 claims description 2
- 241001313699 Thermosynechococcus elongatus Species 0.000 claims description 2
- 241000589499 Thermus thermophilus Species 0.000 claims description 2
- 108050006357 Uridylate kinases Proteins 0.000 claims description 2
- 230000003570 biosynthesizing effect Effects 0.000 claims description 2
- 125000002264 triphosphate group Chemical class [H]OP(=O)(O[H])OP(=O)(O[H])OP(=O)(O[H])O* 0.000 claims description 2
- 241000191382 Chlorobaculum tepidum Species 0.000 claims 1
- 241000589496 Meiothermus ruber Species 0.000 claims 1
- 241000508289 Meiothermus silvanus Species 0.000 claims 1
- 241001115911 Oceanithermus profundus Species 0.000 claims 1
- 101900108740 Thermotoga maritima Guanylate kinase Proteins 0.000 claims 1
- 101900118111 Thermus thermophilus Adenylate kinase Proteins 0.000 claims 1
- 241000329376 Truepera Species 0.000 claims 1
- 229940088598 enzyme Drugs 0.000 description 251
- 239000006166 lysate Substances 0.000 description 151
- 238000006243 chemical reaction Methods 0.000 description 135
- 108090000623 proteins and genes Proteins 0.000 description 108
- 150000007523 nucleic acids Chemical class 0.000 description 73
- 102000039446 nucleic acids Human genes 0.000 description 68
- 108020004707 nucleic acids Proteins 0.000 description 68
- 102000004169 proteins and genes Human genes 0.000 description 68
- 235000018102 proteins Nutrition 0.000 description 63
- 239000002773 nucleotide Substances 0.000 description 62
- 125000003729 nucleotide group Chemical group 0.000 description 58
- 230000014509 gene expression Effects 0.000 description 46
- 239000000047 product Substances 0.000 description 42
- 230000002779 inactivation Effects 0.000 description 41
- 239000000243 solution Substances 0.000 description 39
- 230000015572 biosynthetic process Effects 0.000 description 37
- XTWYTFMLZFPYCI-UHFFFAOYSA-N Adenosine diphosphate Natural products C1=NC=2C(N)=NC=NC=2N1C1OC(COP(O)(=O)OP(O)(O)=O)C(O)C1O XTWYTFMLZFPYCI-UHFFFAOYSA-N 0.000 description 35
- XTWYTFMLZFPYCI-KQYNXXCUSA-N 5'-adenylphosphoric acid Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](COP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O XTWYTFMLZFPYCI-KQYNXXCUSA-N 0.000 description 34
- 229940023064 escherichia coli Drugs 0.000 description 33
- 238000013518 transcription Methods 0.000 description 31
- 230000035897 transcription Effects 0.000 description 31
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 28
- 239000000758 substrate Substances 0.000 description 28
- 230000001419 dependent effect Effects 0.000 description 25
- 235000002639 sodium chloride Nutrition 0.000 description 25
- 238000012705 nitroxide-mediated radical polymerization Methods 0.000 description 22
- KWYUFKZDYYNOTN-UHFFFAOYSA-M Potassium hydroxide Chemical compound [OH-].[K+] KWYUFKZDYYNOTN-UHFFFAOYSA-M 0.000 description 21
- UDMBCSSLTHHNCD-KQYNXXCUSA-N adenosine 5'-monophosphate Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@H]1O UDMBCSSLTHHNCD-KQYNXXCUSA-N 0.000 description 21
- 238000006116 polymerization reaction Methods 0.000 description 21
- 230000000295 complement effect Effects 0.000 description 20
- 239000002609 medium Substances 0.000 description 20
- 238000004458 analytical method Methods 0.000 description 19
- 239000000872 buffer Substances 0.000 description 19
- UDMBCSSLTHHNCD-UHFFFAOYSA-N Coenzym Q(11) Natural products C1=NC=2C(N)=NC=NC=2N1C1OC(COP(O)(O)=O)C(O)C1O UDMBCSSLTHHNCD-UHFFFAOYSA-N 0.000 description 18
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 18
- 238000005119 centrifugation Methods 0.000 description 18
- LNQVTSROQXJCDD-UHFFFAOYSA-N adenosine monophosphate Natural products C1=NC=2C(N)=NC=NC=2N1C1OC(CO)C(OP(O)(O)=O)C1O LNQVTSROQXJCDD-UHFFFAOYSA-N 0.000 description 17
- 230000008569 process Effects 0.000 description 17
- 238000010791 quenching Methods 0.000 description 17
- LWIHDJKSTIGBAC-UHFFFAOYSA-K tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 16
- 239000002028 Biomass Substances 0.000 description 15
- 238000003786 synthesis reaction Methods 0.000 description 15
- 101001112318 Dictyostelium discoideum Nucleoside diphosphate kinase, cytosolic Proteins 0.000 description 14
- 101001112320 Dictyostelium discoideum Nucleoside diphosphate kinase, mitochondrial Proteins 0.000 description 14
- 101001128731 Homo sapiens Putative nucleoside diphosphate kinase Proteins 0.000 description 14
- 102100032116 Putative nucleoside diphosphate kinase Human genes 0.000 description 14
- 239000011780 sodium chloride Substances 0.000 description 14
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 13
- 229910019142 PO4 Inorganic materials 0.000 description 13
- 241000589596 Thermus Species 0.000 description 13
- 238000011534 incubation Methods 0.000 description 13
- 235000021317 phosphate Nutrition 0.000 description 13
- 230000001105 regulatory effect Effects 0.000 description 13
- 230000015556 catabolic process Effects 0.000 description 12
- 238000006731 degradation reaction Methods 0.000 description 12
- 238000012691 depolymerization reaction Methods 0.000 description 12
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 12
- 239000010452 phosphate Substances 0.000 description 12
- 238000000746 purification Methods 0.000 description 12
- 108020002230 Pancreatic Ribonuclease Proteins 0.000 description 11
- 102000005891 Pancreatic ribonuclease Human genes 0.000 description 11
- 230000006819 RNA synthesis Effects 0.000 description 11
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 11
- 230000001580 bacterial effect Effects 0.000 description 11
- 230000006037 cell lysis Effects 0.000 description 11
- 238000012512 characterization method Methods 0.000 description 11
- 230000001939 inductive effect Effects 0.000 description 11
- 239000011535 reaction buffer Substances 0.000 description 11
- 150000003839 salts Chemical class 0.000 description 11
- 101000572820 Homo sapiens MICOS complex subunit MIC60 Proteins 0.000 description 10
- 102100026639 MICOS complex subunit MIC60 Human genes 0.000 description 10
- 108060004795 Methyltransferase Proteins 0.000 description 10
- 102000035195 Peptidases Human genes 0.000 description 10
- 108091005804 Peptidases Proteins 0.000 description 10
- 101710135451 Probable cytidylate kinase Proteins 0.000 description 10
- 239000004365 Protease Substances 0.000 description 10
- 238000003556 assay Methods 0.000 description 10
- 239000001963 growth medium Substances 0.000 description 10
- RQFCJASXJCIDSX-UUOKFMHZSA-N guanosine 5'-monophosphate Chemical compound C1=2NC(N)=NC(=O)C=2N=CN1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@H]1O RQFCJASXJCIDSX-UUOKFMHZSA-N 0.000 description 10
- 230000002934 lysing effect Effects 0.000 description 10
- 239000012528 membrane Substances 0.000 description 10
- 229910021645 metal ion Inorganic materials 0.000 description 10
- 230000035772 mutation Effects 0.000 description 10
- 230000037361 pathway Effects 0.000 description 10
- 239000008188 pellet Substances 0.000 description 10
- 239000013612 plasmid Substances 0.000 description 10
- RQFCJASXJCIDSX-UHFFFAOYSA-N 14C-Guanosin-5'-monophosphat Natural products C1=2NC(N)=NC(=O)C=2N=CN1C1OC(COP(O)(O)=O)C(O)C1O RQFCJASXJCIDSX-UHFFFAOYSA-N 0.000 description 9
- 241000205156 Pyrococcus furiosus Species 0.000 description 9
- 230000001413 cellular effect Effects 0.000 description 9
- 230000009089 cytolysis Effects 0.000 description 9
- 230000002939 deleterious effect Effects 0.000 description 9
- 238000010438 heat treatment Methods 0.000 description 9
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 9
- 235000019341 magnesium sulphate Nutrition 0.000 description 9
- 230000026731 phosphorylation Effects 0.000 description 9
- 238000006366 phosphorylation reaction Methods 0.000 description 9
- 238000005070 sampling Methods 0.000 description 9
- 239000004055 small Interfering RNA Substances 0.000 description 9
- 239000006228 supernatant Substances 0.000 description 9
- 238000012546 transfer Methods 0.000 description 9
- 108091028043 Nucleic acid sequence Proteins 0.000 description 8
- 235000001014 amino acid Nutrition 0.000 description 8
- 239000007795 chemical reaction product Substances 0.000 description 8
- 238000002474 experimental method Methods 0.000 description 8
- 239000003112 inhibitor Substances 0.000 description 8
- 239000013641 positive control Substances 0.000 description 8
- ATHGHQPFGPMSJY-UHFFFAOYSA-N spermidine Chemical compound NCCCCNCCCN ATHGHQPFGPMSJY-UHFFFAOYSA-N 0.000 description 8
- 102100028712 Cytosolic purine 5'-nucleotidase Human genes 0.000 description 7
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 7
- 108700019535 Phosphoprotein Phosphatases Proteins 0.000 description 7
- 102000045595 Phosphoprotein Phosphatases Human genes 0.000 description 7
- 108020004459 Small interfering RNA Proteins 0.000 description 7
- 150000001413 amino acids Chemical class 0.000 description 7
- 150000001875 compounds Chemical class 0.000 description 7
- 239000013078 crystal Substances 0.000 description 7
- 239000000178 monomer Substances 0.000 description 7
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 7
- 229910000160 potassium phosphate Inorganic materials 0.000 description 7
- 235000011009 potassium phosphates Nutrition 0.000 description 7
- 230000004083 survival effect Effects 0.000 description 7
- 230000002103 transcriptional effect Effects 0.000 description 7
- 239000013598 vector Substances 0.000 description 7
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 7
- 230000002407 ATP formation Effects 0.000 description 6
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 6
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 108060001084 Luciferase Proteins 0.000 description 6
- 239000005089 Luciferase Substances 0.000 description 6
- 239000001888 Peptone Substances 0.000 description 6
- 108010080698 Peptones Proteins 0.000 description 6
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 6
- 108010034546 Serratia marcescens nuclease Proteins 0.000 description 6
- 238000011156 evaluation Methods 0.000 description 6
- 230000006870 function Effects 0.000 description 6
- 230000012010 growth Effects 0.000 description 6
- 239000007788 liquid Substances 0.000 description 6
- KWGKDLIKAYFUFQ-UHFFFAOYSA-M lithium chloride Chemical compound [Li+].[Cl-] KWGKDLIKAYFUFQ-UHFFFAOYSA-M 0.000 description 6
- 238000002156 mixing Methods 0.000 description 6
- 235000015097 nutrients Nutrition 0.000 description 6
- 235000019319 peptone Nutrition 0.000 description 6
- 210000001322 periplasm Anatomy 0.000 description 6
- 235000019419 proteases Nutrition 0.000 description 6
- 230000002829 reductive effect Effects 0.000 description 6
- 239000000523 sample Substances 0.000 description 6
- 238000004704 ultra performance liquid chromatography Methods 0.000 description 6
- 241000894006 Bacteria Species 0.000 description 5
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 5
- 238000009825 accumulation Methods 0.000 description 5
- 238000004422 calculation algorithm Methods 0.000 description 5
- 230000010261 cell growth Effects 0.000 description 5
- 230000003833 cell viability Effects 0.000 description 5
- 239000003795 chemical substances by application Substances 0.000 description 5
- 239000012141 concentrate Substances 0.000 description 5
- 239000000470 constituent Substances 0.000 description 5
- 230000009368 gene silencing by RNA Effects 0.000 description 5
- 238000000338 in vitro Methods 0.000 description 5
- 230000001965 increasing effect Effects 0.000 description 5
- 238000009630 liquid culture Methods 0.000 description 5
- 239000011159 matrix material Substances 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- 239000008363 phosphate buffer Substances 0.000 description 5
- 238000012545 processing Methods 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- IHIXIJGXTJIKRB-UHFFFAOYSA-N trisodium vanadate Chemical compound [Na+].[Na+].[Na+].[O-][V]([O-])([O-])=O IHIXIJGXTJIKRB-UHFFFAOYSA-N 0.000 description 5
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 4
- USFZMSVCRYTOJT-UHFFFAOYSA-N Ammonium acetate Chemical compound N.CC(O)=O USFZMSVCRYTOJT-UHFFFAOYSA-N 0.000 description 4
- 239000005695 Ammonium acetate Substances 0.000 description 4
- 241000701832 Enterobacteria phage T3 Species 0.000 description 4
- 101100271432 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) atp-9 gene Proteins 0.000 description 4
- 101100324954 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) oli gene Proteins 0.000 description 4
- 102000008021 Nucleoside-Triphosphatase Human genes 0.000 description 4
- 108010075285 Nucleoside-Triphosphatase Proteins 0.000 description 4
- 229940043376 ammonium acetate Drugs 0.000 description 4
- 235000019257 ammonium acetate Nutrition 0.000 description 4
- 238000003149 assay kit Methods 0.000 description 4
- 230000006696 biosynthetic metabolic pathway Effects 0.000 description 4
- 229940041514 candida albicans extract Drugs 0.000 description 4
- 239000003184 complementary RNA Substances 0.000 description 4
- 210000004748 cultured cell Anatomy 0.000 description 4
- 230000007423 decrease Effects 0.000 description 4
- 238000004925 denaturation Methods 0.000 description 4
- 230000036425 denaturation Effects 0.000 description 4
- 238000011143 downstream manufacturing Methods 0.000 description 4
- 230000009977 dual effect Effects 0.000 description 4
- 102000013165 exonuclease Human genes 0.000 description 4
- 230000001976 improved effect Effects 0.000 description 4
- 230000006698 induction Effects 0.000 description 4
- 230000000977 initiatory effect Effects 0.000 description 4
- 150000002632 lipids Chemical class 0.000 description 4
- 238000003670 luciferase enzyme activity assay Methods 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- SCVFZCLFOSHCOH-UHFFFAOYSA-M potassium acetate Chemical compound [K+].CC([O-])=O SCVFZCLFOSHCOH-UHFFFAOYSA-M 0.000 description 4
- 239000000376 reactant Substances 0.000 description 4
- 239000011541 reaction mixture Substances 0.000 description 4
- GCLGEJMYGQKIIW-UHFFFAOYSA-H sodium hexametaphosphate Chemical compound [Na]OP1(=O)OP(=O)(O[Na])OP(=O)(O[Na])OP(=O)(O[Na])OP(=O)(O[Na])OP(=O)(O[Na])O1 GCLGEJMYGQKIIW-UHFFFAOYSA-H 0.000 description 4
- 235000019982 sodium hexametaphosphate Nutrition 0.000 description 4
- 229940063673 spermidine Drugs 0.000 description 4
- 238000013097 stability assessment Methods 0.000 description 4
- 239000012536 storage buffer Substances 0.000 description 4
- RWRDLPDLKQPQOW-UHFFFAOYSA-N tetrahydropyrrole Natural products C1CCNC1 RWRDLPDLKQPQOW-UHFFFAOYSA-N 0.000 description 4
- 239000001577 tetrasodium phosphonato phosphate Substances 0.000 description 4
- 230000007306 turnover Effects 0.000 description 4
- DJJCXFVJDGTHFX-XVFCMESISA-N uridine 5'-monophosphate Chemical compound O[C@@H]1[C@H](O)[C@@H](COP(O)(O)=O)O[C@H]1N1C(=O)NC(=O)C=C1 DJJCXFVJDGTHFX-XVFCMESISA-N 0.000 description 4
- 239000012138 yeast extract Substances 0.000 description 4
- GXMBHQRROXQUJS-UHFFFAOYSA-N (2-hept-2-ynylsulfanylphenyl) acetate Chemical compound CCCCC#CCSC1=CC=CC=C1OC(C)=O GXMBHQRROXQUJS-UHFFFAOYSA-N 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- NLXLAEXVIDQMFP-UHFFFAOYSA-N Ammonia chloride Chemical compound [NH4+].[Cl-] NLXLAEXVIDQMFP-UHFFFAOYSA-N 0.000 description 3
- 108020005544 Antisense RNA Proteins 0.000 description 3
- 235000014469 Bacillus subtilis Nutrition 0.000 description 3
- 108091026890 Coding region Proteins 0.000 description 3
- 101100338765 Danio rerio hamp2 gene Proteins 0.000 description 3
- 241001646716 Escherichia coli K-12 Species 0.000 description 3
- 108060002716 Exonuclease Proteins 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- 101150043052 Hamp gene Proteins 0.000 description 3
- 229910021380 Manganese Chloride Inorganic materials 0.000 description 3
- GLFNIEUTAYBVOC-UHFFFAOYSA-L Manganese chloride Chemical compound Cl[Mn]Cl GLFNIEUTAYBVOC-UHFFFAOYSA-L 0.000 description 3
- 108091034117 Oligonucleotide Proteins 0.000 description 3
- 241000589516 Pseudomonas Species 0.000 description 3
- 102000013009 Pyruvate Kinase Human genes 0.000 description 3
- 108020005115 Pyruvate Kinase Proteins 0.000 description 3
- 238000012228 RNA interference-mediated gene silencing Methods 0.000 description 3
- 108010065868 RNA polymerase SP6 Proteins 0.000 description 3
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 3
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- 108091027967 Small hairpin RNA Proteins 0.000 description 3
- 241000204666 Thermotoga maritima Species 0.000 description 3
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 3
- 150000007513 acids Chemical class 0.000 description 3
- 230000000692 anti-sense effect Effects 0.000 description 3
- 230000033228 biological regulation Effects 0.000 description 3
- 108091092259 cell-free RNA Proteins 0.000 description 3
- 108091092328 cellular RNA Proteins 0.000 description 3
- 238000005352 clarification Methods 0.000 description 3
- 238000010367 cloning Methods 0.000 description 3
- 238000002425 crystallisation Methods 0.000 description 3
- 230000008025 crystallization Effects 0.000 description 3
- IERHLVCPSMICTF-XVFCMESISA-N cytidine 5'-monophosphate Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](COP(O)(O)=O)O1 IERHLVCPSMICTF-XVFCMESISA-N 0.000 description 3
- 230000030609 dephosphorylation Effects 0.000 description 3
- 238000006209 dephosphorylation reaction Methods 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- 238000011067 equilibration Methods 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- 238000000855 fermentation Methods 0.000 description 3
- 230000004151 fermentation Effects 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 238000003306 harvesting Methods 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 238000000265 homogenisation Methods 0.000 description 3
- 238000006460 hydrolysis reaction Methods 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 239000000411 inducer Substances 0.000 description 3
- 150000002500 ions Chemical class 0.000 description 3
- 230000002427 irreversible effect Effects 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 230000028744 lysogeny Effects 0.000 description 3
- 239000011565 manganese chloride Substances 0.000 description 3
- 235000002867 manganese chloride Nutrition 0.000 description 3
- 229940099607 manganese chloride Drugs 0.000 description 3
- 229930029653 phosphoenolpyruvate Natural products 0.000 description 3
- DTBNBXWJWCWCIK-UHFFFAOYSA-N phosphoenolpyruvic acid Chemical compound OC(=O)C(=C)OP(O)(O)=O DTBNBXWJWCWCIK-UHFFFAOYSA-N 0.000 description 3
- 239000001103 potassium chloride Substances 0.000 description 3
- 235000011164 potassium chloride Nutrition 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 230000000171 quenching effect Effects 0.000 description 3
- 238000000926 separation method Methods 0.000 description 3
- 238000012163 sequencing technique Methods 0.000 description 3
- 239000011734 sodium Substances 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 230000008685 targeting Effects 0.000 description 3
- 238000001890 transfection Methods 0.000 description 3
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 3
- 230000003612 virological effect Effects 0.000 description 3
- 239000011534 wash buffer Substances 0.000 description 3
- GZCWLCBFPRFLKL-UHFFFAOYSA-N 1-prop-2-ynoxypropan-2-ol Chemical compound CC(O)COCC#C GZCWLCBFPRFLKL-UHFFFAOYSA-N 0.000 description 2
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 2
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 2
- VUTBELPREDJDDH-UHFFFAOYSA-N 4-amino-5-hydroxymethyl-2-methylpyrimidine Chemical compound CC1=NC=C(CO)C(N)=N1 VUTBELPREDJDDH-UHFFFAOYSA-N 0.000 description 2
- 108010011619 6-Phytase Proteins 0.000 description 2
- 108010092060 Acetate kinase Proteins 0.000 description 2
- 108010051457 Acid Phosphatase Proteins 0.000 description 2
- 102000013563 Acid Phosphatase Human genes 0.000 description 2
- 241000607534 Aeromonas Species 0.000 description 2
- 241000588986 Alcaligenes Species 0.000 description 2
- 244000063299 Bacillus subtilis Species 0.000 description 2
- 241000589519 Comamonas Species 0.000 description 2
- 102000004420 Creatine Kinase Human genes 0.000 description 2
- 108010042126 Creatine kinase Proteins 0.000 description 2
- 101100054516 Drosophila melanogaster Ance gene Proteins 0.000 description 2
- 241000588722 Escherichia Species 0.000 description 2
- 108010002700 Exoribonucleases Proteins 0.000 description 2
- 102000004678 Exoribonucleases Human genes 0.000 description 2
- 108700007698 Genetic Terminator Regions Proteins 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 2
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- DRBBFCLWYRJSJZ-UHFFFAOYSA-N N-phosphocreatine Chemical compound OC(=O)CN(C)C(=N)NP(O)(O)=O DRBBFCLWYRJSJZ-UHFFFAOYSA-N 0.000 description 2
- 241000228143 Penicillium Species 0.000 description 2
- 241001603151 Philus Species 0.000 description 2
- 229940122907 Phosphatase inhibitor Drugs 0.000 description 2
- 102000004861 Phosphoric Diester Hydrolases Human genes 0.000 description 2
- 108090001050 Phosphoric Diester Hydrolases Proteins 0.000 description 2
- 241000235648 Pichia Species 0.000 description 2
- 102000002681 Polyribonucleotide nucleotidyltransferase Human genes 0.000 description 2
- 241000589776 Pseudomonas putida Species 0.000 description 2
- CZPWVGJYEJSRLH-UHFFFAOYSA-N Pyrimidine Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 description 2
- 108091030071 RNAI Proteins 0.000 description 2
- 241000589180 Rhizobium Species 0.000 description 2
- 108091028664 Ribonucleotide Proteins 0.000 description 2
- 241001468001 Salmonella virus SP6 Species 0.000 description 2
- 241000192707 Synechococcus Species 0.000 description 2
- 239000004098 Tetracycline Substances 0.000 description 2
- 241000723792 Tobacco etch virus Species 0.000 description 2
- 239000007983 Tris buffer Substances 0.000 description 2
- 108091079639 Type I family Proteins 0.000 description 2
- 108020000553 UMP kinase Proteins 0.000 description 2
- 238000002441 X-ray diffraction Methods 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- LIPOUNRJVLNBCD-UHFFFAOYSA-N acetyl dihydrogen phosphate Chemical compound CC(=O)OP(O)(O)=O LIPOUNRJVLNBCD-UHFFFAOYSA-N 0.000 description 2
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 2
- 239000011543 agarose gel Substances 0.000 description 2
- 238000000246 agarose gel electrophoresis Methods 0.000 description 2
- 230000002776 aggregation Effects 0.000 description 2
- 238000004220 aggregation Methods 0.000 description 2
- 238000005904 alkaline hydrolysis reaction Methods 0.000 description 2
- 235000019270 ammonium chloride Nutrition 0.000 description 2
- RASZIXQTZOARSV-BDPUVYQTSA-N astacin Chemical compound CC=1C(=O)C(=O)CC(C)(C)C=1/C=C/C(/C)=C/C=C/C(/C)=C/C=C/C=C(C)C=CC=C(C)C=CC1=C(C)C(=O)C(=O)CC1(C)C RASZIXQTZOARSV-BDPUVYQTSA-N 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 230000027455 binding Effects 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 238000004364 calculation method Methods 0.000 description 2
- 239000003054 catalyst Substances 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 239000002738 chelating agent Substances 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 238000004590 computer program Methods 0.000 description 2
- 238000009295 crossflow filtration Methods 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- IERHLVCPSMICTF-UHFFFAOYSA-N cytidine monophosphate Natural products O=C1N=C(N)C=CN1C1C(O)C(O)C(COP(O)(O)=O)O1 IERHLVCPSMICTF-UHFFFAOYSA-N 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- KXGVEGMKQFWNSR-LLQZFEROSA-N deoxycholic acid Chemical compound C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)[C@@H](O)C1 KXGVEGMKQFWNSR-LLQZFEROSA-N 0.000 description 2
- 230000001627 detrimental effect Effects 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 238000000502 dialysis Methods 0.000 description 2
- ZPWVASYFFYYZEW-UHFFFAOYSA-L dipotassium hydrogen phosphate Chemical compound [K+].[K+].OP([O-])([O-])=O ZPWVASYFFYYZEW-UHFFFAOYSA-L 0.000 description 2
- 235000019797 dipotassium phosphate Nutrition 0.000 description 2
- 229910000396 dipotassium phosphate Inorganic materials 0.000 description 2
- 239000012149 elution buffer Substances 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 238000006911 enzymatic reaction Methods 0.000 description 2
- 239000006167 equilibration buffer Substances 0.000 description 2
- 235000019253 formic acid Nutrition 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- 239000012737 fresh medium Substances 0.000 description 2
- 230000007062 hydrolysis Effects 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 238000003674 kinase activity assay Methods 0.000 description 2
- 238000011031 large-scale manufacturing process Methods 0.000 description 2
- 231100000518 lethal Toxicity 0.000 description 2
- 230000001665 lethal effect Effects 0.000 description 2
- 239000011777 magnesium Substances 0.000 description 2
- 229910052749 magnesium Inorganic materials 0.000 description 2
- 229940091250 magnesium supplement Drugs 0.000 description 2
- 230000035800 maturation Effects 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 230000010534 mechanism of action Effects 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 230000004060 metabolic process Effects 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- 238000002552 multiple reaction monitoring Methods 0.000 description 2
- 101150061429 nagD gene Proteins 0.000 description 2
- 125000003835 nucleoside group Chemical group 0.000 description 2
- 108010027581 nucleoside triphosphate pyrophosphatase Proteins 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 230000002018 overexpression Effects 0.000 description 2
- 229940085127 phytase Drugs 0.000 description 2
- 238000005498 polishing Methods 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 238000003752 polymerase chain reaction Methods 0.000 description 2
- 235000011056 potassium acetate Nutrition 0.000 description 2
- 238000011533 pre-incubation Methods 0.000 description 2
- 230000001376 precipitating effect Effects 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 238000011002 quantification Methods 0.000 description 2
- 239000002336 ribonucleotide Substances 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 229910052708 sodium Inorganic materials 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- PUZPDOWCWNUUKD-UHFFFAOYSA-M sodium fluoride Chemical compound [F-].[Na+] PUZPDOWCWNUUKD-UHFFFAOYSA-M 0.000 description 2
- 239000001488 sodium phosphate Substances 0.000 description 2
- 229910000162 sodium phosphate Inorganic materials 0.000 description 2
- 235000011008 sodium phosphates Nutrition 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 239000007858 starting material Substances 0.000 description 2
- 239000011550 stock solution Substances 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 230000002194 synthesizing effect Effects 0.000 description 2
- 229960002180 tetracycline Drugs 0.000 description 2
- 229930101283 tetracycline Natural products 0.000 description 2
- 235000019364 tetracycline Nutrition 0.000 description 2
- 150000003522 tetracyclines Chemical class 0.000 description 2
- 230000036962 time dependent Effects 0.000 description 2
- 238000010361 transduction Methods 0.000 description 2
- 230000026683 transduction Effects 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- 108010016126 uridine diphosphate kinase Proteins 0.000 description 2
- 101150047507 ushA gene Proteins 0.000 description 2
- 239000003643 water by type Substances 0.000 description 2
- 210000005253 yeast cell Anatomy 0.000 description 2
- JIAARYAFYJHUJI-UHFFFAOYSA-L zinc dichloride Chemical compound [Cl-].[Cl-].[Zn+2] JIAARYAFYJHUJI-UHFFFAOYSA-L 0.000 description 2
- DGWDWLRHFOUZCX-UHFFFAOYSA-N (25R)-26-[(D-Glucopyranosyl)oxy]-2hydroxyfurosta-5,20(22)-dien-3yl O-D-glucopyranosyl-(1‘Â∆3)-O-D-glucopyranosyl-(1‘Â∆2)-O-[D-xylopyranosyl-(1‘Â∆3)]-O-D-glucopyranosyl-(1‘Â∆4)-D-ga Natural products O1C(CO)C(O)C(O)C(O)C1OCC(C)CCC(O1)=C(C)C(C2(CCC3C4(C)CC5O)C)C1CC2C3CC=C4CC5OC(C(C1O)O)OC(CO)C1OC(C1OC2C(C(OC3C(C(O)C(O)C(CO)O3)O)C(O)C(CO)O2)O)OC(CO)C(O)C1OC1OCC(O)C(O)C1O DGWDWLRHFOUZCX-UHFFFAOYSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-UHFFFAOYSA-N 1-beta-D-Xylofuranosyl-NH-Cytosine Natural products O=C1N=C(N)C=CN1C1C(O)C(O)C(CO)O1 UHDGCWIWMRVCDJ-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- RCEFMOGVOYEGJN-UHFFFAOYSA-N 3-(2-hydroxyphenyl)-6-(3-nitrophenyl)-1,4-dihydropyrimidin-2-one Chemical compound OC1=CC=CC=C1N1C(=O)NC(C=2C=C(C=CC=2)[N+]([O-])=O)=CC1 RCEFMOGVOYEGJN-UHFFFAOYSA-N 0.000 description 1
- 108010091324 3C proteases Proteins 0.000 description 1
- 102000004008 5'-Nucleotidase Human genes 0.000 description 1
- 108700004024 5'-Nucleotidase Proteins 0.000 description 1
- AEOBEOJCBAYXBA-UHFFFAOYSA-N A2P5P Natural products C1=NC=2C(N)=NC=NC=2N1C1OC(COP(O)(O)=O)C(O)C1OP(O)(O)=O AEOBEOJCBAYXBA-UHFFFAOYSA-N 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 101100148259 Actinobacillus pleuropneumoniae apxIIA gene Proteins 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 108010075409 Alanine carboxypeptidase Proteins 0.000 description 1
- 241001136792 Alle Species 0.000 description 1
- 108030000961 Aminopeptidase Y Proteins 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- VHUUQVKOLVNVRT-UHFFFAOYSA-N Ammonium hydroxide Chemical compound [NH4+].[OH-] VHUUQVKOLVNVRT-UHFFFAOYSA-N 0.000 description 1
- 241001607870 Anaerolinea thermophila UNI-1 Species 0.000 description 1
- 241001550224 Apha Species 0.000 description 1
- 241000203069 Archaea Species 0.000 description 1
- 244000221226 Armillaria mellea Species 0.000 description 1
- 235000011569 Armillaria mellea Nutrition 0.000 description 1
- 108090000658 Astacin Proteins 0.000 description 1
- 102000034498 Astacin Human genes 0.000 description 1
- 238000012935 Averaging Methods 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 108010066768 Bacterial leucyl aminopeptidase Proteins 0.000 description 1
- NLZUEZXRPGMBCV-UHFFFAOYSA-N Butylhydroxytoluene Chemical compound CC1=CC(C(C)(C)C)=C(O)C(C(C)(C)C)=C1 NLZUEZXRPGMBCV-UHFFFAOYSA-N 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- YQUAKORMLHPSLZ-UHFFFAOYSA-N CMP Natural products O=C1N=C(N)C=CN1C1C(OP(O)(O)=O)C(O)C(CO)O1 YQUAKORMLHPSLZ-UHFFFAOYSA-N 0.000 description 1
- 241000633199 Caldilinea Species 0.000 description 1
- 241001607904 Caldilinea aerophila DSM 14535 = NBRC 104270 Species 0.000 description 1
- 241000222120 Candida <Saccharomycetales> Species 0.000 description 1
- 108010006303 Carboxypeptidases Proteins 0.000 description 1
- 102000005367 Carboxypeptidases Human genes 0.000 description 1
- 108090000712 Cathepsin B Proteins 0.000 description 1
- 102000004225 Cathepsin B Human genes 0.000 description 1
- CXRFDZFCGOPDTD-UHFFFAOYSA-M Cetrimide Chemical compound [Br-].CCCCCCCCCCCCCC[N+](C)(C)C CXRFDZFCGOPDTD-UHFFFAOYSA-M 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- 241001389325 Chlorobaculum Species 0.000 description 1
- 241000588881 Chromobacterium Species 0.000 description 1
- 102100023336 Chymotrypsin-like elastase family member 3B Human genes 0.000 description 1
- 101710172087 Class B acid phosphatase Proteins 0.000 description 1
- 108020004394 Complementary RNA Proteins 0.000 description 1
- UHDGCWIWMRVCDJ-PSQAKQOGSA-N Cytidine Natural products O=C1N=C(N)C=CN1[C@@H]1[C@@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-PSQAKQOGSA-N 0.000 description 1
- UOOOPKANIPLQPU-UHFFFAOYSA-N Cytidylic acid B Natural products O=C1N=C(N)C=CN1C1C(O)C(OP(O)(O)=O)C(CO)O1 UOOOPKANIPLQPU-UHFFFAOYSA-N 0.000 description 1
- 108030000958 Cytosol alanyl aminopeptidases Proteins 0.000 description 1
- 102100034560 Cytosol aminopeptidase Human genes 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 241000192093 Deinococcus Species 0.000 description 1
- 241001332002 Deinococcus geothermalis DSM 11300 Species 0.000 description 1
- FMKGDHLSXFDSOU-BDPUVYQTSA-N Dienon-Astacin Natural products CC(=C/C=C/C=C(C)/C=C/C=C(C)/C=C/C1=C(C)C(=O)C(=CC1(C)C)O)C=CC=C(/C)C=CC2=C(C)C(=O)C(=CC2(C)C)O FMKGDHLSXFDSOU-BDPUVYQTSA-N 0.000 description 1
- 108700036055 EC 3.4.21.90 Proteins 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 101100001670 Emericella variicolor andE gene Proteins 0.000 description 1
- 102000002494 Endoribonucleases Human genes 0.000 description 1
- 108010093099 Endoribonucleases Proteins 0.000 description 1
- 108010013369 Enteropeptidase Proteins 0.000 description 1
- 102100029727 Enteropeptidase Human genes 0.000 description 1
- 241001517310 Eria Species 0.000 description 1
- 241000588698 Erwinia Species 0.000 description 1
- 101900137339 Escherichia coli Adenylate kinase Proteins 0.000 description 1
- 101900345593 Escherichia coli Alkaline phosphatase Proteins 0.000 description 1
- 101000981098 Escherichia coli Cloacin Proteins 0.000 description 1
- 101000981105 Escherichia coli Colicin-E3 Proteins 0.000 description 1
- 101000981106 Escherichia coli Colicin-E6 Proteins 0.000 description 1
- 241000660147 Escherichia coli str. K-12 substr. MG1655 Species 0.000 description 1
- 101000686777 Escherichia phage T7 T7 RNA polymerase Proteins 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 241000589565 Flavobacterium Species 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 230000005526 G1 to G0 transition Effects 0.000 description 1
- 102000013446 GTP Phosphohydrolases Human genes 0.000 description 1
- 108091006109 GTPases Proteins 0.000 description 1
- 108090001072 Gastricsin Proteins 0.000 description 1
- 102000055441 Gastricsin Human genes 0.000 description 1
- 102000013382 Gelatinases Human genes 0.000 description 1
- 108010026132 Gelatinases Proteins 0.000 description 1
- 241000626621 Geobacillus Species 0.000 description 1
- 241000589236 Gluconobacter Species 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 101000907951 Homo sapiens Chymotrypsin-like elastase family member 3B Proteins 0.000 description 1
- 101000637726 Homo sapiens Toll/interleukin-1 receptor domain-containing adapter protein Proteins 0.000 description 1
- 101000868883 Homo sapiens Transcription factor Sp6 Proteins 0.000 description 1
- 241000430519 Human rhinovirus sp. Species 0.000 description 1
- 108090000571 Hypodermin C Proteins 0.000 description 1
- 101710172990 Inducible lysine decarboxylase Proteins 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- 101710176219 Kallikrein-1 Proteins 0.000 description 1
- 102100038297 Kallikrein-1 Human genes 0.000 description 1
- 241000588748 Klebsiella Species 0.000 description 1
- 241000235649 Kluyveromyces Species 0.000 description 1
- 241000186660 Lactobacillus Species 0.000 description 1
- 108010004098 Leucyl aminopeptidase Proteins 0.000 description 1
- 102000002704 Leucyl aminopeptidase Human genes 0.000 description 1
- 108030007165 Leucyl endopeptidases Proteins 0.000 description 1
- 239000007987 MES buffer Substances 0.000 description 1
- 239000007993 MOPS buffer Substances 0.000 description 1
- 102000007307 Maf Transcription Factors Human genes 0.000 description 1
- 108010033714 Maf Transcription Factors Proteins 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 108090000192 Methionyl aminopeptidases Proteins 0.000 description 1
- 102000034452 Methionyl aminopeptidases Human genes 0.000 description 1
- 241000186359 Mycobacterium Species 0.000 description 1
- 241001544324 Myxobacter Species 0.000 description 1
- 102000010722 N-Glycosyl Hydrolases Human genes 0.000 description 1
- 108010063372 N-Glycosyl Hydrolases Proteins 0.000 description 1
- BAWFJGJZGIEFAR-NNYOXOHSSA-O NAD(+) Chemical compound NC(=O)C1=CC=C[N+]([C@H]2[C@@H]([C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OC[C@@H]3[C@H]([C@@H](O)[C@@H](O3)N3C4=NC=NC(N)=C4N=C3)O)O2)O)=C1 BAWFJGJZGIEFAR-NNYOXOHSSA-O 0.000 description 1
- 102100021850 Nardilysin Human genes 0.000 description 1
- 108090000970 Nardilysin Proteins 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 102100036518 Nucleoside diphosphate phosphatase ENTPD5 Human genes 0.000 description 1
- 102100021969 Nucleotide pyrophosphatase Human genes 0.000 description 1
- 108090000854 Oxidoreductases Proteins 0.000 description 1
- 102000004316 Oxidoreductases Human genes 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 239000007990 PIPES buffer Substances 0.000 description 1
- 108010067372 Pancreatic elastase Proteins 0.000 description 1
- 102000016387 Pancreatic elastase Human genes 0.000 description 1
- 241000520272 Pantoea Species 0.000 description 1
- 241000228153 Penicillium citrinum Species 0.000 description 1
- 108010010677 Phosphodiesterase I Proteins 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 102000006437 Proprotein Convertases Human genes 0.000 description 1
- 108010044159 Proprotein Convertases Proteins 0.000 description 1
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 1
- 102100038358 Prostate-specific antigen Human genes 0.000 description 1
- 101800001491 Protease 3C Proteins 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 102100033192 Puromycin-sensitive aminopeptidase Human genes 0.000 description 1
- 241000522615 Pyrococcus horikoshii Species 0.000 description 1
- LCTONWCANYUPML-UHFFFAOYSA-M Pyruvate Chemical compound CC(=O)C([O-])=O LCTONWCANYUPML-UHFFFAOYSA-M 0.000 description 1
- 239000013614 RNA sample Substances 0.000 description 1
- 230000004570 RNA-binding Effects 0.000 description 1
- 108091007187 Reductases Proteins 0.000 description 1
- 241000316848 Rhodococcus <scale insect> Species 0.000 description 1
- 102000016144 Ribonuclease 11 Human genes 0.000 description 1
- 108050005905 Ribonuclease J Proteins 0.000 description 1
- 108090000040 Russellysin Proteins 0.000 description 1
- 241000235070 Saccharomyces Species 0.000 description 1
- 108090000077 Saccharopepsin Proteins 0.000 description 1
- 241000187560 Saccharopolyspora Species 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 241000235346 Schizosaccharomyces Species 0.000 description 1
- 108091058545 Secretory proteins Proteins 0.000 description 1
- 102000040739 Secretory proteins Human genes 0.000 description 1
- 102000003667 Serine Endopeptidases Human genes 0.000 description 1
- 108090000083 Serine Endopeptidases Proteins 0.000 description 1
- 241000607720 Serratia Species 0.000 description 1
- 241000607715 Serratia marcescens Species 0.000 description 1
- 101001008392 Serratia marcescens Nuclease Proteins 0.000 description 1
- 241001175007 Silvanus Species 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- 241001135312 Sinorhizobium Species 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 241000194017 Streptococcus Species 0.000 description 1
- 241000051160 Thermus thermophilus HB27 Species 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 108090000373 Tissue Plasminogen Activator Proteins 0.000 description 1
- 102000003978 Tissue Plasminogen Activator Human genes 0.000 description 1
- 108030000963 Tryptophanyl aminopeptidases Proteins 0.000 description 1
- DJJCXFVJDGTHFX-UHFFFAOYSA-N Uridinemonophosphate Natural products OC1C(O)C(COP(O)(O)=O)OC1N1C(=O)NC(=O)C=C1 DJJCXFVJDGTHFX-UHFFFAOYSA-N 0.000 description 1
- 102000003990 Urokinase-type plasminogen activator Human genes 0.000 description 1
- 108090000435 Urokinase-type plasminogen activator Proteins 0.000 description 1
- 241000112708 Vates Species 0.000 description 1
- 241000607598 Vibrio Species 0.000 description 1
- 108030004686 Xaa-Pro aminopeptidases Proteins 0.000 description 1
- 241000589634 Xanthomonas Species 0.000 description 1
- 241000235013 Yarrowia Species 0.000 description 1
- 241000588901 Zymomonas Species 0.000 description 1
- RQFCJASXJCIDSX-YYJQJZIPSA-N [(2r,3s,4r,5r)-5-(2-azanyl-6-oxo-3h-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methyl dihydrogen phosphate Chemical compound C1=2[15NH]C([15NH2])=[15N]C(=O)C=2[15N]=C[15N]1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@H]1O RQFCJASXJCIDSX-YYJQJZIPSA-N 0.000 description 1
- LSJIZCGOXSEZNF-UHFFFAOYSA-N [2-[(2-amino-6-oxo-3h-purin-9-yl)methoxy]-3-hydroxypropyl] dihydrogen phosphate Chemical compound N1C(N)=NC(=O)C2=C1N(COC(CO)COP(O)(O)=O)C=N2 LSJIZCGOXSEZNF-UHFFFAOYSA-N 0.000 description 1
- 239000008351 acetate buffer Substances 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 239000008186 active pharmaceutical agent Substances 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- 229950006790 adenosine phosphate Drugs 0.000 description 1
- 150000003838 adenosines Chemical class 0.000 description 1
- 238000013019 agitation Methods 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- LFVGISIMTYGQHF-UHFFFAOYSA-N ammonium dihydrogen phosphate Chemical compound [NH4+].OP(O)([O-])=O LFVGISIMTYGQHF-UHFFFAOYSA-N 0.000 description 1
- 239000000908 ammonium hydroxide Substances 0.000 description 1
- 235000011114 ammonium hydroxide Nutrition 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 230000003698 anagen phase Effects 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 101150050411 appA gene Proteins 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 239000012131 assay buffer Substances 0.000 description 1
- 235000003676 astacin Nutrition 0.000 description 1
- 238000010923 batch production Methods 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 230000001588 bifunctional effect Effects 0.000 description 1
- 230000008033 biological extinction Effects 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 230000001851 biosynthetic effect Effects 0.000 description 1
- OWMVSZAMULFTJU-UHFFFAOYSA-N bis-tris Chemical compound OCCN(CCO)C(CO)(CO)CO OWMVSZAMULFTJU-UHFFFAOYSA-N 0.000 description 1
- 108090001015 cancer procoagulant Proteins 0.000 description 1
- 229960003669 carbenicillin Drugs 0.000 description 1
- FPPNZSSZRUTDAP-UWFZAAFLSA-N carbenicillin Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)C(C(O)=O)C1=CC=CC=C1 FPPNZSSZRUTDAP-UWFZAAFLSA-N 0.000 description 1
- 230000001925 catabolic effect Effects 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 238000006555 catalytic reaction Methods 0.000 description 1
- 229920006317 cationic polymer Polymers 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 230000007248 cellular mechanism Effects 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 230000007073 chemical hydrolysis Effects 0.000 description 1
- 239000013000 chemical inhibitor Substances 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 108090001092 clostripain Proteins 0.000 description 1
- 239000005515 coenzyme Substances 0.000 description 1
- 229960003624 creatine Drugs 0.000 description 1
- 239000006046 creatine Substances 0.000 description 1
- UHDGCWIWMRVCDJ-ZAKLUEHWSA-N cytidine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-ZAKLUEHWSA-N 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical class NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 1
- 230000009849 deactivation Effects 0.000 description 1
- 230000000593 degrading effect Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 229940009976 deoxycholate Drugs 0.000 description 1
- 229960003964 deoxycholic acid Drugs 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000004807 desolvation Methods 0.000 description 1
- 239000000032 diagnostic agent Substances 0.000 description 1
- 229940039227 diagnostic agent Drugs 0.000 description 1
- MNNHAPBLZZVQHP-UHFFFAOYSA-N diammonium hydrogen phosphate Chemical compound [NH4+].[NH4+].OP([O-])([O-])=O MNNHAPBLZZVQHP-UHFFFAOYSA-N 0.000 description 1
- 229910000388 diammonium phosphate Inorganic materials 0.000 description 1
- 235000019838 diammonium phosphate Nutrition 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 229910000397 disodium phosphate Inorganic materials 0.000 description 1
- 235000019800 disodium phosphate Nutrition 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 238000000132 electrospray ionisation Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 230000009088 enzymatic function Effects 0.000 description 1
- 238000010799 enzyme reaction rate Methods 0.000 description 1
- 235000020774 essential nutrients Nutrition 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 108010052305 exodeoxyribonuclease III Proteins 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 239000012526 feed medium Substances 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 125000001207 fluorophenyl group Chemical group 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 230000030279 gene silencing Effects 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 238000002873 global sequence alignment Methods 0.000 description 1
- 108010092515 glycyl endopeptidase Proteins 0.000 description 1
- 229940005740 hexametaphosphate Drugs 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 238000001597 immobilized metal affinity chromatography Methods 0.000 description 1
- 238000000530 impalefection Methods 0.000 description 1
- 229910001410 inorganic ion Inorganic materials 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 229940039696 lactobacillus Drugs 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 238000004811 liquid chromatography Methods 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 101150035025 lysC gene Proteins 0.000 description 1
- 108010026228 mRNA guanylyltransferase Proteins 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- QWLHYYKDLOVBNV-UHFFFAOYSA-L magnesium orotate Chemical compound [Mg+2].[O-]C(=O)C1=CC(=O)NC(=O)N1.[O-]C(=O)C1=CC(=O)NC(=O)N1 QWLHYYKDLOVBNV-UHFFFAOYSA-L 0.000 description 1
- 229960000407 magnesium orotate Drugs 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 229940049920 malate Drugs 0.000 description 1
- BJEPYKJPYRNKOW-UHFFFAOYSA-N malic acid Chemical compound OC(=O)C(O)CC(O)=O BJEPYKJPYRNKOW-UHFFFAOYSA-N 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 108091070501 miRNA Proteins 0.000 description 1
- 239000002679 microRNA Substances 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 229910000402 monopotassium phosphate Inorganic materials 0.000 description 1
- 239000002091 nanocage Substances 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 108010028546 nucleoside-diphosphatase Proteins 0.000 description 1
- 108010067588 nucleotide pyrophosphatase Proteins 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- 229940099990 ogen Drugs 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 210000003463 organelle Anatomy 0.000 description 1
- 238000012261 overproduction Methods 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 230000008823 permeabilization Effects 0.000 description 1
- 229950007002 phosphocreatine Drugs 0.000 description 1
- 150000004713 phosphodiesters Chemical class 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 101150037544 pnp gene Proteins 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 230000000379 polymerizing effect Effects 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 108091081723 polyphosphate kinase 2 (PPK2) family Proteins 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 108010017378 prolyl aminopeptidase Proteins 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 108010043671 prostatic acid phosphatase Proteins 0.000 description 1
- 230000009145 protein modification Effects 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 230000003134 recirculating effect Effects 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 108010033826 ribosomal protein S1 Proteins 0.000 description 1
- 101150062601 rnr gene Proteins 0.000 description 1
- 101150064274 rnt gene Proteins 0.000 description 1
- 101150008822 rpsA gene Proteins 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 238000007423 screening assay Methods 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 238000010008 shearing Methods 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- AJPJDKMHJJGVTQ-UHFFFAOYSA-M sodium dihydrogen phosphate Chemical compound [Na+].OP(O)([O-])=O AJPJDKMHJJGVTQ-UHFFFAOYSA-M 0.000 description 1
- 239000011775 sodium fluoride Substances 0.000 description 1
- 235000013024 sodium fluoride Nutrition 0.000 description 1
- ZEDAGFBWUVYFQU-UHFFFAOYSA-M sodium;3-morpholin-4-ylpropane-1-sulfonate;hydrate Chemical compound [OH-].[Na+].OS(=O)(=O)CCCN1CCOCC1 ZEDAGFBWUVYFQU-UHFFFAOYSA-M 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 235000011149 sulphuric acid Nutrition 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 238000010257 thawing Methods 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- UNXRWKVEANCORM-UHFFFAOYSA-N triphosphoric acid Chemical compound OP(O)(=O)OP(O)(=O)OP(O)(O)=O UNXRWKVEANCORM-UHFFFAOYSA-N 0.000 description 1
- 229910000404 tripotassium phosphate Inorganic materials 0.000 description 1
- 235000019798 tripotassium phosphate Nutrition 0.000 description 1
- 229910000406 trisodium phosphate Inorganic materials 0.000 description 1
- 235000019801 trisodium phosphate Nutrition 0.000 description 1
- 239000012137 tryptone Substances 0.000 description 1
- 108010087967 type I signal peptidase Proteins 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- LSGOVYNHVSXFFJ-UHFFFAOYSA-N vanadate(3-) Chemical compound [O-][V]([O-])([O-])=O LSGOVYNHVSXFFJ-UHFFFAOYSA-N 0.000 description 1
- 231100000611 venom Toxicity 0.000 description 1
- 108010025739 venombin B Proteins 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 239000011592 zinc chloride Substances 0.000 description 1
- 235000005074 zinc chloride Nutrition 0.000 description 1
Abstract
Provided herein, in some aspects, are methods and compositions for cell-free production of ribonucleic acid.
Description
CELL-FREE PRODUCTION OF RIBONUCLEIC ACID RELATED APPLICATIONS This application claims the benefit under 35 U.S.C. § 119(e) of US. ional application number 62/319,220 filed April 6, 2016 and US. provisional application number 62/452,550 filed y 31, 2017, each of which is incorporated by reference herein in its entirety.
BACKGROUND OF THE INVENTION Ribonucleic acid (RNA) is ubiquitous to life. RNA acts as the key messenger of ation in cells, carrying the instructions from DNA for the regulation and synthesis of proteins. RNA is of interest in biotechnology as synthetically modulating mRNA levels in cells (positively through the introduction of mRNA or negatively through the introduction of siRNA or dsRNA) has applications in fields such as agricultural crop protection, anti-cancer eutics, and vaccines. RNA interference , for example, refers to a cellular mechanism that uses the DNA sequence of a gene to turn the gene "off’ — a process referred to as "silencing." In a wide variety of organisms, including animals, plants, and fungi, RNAi is triggered by double-stranded RNA (dsRNA). Functional single-stranded (e.g. mRNA) and double-stranded RNA molecules have been produced in living cells and in vitro using purified, recombinant enzymes and purified nucleotide triphosphates (see, e.g., European Patent No. 1631675 and US. Patent ation Publication No. 271559 A1, each of which is incorporated herein by reference). Nonetheless, the production ofRNA at scales enabling widespread commercial application is currently rohibitive.
SUMMARY OF THE INVENTION Provided herein are methods, compositions, cells, constructs, and systems for the production nthesis) of RNA. lly, polymeric RNA from a biomass material is tically depolymerized into its constituent monomers, these monomers are then phosphorylated to their cognate triphosphorylated variants (via a series of kinases) which are subsequently polymerized into a polymeric RNA using a corresponding nuclei acid (e.g., DNA) template.
In some embodiments, the methods, compositions, cells, constructs, and s of the present disclosure are used for the production ofRNA under cell-free conditions, for example, using at least one cell lysate, a combination of purified proteins, or a combination of cell lysate(s) and purified protein(s). The present disclosure is based, in some embodiments, on the conversion ofRNA from biomass (e.g., endogenous cellular RNA) to desired synthetic RNA (e.g., synthetic single-stranded or double-stranded RNA) using a cell lysate. First, RNA from biomass (e.g., endogenous RNA), such as messenger RNA (mRNA), transfer RNA (tRNA), and/or ribosomal RNA (rRNA) (e.g., present in a cell lysate) is merized into its monomeric form, 5'—nucleoside monophosphates (NMPs) by one or more nucleases e 1, reaction 1). Next, these nucleases, as well as native ses and atases, are inactivated or lly inactivated (e.g., via heat inactivation), and the NMPs are phosphorylated to ribonucleotide triphosphates (NTPs) by a series of thermostable kinase activities (Figure 1, reaction 2). Finally, the NTPs are rized by a RNA polymerase (e.g., thermostable RNA polymerase) to form a desired RNA, using a nucleic acid (e.g., DNA) template (Figure 1, reaction 3). The desired synthetic RNA ally may be purified from the cell lysate.
Thus, some aspects of the present disclosure provide cell-free methods of producing nthesizing) ribonucleic acid (RNA), the methods comprising: (a) incubating at least one cell lysate mixture that comprises (i) RNA and (ii) at least one enzymatic activity selected from the group consisting of enzymatic activities that depolymerize RNA, thermostable kinase activities, and thermostable RNA polymerase activities, under conditions that result in depolymerization ofRNA to produce a cell lysate mixture that comprises nucleoside osphates, (b) heating the cell lysate mixture produced in step (a) to a temperature (e.g., 50-80 0C) that inactivates or partially vates endogenous nucleases and phosphatases without completely inactivating the thermostable kinase activities and stable RNA polymerase activities, to produce a cell lysate mixture that comprises heat-inactivated nucleases and phosphatases, and (c) incubating the cell lysate mixture produced in step (b) in the presence of an energy source (e.g., an ATP regeneration system) and a deoxyribonucleic acid (DNA) template (e.g., ning a promoter operably linked to a nucleotide sequence encoding a RNA of interest), under conditions that result in production of nucleoside triphosphates and polymerization of the nucleoside triphosphates to produce a cell lysate mixture that comprises the RNA of interest.
The cell lysate mixture may comprise a single cell lysate obtained from cells that comprise RNA and express at least one enzyme (including at least one fusion enzyme) that acts as a clease, acts as a kinase, and/or acts as a RNA polymerase. Alternatively, the cell lysate e may comprise at least two (e.g., at least 3, 4, 5, or 6) cell s, wherein at least one cell lysate is ed from cells that comprise RNA, and at least one cell lysate (e.g., at least 2, 3, 4, or 5) is obtained from cells that s at least one enzyme that acts as a nuclease, acts as a , and/or acts as a RNA polymerase.
An enzyme or fusion enzyme is considered to "act as a nuclease" if the enzyme of fusion enzyme exhibits nuclease ty (cleaves or depolymerizes a nucleic acid, e.g., RNase R). An enzyme or fusion enzyme is considered to "act as a kinase" if the enzyme of fusion enzyme exhibits kinase activity (catalyzes the transfer of a phosphate group from one molecule to another molecule, e.g. polyphosphate kinase). An enzyme or fusion enzyme is considered to "act as a polymerase" if the enzyme of fusion enzyme exhibits polymerase activity (assembles nucleotides to produce nucleic acids, e.g., RNA polymerase).
In some embodiments, the RNA of step (a) is messenger RNA (mRNA), transfer RNA (tRNA), or ribosomal RNA (rRNA).
In some embodiments, the cell lysate e comprises at least one ribonuclease, at least one thermostable kinase, and/or at least one RNA polymerase (e.g., a thermostable RNA polymerase). The use of fusion enzymes is also encompassed by the present disclosure.
For example the cell lysate mixture may comprise a fusion of a ribonuclease and a kinase, or a fusion of le kinases. Other fusion enzymes are encompassed by the present sure.
Other aspects of the present disclosure provide engineered cells, cell s, and cell lysate mixtures comprising at least one nucleoside monophosphate kinase (e.g., stable nucleoside monophosphate kinase), at least one nucleoside phate kinase (e.g., thermostable nucleoside diphosphate kinase), and at least one polyphosphate kinase (e.g., stable polyphosphate kinase). The cells, in some ments, may also comprise at least one ribonuclease and/or at least one RNA polymerase (e.g., thermostable RNA polymerase).
In some embodiments, methods of producing nthesizing) RNA comprise (a) lysing cultured cells (e.g., engineered cells) that comprise RNA (e.g., mRNA, tRNA, and/or rRNA), RNase R, thermostable kinases (e.g., PnyrH, TthAdk, Tthka, Pmek, AaNdk, TePpk, and/or PPK2 (e.g., see Table 6), and a thermostable T7 RNA polymerase, y producing a cell lysate, (b) incubating the cell lysate produced in step (a) under conditions that result in depolymerization ofRNA to 5'—NMPs, thereby producing a cell lysate that comprises 5'—NMPs, (c) heating the cell lysate produced in step (b) to 60-80 0C to inactivate endogenous nucleases and phosphatases without completely inactivating the thermostable kinases and thermostable RNA polymerase, thereby producing a cell lysate that comprises heat-inactivated nucleases and phosphatases, and (d) incubating the cell lysate produced in step (c) in the presence of an energy source (e.g., an ATP regeneration system comprising polyphosphate) and an ered nucleic acid (e.g., DNA) template (e.g., containing a promoter ly linked to a nucleotide sequence encoding a RNA of interest), under conditions that result in production of nucleoside triphosphates and polymerization of the nucleoside triphosphates to produce the RNA of interest.
In some embodiments, the RNA, RNase R, thermostable kinases, and thermostable T7 RNA polymerase are contained in a single strain of cultured cells (e.g., engineered cells). In other embodiments, cultured cells (e.g., engineered cells) containing a subset of the above activities/components are lysed, and the lysates combined to generate a cell lysate mixture that ses all the enzymatic activities described in step (a) above. In some embodiments, tic activities, in the form of purified enzymes, are added to the lysates described in step (a) above. In some embodiments, lysates and/or purified proteins are ed before the heat-inactivation step described in step (c) above. In other ments, lysates and/or purified proteins are combined after the heat inactivation step described in step (c) above.
The RNA of st may be any form of RNA, including -stranded RNA and double-stranded RNA. For example, the RNA of interest may be messenger RNA (mRNA), antisense RNA, micro RNA, small interfering RNA (siRNA), or a short hairpin RNA (shRNA). Other RNA erence (RNAi) molecules are encompassed herein.
The s of l embodiments of the invention are set forth in the accompanying Figures and the Detailed Description. Other features, objects, and advantages of the invention will be apparent from the description and from the claims.
BRIEF DESCRIPTION OF THE DRAWINGS Figure 1 shows a schematic of cell-free RNA production as described herein.
Cells containing RNA from biomass (e.g., endogenous RNA), a nuclease, a thermostable kinase, and/or a thermostable RNA polymerase are lysed (or combined and lysed), and the ing cell lysate(s) is/are incubated under conditions that result in depolymerization of the RNA. The cell lysate is then heated to inactivate the nuclease and any endogenous phosphatases (without inactivating the thermostable kinase and thermostable RNA polymerase). The cell lysate is then ted in the presence of an engineered DNA template that encodes a RNA of interest, under conditions that result in production of nucleoside triphosphates and polymerization of the nucleoside triphosphates, thereby producing a RNA of interest (e.g., ssRNA or dsRNA). Alternatively, individual, purified pathway enzymes (e.g., RNA rase, such as thermostable RNA polymerase) may be added to the cell lysate following the heat inactivation step. Thus, in some instances, the engineered cells used to produce the cell lysate do not express one or more of the tic activities described above, e.g., a nuclease, a thermostable kinase and/or a thermostable RNA polymerase.
Figure 2A shows a schematic of a polyphosphate-dependent kinase y for energy generation. Figure 2B shows a schematic of additional exemplary energy conversion pathways for use in the methods and systems of the present disclosure. A UTVIP kinase (e.g., obtained from Pyrococcusfuriosus) and a polyphosphate kinase (e.g., obtained from Thermosynechococcus ius, Caldilinea aerophila, Deinococcus geothermalis, Meioihermus ruber, Meioihermus silvanus, Deinococcus geolhermalis, Anaerolinea phila, Chlorobaculum iepidum, Oceaniihermus profundus, Roseiflexus casienholzii, exus sp., or ra radiovcirix) may be used to convert UTVIP to UDP, and NDP kinases (e.g., encoded by an Aquifex aeolicus ndk gene) and a polyphosphate kinase may be used to convert UDP to UTP. A CMP kinase (e.g., obtained from Thermus ihermophilus) and a polyphosphate kinase may be used to convert CMP to CDP, and NDP kinases and a polyphosphate kinase may be used to convert CDP to CTP. A GMP kinase (e.g., obtained from Thermoioga maritima) and a polyphosphate kinase may be used to convert GMP to GDP, and NDP kinases and a polyphosphate kinase may be used to convert GDP to GTP. An AMP kinase (e.g., obtained from Thermus ihermophilus) and a polyphosphate kinase may be used to convert AMP to ADP, and NDP kinases (e.g., encoded by an Aquifex aeolicus ndk gene) and a polyphosphate kinase may be used to convert ADP to ATP. Alternatively, a Class III PPK2 enzyme (see, e.g., Table 6) may be used to convert AMP to ATP.
Figure 3A shows a schematic of an example of a DNA template used for the thesis of double-stranded RNA. The DNA template, encoded as part of a plasmid, contains a single coding region including of a promoter ly linked to the coding region of interest and one or more terrninators. Following transcription, the RNA folds into a hairpin ure through intramolecular nucleotide base pairing. The DNA template, either alone or encoded as part of a d, contains two complementary domains (1 and 3), separated by domain 2. Figure 3B shows a schematic of another example of a DNA template used for biosynthesis of double-stranded RNA. The DNA te contains ging promoter ces on complementary strands. RNA sequences transcribed from each template strand anneal after transcription. Figure 3C shows a schematic of another example of a DNA te used for biosynthesis of double-stranded RNA. The DNA template, encoded as part of a plasmid, contains converging promoter ces ly linked to coding s of interest on complementary s, as well as one or more terminator sequences to prevent read-through transcription. Figure 3D shows a schematic of another example of a DNA template used for thesis of double-stranded RNA. The DNA template, encoded as part of a plasmid, contains independent cassettes, each including of a er operably linked to the coding region of interest and one or more terminators, driving transcription of complementary sequences, which anneal after transcription. Figure 3E shows a schematic of another example of a DNA template used for biosynthesis of double-stranded RNA. DNA- dependent RNA polymerase is used to produce ssRNA template, and the RNA-dependent RNA rase is used to produce double-stranded RNA.
Figure 4 shows a schematic of another example of a cell-free RNA production method of the present disclosure. The process starts with a single tation vessel in which engineered cells are produced using standard fermentation techniques. Biomass generated from the fermentation is optionally concentrated by microflltration (MF) followed by lysis via mechanical homogenization, for e. The lysate is then pumped into a second fermentation vessel wherein the expressed nuclease enzymes convert RNA to its monomeric constituents. The entire reaction is heated to inactivate any endogenous phosphatase or se (e.g., RNase) activities as well as any other exogenous/introduced cellular (e.g., nuclease) activity that would be detrimental to RNA product stability and/or fidelity. Following heat inactivation, polyphosphate is fed to the reaction as a source of high- energy ate for the phosphorylation ofNMPs to NTPs via a series of thermostable kinases, followed by polymerization to dsRNA. Downstream processing may be used to increase purity to as much as 99% (e.g., 50%, 60%, 70%, 80%, 90%, 95%, 98%, or 99%) dsRNA by weight. For example, processing may be used to increase purity to 50-60%, 50- 70%, 50-80%, 50—90%, , 70-80%, 70—90%, or 70—95%. An examplary downstream process starts with the addition of a protein precipitating agent (e.g., ammonium acetate) followed by removal of protein, lipids and some DNA from the product stream by disc stack centrifugation (DSC) or tangential flow filtration (TFF). Ultraflltration is then implemented to remove salts and reduce volume. Addition of lithium chloride to the product stream leads to itation of the dsRNA product, is subsequently be separated from the bulk liquid using disc stack centrifugation, ng an 80% purity dsRNA product stream. Further tographic polishing yields a 99% pure product (Nilsen, TW. Cold Spring Harb Protoc. 2012 Dec l,2012(12)).
Figures 5A-5B show a ison of ribonuclease activities by digestion of purified E. coli RNA. (Figure 5A) Release of acid-soluble nucleotides (mononucleotides and short oligonucleotides) with nuclease ent was most rapid with Benzonase, RNase A, RNase R, and Nuclease Pl. (Figure 5B) LC-MS analysis of reaction products demonstrated NMP release from RNA with RNase R and Nuclease Pl ent.
Figure 6 is a graph showing depolymerization of lysate RNA using exogenous RNase R, with products analyzed by UPLC to specifically identify 5'—NMPs. In the absence of RNase R, lysates exhibited endogenous RNase activity that led to the slow accumulation of 5'—NMPs (solid dark gray line). on of ous RNase R led to rapid 5'—NMP release (dashed dark gray line) without ing rates of 2’ or 3’ NMP accumulation (light gray lines). Thus, overexpression of RNase R accelerates the rate of polymeric RNA to 5'- NMP conversion, reducing the deleterious effects of phosphatase/nuclease activities present in the extract. Experiments were performed at a final concentration of 50% lysate.
Figures 7A-7C show results of RNase R overexpression in IL bioreactors cultures grown in batch phase. (Figure 7A) GE analysis of protein expression in duplicate cultures. Empty vector cultures contained an empty protein expression vector (pETDuet-l).
RNase R cultures contained E. coli rnr cloned into t-l. Samples from d cultures (+) exhibited strong expression of RNase R (MW 92.9 kDa with C-terminal hexahistidine tag) ted by arrow at right. (Figure 73) Growth kinetics (encompassing pre- and post-induction growth) of Empty Vector (dark gray) and RNase R-expressing strains (light gray) demonstrated that RNase R pression was not deleterious to cell growth.
Dashed lines represent exponential curve fits. (Figure 7C) Overexpressed RNase R was active in lysates of batch-grown biomass, releasing acid-soluble nucleotides. In the empty vector strain (solid dark gray line), adding exogenous RNase R increased the rate of nucleotide release (dashed dark gray line). In contrast, strains expressing RNase R exhibited rapid nucleotide release upon lysis (solid light gray line). Adding exogenous RNase R did not increase rates of nucleotide release or final nucleotide yields (dashed light gray line).
Experiments were performed at a final concentration of 50% lysate.
Figure 8 is a graph bing the effects of chelating Mg2+ on depolymerization rates in high-density lysates. Lysates prepared from biomass ning Empty Vector (dark gray) were itive to EDTA. Lysates with overexpressed RNase R (light gray) exhibited rapid RNA depolymerization with Mg2+ removal, with 8 mM EDTA providing maximum depolymerization rates. Experiments were performed at a final concentration of 90% lysate.
Figures 9A-9D show graphs demonstrating stability of exogenous ically- labeled "heavy" NMPs (hNMPs) in lysates: (Figure 9A) hAMP was relatively stable in lysates, with 90% remaining after a 1 hour incubation at 37 0C. (Figure QB) hCMP was degraded in lysates, with 70% remaining after approximately 30 s. Addition of 10 mM sodium orthovanadate (dotted line) (an inhibitor of several phosphatases and kinases) significantly improved stability. (Figure 9C) hIflVlP was degraded in lysates, with 70% remaining after imately 20 minutes. Sodium phosphate (150 mM) (dashed line) and sodium orthovanadate (dotted line) significantly improved stability. e 9D) hGMP was degraded in lysates, with 70% remaining after approximately 10 minutes. Sodium orthovanadate significantly improved stability, with 70% hGMP remaining after 30 minutes.
Figure 10 is a graph demonstrating the effect of heat inactivation on the stability of exogenous NTPs in lysates. Lysates were pre-incubated at 70 0C before the temperature was d to 37 oC and an equimolar mixture ofNTPs (ATP, CTP, UTP, and GTP) was added. Pre-incubation times are listed in the legend at right. Control lysates (not subject to heat inactivation) rapidly ed NTPs (T=0 min). Increasing pre-incubation time stabilized NTPs, with 15 minutes at 70 CC eliminating NTPase activity (T=15 min).
Figures B are graphs demonstrating the effect of heat inactivation on the stability ofNMPs and dsRNA in lysates. e 11A) Heat inactivation stabilized NMPs in lysates. Lysates were treated with exogenous RNase R (Lysate + RNase R) (t = 0 min — 5 min) at 37 0C to e NMPs, then heat inactivated (t = 5 min to 25 min) at 70°C. The temperature was then d to 37 oC and the reaction was incubated for an additional 60 min. NMPs were largely stable in lysates after heat inactivation. (Figure IIB) Heat inactivation stabilized nts and products of transcription reactions in lysates. Lysates were pre-incubated for 15 minutes at the ted temperature, then the temperature was lowered to 37 oC and transcription reactants were added. Heat inactivation at 70 oC and 80 0C, but not 60 oC ized substrates and products sufficiently to produce a detectable transcription product similar to the positive control (no lysate).
Figure 12 is a graph demonstrating temperature-dependent activity ofWP kinase from P. us (PnyrH), quantified by luciferase assay for ATP consumption. The specific activity of purified PnyrH was largely insensitive to incubation temperature.
Figure 13 is a graph trating temperature-dependent activity of AMP kinase from T lhermophilus (TthAdk) compared to Adk from E. coli (EcAdk), measured via luciferase. Purified EcAdk was active at temperatures below 60 oC. TthAdk had higher specific activity, with a maximum at 70 oC.
Figure 14 is a graph demonstrating ature-dependent activity of CMP kinase from T ihermophilus (Tthka), measured via luciferase. Purified Tthka was relatively insensitive to temperature, with high activity from 37-80°C.
Figure 15 is a graph trating temperature-dependent activity of GMP kinases from E. coli , T lhermophilus (Ttthk), and T. maritima (Tmek), measured via luciferase. Purified Echk (dark gray) was more active at lower temperatures, while Ttthk (light gray) and Tmek (medium gray) were most active at 70°C.
Figure 16 is a graph of data demonstrating activity of purified NDP kinase from A. aeolicus (AaNdk), measured via luciferase. Purified AaNdk was highly active from 37- 80°C, using ATP and GDP as substrates, with optimal activity at 50°C.
Figure 17 is a graph demonstrating activity of d polyphosphate kinase 1 (PPKl) enzymes from E. coli (Echk), Thermosynechococcus elongatus (TePpk), and Thermus ihermophilus (Ttthk) measured via luciferase. Echk was most active at temperatures 360°C, while TePpk was optimally active at 70°C. Ttthk exhibited relatively low activity.
Figure 18 is a graph demonstrating activity of commercially-available T7 RNA polymerases in buffer using conditions recommended by their respective manufacturers at 37°C. ThermoT7 and ript polymerases exhibited higher specific activity than the NEB polymerase under the tested conditions with duplex DNA template (e.g. in Figure 3B).
Figure 19 is a graph comparing T7 RNA polymerase activities in dilute lysates at 37°C and 50°C under rdized reaction conditions with duplex DNA template. At 37°C, ThermoT7 exhibited the highest c activity. At 50°C, only ThermoT7 had detectable ty, producing over 10 g/L/hr dsRNA.
Figure 20 is a graph demonstrating activity of ThermoT7 activities in buffer and high-density heat-inactivated lysates. ThermoT7 activity was t in s clarified by centrifugation after heat-inactivation. Omitting the clarification step led to a 60% decrease in activity, although polymerase activity in unclarified matrix was r than in buffer alone.
Figure 21 is a graph demonstrating tolerance of ThermoT7 to elevated atures. Pre-incubating ThermoT7 at 50°C had no effect on subsequent polymerase activity assayed at 37°C. Pre-incubating at 60°C and 70°C led to rapid, irreversible inhibition of enzyme function.
Figure 22A is an image of an SDS—PAGE gel showing expression and solubility data for A. ihermophila PPK2 in E. coli strain GLl6-l70. MW: Unstained Protein Standard, Broad Range (New England Biolabs Cat # P7704). -: Pre-induction culture. +: Induced culture at harvest. L: Soluble protein in clarified lysates. A. ihermophila PPK2: 33 kDa.
Figure 223 is a graph showing ATP production ofA. lhermophila PPK2 in heat-inactivated lysates. Closed circles denote ATP production from ADP. Open circles denote ATP production from AMP. For both substrates, A. ihermophila PPK2 produces ATP at rates exceeding 400 mM/hr.
Figure 23 is an image of an agarose gel demonstrating application of thermostable Class III PPK2 for energy generation in cell-free dsRNA production. Left lanes contain positive controls, trating dsRNA synthesis from NTPs. Middle lanes contain positive controls, demonstrating dsRNA synthesis from NMPs in nucleotide kinase-expressing lysates using exogenous ATP as an energy source. Right lanes contain ons demonstrating dsRNA synthesis from NMPs and HMP using nucleotide kinase and C. aerophila Ppk- expressing lysates. In each case, cell-free RNA synthesis ons are Mn2+ independent.
Reactions without polymerase are included as ve ls, illustrating background c acid content of each lysate-containing reaction.
Figure 24 is an image of an agarose gel demonstrating application of thermostable Class III PPK2 for energy tion in ree dsRNA production. Left lanes contain positive controls, demonstrating dsRNA synthesis from NTPs. Middle lanes contain positive controls, demonstrating dsRNA synthesis from NMPs in nucleotide kinase-expressing lysates using exogenous ATP as an energy source. Right lanes n reactions demonstrating dsRNA synthesis from NMPs and HMP using tide kinase and C. aerophila Ppk- expressing lysates. With C. aerophila PPK2, dsRNA synthesis proceeds in the absence of AMP kinase and exogenous ADP.
DETAILED DESCRIPTION OF CERTAIN EMBODHVIENTS OF THE INVENTION Provided herein, in some aspects, are methods, compositions, cells, constructs, and systems for the cell-free production (biosynthesis) of nucleic acid (e.g., RNA or DNA).
In some embodiments, a single type of organism (e.g., a population of bacterial cells) is engineered to express at least one nuclease, at least one thermostable s and at least one thermostable polymerase (e.g., RNA or DNA polymerase). The engineered cells are grown (cultured) under conditions that result in enzyme expression. In some embodiments, the engineered cells may be grown to a desired cell density, and then sion of certain enzymes may be induced (activated). Thus, transcription of certain enzymes may be under the control of an inducible promoter. The cells (e.g., engineered and/or non-engineered cells) are then lysed (e.g., mechanically, chemically, or enzymatically ted) to produce a cell lysate that comprises the enzymatic activities required for cell-free production ofRNA (e.g., ssRNA or dsRNA). In some embodiments, cells containing polymeric RNA (e.g., mRNA, tRNA, and/or rRNA) are mixed with the ered cells containing pathway enzymes prior to the cell lysis step. In other embodiments, cell lysate(s) obtained from cells containing polymeric RNA is combined (mixed) with cell lysate(s) obtained from engineered cells containing y enzymes. In yet other embodiments, one or more purified pathway enzymes are combined (mixed) with cell lysate(s) obtained from ered cells. "Pathway enzymes" are enzymes required to biosynthesize the RNA of interest (e.g., starting from ric RNA).
To synthesize RNA, the cell lysate (or cell lysate mixture) is incubated under conditions that result in nuclease-mediated (e.g., RNase-mediated) depolymerization of the host-derived (endogenous) RNA to a desired yield of 5'—nucleoside monophoshates (NMPs, or nucleoside monophosphates). The cell lysate (or cell lysate mixture) is then heated, in some embodiments, to inactivate the ty of host-derived enzymes, including phosphatases and nucleases (e.g., RNases), as well as any ous nuclease(s) previously added to the cell lysate to facilitate depolymerization of the host-derived RNA. Following the heat inactivation step, the cell lysate is incubated under conditions that result in phosphorylation of the NMPs to NTPs (nucleoside triphosphates) by thermostable kinases (e. g., thermostable nucleoside monophosphate kinases and nucleoside diphosphate kinases) using, for example, thermostable polyphosphate kinase and the addition of polyphosphate as the energy source. The ing NTPs are subsequently polymerized to RNA by a RNA polymerase (e.g., thermostable RNA polymerase) using an engineered template (e.g., DNA template) present in the s (e.g., either expressed by the ered cells and included as a cellular component of the cell lysate, or later added to the cell lysate).
Cell-Free Production "Cell-free tion" is the use of biological processes for the synthesis of a biomolecule or chemical compound without using living cells. The cells are lysed and unpurified (crude) portions or partially-purified portions, both containing s, are used for the production of a desired product. d s may be added to cell lysates, in some embodiments. As an example, cells are cultured, ted, and lysed by high-pressure homogenization or other cell lysis method (e.g., al cell lysis). The cell-free reaction may be conducted in a batch or fed-batch mode. In some instances, the tic pathways fill the working volume of the reactor and may be more dilute than the intracellular environment. Yet substantially all of the cellular catalysts are provided, including catalysts that are membrane associated. The inner membrane is fragmented during cell lysis, and the fragments of these membranes may form membrane es. See, e.g., Swartz, AIChE Journal, 2012, 58(1), 5-13, incorporated herein by reference.
Cell-free s, compositions, and systems of the present disclosure utilize cell lysates (e.g., crude or lly purified cell lysates), sed in greater detail herein. Cell lysates prepared, for example, by mechanical means (e.g., shearing or crushing), are distinct from chemically-permeabilized cells. As discussed above, in some embodiments, during cell lysis (e.g., ical cell lysis), the inner cell membrane is fragmented such that ed membrane vesicles are formed in the cell lysates. Such inverted membrane vesicles are not produced through chemical cell permeabilization methods. Cells that are lysed (e.g., at least 75%, 80%, 85%, 90%, or 95%) are no longer . Thus, permeabilized cells, which are intact cells containing perforations (small holes) are not considered lysed cells.
While the methods provided herein are generally cell-free and use cell s, in some ments, it may be advantageous, at least for some steps of the methods, to use permeabilized cells. Thus, the present disclosure does not exclude the use of permeabilized cells in at least one step of the RNA production methods.
It should be understood that while many of the embodiments described herein refer to "lysing cultured cells" that comprise particular enzymes, the phrase is intended to encompass lysing a clonal population of cells obtained from a single culture (e.g., containing all the enzymes needed to synthesize RNA) as well as lysing more than one clonal population of cells, each obtained from different cell cultures (e.g., each containing one or more enzymes needed to synthesize RNA and/or the polymeric RNA substrate). For example, in some embodiments, a population of cells (e.g., engineered cells) expressing one thermostable kinase may be cultured er and used to produce one cell lysate, and r population of cells (e.g., engineered cells) expressing a different thermostable kinase may be cultured together and used to produce another cell lysate. These two cell lysates, each sing a different thermostable kinase, may then be combined for use in a RNA biosynthesis method of the present disclosure.
Depolymerizalion ofRibonucleic Acid l0 Nucleoside Monophosphales The present disclosure is based on the sion ofRNA from biomass (e.g., endogenous cellular RNA) to desired synthetic RNA using a cell lysate through a cell-free process ing a series of enzymatic reactions. First, RNA (e.g., endogenous RNA) present in a cell lysate, derived from host cells, is converted to its constituent monomers by nucleases. RNA from biomass (e.g., nous RNA) lly includes ribosomal RNA (rRNA), messenger RNA (mRNA), er RNA (tRNA), other RNAs, or a combination thereof. Depolymerization or degradation ofRNA results in a pool of 5'—nucleoside monophosphates (5'—NMPs), also referred to simply as ers." These monomers, which are converted to nucleoside diphosphates, which are converted to nucleoside triphosphates, are used as starting material for the downstream polymerization/synthesis of a RNA of interest. In some ments, the RNA of interest is ssRNA (e.g., mRNA). In some ments, the RNA of interest is dsRNA.
The amount ofRNA (e.g., endogenous RNA) required to size a RNA of interest may vary, depending on, for example, the d length and yield of the RNA of interest as well as the nucleotide composition of the RNA relative to the nucleotide composition of the RNA (e.g., endogenous RNA) of the cell (e.g., E. coli cell). Typically, for a bacterial cell, for example, RNA (e.g., endogenous RNA) content ranges from 5-50% of the total cell mass. The mass of the starting material can be calculated, for example, using the following equation: (kilogram (kg) of RNA/kilogram of dry cell weight) x 100%.
Endogenous RNA may be depolymerized or degraded into its constituent monomers by chemical or enzymatic means. Chemical hydrolysis of RNA, however, typically produces 2'- and 3'—NMPs, which cannot be polymerized into RNA. Thus, the methods, compositions, and systems as provided herein primarily use enzymes for the depolymerization of endogenous RNA. An "enzyme that depolymerizes RNA" catalyzes the hydrolysis of the phosphodiester bonds between two nucleotides in a RNA. Thus, "an enzyme that depolymerizes RNA" converts RNA (polymeric RNA) into its monomeric form—nucleoside monophosphates (NMPs). Depending on the enzyme, tic depolymerization ofRNA may yield 3'—NMPs, 5'—NMPs or a combination of 3'—NMPs and 5'- NMPs. Because it is not possible to polymerize 3'—NTPs rted from 3'—NDPs, which are converted from 3'—NMPs), enzymes (e.g., RNase R) that yield 5'—NMPs (which are then converted to 5'—NDPs, and then 5'—NTPs) are preferred. In some embodiments, s that yield 3'—NMPs are removed from the genomic DNA of the engineered cell to increase efficiency ofRNA tion. In some embodiments, the enzyme used for RNA depolymerization is RNase R. In some embodiments, the tration of RNase R used is 01-10 mg/mL (e.g., 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9. or 1.0 mg/mL). In some embodiments, the concentration of RNase R used is 04-06 mg/mL. In some ments, the concentration of RNase R used is 0.5 mg/mL. In some embodiments, the concentration of RNase R used is greater than 1.0 mg/mL.
Examples of enzymes that depolymerize RNA include, without limitation, nucleases, including ribonucleases (RNases, e.g., RNase R) and phosphodiesterases.
Nucleases catalyze the degradation of nucleic acid into smaller components (e.g., monomers, also referred to as nucleoside monophosphates, or oligonucleotides). Phosphodiesterases catalyze degradation of phosphodiester bonds. These s that depolymerize RNA may be encoded by full length genes or by gene fusions (e.g., DNA that includes at least two different genes (or fragments of genes) encoding at two different enzymatic activities).
RNase functions in cells to regulate RNA maturation and turn over. Each RNase has a specific substrate preferences—dsRNA or ssRNA. Thus, in some embodiments, a ation of different RNases, or a combination of different nucleases, generally, may be used to depolymerize biomass-derived polymeric RNA (e.g., endogenous RNA). For example, 1-2, 1-3, 1-4, 1-5, 1-6, 1-7, 1-8, 1-9, or 1-10 different ses may be used in combination to depolymerize RNA. In some embodiments, at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10 ent nucleases may be used in combination to merize RNA. miting examples of nucleases for use as ed herein are included in Table 1. In some embodiments, the nuclease used is RNase R.
Table I. Enzymes that Depolymerize cleic Acid Nuclease Host Or_anism s EC # Nuclease Penicillium cilrum P24289 1, 2, 3 P1 (P1 Nuclease) RNaseII Escherichia coli 3.1.13.1 P30850 RNase III Escherichia coli 3.1.26.3 POA7YO —--Escherichiacoli P21499 RNase JI Bacillus subtilis 3.1.4.1 RNase T Escherichia coli 3.1.27.3 P30014 15, 16, 17 RNase E ichia coli 3.1.26.12 P21513 18, 19 Enzymes that depolymerize RNA (e.g., RNases) may be endogenous to a host cell (host-derived), or they may be encoded by engineered nucleic acids exogenously introduced into a host cell (e.g., on an al vector or integrated into the genome of the host cell).
In some embodiments, engineered nucleic acids encoding enzymes that depolymerize RNA are operably linked to an inducible er. Thus, in some embodiments, expression of an engineered nucleic acid encoding an enzyme that depolymerizes RNA is temporally or spatially regulated. For example, nucleic acids may be engineered to encode enzymes (e.g., RNases) that are relocated to or are sequestered in the periplasm of a host cell so that activity of the enzyme does not interfere with cell growth or other metabolic processes. Upon cell lysis, the relocated enzyme is released from the periplasm, brought into contact with the endogenous RNA, and depolymerizes the RNA into monomeric form. See, e.g., International Publication No. WO 201 1/140516, published November 10, 2011, incorporated herein by reference.
"Conditions that result in depolymerization of RNA" are known in the art or may be determined by one of ordinary skill in the art, taking into consideration, for example, optimal conditions for nuclease (e.g., RNase) ty, including pH, temperature, length of time, and salt concentration of the cell lysate as well as any exogenous cofactors. Examples including those described previously (see, e.g., Wong, C.H. et al. J. Am. Chem. Soc, 105: 7, 1983), EP1587947B1, Cheng ZF, Deutscher MP. .1370] Chem. 624—21629, 2002) In some embodiments, metal ions (e.g., Mg2+) are depleted from the depolymerization reaction. In some ments, the concentration of metal ion (e.g., Mg2+) is 8 mM or less (e.g., less than 8 mM, less than 7 mM, less than 6 mM, less than 5 mM, less than 4 mM, less than 3 mM, less than 2 mM, less than 1 mM, less than 0.5 mM). In some embodiments, the concentration of metal ion (e.g., Mg2+) is 0.1 mM-8 mM, 0.1 mM-7 mM, or 0.1 mM-5 mM.
The pH of a cell lysate during a RNA depolymerization reaction may have a value of3.0 to 8.0. In some embodiments, the pH value ofa cell lysate is 3.0-8.0, 4.0-8.0, 5.0-8.0, 0, 7.0-8.0, 3.0—7.0, 4.0—7.0, 5.0—7.0, 6.0-7.0, 0, 4.0-6.0, 5.0-6.0, 3.0—5.0, 3.0—4.0, or 4.0-5.0. In some embodiments, the pH value ofa cell lysate is 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, or 8.0. In some embodiments, the pH value ofa cell lysate is 7.0, 7.1, 7.2, 7.3, 7.4, or 7.5. The pH of a cell lysate may be adjusted, as needed.
The ature of a cell lysate during a RNA depolymerization on may be oC to70 0C. In some embodiments, the temperature of a cell lysate during a RNA merization reaction is 15-60 c’C, 15-50 c’C, 15-40 c’C, 15-30 c’C, 25-70 c’C, 25-60 c’C, -50 0C, 25-40 0C, 30-70 0C, 30-60 0C, or 30-50 0C. In some embodiments, the temperature of a cell lysate during a RNA depolymerization reaction is 37 0C. In some embodiments, the temperature of a cell lysate during a RNA depolymerization reaction is 15 0C, 25 0C, 32 0C, 37 0C, 40 0C, 42 0C, 45 0C, 50 0C, 55 0C, 56 0C, 57 0C, 58 0C, 59 0C, 60 0C, 61 0C, 62 0C, 63 0C, 64 0C, 65 0C, 66 0C, 67 0C, 68 0C, 69 0C, or 70 0C.
WO 76963 A cell lysate during a RNA depolymerization reaction may be incubated for 5 minutes (min) to 72 hours (hrs). In some embodiments, a cell lysate during a RNA depolymerization reaction is incubated for 5-10 min, 5-15 min, 5-20 min, 5-30 min, or 5 min- 48 hrs. For example, a cell lysate during a RNA depolymerization reaction may be incubated for 5 min, 10 min, 15 min, 20 min, 25 min, 30 min, 45 min, 1 hr, 2 hrs, 3 hrs, 4 hrs, 5 hrs, 6 hrs, 7 hrs, 8 hrs, 9 hrs, 10 hrs, 11 hrs, 12 hrs, 18 hrs, 24 hrs, 30 hrs, 36 hrs, 42 hours, or 48 hours. In some embodiments, a cell lysate during a RNA depolymerization reaction is incubated for 24 hours at a temperature of 37 0C. In some embodiments, a cell lysate during a RNA depolymerization reaction is incubated for 5-10 min at a temperature of 37 0C. In some embodiments, a cell lysate during a RNA merization reaction has a pH of 7.0 and is incubated for 15 minutes at a temperature of 37 0C. In some embodiments, a cell lysate during a RNA depolymerization reaction may be incubated under conditions that result in r than 65% conversion ofRNA to 5'—NMPs. In some ments, RNA is converted to 5'—NMPs at a rate of (or at least) 50 mM/hr, 100 mM/hr or 200 mM/hr.
In some embodiments, salt is added to a cell lysate, for example, to prevent enzyme aggregation. For example, sodium chloride, potassium de, sodium e, potassium acetate, or a combination thereof, may be added to a cell lysate. The concentration of salt in a cell lysate during a RNA merization on may be 5 mM to 1 M. In some embodiments, the concentration of salt in a cell lysate during a RNA depolymerization reaction 5 mM, 10 mM, 15 mM, 20 mM, 25 mM, 50 mM, 100 mM, 150 mM, 200 mM, 250 mM, 500 mM, 750 mM, or 1 M. In some embodiments, the cell lysate comprises a e that includes 40-60 mM potassium phosphate, 1-5 mM MnClz, and/or 10-50 mM MgClz (e.g., mM MgClz).
In some embodiments, buffer is added to a cell lysate, for example, to achieve a particular pH value and/or salt concentration. Examples of buffers include, without limitation, phosphate buffer, Tris buffer, MOPS buffer, HEPES buffer, citrate buffer, acetate buffer, malate buffer, MES buffer, histidine buffer, PIPES buffer, bis-tris buffer, and ethanolamine buffer.
Depolymerization ofRNA s in the production of 5'-NMP, including 5'-AMP, /IP, 5'-CMP, and 5'-GMP. While the NMP may be t in the cell lysate at relatively equimolar amounts, depolymerization ofRNA does not result in any predetermined ratio of NMPs.
In some embodiments, 50-98% of the endogenous RNA in a cell upon lysis is converted to (depolymerized to) 5'-N1\/1Ps. For example, 50-95%, 50-90%, 50-85%, 50-80%, 75-98%, 75-95%, 75-90%, 75-85% or 75-80% RNA is converted to (depolymerized to) 5'- NMPs. In some ments, 65-70% of the endogenous RNA in a cell upon lysis is converted to ymerized to) 5'—NMPs. Lower yields are also acceptable.
Elimination ofFutile Cycles Following sion of RNA from biomass (e.g., nous RNA) to its monomeric constituents by endogenous and/or exogenous nucleases, there typically remains in the cell lysate l enzymes, including nucleases and phosphatases, which may have deleterious effects on RNA biosynthesis. For example, Escherichia coli has numerous phosphatases, many of which dephosphorylate NTPs, NDPs, and NMPs. Dephosphorylation ofNMPs following RNA depolymerization results in the accumulation of the non- phosphorylated nucleosides and a loss of usable NMP substrate, thus ng synthetic RNA yield. Dephosphorylation ofNMPs, NDPs, or NTPs following RNA depolymerization results in futile energy cycles (energy cycles that e a low yield of synthetic RNA) during which NMPs are phosphorylated to NDPs and NTPs, which in turn are dephosphorylated back to their NMP or nucleoside starting point. Futile cycles reduce the yield ofRNA product per unit energy input (e.g., polyphosphate, ATP, or other s of high energy phosphate). In some embodiments, the enzymatic activities are eliminated by removal from the host genome. In some embodiments, the enzymatic activities are ated by heat inactivation. In some embodiments, the enzymatic activities are eliminated by protease ing. In some embodiments the enzymatic activities are eliminated h the use of chemical inhibitors. A combination of any of the foregoing approaches may also be used.
Enzymes deleterious to the biosynthesis of RNA, as provided herein, may be deleted from the host cell genome during the process of engineering the host cell, provided the enzymes are not essential for host cell (e.g., bacterial cell) survival and/or growth.
Deletion of enzymes or enzyme activities may be achieved, for example, by deleting or modifying in the host cell genome a gene encoding the essential enzyme. An enzyme is "essential for host cell survival" if the enzyme is ary for the survival of the host cell.
That is, if a host cell cannot survive without expression and/or activity of a particular enzyme, then that enzyme is considered essential for host cell survival. Similarly, an enzyme is "essential for host cell growth" if the enzyme is necessary for the growth of the host cell.
That is, if a host cell cannot divide and/or grow without expression and/or ty of a particular enzyme, then that enzyme is considered essential for host cell growth.
If enzymes deleterious to the biosynthesis ofRNA are essential for host cell survival and/or growth, then it may not be possible to delete or modify the genes encoding the enzymes. In such instances, the enzymes may be heat inactivated. "Heat inactivation" refers to the process of heating a cell lysate to a temperature sufficient to inactivate (or at least partially inactivate) endogenous nucleases and phosphatases. Generally, the s of heat inactivation involves denaturation of (unfolding of) the deleterious enzyme. The temperature at which endogenous cellular proteins denature varies among organisms. In E. cab, for example, endogenous cellular enzymes generally denature at temperatures above 41 oC. The denaturation temperature may be higher or lower than 41 0C for other sms.
Enzymes of a cell lysate, as provide here, may be heat inactivated at a temperature of 40 0C- 95 0C, or higher. In some embodiments, enzymes of a cell lysate may be heat inactivated at a temperature of 40—90 0C, 40-80 0C, 40—70 0C, 40-60 0C, 40—50 0C, 50-80 0C, 50—70 0C, 50-60 0C, 60-80 0C, 60-70 0C, or 70-80 0C. For example, enzymes ofa cell lysate may be heat inactivated at a temperature of 40 0C, 42 0C, 45 0C, 50 0C, 55 0C, 60 0C, 65 0C, 70 0C, 75 0C, 80 0C, 85 0C, 90 0C, or 95 0C. In some embodiments, enzymes ofa cell lysate may be heat inactivated at a temperature of 50-80 0C. In some ments, enzymes of a cell lysate may be heat inactivated at a temperature of 70 0C. In some embodiments, s of a cell lysate may be heat inactivated at a temperature of 60 0C. It may also be possible to introduce al inhibitors of deleterious enzymes. Such inhibitors may include, but are not limited to, sodium orthovanadate (inhibitor of n phosphotyrosyl phosphatases), sodium fluoride (inhibitor of phosphoseryl and phosphothreonyl phosphatases), sodium osphate (phosphatase inhibitor), sodium phosphate, and/or potassium phosphate.
The period of time during which a cell lysate is incubated at elevated temperatures to achieve heat inactivation of endogenous enzymes may vary, depending, for e, on the volume of the cell lysate and the organism from which the cell lysate was prepared. In some embodiments, a cell lysate is incubated at a temperature of 35 0C-80 0C for 2 minutes (min) to 48 hours (hr). For example, a cell lysate may be incubated at a temperature of 35 c’C-8O CC for 2 min, 4 min, 5 min, 10 min, 15 min, 30 min, 45 min, or 1 hr. In some embodiments, a cell lysate is incubated at a temperature of35 OC-8O 0C for 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 24, 36, 42, or 48 hr.
In some ments, enzymes are heat inactivated at a temperature of 60-80 0C for 10-20 min. In some embodiments, enzymes are heat inactivated at a temperature of 70 0C for 15 min.
In some embodiments, enzymes that depolymerize endogenous RNA comprise one or more modifications (e.g., mutations) that render the enzymes more sensitive to heat.
These enzymes are referred to as "heat-sensitive enzymes." Heat-sensitive enzymes re and become inactivated at temperatures lower than that of their wild-type rparts, and/or the period of time required to reduce the activity of the heat-sensitive enzymes is shorter than that of their wild-type counterparts.
It should be understood that enzymes that are heat inactivated may, in some instances, retain some degree of activity. For example, the activity level of a heat-inactivated enzyme may be less than 50% of the activity level of the same enzyme that has not been heat inactivated. In some embodiments, the ty level of a heat-inactivated enzyme is less than 40%, less than 30%, less than 20%, less than 10%, less than 5%, less than 1%, or less than 0. l% of the activity level of the same enzyme that has not been heat inactivated.
Thus, an enzyme’s activity may be completely eliminated or reduced. An enzyme is considered completely inactive if the denatured (heat inactivated) form of the enzyme no longer catalyzes a reaction zed by the enzyme in its native form. A heat-inactivated, denatured enzyme is ered "inactivated" when activity of the heat-inactivated enzyme is reduced by at least 50% relative to activity of the enzyme that is not heated (e.g., in its native environment). In some embodiments, activity of a heat-inactivated enzyme is reduced by 50- 100% relative to the activity of the enzyme that is not . For example, activity of a heat- inactivated enzyme is reduced by 50-90%, 50-85%, 50-80%, 50-75%, 50-70%, 50-65%, 50- 60%, or 50-55% relative to activity of the enzyme that is not heated. In some embodiments, the activity of a heat-inactivated enzyme is reduced by 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or 100% relative to the activity of the enzyme that is not heated.
Examples of enzymes that may be heat inactivated, or d from the genome of a host cell, include, without limitation, nucleases (e.g., RNase III, RNase I, RNase R, , RNase II, and RNase T), phosphatases (e.g., side monophosphatase, nucleoside diphosphatase, nucleoside triphosphatase), and other enzymes that depolymerize RNA or phorylate nucleotides. Enzymes that depolymerize RNA include any enzyme that is able to cleave, partially hydrolyze, or tely hydrolyze a RNA molecule. Table 2 provides a list of non-limiting examples of nucleases that may be heat inactivated or, in some instances, deleted from an engineered host cell. Table 3 provides a list of non-limiting examples of phosphatases that may be heat vated or, in some instances, deleted from an engineered host cell. Heat inactivation of these and other nucleases and phosphatases is encompassed by the present disclosure.
Table 2. Examples ofNucleases Nuclease Gene Function EC # Uniprot Reference RNase 111 MC Cleaves dsRNA, rRNA and some mRNA 3.1.26.3 POA7Y0 6, 7, 8 General ribonuclease, broad substrate .6 P21338 20 RNase I spec1fic1ty. Locahzes to penplasm.. . . .
Cleaves some dsRNA, poly-A mRNA, 3.1.13.- P21499 4, 21 RNase R mRNA and rRNA General mRNA degradation, tRNA 3.1.13.1 P05055 22, 23, 24 PNPase tion and degradation.
Exonuclease. Plays a role in tRNA 3.1.13.1 P30850 4, 5 RNase II Processing oftRNAs, rRNA and other 3.1.13.- P30014 15, 16, 17 RNase T stable RNAs. Capable of degrading ssDNA and ssRNA.
Processes rRNA, tRNA and other RNAs. 3.1.26.12 P21513 18, 19 RNase E Associates with the "degradasome" Table 3. Examples ofPhosphalases.
Phos n hatase Class Host EC # Exam les Uni n rot Reference POAE22 POO634 POA84O NMP/NDP phosphatase P64636 PO7024 P POAF24 . PO7102 NTP phosphatase E. coll 3.6.1.15 P31473 . P25536 NTP phosphohydrolase E. coll 3.6.1.19 POAEY3 E. coli RNase III preferentially cleaves dsRNA as well as some single-stranded mRNA molecules. The presence of RNase III in cell lysate may limit the accumulation of high concentrations of tic RNA (e.g., dsRNA), because the synthetic RNA is readily cleaved. Neither RNase 111 nor the gene encoding RNase III, rnc, is essential for cell viability, thus, in some embodiments, rnc is deleted or mutated in engineered host cells. In other embodiments, RNase III is heat vated following depolymerization of nous E. coli RNase I localizes to the asmic space in intact cells and catalyzes depolymerization of a wide range ofRNA molecules, including rRNA, mRNA, and tRNA.
Under logical conditions the periplasmic localization of this enzyme means that the enzyme has little impact on RNA stability within the cell, however, mixing of the periplasm and cytoplasm in cell lysates permits RNase I access to cellular RNA. The presence of RNaseI in a cell lysate may reduce the yield of tic RNA through RNA degradation.
Neither RNase I nor the gene encoding RNase I, ma, is essential for cell viability, thus, in some embodiments, ma is deleted or mutated in engineered host cells. In other embodiments, RNase I is heat inactivated following depolymerization of endogenous RNA.
E. coli RNase R and RNase T catalyze the depolymerization of dsRNA, rRNA, tRNA, and mRNA, as well as small unstructured RNA molecules. Neither the enzymes nor the genes encoding the enzymes, rnr and ml, tively, are essential for cell viability, thus, in some ments, rnr and/or mt are deleted or mutated in engineered host cells (e.g., E. coli host cells). In other embodiments, RNase R and/or RNase T are heat inactivated following the depolymerization of endogenous RNA.
E. coli RNase E and PNPase are components of the degradasome, which is responsible for mRNA turnover in cells. RNase E is t to function together with PNPase and RNase II to turn over cellular mRNA pools. Disruption of the gene encoding RNase E, me, is lethal in E. coli. Thus, in some embodiments, RNase E is heat inactivated ing merization of endogenous RNA. Neither PNPase nor the gene encoding PNPase, pnp, is ial for cell viability, thus, in some embodiments, pnp is deleted or d in engineered host cells (e.g., E. coli host cells). In other embodiments, PNPase is heat inactivated following depolymerization of endogenous RNA.
E. coli RNase II depolymerizes both mRNA and tRNA in a 3' 9 5' direction.
Neither RNase II nor the gene ng RNase II, rnb, is essential for cell viability, thus, in some embodiments, rnb is deleted or mutated in engineered host cells. In other embodiments, RNase II is heat inactivated following merization of endogenous RNA.
While neitherpnp nor rnb is essential to host cell survival, disruption of both simultaneously may be lethal. Thus, in some embodiments, both PNPase and RNase II are heat inactivated.
Phosphorylation ofNucleoside Monophosphales l0 Nucleoside sphales Following conversion of endogenous RNA to its monomeric form, and following heat inactivation of endogenous nucleases and phosphatases, the ing nucleoside monophosphates (NMPs) in a cell lysate are phosphorylated before they are polymerized to form a desired synthetic RNA, such as a double-stranded RNA or single-stranded RNA (e.g., mRNA or antisense RNA). This process is highly energy dependent, thus, this process WO 76963 requires an energy source. The phosphates are typically donated from a high-energy phosphate source, such as, for example, phosphoenolpyruvate, ATP, or polyphosphate.
In some embodiments, the energy source is ATP that is directly added to a cell lysate. In other ments, the energy source is provided using an ATP regeneration system. For example, polyphosphate and polyphosphate kinase may be used to produce ATP.
Other examples included the use of acetyl-phosphate and acetate kinase to produce ATP, phospho-creatine and creatine kinase to e ATP, and oenolpyruvate and te kinase to produce ATP. Other ATP (or other energy) regeneration systems may be used. In some embodiments, at least one component of the energy source is added to a cell lysate or cell lysate mixture. A nent" of an energy source includes the sub strate(s) and enzyme(s) required to produce energy (e.g., ATP). Non-limiting examples of these components include polyphosphate, polyphosphate kinase, acetyl-phosphate, acetate kinase, o-creatine, creatine kinase, phosphoenolpyruvate, and pyruvate kinase.
A kinase is an enzyme that zes the transfer of phosphate groups from high- energy, phosphate-donating molecules, such as ATP, to specific substrates/molecules. This process is referred to as phosphorylation, where the substrate gains a phosphate group and the high-energy ATP molecule donates a phosphate group. This transesterif1cation produces a phosphorylated substrate and ADP. The kinases of the present disclosure, in some embodiments, convert the NMPs to NDPs and NDPs to NTPs.
In some embodiments, a kinase is a nucleoside osphate kinase, which catalyzes the transfer of a high-energy phosphate from ATP to an NMP, resulting in ADP and NDP. Non-limiting examples of nucleoside monophosphate kinases are ed in Tables 4 and 5. As discussed below, thermostable variants of the enzymes listed in Tables 4 and 5 are encompassed by the present disclosure. In some embodiments, a cell lysate comprises one or more (or all) of the following four nucleoside monophosphate kinases: thermostable ate kinase, thermostable cytidylate kinase, thermostable ate kinase and thermostable ate kinase. In some embodiments, UIVIP kinase is obtained from ccusfuriosus (e.g., SEQ ID N03 or a variant comprising an amino acid sequence that is at least 70% identical to the amino acid sequence fied by SEQ ID NO:3). In some embodiments, CMP kinase is obtained from Thermus lhermophilus (e.g., SEQ ID N04 or a variant comprising an amino acid sequence that is at least 70% identical to the amino acid sequence identified by SEQ ID NO:4). In some embodiments, GMP kinase is obtained from Thermologa maritima (e.g., SEQ ID N05 or a variant comprising an amino acid sequence that is at least 70% identical to the amino acid sequence identified by SEQ ID NO:5). In some embodiments, AMP kinase is obtained from Thermus lhermophilus (e.g., SEQ ID N06 or a variant sing an amino acid sequence that is at least 70% identical to the amino acid sequence identified by SEQ ID N06).
Thus, in some embodiments, a NMP kinase has an amino acid sequence identified by the amino acid sequence of any one of SEQ ID NO: 3-6. In some embodiments, the NMP kinase has an amino acid sequence that is at least 70% identical to the amino acid sequence of any one of SEQ ID NO: 3-6. For example, the NMP kinase may have an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid ce identified by any one of SEQ ID NO: 3-6.
It should be understood that the present disclosure asses the use of any one or more of the enzymes described herein as well as variants of the enzymes (e.g., "PPK2 variants"). Variant enzymes may share a certain degree of sequence identity with the reference enzyme. The term ity" refers to a relationship n the sequences of two or more ptides or polynucleotides, as determined by comparing the sequences.
Identity measures the percent of identical matches between the smaller of two or more sequences with gap alignments (if any) addressed by a particular atical model or computer program (e.g., "algorithms"). Identity of related molecules can be readily calculated by known methods. nt (%) identity" as it applies to amino acid or nucleic acid sequences is defined as the percentage of residues (amino acid residues or nucleic acid es) in the candidate amino acid or nucleic acid sequence that are cal with the residues in the amino acid sequence or nucleic acid sequence of a second sequence after aligning the sequences and introducing gaps, if necessary, to achieve the m percent identity. Identity depends on a calculation of percent ty but may differ in value due to gaps and penalties introduced in the calculation. Variants of a particular sequence may have at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% but less than 100% sequence identity to that particular reference sequence, as determined by sequence alignment programs and parameters bed herein and known to those d in the art.
The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. Techniques for determining identity are codified in publicly available computer programs. Exemplary computer software to determine homology n two sequences include, but are not limited to, GCG program package (DevereuX, J. et al. Nucleic Acids Research, 12(1): 387, 1984), the BLAST suite (Altschul, S. F. et al. Nucleic Acids Res. 25: 3389, 1997), and FASTA (Altschul, S. F. et al. J.
Molec. Biol. 215: 403, 1990). Other techniques include: the Smith-Waterman algorithm (Smith, T.F. et al. J. Mol. Biol. 147: 195, 1981, the Needleman—Wunsch algorithm (Needleman, S.B. et al. J. Mol. Biol. 48: 443, 1970, and the Fast Optimal Global Sequence Alignment Algorithm (FOGSAA) (Chakraborty, A. et al. Sci Rep.3: 1746, 2013).
Table 4. Examples eoside Monophosphale Kinases E. coli POA7E9 39, 40 PyrH T ihermophilus 2.7.4.22 UMP -- ATP 9 UDP + ADP P4389l 41 P. furiosus Q8U122 42, 43 E. coli POA6IO 44, 45 ka T fhermophilus 2.7.4.25 CMP -- ATP 9 CDP + ADP QSSL35 41 P. furiosus Q8U2L4 46 E. coli P60546 47, 48 Gmk T fhermophilus 2.7.4.8 GMP -- ATP 9 GDP + ADP QSSHS 41 T. maritima Q9X215 49 E. coli P69441 50, 51 Adk T ihermophilus 2.7.4.3 AMP -- ATP 9 2 ADP Q72125 523 53 P. uriosus Q8U207 46 In some embodiments, a kinase is a nucleoside diphosphate kinase, which transfers a phosphoryl group to NDP, resulting in NTP. The donor of the phosphoryl group may be, without limitation, ATP, polyphosphate polymer, or phosphoenolpyruvate. Non- limiting es of kinases that convert NDP to NTP include side diphosphate kinase, polyphosphate kinase, and pyruvate . As discussed below, stable variants of the foregoing enzymes are encompassed by the present disclosure. In some embodiments, the NDP (s) is/are ed from Aquifex aeolicus (e.g., SEQ ID NO: 9 or a variant comprising an amino acid sequence that is at least 70% identical to the amino acid sequence identified by SEQ ID NO:9). In some embodiments, the NDP kinase has an amino acid sequence that is at least 70% identical to the amino acid ce fied by SEQ ID NO: 9. For example, the NDP kinase may have an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence identified by SEQ ID NO: 9.
Phosphorylation ofNMPs to NTPs occurs, in some embodiments, through the polyphosphate-dependent kinase pathway (Figures 2A and 23), where high-energy phosphate is transferred from polyphosphate to ADP via a polyphosphate kinase (PPK). In some embodiments, the polyphosphate kinase belongs to the polyphosphate kinase 1 (PPKl) family, which transfers high-energy phosphate from polyphosphate to ADP to form ATP.
This ATP is subsequently used by NMP kinases (e.g., AMP kinase, UIVIP kinase, GMP kinase, and CMP kinase) to t NMPs to their cognate ribonucleotide diphosphates (NDPs). Furthermore, ATP is subsequently used by nucleotide diphosphate kinase to convert NDPs to NTPs. See, e.g., Tables 5 and 6 for ary enzymes.
In some embodiments, the polyphosphate kinase belongs to the polyphosphate kinase 2 (PPK2) family. In some embodiments, the polyphosphate kinase belongs to a Class I PPK2 family, which transfers high-energy phosphate from polyphosphate to NDPs to form NTPs. ATP produced by the system is used as a high-energy ate donor to convert NMPs to NDPs. In some embodiments, the polyphosphate kinase belongs to a Class III PPK2 family, which transfers high-energy phosphate from polyphosphate to NMPs and NDPs to form NTPs. In some embodiments, Class III PPK2 is used alone to e NTPs from NMPs. In other ments, Class III PPK2 is used in combination with other kinases. Class III PPK2 produces ATP from ADP, AMP, and polyphosphate, which is subsequently used by NMP and NDP kinases to convert NMPs to NTPs.
Non-limiting examples of PPK2 enzymes for use as provided herein are listed in Table 6 (SEQ ID NO: 8-18). Thus, in some ments, the PPK2 enzymes are stable. For example, the PPK2 enzymes may be stable Class III PPK2 enzymes, which favor ATP synthesis over polyphosphate polymerization, and convert both ADP and AMP to ATP. In some embodiments, the PPK2 s are used to convert a polyphosphate, such as hexametaphosphate to ATP, at rates ranging, for example, from 10 to 800 mM per hour (e.g., 10, 15, 20, 25, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, or 800 mM per hour).
In some embodiments, the RNA biosynthesis methods of the present disclosure utilize a PPK2 enzyme that comprises an amino acid sequence identical to the amino acid sequence identified by any one of SEQ ID NO: 8-18. In some embodiments, the PPK2 enzyme comprises an amino acid sequence that is at least 70% identical to the amino acid sequence fied by any one of SEQ ID NO: 8-18. For example, the PPK2 enzyme may comprise an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence identified by any one of SEQ ID NO: 8-18.
The present disclosure also encompasses fusion enzymes. Fusion enzymes may exhibit le activities, each corresponding to the activity of a different . For example, rather than using an independent nucleoside monophosphate kinase and an independent nucleoside diphosphate kinase, a fusion enzyme (or any other enzyme) having both nucleoside monophosphate kinase activity and nucleoside diphosphate kinase ty may be used.
Table 5. Examples ofPathway Enzymes Enzyme Name Organism t # Sequence Identification Number |RNase R 3113- Escherichia coli P21499 SEQ ID NO: 1 synechococcus Q8DMA8 SEQ ID NO; 2 PPKl 2.7.4.1 UMP Kinase 2.7.4.22 Pyrococcusfuriosus Q8U122 SEQ ID NO: 3 |CMP Kinase 2.7.4.25 Thermus lhermophilus Q5 SL35 SEQ ID NO: 4 O\U‘I GMP Kinase 2.7.4.8 Thermaioga maritima Q9X215 SEQ ID NO: 5 AMP Kinase 2.7.4.3 Thermus lhermophilus Q72I25 SEQ ID NO: 6 ||NDP Kinase 2.7.4.6 Aquifex aeolicus 067528 SEQ ID NO: 7 RNA Polymerase Table 6. Examples ofPPK2 Enzymes Organ1sm Accession # ce Identification Number ADD29239.1 WP_013159015.1 WP_011531362.1 NP_682498.1 WP_013558940 Caldilinea aerophila DSM 1453 5 WP_O 1443 3 181 NP_661973.1 WP_013458618 WP_012120763 WP_011956376 WP_013178933 Polymerization ofNucleosia’e Triphospnales lo Ribonucleic Acid The final step in the biosynthesis of a RNA of interest is the polymerization of NTPs to the RNA (e.g., dsRNA or ssRNA) end product using, for example, a DNA- dependent RNA rase. In this step of the process, a DNA designed to encode the RNA of interest serves as the template for the synthesis of the RNA of interest. The DNA template may be engineered, in some instances, to have a transcriptional promoter that selectively drives transcription of the RNA of interest. An example DNA template is shown in Figure 3A. The DNA template encodes three RNA domains: a sense domain (domain 1), a flexible hinge domain (domain 2) and a domain complementary to the sense domain (antisense domain 3). Following transcription of the DNA template, the antisense domain binds (hybridizes) to the sense domain to form a double-stranded RNA hairpin stem domain and an adjacent hairpin loop domain. Other examples of a DNA te are shown in Figures 33- 3E. The DNA template in Figure 33 contains converging promoter ces on complementary strands. RNA sequences transcribed from each template strand anneal after transcription. The DNA template in Figure 3C, encoded as part of a plasmid, contains converging promoter sequences on complementary strands, as well as one or more terminator sequences to minimize read-through transcription. The DNA template in Figure 3D, encoded as part of a plasmid, contains independent promoter-terminator cassettes driving transcription of complementary sequences, which anneal after transcription. The DNA template in Figure 3E encodes a single RNA domain. Use of both DNA-dependent RNA polymerase and RNA- dependent RNA polymerase produces a double-stranded RNA end product.
Polymerization ofRNA es NTPs, a DNA template comprising a riptional promoter, and a polymerase (RNA polymerase) specific to the transcriptional promoter. lly, a rase for use as provided herein is a single subunit polymerase, is highly selective for its cognate transcriptional promoters, has high fidelity, and is highly efficient. Examples of polymerases include, without limitation, T7 RNA polymerase, T3 RNA polymerase, and SP6 RNA rase. Bacteriophage T7 RNA polymerase is a DNA- dependent RNA polymerase that is highly specific for the T7 phage promoters. The 99 KD enzyme catalyzes in vitro RNA synthesis from a cloned DNA sequence under control of the T7 promoter. Bacteriophage T3 RNA rase is a DNA-dependent RNA polymerase that is highly specific for the T3 phage promoters. The 99 KD enzyme catalyzes in vitro RNA synthesis from a cloned DNA sequence under the T3 promoter. Bacteriophage SP6 RNA polymerase is a DNA-dependent RNA polymerase that is highly c for the SP6 phage promoter. The 98.5 KD polymerase catalyzes in vitro RNA synthesis from a cloned DNA template under the SP6 promoter. Each of T7, T3, and SP6 polymerase are lly active at C. In some embodiments, thermostable ts of T7, T3, and SP6 polymerase are used. Thermostable t polymerases are typically optimally active at temperatures above 40°C (or about 50-6OOC).
"Conditions that result in production of nucleoside triphosphates and polymerization of the nucleoside triphosphates," also referred to as "conditions for the biosynthesis of RNA," may be ined by one of ordinary skill in the art, taking into consideration, for example, optimal conditions for polymerase activity, including pH, temperature, length of time, and salt concentration of the cell lysate as well as any ous cofactors.
The pH of a cell lysate during the biosynthesis ofRNA may have a value of 3.0 to 8.0. In some embodiments, the pH value ofa cell lysate is 3.0-8.0, 4.0-8.0, 5.0-8.0, 6.0-8.0, 0, 3.0-7.0, 4.0-7.0, 5.0-7.0, 6.0-7.0, 3.0-6.0, 4.0-6.0, 5.0-6.0, 3.0-5.0, 3.0-4.0, or 40-50.
In some embodiments, the pH value ofa cell lysate is 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, or 8.0. In some embodiments, the pH value of a cell lysate during biosynthesis ofRNA is 7.0.
The temperature of a cell lysate during biosynthesis ofRNA may be 15°C to 70 0C. In some embodiments, the temperature of a cell lysate during biosynthesis ofRNA is -60 0C, 15—50 0C, 15—40 0C, 15—30 0C, 25—70 0C, 25-60 0C, 25—50 0C, 25—40 0C, 30—70 0C, -60 0C, 30—50 0C, 40—70 0C, 40-60 0C, 40—50 0C, 50—70 0C, or 50-60 0C. In some embodiments, the temperature of a cell lysate during biosynthesis ofRNA is 15 0C, 25 0C, 32 0C, 37 0C, 42 0C, 45 0C, 55 0C, 56 0C, 57 0C, 58 0C, 59 0C, 60 0C, 61 0C, 62 0C, 63 0C, 64 0C, 65 0C, 66 0C, 67 0C, 68 0C, 69 0C, or 70 0C. In some embodiments, the temperature ofa cell lysate during biosynthesis ofRNA is 50 0C.
A cell lysate during biosynthesis ofRNA may be incubated for 15 minutes (min) to 72 hours (hrs). In some embodiments, a cell lysate during biosynthesis ofRNA is incubated for 30 min-48 hrs. For e, a cell lysate during biosynthesis ofRNA may be incubated for 30 min, 45 min, 1 hr, 2 hrs, 3 hrs, 4 hrs, 5 hrs, 6 hrs, 7 hrs, 8 hrs, 9 hrs, 10 hrs, 11 hrs, 12 hrs, 18 hrs, 24 hrs, 30 hrs, 36 hrs, 42 hours, or 48 hours. In some embodiments, a cell lysate during biosynthesis ofRNA is ted for 3 hours. In some embodiments, a cell lysate during biosynthesis ofRNA is incubated for 24 hours at a ature of 37 0C.
In some embodiments, a cell lysate during biosynthesis ofRNA is incubated at a pH of 7.0 for 2-4 hours at a ature of 50 0C.
Some polymerase activities may require the presence of metal ions. Thus, in some embodiments, metal ions are added to a cell lysate. miting examples of metal ions include Mg2 1, Li 1, Na}, K 1, Ni2 1, Ca2 1, Cu2 1, and Mn2+. Other metal ions may be used.
In some embodiments, more than one metal ion may be used. The concentration of a metal ion in a cell lysate may be 0.1 mM to 100 mM, or 10 mM to 50 mM. In some embodiments, the concentration ofa metal ion in a cell lysate is 0.1, 0.2, 0.5, 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5., 6.0, 6.5, 7.0, 7.5, 8.0, 8.5, 9.0, 9.5, 10.0, 20.0, 25.0, 30.0, 35.0, 40.0, 45.0, 50.0, 60.0, 70.0, 80.0, 90.0, or 100.0 mM.
In some embodiments, salt is added to a cell lysate, for example, to prevent enzyme aggregation. For example, sodium chloride, potassium chloride, sodium acetate, potassium acetate, or a combination thereof, may be added to a cell lysate. The concentration of salt in a cell lysate during a RNA depolymerization on may be 5 mM to 1 M. In some embodiments, the concentration of salt in a cell lysate during a RNA depolymerization reaction 5 mM, 10 mM, 15 mM, 20 mM, 25 mM, 50 mM, 100 mM, 150 mM, 200 mM, 250 mM, 500 mM, 750 mM, or 1 M.
Thermoslable Enzymes One age of the cell-free RNA-biosynthesis methods of the present disclosure is that all of the enzymes needed to convert endogenous RNA to synthetic - stranded RNA, for example, may be (but need not be) expressed in a single engineered cell.
For example, a clonal population of the engineered cell is cultured to a desired cell density, the cells are lysed, incubated under conditions that result in depolymerization of nous RNA to its monomer form (e.g., at a temperature of 30-37 0C), subjected to temperatures sufficient to inactivate endogenous nucleases and phosphatases (e.g., 40-90 0C), and ted under conditions that result in the polymerization ofRNA (e.g., dsRNA or ssRNA) (e.g., 30-50 0C). In order to proceed to end product synthetic RNA, the enzymes required for conversion ofNMPs to NDPs (e.g., nucleoside monophosphate kinases and/or osphate kinases), from NDPs to NTPs (e.g., nucleoside diphosphate kinases and/or polyphosphate kinase), and from NTPs to RNA (e.g., polymerase) should be thermostable to avoid denaturation during heat vation of the endogenous nuclease (and/or ous nucleases) and phosphatases. Thermostability refers to the y of enzymes to resist denaturation at relatively high ature. For example, if an enzyme is denatured (inactivated) at a temperature of 42 0C, an enzyme having similar activity (e.g., kinase activity) is considered ostable" if it does not denature at 42 0C.
An enzyme (e.g., kinase or polymerase) is considered thermostable if the enzyme (a) retains activity after temporary exposure to high temperatures that denature other native enzymes or (b) functions at a high rate after temporary exposure to a medium to high temperature where native enzymes function at low rates.
In some embodiments, a thermostable enzyme retains r than 50% activity ing temporary exposure to relatively high temperature (e.g., higher than 41 0C for kinases obtained from E. coli, higher than 37 0C for many RNA polymerases) that would otherwise denature a r (non-thermostable) native enzyme. In some embodiments, a thermostable enzyme retains 50-100% activity ing temporary exposure to relatively high temperature that would otherwise denature a similar (non-thermostable) native enzyme.
For example, a thermostable enzyme may retain , 50-85%, 50-80%, 50-75%, 50-70%, 50-65%, 50-60%, or 50-55% activity following ary exposure to relatively high temperature that would otherwise denature a similar (non-thermostable) native enzyme. In some embodiments, a thermostable enzyme retains 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or 100% activity following temporary exposure to relatively high temperature that would otherwise denature a similar (non-thermostable) native enzyme.
In some embodiments, the activity of a stable enzyme after temporary exposure to medium to high temperature (e.g., 42-80 0C) is greater than (e.g., 25%, 30%, %, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or 100% greater than) the activity of a similar (non-thermostable) native enzyme.
The activity of a thermostable kinase, for e, may be measured by the amount ofNMP or NDP the kinase is able to phosphorylate. Thus, in some embodiments, a thermostable kinase, at relatively high temperature (e.g., 42 oC) converts greater than 50% of NMP to NDP, or greater than 50% ofNDP to NTP, in the same amount of time required to complete a similar conversion at 37 0C. In some embodiments, a thermostable , at relatively high temperature (e.g., 42 oC) converts greater than 60% ofNMP to NDP, or greater than 60% ofNDP to NTP, in the same amount of time ed to complete a similar conversion at 37 0C. In some embodiments, a thermostable kinase, at relatively high temperature (e.g., 42 oC) converts greater than 70% ofNMP to NDP, or greater than 70% of NDP to NTP, in the same amount of time required to complete a similar conversion at 37 0C.
In some embodiments, a thermostable , at relatively high temperature (e.g., 42 oC) converts greater than 80% ofNMP to NDP, or greater than 80% ofNDP to NTP, in the same amount of time required to complete a similar conversion at 37 0C. In some embodiments, a thermostable kinase, at vely high temperature (e.g., 42 oC) converts greater than 90% of NMP to NDP, or greater than 90% ofNDP to NTP, in the same amount of time required to complete a similar conversion at 37 0C.
The activity of a thermostable polymerase, for e, is assessed based on y and polymerization kinetics (e.g., rate of polymerization). Thus, one unit of a thermostable T7 polymerase, for example, may incorporate 10 nmoles ofNTP into acid ble material in 30 minutes at temperatures above 37 0C (e.g., at 50 0C).
Thermostable enzymes (e.g., kinases or polymerases) may remain active (able to catalyze a reaction) at a ature of 42 0C to 80 0C, or . In some embodiments, thermostable enzymes remain active at a temperature of 42-80 0C, 42-70 0C, 42-60 0C, 42-50 0C, 50-80 0C, 50—70 0C, 50-60 0C, 60-80 0C, 60-70 0C, or 70-80 0C. For example, thermostable enzymes may remain active at a temperature of 42 0C, 43 0C, 44 0C, 45 0C, 46 0C, 47 0C, 48 0C, 49 0C, 50 0C, 51 0C, 52 0C, 53 0C, 54 0C, 55 0C, 55 0C, 56 0C, 57 0C, 58 0C, 59 0C, 60 0C, 61 0C, 62 0C, 63 0C, 64 0C, 65 0C, 66 0C, 67 0C, 68 0C, 69 0C, 70 0C, 71 0C, 72 0C, 73 0C, 74 0C, 75 0C, 76 0C, 77 0C, 78 0C, 79 0C, or 80 oC. Thermostable s may remain active at vely high temperatures for 15 minutes to 48 hours, or longer. For example, thermostable enzymes may remain active at relatively high temperatures for 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 24, 36, 42, or 48 hours.
Non-limiting examples of thermostable NMP s are listed in Tables 5 and 7.
Other thermostable kinases include thermostable nucleoside diphosphate kinases, thermostable pyruvate kinases, and thermostable polyphosphate kinases (see, e.g., Table 6).
Other thermostable kinases are encompassed by the present disclosure.
Table 7. Examples of stable sia’e Monophosphale Kinases.
Host Organism . . T thermophilus, P. P43891 41 Undylate kmase 2.7.4.22 UMP 9 UDP + ADP Q8U122 423 43 T thermophilus, P. Q5SL35 41 Cytldylate kmase. . 2.7.4.25 CMP 9 CDP + ADP Q8U2L4 . T thermophilus, T Q5S118 41 Guanylate kmase 2.7.4.8 GMP 9 GDP + ADP maritima Q9X215 . T thermophilus, P. Q72125 52, 53 Adenylate kmase 2.7.4.3 AMP 9 2ADP furiosus Q8U207 Non-limiting examples ofRNA polymerases are listed in Table 8. Other RNA polymerases, including thermostable RNA polymerases, are encompassed by the present disclosure.
Table 8. Examples ofRNA Polymerases Organ1sm Organlsm T7 RNA T7 Phage DNA-dependent RNA polymerase P00573 54, 55 Polymerase Q6 RdRP Phage Q6 RNA-dependent RNA polymerase P11124 T3 RNA T3 Phage DNA-dependent RNA polymerase P07659 57 SP6 Polymerase SP6 Phage DNA-Dependent RNA polymerase P06221 stable RNA polymerases may be prepared by modifying wild-type enzymes. Such modifications (e.g., mutations) are known. For example, variant thermostable T7 RNA polymerases may include one or more of the following point mutations: V426L, A702V, V7951, S43OP, F8491, S6331, F880Y, C51OR, and S767G (EP23 77928 and EP1261696A1, each of which is incorporated herein by reference). In some embodiments, a variant thermostable T7 RNA polymerase es V426L, A702V, and V7951 mutations. In some embodiments, a variant thermostable T7 RNA polymerase includes S43OP, F8491, S6331, and F880Y mutations. In some embodiments, a variant stable T7 RNA polymerase includes F880Y, S43OP, F8491, S6331, C51OR, and S767G mutations. In some embodiments, a variant thermostable T7 RNA polymerase includes Y639V, H784G, E593G, and V685A mutations. In some embodiments, a variant thermostable T7 RNA polymerase includes S43OP, N433T, S633P, F8491, and F880Y mutations. Other variant and recombinant thermostable polymerases are encompassed by the present disclosure.
In some embodiments, a thermostable T7 polymerase is used to produce a RNA of interest. For example, a thermostable T7 polymerase (e.g., ted at a temperature of 40- 60 oC) having a concentration of 1-2% total protein may be used to synthesize RNA of interest at a rate of greater than 2 g/L/hr (or, e.g., 2 g/L/hr — 10 g/L/hr). As another example, a thermostable T7 rase (e.g., ted at a temperature of 40-60 0C) having a concentration of 3-5% total protein may be used to size RNA of interest at a rate of greater than 10 g/L/hr (or, e.g., 10 g/L/hr — 2O g/L/hr).
It should be understood that while many embodiments of the present sure describe the use of stable polymerases/enzymes, other enzymes/polymerases may be used. In some embodiments, polymerase may be exogenously added to heat-inactivated cell lysates, for example, to compensate for any reduction or loss of activity of the stable enzyme(s).
RNA ofInZeresZ Methods of the present disclosure are used to biosynthesize a RNA of interest.
The RNA may be single-stranded or double-stranded. In some embodiments, the RNA is a double-stranded RNA erence molecule. For example, a RNA of interest may be an siRNA or a hairpin RNA interference molecule. As discussed above, a RNA of interest is encoded by a DNA te, examples of which are shown in s 3A-3E. The RNA produced using the template ofFigure 3A includes a sense domain (domain 1), a flexible hinge domain n 2) and a domain complementary to the sense domain (antisense domain 3). ing transcription of the DNA template, the nse domain binds (hybridizes) to the sense domain to form a double-stranded RNA hairpin stem domain and an adjacent hairpin loop (hinge) domain.
A double-stranded hairpin stem domain is formed by the g of two complementary nucleic acid domains (e.g., discrete nucleotide sequences) to each other.
Nucleic acid domains are "complementary" if they bind (base pair via Watson-Crick interactions, hybridize) to each other to form a -stranded nucleic acid. The complementary domains of a DNA template encoding a RNA of interest may vary, depending, for example, on the desired end product. Complementary domains may have a length of, for example, 4 to 1000 nucleotides, or longer. For example, complementary domains may have a length of4 to 10, 4 to 20, 4 to 30, 4 to 50, 4 to 60, 4 to 70, 4 to 80, 4 to 90, 4 to 100, 4 to 200, 4 to 300, 4 to 400, or 4 to 500, or 4 to 1000 nucleotides. In some embodiments complementary domains have a length of 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 nucleotides. In some embodiments, complementary domains have a length of 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 100 nucleotides.
A hairpin loop domain is also formed by g of two complementary nucleic acid domains. A hairpin loop domain is the intervening sequence between two complementary domains. Typically, a hairpin loop domain is non-specific, meaning that it is not ed to bind intramolecularly or to another nucleic acid. A hairpin loop domain forms a loop-like structure upon g of the complementary domains to form a double- stranded hairpin stem domain. In some embodiments, a hairpin loop domain has a length of 4 to 500 nucleotides, or more. For example, a hairpin loop domain may have a length of 4 to , 4 to 20, 4 to 30, 4 to 50, 4 to 60, 4 to 70, 4 to 80, 4 to 90, 4 to 100, 4 to 200, 4 to 300, 4 to 400, or 4 to 500 nucleotides. In some embodiments, a hairpin loop domain has a length of 4, , 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 100 nucleotides.
A "double-stranded RNA" of the present disclosure asses wholly double- stranded molecules, which do not contain a single-stranded region (e.g., a loop or ng), as well as partially double-stranded les, which contain a -stranded region and a single-stranded region (e.g., a loop or overhang). The dsRNA product depicted at the bottom ofFigure 3A is considered a partially double-stranded le, while the dsRNA product depicted at the bottom ofFigure 3B is considered a wholly double-stranded molecule.
Examples of "single-stranded RNA" of interest e messenger RNA (mRNA) and antisense RNA. Thus, provided herein are methods of synthesizing mRNA and other single-stranded RNA molecules.
These methods may comprise (a) lysing cultured engineered cells that comprise RNA, an enzyme that depolymerizes RNA, thermostable kinases, a thermostable RNA polymerase, thereby producing a cell lysate, (b) incubating the cell lysate produced in step (a) under conditions that result in depolymerization of RNA, y producing a cell lysate that comprises nucleoside monophosphates, (c) heating the cell lysate produced in step (b) to a temperature that inactivates endogenous nucleases and phosphatases without inactivating the thermostable kinases and thermostable RNA polymerase, thereby producing a cell lysate that comprises heat-inactivated nucleases and phosphatases, and (d) incubating the cell lysate ed in (c) in the presence of an energy source and an engineered DNA template containing a promoter operably linked to a nucleotide ce encoding a RNA of st, under conditions that result in production of nucleoside triphosphates and polymerization of the side triphosphates, thereby producing a cell lysate that comprises the mRNA of interest.
Alternatively, such methods may comprise (a) combining cell lysates obtained from engineered cells that comprise endogenous, polymeric RNA, an enzyme that depolymerizes RNA, stable nucleoside monophosphate (NMP) kinases, thermostable nucleoside diphosphate (NDP) kinases, a thermostable PPK2 kinase, and/or a polyphosphate, to produce a cell lysate mixture, (b) incubating the cell lysate mixture ed in step (a) under conditions that result in depolymerization of RNA, thereby producing a cell lysate that comprises nucleoside monophosphates, (c) heating the cell lysate produced in step (b) to a temperature that inactivates phosphatases and RNases (and any other ties that may be detrimental to RNA stability or polymerization y, such as native RNA polymerase, NMP reductases, and/or nucleosidases) without inactivating the thermostable kinase and thermostable RNA polymerase, thereby producing a cell lysate that comprises heat- inactivated atases and RNases (and other deleterious cellular activities), and (d) incubating the cell lysate produced in step (c) in the presence of an energy source and an engineered DNA template containing a promoter operably linked to a nucleotide sequence encoding a RNA of st, under conditions that result in production of nucleoside triphosphates and polymerization of the nucleoside triphosphates, thereby producing a cell lysate that ses mRNA.
In some embodiments, the DNA template encoding the RNA containing a single target domain is transcribed using a DNA-dependent RNA polymerase, such as, for example, a T7 RNA polymerase, and the resulting RNA transcript serves as a template for a RNA- dependent RNA polymerase, such as, for e, the phage (1)6 RdRP, to synthesize a complementary RNA molecule, yielding a dsRNA. See, e.g., Figure 3B. Phage (1)6 is a double stranded RNA virus that infects members of the genus Pseudomonas. This phage encodes an RdRP that is e of synthesizing RNA using a RNA template, yielding a dsRNA molecule. The (1)6 RdRP is capable of polymerizing RNA absent a primer molecule, thus the polymerase requires only template RNA (Wright, S. el al, 2012. Journal of Virology.
Mar,86(5):2837-49, Van Dijk, AA., el al, 2004. JGen Virol. May,85(Pt 5), incorporated herein by reference). Other RNA-dependent RNA polymerase (RdRP) are encompassed by the present disclosure.
In some ments, the engineered cells se a DNA template encoding the RNA of interest. A DNA template encoding the RNA may be integrated into the genomic DNA of the engineered cells, or a DNA template may be introduced into the engineered cells on a plasmid. In other embodiments, the DNA template is added to the cell lysate during thesis of the RNA of interest (e.g., ing a heat inactivation step). In some embodiments, the concentration of the DNA template in a cell lysate is 0.05-l ug/ul. In some embodiments, the tration of the DNA template in a cell lysate is 0.05 ug/ul, 0.1 ug/ul, 0.5 [Lg/111,10 ug/ul.
As discussed above, other examples ofRNA end products of interest include messenger RNA (mRNA) and short/small-interfering RNA (siRNA) (a synthetic RNA duplex designed to specifically target a particular mRNA for degradation).
In some ments, the concentration ofRNA end product (biosynthesized RNA of interest) is at least 1 g/L to 50 g/L of cell . For example, the concentration of RNA end product may be 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50 g/L, or more.
] In some embodiments, a RNA of interest is designed to bind to a target nucleic acid of interest and is used, for example, as a therapeutic, prophylactic, or diagnostic agent.
Protease Targeting ] Engineered cells of the present disclosure may express (e.g., endogenously express) enzymes necessary for the health of the cells that may have a negative impact on the production of nucleic acids, such as RNA. Such enzymes are referred to herein as "target enzymes." For example, target enzymes sed by engineered cells may compete for substrates or cofactors with an enzyme that ses the rate of sor supplied to a RNA thetic pathway. As another example, target enzymes expressed by the engineered cells may compete for substrates or cofactors with an enzyme that is a key pathway entry enzyme of a RNA biosynthetic pathway. As yet another example, target enzymes expressed by the engineered cells may compete for substrates or cofactors with an enzyme that supplies a substrate or cofactor of a RNA biosynthetic y.
To negate, or reduce, this negative impact, target enzymes can be d to include a site-specific protease-recognition sequence in their protein sequence such that the target enzyme may be "targeted" and cleaved for inactivation during RNA production (see, e.g., U.S. Publication No. 2012/0052547 A1, published on March 1, 2012, and International Publication No. incorporated by nce herein).
Cleavage of a target enzyme containing a site-specific protease-recognition sequence results from contact with a cognate site-specif1c protease is sequestered in the asm of cell (separate from the target enzyme) during the cell growth phase (e.g., as engineered cells are cultured) and is brought into contact with the target enzyme during the RNA production phase (e.g., following cell lysis to produce a cell lysate). Thus, engineered cells of the present disclosure comprise, in some embodiments, (i) an ered nucleic acid encoding a target enzyme that negatively impacts the rate ofRNA production and includes a site-specific protease-recognition sequence in the protein ce of the target , and (ii) an ered nucleic acid ng a site-specific protease that cleaves the site-specific protease-recognition sequence of the target enzyme and includes a periplasmic-targeting sequence. This periplasmic-targeting sequence is responsible for sequestering the site- specific protease to the periplasmic space of the cell until the cell is lysed. Examples of periplasmic-targeting sequences are provided below.
] Examples of proteases that may be used in accordance with the t disclosure e, without limitation, alanine carboxypeptidase, proteases obtained from Armillaria mellea, astacin, bacterial leucyl aminopeptidase, cancer procoagulant, cathepsin B, clostripain, cytosol alanyl aminopeptidase, elastase, endoproteinase Brg-C, enterokinase, gastricsin, gelatinase, Gly-X ypeptidase, glycyl endopeptidase, human rhinovirus 3C protease, hypodermin C, Iga-specif1c serine endopeptidase, leucyl aminopeptidase, leucyl endopeptidase, lysC, mal pro-X carboxypeptidase, lysyl aminopeptidase, methionyl aminopeptidase, myxobacter, nardilysin, pancreatic endopeptidase E, picornain 2B, picornain 3C, opeptidase, prolyl aminopeptidase, proprotein convertase I, tein convertase II, russellysin, saccharopepsin, semenogelase, T-plasminogen activator, thrombin, tissue kallikrein, proteases obtained from tobacco etch virus (TEV), togavirin, tryptophanyl aminopeptidase, U-plasminogen activator, V8, venombin B, venombin BB and Xaa-pro aminopeptidase.
Periplasmic Targeting s of a nucleic acid (e.g., RNA) biosynthetic pathway may include at least one enzyme that has a ve impact on the health (e.g., viability) of a cell. To negate or reduce this negative impact, an enzyme can be modified to include a relocation sequence such that the enzyme is relocated to a cellular or extra-cellular compartment where it is not naturally located and where the enzyme does not negatively impact the health of the cell (see, e.g., Publication No. US—2011Al, published on November 10, 2011, orated by reference herein). For example, an enzyme of a biosynthetic pathway may be relocated to the asmic space of a cell.
Thus, in some embodiments, engineered cells of the present disclosure comprise at least one enzyme of a nucleic acid (e.g., RNA) biosynthetic pathway that is linked to a periplasmic-targeting sequence. A "periplasmic-targeting ce" is an amino acid sequence that targets to the periplasm of a cell the protein to which it is linked. A protein that is linked to a periplasmic-targeting sequence will be tered in the periplasm of the cell in which the protein is expressed.
Periplasmic-targeting sequences may be d from the N-terminus of bacterial secretory protein, for example. The sequences vary in length from about 15 to about 70 amino acids. The primary amino acid sequences of asmic-targeting sequences vary, but generally have a common structure, including the following ents: (i) the N-terminal part has a variable length and generally carries a net positive charge, (ii) following is a central hobic core of about 6 to about 15 amino acids, and (iii) the final component includes four to siX amino acids which define the cleavage site for signal peptidases.
Periplasmic-targeting sequences of the present sure, in some embodiments, may be derived from a protein that is secreted in a Gram negative bacterium. The secreted protein may be encoded by the ium, or by a bacteriophage that infects the bacterium.
Examples of Gram negative ial sources of secreted proteins include, without limitation, members of the genera Escherichia, Pseudomonas, Klebsiella, Salmonella, Caulobacier, omonas, Acelobacier, Achromobacler, Acineiobacler, Aeromonas, Agrobaclerium, Alcaligenes, acler, Burkhola’eria, Citrobacier, Comamonas, Enierobacler, Erwinia, Rhizobium, Vibrio, and Xaninomonas.
Examples of periplasmic-targeting sequences for use in accordance with the present disclosure include, without limitation, sequences selected from the group consisting of: MKIKTGARILALSALTTMIVIFSASALA (SEQ ID NO: 19), VIKQSTIALALLPLLFTPVTKA (SEQ ID NO: 20), VIMITLRKLPLAVAVAAGVMSAQAMA (SEQ ID NO: 21), VINKKVLTLSAVMASMLFGAAAHA (SEQ ID NO: 22), VIKYLLPTAAAGLLLLAAQPAMA (SEQ ID NO: 23), LALAGLVLAFSASA (SEQ ID NO: 24), VIMTKIKLLMLIIFYLIISASAHA (SEQ ID NO: 25), VIKQALRVAFGFLILWASVLHA (SEQ ID NO: 26); VIRVLLFLLLSLFMLPAFS (SEQ ID NO: 27), and VIANNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATA (SEQ ID NO: 28).
Engineered Cells ered cells of the present disclosure typically comprise at least one, most, or all, of the enzymatic activities required to biosynthesize RNA. "Engineered cells" are cells that comprise at least one engineered (e.g., recombinant or synthetic) nucleic acid, or are otherwise modified such that they are structurally and/or functionally distinct from their naturally-occurring rparts. Thus, a cell that contains an engineered c acid is considered an "engineered cell." Engineered cells of the present disclosure, in some ments, comprise RNA, enzymes that depolymerizes RNA, thermostable kinases, and/or thermostable rases.
In some embodiments, the engineered cells further comprise a DNA template containing a promoter operably linked to a nucleotide sequence encoding a RNA of interest.
Engineered cells, in some embodiments, express selectable s. Selectable markers are lly used to select engineered cells that have taken up and expressed an engineered nucleic acid following transfection of the cell (or ing other ure used to introduce foreign nucleic acid into the cell). Thus, a nucleic acid encoding product may also encode a selectable marker. Examples of selectable markers include, without limitation, genes encoding proteins that increase or decrease either resistance or ivity to antibiotics (e.g., ampicillin resistance genes, kanamycin ance genes, neomycin resistance genes, tetracycline resistance genes and chloramphenicol resistance genes) or other compounds.
Additional examples of selectable markers include, without limitation, genes ng proteins that enable the cell to grow in media ent in an otherwise essential nutrient (auxotrophic markers). Other selectable markers may be used in accordance with the present disclosure.
] An engineered cell "expresses" a t if the product, encoded by a nucleic acid (e.g., an engineered nucleic acid), is produced in the cell. It is known in the art that gene expression refers to the process by which c instructions in the form of a nucleic acid are used to synthesize a product, such as a protein (e.g., an enzyme).
] Engineered cells may be prokaryotic cells or eukaryotic cells. In some embodiments, engineered cells are bacterial cells, yeast cells, insect cells, mammalian cells, or other types of cells.
Engineered bacterial cells of the present disclosure include, without tion, ered Escherichia spp., Sireplomyces spp., Zymomonas spp., Acelobacter spp., Citrobacler spp., ocystis spp., Rhizobium spp., Clostria’ium spp., Corynebaclerium spp., Streptococcus spp., Xanthomonas spp., Lactobacillus spp., Laclococcus spp., Bacillus spp., Alcaligenes spp., Pseudomonas spp., Aeromonas spp., Azolobacter spp., Comamonas spp., Mycobacterium spp., Rhodococcus spp., Gluconobacter spp., Ralslonia spp., Acidilhiobacillus spp., A/[icrolunatus spp., Geobacler spp., Geobacillus spp., Arthrobacler spp., Flavobacterium spp., Serratia spp., Saccharopolyspora spp., Thermus spp., Stenolrophomonas spp., Chromobacterium spp., Sinorhizobium spp., Saccharopoh/spora spp., Agrobaclerium spp., and Pantoea spp.
Engineered yeast cells of the present disclosure include, without limitation, engineered romyces spp., Schizosaccharomyces, Hansenula, Candida, Kluyveromyces, Yarrowia and Pichia.
In some ments, engineered cells of the present disclosure are ered Escherichia coli cells, Bacillus subtilis cells, Pseudomonas putida cells, Saccharomyces cerevisae cells, or Laclobacillus brevis cells. In some embodiments, engineered cells of the present disclosure are engineered Escherichia coli cells.
EngineeredNucleic Acids A "nucleic acid" is at least two nucleotides ntly linked together, and in some instances, may contain phosphodiester bonds (e.g., a phosphodiester "backbone").
Nucleic acids (e.g., components, or portions, of nucleic acids) may be lly occurring or engineered. "Naturally occurring" nucleic acids are present in a cell that exists in nature in the absence of human intervention. "Engineered c acids" include recombinant nucleic acids and synthetic nucleic acids. A "recombinant nucleic acid" refers to a molecule that is constructed by joining nucleic acid les (e.g., from the same s or from different species) and, typically, can replicate in a living cell. A "synthetic nucleic acid" refers to a molecule that is biologically synthesized, chemically synthesized, or by other means synthesized or amplified. A synthetic nucleic acid includes nucleic acids that are chemically ed or otherwise modif1ed but can base pair with naturally-occurring nucleic acid les. Recombinant and synthetic nucleic acids also include those molecules that result from the replication of either of the foregoing. Engineered c acids may contain portions of nucleic acids that are naturally occurring, but as a whole, engineered nucleic acids do not occur naturally and require human intervention. In some embodiments, a nucleic acid encoding a product of the present disclosure is a recombinant nucleic acid or a tic c acid. In other embodiments, a c acid encoding a product is naturally occurring.
An engineered nucleic acid encoding RNA, as provided herein, may be operably linked to a "promoter," which is a control region of a nucleic acid at which initiation and rate of transcription of the remainder of a nucleic acid are controlled. A promoter drives expression or drives transcription of the nucleic acid that it regulates.
A promoter may be one naturally associated with a gene or sequence, as may be obtained by ing the 5' ding sequences located upstream of the coding segment of a given gene or sequence. Such a promoter can be ed to as enous." In some embodiments, a coding nucleic acid sequence may be positioned under the control of a recombinant or heterologous promoter, which refers to a promoter that is not normally associated with the encoded ce in its natural environment. Such promoters may include promoters of other genes, promoters isolated from any other cell, and synthetic promoters or enhancers that are not "naturally occurring" such as, for example, those that contain different elements of different transcriptional regulatory regions and/or mutations that alter expression through methods of genetic engineering that are known in the art. In addition to ing nucleic acid sequences of promoters and enhancers synthetically, sequences may be produced using recombinant cloning and/or c acid cation technology, including polymerase chain reaction (PCR).
A promoter is considered to be "operably linked" when it is in a t functional location and orientation in relation to the nucleic acid it regulates to control ("drive") transcriptional initiation and/or expression of that nucleic acid. ered nucleic acids of the present disclosure may contain a constitutive promoter or an inducible promoter. A "constitutive promoter" refers to a er that is constantly active in a cell. An "inducible promoter" refers to a promoter that initiates or enhances transcriptional activity when in the presence of, influenced by, or contacted by an inducer or inducing agent, or activated in the absence of a factor that causes repression.
Inducible promoters for use in ance with the present disclosure include any ble promoter described herein or known to one of ordinary skill in the art. Examples of inducible promoters include, t limitation, chemically/biochemically-regulated and physically- regulated promoters such as alcohol-regulated promoters, tetracycline-regulated promoters, steroid-regulated promoters, metal-regulated promoters, pathogenesis-regulated promoters, temperature/heat-inducible, phosphate-regulated (e.g., PhoA), and light-regulated promoters.
] An inducer or inducing agent may be endogenous or a normally exogenous condition (e.g., light), compound (e.g., chemical or emical compound) or protein that contacts an inducible promoter in such a way as to be active in regulating transcriptional activity from the inducible promoter. Thus, a "signal that regulates transcription" of a nucleic acid refers to an inducer signal that acts on an inducible promoter. A signal that regulates transcription may activate or inactivate transcription, depending on the regulatory system used. tion of transcription may involve ly acting on a er to drive transcription or ctly acting on a promoter by inactivation a repressor that is preventing the promoter from driving transcription. Conversely, deactivation of transcription may involve directly acting on a promoter to prevent transcription or indirectly acting on a promoter by activating a repressor that then acts on the promoter.
Engineered nucleic acids may be introduced into host cells using any means known in the art, including, without limitation, transformation, transfection (e.g., chemical (e.g., m phosphate, cationic polymers, or liposomes) or non-chemical (e.g., electroporation, sonoporation, impalefection, optical transfection, hydrodynamic ection)), and transduction (e.g., viral transduction). s or other proteins encoded by a naturally-occurring, intracellular nucleic acid may be ed to as "endogenous enzymes" or "endogenous proteins." Cell Cultures and Cell s Typically, engineered cells are cultured. "Culturing" refers to the process by which cells are grown under controlled conditions, typically outside of their natural environment. For example, engineered cells, such as ered bacterial cells, may be grown as a cell suspension in liquid nutrient broth, also referred to as liquid "culture medium." Examples of commonly used bacterial Escherichia coli growth media include, without limitation, LB (Lysogeny Broth) Miller broth (1% NaCl): 1% peptone, 0.5% yeast extract, and 1% NaCl, LB (Lysogeny Broth) Lennox Broth (0.5% NaCl): 1% peptone, 0.5% yeast extract, and 0.5% NaCl, SOB medium (Super Optimal Broth): 2% peptone, 0.5% Yeast t, 10 mM NaCl, 2.5 mM KCl, 10 mM MgC12, 10 mM MgSO4, SOC medium (Super Optimal broth with Catabolic repressor): SOB + 20 mM glucose, 2x YT broth (2x Yeast t and Tryptone): 1.6% peptone, 1% yeast t, and 0.5% NaCl, TB (Terrific Broth) medium: 1.2% peptone, 2.4% yeast extract, 72 mM KZHPO4, 17 mM KHZPO4 and 0.4% glycerol, and SB (Super Broth) medium: 3.2% peptone, 2% yeast extract, and 0.5% NaCl and or Korz medium (Korz, DJ el al. 1995).
Examples of high density bacterial Escherichia coli growth media include, but are not limited to, DNAGroTM medium, ProGroTM medium, AutoXTM medium, M medium, InduXTM medium, and SecProTM medium.
In some ments, engineered cells are cultured under conditions that result in expression of enzymes or nucleic acids. Such culture conditions may depend on the particular product being expressed and the desired amount of the product.
In some embodiments, engineered cells are cultured at a temperature of 30 0C to 40 0C. For example, engineered cells may be cultured at a temperature of 30 0C, 31 0C, 32 0C, 33 0C, 34 0C, 35 0C, 36 0C, 37 0C, 38 0C, 39 0C or 40 oC. Typically, engineered cells, such as engineered E. coli cells, are cultured at a temperature of 37 0C.
In some embodiments, engineered cells are ed for a period of time of 12 hours to 72 hours, or more. For example, engineered cells may be cultured for a period of time of 12, 18, 24, 30, 36, 42, 48, 54, 60, 66, or 72 hours. lly, engineered cells, such as engineered ial cells, are ed for a period of time of 12 to 24 hours. In some embodiments, engineered cells are cultured for 12 to 24 hours at a temperature of 37 0C.
In some embodiments, engineered cells are cultured (e.g., in liquid cell e medium) to an optical density, measured at a wavelength of 600 nm (OD600), of 5 to 200. In some embodiments, engineered cells are cultured to an OD6OO of 5, 10, 15, 20, 25, 50, 75, 100, 150, or 200.
In some embodiments, engineered cells are cultured to a density of 1 X 108 (OD < 1) to 2 X 1011 (OD ~ 200) viable cells/ml cell e medium. In some embodiments, engineered cells are ed to a density of 1 x 108, 2 x 108, 3 x 108, 4 x 108, 5 x 108, 6 x 108, 7 x 108, 8 x 108, 9 X108,1X109,2 x 109, 3 x 109, 4 x 109, 5 x 109, 6 x 109, 7 x 109, 8 x 109, 9 X109,1X1010,2 x 10103 x 1010, 4 x 1010, 5 x 1010, 6 x 1010, 7 x 1010, 8 x 1010, 9 x1010 l X 1011, or 2 X 1011 viable cells/ml. (Conversion factor: OD 1 = 8 X 108 cells/ml).
In some embodiments, engineered cells are cultured in a bioreactor. A ctor refers simply to a container in which cells are cultured, such as a culture flask, a dish, or a bag that may be single-use (disposable), autoclavable, or sterilizable. The bioreactor may be made of glass, or it may be polymer-based, or it may be made of other materials. es of bioreactors include, without limitation, d tank (e.g., well miXed) bioreactors and tubular (e.g., plug flow) bioreactors, airlift bioreactors, membrane stirred tanks, spin fllter stirred tanks, ixers, fluidized bed reactors, and membrane ctors.
The mode of operating the bioreactor may be a batch or uous processes and will depend on the engineered cells being cultured. A bioreactor is continuous when the feed and product streams are continuously being fed and withdrawn from the system. A batch bioreactor may have a continuous recirculating flow, but no continuous feeding of nutrient or product t. For intermittent-harvest and fed-batch (or batch fed) cultures, cells are inoculated at a lower viable cell y in a medium that is similar in composition to a batch medium. Cells are allowed to grow eXponentially with essentially no external manipulation until nutrients are somewhat depleted and cells are approaching stationary growth phase. At this point, for an intermittent harvest batch-fed process, a portion of the cells and product may be harvested, and the removed culture medium is replenished with fresh medium. This process may be repeated several times. For production of recombinant proteins and antibodies, a fed-batch process may be used. While cells are growing ntially, but nutrients are becoming depleted, concentrated feed medium (e.g., 10-15 times concentrated basal ) is added either continuously or ittently to supply additional nutrients, allowing for further increase in cell concentration and the length of the production phase.
Fresh medium may be added proportionally to cell concentration without removal of culture medium (broth). To accommodate the addition of medium, a fedbatch culture is started in a volume much lower that the full capacity of the bioreactor (e.g., approximately 40% to 50% of the maXimum volume).
Some methods of the present disclosure are directed to large-scale production of RNA (e.g., ssRNA or . For large-scale production methods, engineered cells may be grown in liquid culture medium in a volume of 5 liters (L) to 250,000 L, or more. In some embodiments, engineered cells may be grown in liquid culture medium in a volume of greater than (or equal to) 10 L, 100 L, 1000 L, 10000 L, or 100000 L. In some ments, engineered cells are grown in liquid culture medium in a volume of 5 L, 10 L, 15 L, 20 L, 25 L, 30 L, 35 L, 40 L, 45 L, 50 L, 100 L, 500 L, 1000 L, 5000 L, 10000 L, 100000 L, 150000 L, 200000 L, 250000 L, or more. In some embodiments, engineered cells may be grown in liquid culture medium in a volume of5 L to 10 L, 5 L to 15 L, 5 L to 20 L, 5 L to 25 L, 5 L to 30L, 5Lto 35 L, 5Lto40L, 5Lto45 L, lOLto 15 L, lOLto20L, lOLto25 L, 20Lto 30L, 10Lto 35 L, 10Lto40L, 10Lto45 L, 10Lto 50L, 15 Lto20L, 15 Lto25 L, 15L to 30 L, 15 L to 35 L, 15 L to 40 L, 15 L to 45 L, or 15 to 50 L. In some embodiments, engineered cells may be grown in liquid culture medium in a volume of 100 L to 300000 L, 100 L to 200000 L, or 100 L to 100000 L. lly, culturing of engineered cells is followed by lysing the cells. "Lysing" refers to the process by which cells are broken down, for example, by viral, enzymatic, mechanical, or c mechanisms. A "cell lysate" refers to a fluid containing the contents of lysed cells (e.g., lysed engineered cells), including, for example, organelles, membrane lipids, proteins, nucleic acids and inverted membrane vesicles. Cell lysates of the t disclosure may be ed by lysing any population of engineered cells, as provided .
Methods of cell lysis, referred to as g," are known in the art, any of which may be used in accordance with the present disclosure. Such cell lysis methods include, t limitation, physical lysis such as homogenization.
Cell lysis can disturb carefully controlled cellular environments, resulting in protein degradation and modification by unregulated endogenous proteases and phosphatases.
Thus, in some embodiments, protease inhibitors and/or phosphatase inhibitors may be added to the cell lysate or cells before lysis, or these activities may be removed by heat inactivation, gene inactivation, or protease targeting.
Cell s, in some embodiments, may be combined with at least one nutrient.
For example, cell lysates may be combined with NazHPO4, KH2P04, NH4Cl, NaCl, MgSO4, CaClz. Examples of other nts include, without limitation, magnesium sulfate, magnesium de, magnesium orotate, magnesium e, potassium phosphate sic, potassium phosphate dibasic, potassium phosphate tribasic, sodium phosphate monobasic, sodium phosphate dibasic, sodium phosphate tribasic, ammonium phosphate monobasic, ammonium phosphate dibasic, ammonium sulfate, ammonium chloride, and ammonium hydroxide.
Cell lysates, in some embodiments, may be ed with at least one cofactor.
For example, cell lysates may be combined with adenosine diphosphate (ADP), adenosine triphosphate (ATP), nicotinamide adenine dinucleotide (NAD+), or other non-protein chemical compounds required for activity of an enzyme (e.g., inorganic ions and coenzymes).
In some embodiments, cell lysates are incubated under conditions that result in RNA merization. In some embodiments, cell lysates are incubated under conditions that result in production of ssRNA or dsRNA.
The volume of cell lysate used for a single reaction may vary. In some embodiments, the volume of a cell lysate is 0.001 to 250 m3. For example, the volume of a cell lysate may be 0.001 m3, 0.01 m3, 0.1 m3, 1 m3, 5 m3, 10 m3, 15 m3, 20 m3, 25 m3, 30 m3, m3, 40 m3, 45 m3, 50 m3, 55 m3, 60 m3, 65 m3, 70 m3, 75 m3, 80 m3, 85 m3, 90 m3, 95 m3, 100 m3, 105 m3, 110 m3,115 m3, 120 m3, 125 m3, 130 m3, 135 m3, 140 m3, 145 m3, 150 m3, 155 m3, 160 m3, 165 m3, 170 m3, 175 m3, 180 m3, 185 m3, 190 m3, 195 m3, 200 m3, 205 m3, 210 m3, 215 m3, 220 m3, 225 m3, 230 m3, 235 m3, 240 m3, 245 m3, or 250 m3. In some embodiments, the volume ofa cell lysate is 25 m3 to 250 m3, 50 m3 to 250 m3, or 100 m3 to 250 m3. ream Processing The methods and systems provided herein, in some embodiments, yield RNA (e.g., dsRNA, ssRNA) product at a concentration of l-50 g/L (e.g., 30, 35, 40, 45, or 50 g/L).
Downstream processing increases purity to as much as 99% (e.g., 75, 80, 85, 90, 95, 96, 97, 98, or 99%) dsRNA by weight. An example of downstream processing is shown in Figure 4, starting with the addition of a protein precipitating agent (e.g., ammonium e) followed by disc-stack fugation (DSC) to remove n, lipids, and some DNA from the product stream. ltration is then ented to remove salts and volume. Addition of m chloride to the product stream leads to precipitation of the RNA product, which is subsequently separated from the bulk liquid using disc stack centrifugation, for example, yielding an ~80% purity RNA product stream. Further chromatographic polishing yield a ~99% pure product.
Additional Embodiments Additional embodiments of the present sure are encompassed by the following numbered aphs 1-46: 1. A ree method of biosynthesizing ribonucleic acid (RNA), the method comprising: (a) lysing cultured engineered cells that comprise RNA, an enzyme that depolymerizes RNA, thermostable kinases, a stable RNA polymerase, thereby producing a cell lysate, (b) incubating the cell lysate produced in step (a) under conditions that result in merization of RNA, thereby producing a cell lysate that comprises nucleoside osphates, (c) heating the cell lysate produced in step (b) to a temperature that inactivates endogenous nucleases and phosphatases without vating the thermostable kinases and thermostable RNA rase, thereby producing a cell lysate that comprises heat- inactivated nucleases and phosphatases, and (d) incubating the cell lysate produced in (c) in the presence of an energy source and an engineered DNA template containing a promoter operably linked to a nucleotide ce encoding a RNA of interest, under conditions that result in tion of nucleoside triphosphates and polymerization of the nucleoside triphosphates, thereby producing a cell lysate that comprises the RNA of interest. 2. The method of paragraph 1, wherein the energy source is polyphosphate, polyphosphate kinase, or both polyphosphate and osphate kinase. 3. The method of paragraph 1 or 2, wherein the cultured engineered cells comprise the engineered DNA template. 4. The method of paragraph 1 or 2, wherein the engineered DNA template is added to the cell lysate of step (d).
. The method of any one of paragraphs 1-4, wherein an ATP regeneration system is added to the cell lysate of step (d). 6. The method of paragraph 1, wherein the cultured engineered cells further comprise a thermostable polyphosphate . 7. The method of any one of paragraphs 1-6, wherein the RNA of the engineered cells of step (a) is endogenous RNA. 8. The method of any one of paragraphs 1-7, wherein the RNA comprises ribosomal RNA, messenger RNA, transfer RNA, or a combination thereof. 9. The method of any one of paragraphs 1-8, wherein the cultured engineered cells comprise at least two enzymes that depolymerize RNA.
. The method of any one of paragraphs 1-9, wherein the enzyme that depolymerizes RNA is selected from the group consisting of: $1 nuclease, Nuclease P1, RNase II, RNase III, RNase R, RNase JI, NucA, PNPase, RNase T, RNase E, RNaseG and combinations thereof. 11. The method of paragraph 10, n the enzyme that depolymerizes RNA is Nuclease P1. 12. The method of any one of paragraphs 1-11, wherein the cell lysate of step (b) comprises a Mg2+'chelating agent. 13. The method of paragraph 12, wherein the Mg2+'chelating agent is ethylenediaminetetraacetic acid (EDTA). 14. The method of paragraph 13, wherein the concentration of the EDTA is 0.1 mM to mM.
. The method of paragraph 14, wherein the concentration of the EDTA is 8 mM. 16. The method of any one of aphs 1-15, wherein the thermostable kinases comprise thermostable side monophosphate kinases. 17. The method of paragraph 16, wherein the thermostable nucleoside monophosphate kinases are selected from the group consisting of thermostable uridylate kinases, thermostable cytidylate s, thermostable guanylate kinases, and thermostable adenylate kinases. 18. The method of paragraph 17, wherein the stable nucleoside monophosphate kinases a selected from the group consisting of a thermostable Pyrococcusfuriosus uridylate kinase encoded by apyrH gene (PnyrH), a stable Thermus lhermophilus ate kinase encoded by a adk gene (TthAdk), a thermostable Thermus lhermophilus cytidylate kinase encoded by a cmk gene (Tthka), and a stable Pyrococcusfuriosus guanylate kinase encoded by a gmk gene . 19. The method of any one of paragraphs 1-18, wherein the stable s comprise thermostable nucleoside diphosphate kinases.
. The method of paragraph 19, wherein the thermostable nucleoside diphosphate kinases are selected from the group consisting of thermostable nucleoside phosphate kinases, thermostable pyruvate kinases, and thermostable polyphosphate s. 21. The method of paragraph 20, n at least one of the thermostable side diphosphate kinases is a thermostable Aquifex aeolicus enzyme encoded by a ndk gene. 22. The method of any one of paragraphs l-2l, wherein the cells comprise a thermostable nucleoside monophosphate kinase and a thermostable nucleoside diphosphate kinase. 23. The method of any one of paragraphs l-22, wherein the cultured ered cells comprise thermostable uridylate kinase, thermostable late kinase, thermostable ate kinase, thermostable adenylate kinase, and thermostable polyphosphate kinase. 24. The method of any one of aphs l-23, wherein the thermostable RNA polymerase is a stable DNA-dependent RNA polymerase.
. The method of paragraph 24, wherein the DNA-dependent RNA rase is selected from the group consisting of thermostable T7 RNA polymerases, thermostable SP6 RNA polymerases, and thermostable T3 RNA polymerases. 26. The method of paragraph 25, wherein the DNA-dependent RNA polymerase is a thermostable T7 RNA polymerase. 27. The method of any one of paragraphs l-26, wherein the temperature in step (c) is at least 50°C. 28. The method of paragraph 27, wherein the temperature in step (c) is at 50°C-800C. 29. The method of any one of paragraphs 1-28, wherein step (c) comprises heating the cell lysate for at least 15 minutes.
. The method of any one of paragraphs 1-29, wherein step (c) comprises heating the cell lysate to a temperature of at least 65°C for 15 minutes. 3 l. The method of any one of paragraphs l-30, wherein the side sphates in step (d) are produced at a rate of 15-30 mM/hour. 32. The method of any one of paragraphs 1-3 1, wherein the RNA of interest produced in step (d) is double-stranded RNA. 33. The method of any one of paragraphs l-32, n the RNA of interest is produced in step (d) a RNA interference molecule. 34. The method of any one of paragraphs l-33, wherein the RNA of interest produced in step (d) is an mRNA containing complementary domains linked by a hinged domain.
. The method of any one of paragraphs l-34, wherein the RNA of interest ed in step (d) is produced at a concentration of at least 4 g/L, at least 6 g/L, at least 6 g/L, or at least 10 g/L. 36. The method of paragraph 35 further comprising purifying the double-stranded 37. The method of paragraph 36, n the purifying step comprises combining the cell lysate of step (d) with a protein itating agent and ng precipitated protein, lipids, and DNA. 38. A cell lysate produced by the method of any one of paragraphs 1-37. 39. An engineered cell comprising RNA, an enzyme that depolymerizes RNA, a thermostable kinase and a thermostable RNA polymerase. 40. The engineered cell of paragraph 39 further comprising an engineered DNA template containing a er operably linked to a nucleotide sequence ng a RNA of interest. 41. A population of ered cells of paragraph 39 or 40. 42. A , comprising: maintaining in cell culture media engineered cells of paragraph 39. 43. The method of paragraph 42 further comprising lysing the cultured engineered cells to produce a cell lysate. 44. The method of paragraph 43 further comprising ting the cell lysate under conditions that result in depolymerization ofRNA to produce a cell lysate that comprises nucleoside monophosphates. 45. The method of paragraph 44 further comprising heating the cell lysate to a temperature that inactivates endogenous nucleases and phosphatases without inactivating the thermostable kinases and thermostable RNA polymerase to produce a cell lysate that comprises heat-inactivated nucleases and phosphatases. 46. The method of paragraph 45 further comprising incubating the cell lysate that comprises heat-inactivated nucleases and phosphatases in the presence of an energy source and an engineered DNA template ning a promoter operably linked to a nucleotide sequence encoding a RNA of interest, under conditions that result in production of nucleoside triphosphates and polymerization of the nucleoside triphosphates, to e a cell lysate that comprises the RNA of st.
Example I Nuclease downselecll'on To identify the optimal nuclease(s) for digesting lysate RNA, a series of screening experiments were performed using commercially-available enzymes chosen based on their ability to generate 5'—NMPs or oligonucleotides. The activity of these enzymes was first determined using purified E. coli RNA and reaction conditions ended by the manufacturer, where RNA depolymerization was monitored by the release of acid-soluble nucleotides. Under these conditions, four nucleases demonstrated depolymerization activity over background. The endonucleases Benzonase and RNase A, which served as positive controls, yielded immediate conversion ofRNA to acid-soluble nucleotides (Figure 5A).
Treatment ofRNA with the exonucleases P1 and RNase R yielded a time-dependent conversion ofRNA to acid-soluble tides, with RNase R reaching nearly 100% depolymerization in 2 hours. The remaining nucleases (terminator lease, RNase III and RNase T) did not e detectable depolymerization in this assay. Subsequent analyses by LC-MS revealed NMP tion in samples treated with RNase R and Nuclease P1, but not Benzonase or RNase A (Figure SB). These results suggest that RNase R and Nuclease P1 may be suitable for merizing lysate RNA into s. RNase R was chosen for further study for several reasons, including its lack of DNAse activity, its ability to e dsRNA and structured RNA, and its processive 3’ -> 5’ exonuclease activity.
RNA depolymerization in lysates RNase R was then tested for its y to depolymerize nous RNA in bacterial lysates. In these experiments, purified RNase R (0.5 mg/mL final concentration) was added to s (50% final concentration), and free nucleotides were quantified by UPLC. A representative experiment is shown in Figure 6. Adding d RNase R to lysates resulted in the rapid release of 5’-NMPs from lysate RNA, with maximal NMP liberation after 5-10 minutes. After this initial period of rapid depolymerization, NMP concentrations stabilized, then began to slowly decline. Endogenous RNase activity also resulted in 5'-NMP tion, albeit at much lower rates. Importantly, RNase R addition did not increase the rate of 2’ or 3’ NMP liberation from RNA, consistent with its known mechanism of action. Across multiple independent experiments, addition of RNase R to lysates resulted in the conversion of 68% of lysate RNA to 5'-NMPs in 5-10 minutes at rates in excess of 200 mM/hr.
To assess the toxicity of RNase R expression, two bacterial strains were constructed. One strain included the base strain (GL16-170) transformed with an empty protein expression vector, and the other included GL16-170 transformed with the same protein sion vector encoding RNase R. Both strains were grown under batch conditions in 1L bioreactors, induced at OD600 = 20, and harvested before glucose exhaustion.
Induction yielded strong expression of RNase R (Figure 7A) with no detectable change in growth rate (Figure 73). Upon lysis and 50% on, the strain expressing RNase R exhibited rapid depolymerization ofRNA into acid-soluble nucleotides (Figure 7C), indicating that overexpressed RNase R was functional. y, additional RNase R activity, which was supplied by adding purified enzyme to the reaction, did not se rates of depolymerization or yields of acid-soluble nucleotides, suggesting that overexpressed RNase R is fully active upon lysis and dilution.
Next, the activity of overexpressed RNase R was assessed in high-density lysates. Mg2+, which is known to stabilize ribosome structure and protect rRNA from nucleases, is also required (in low amounts) for RNase R activity. Therefore, depolymerization rates were measured in the presence of varying concentrations of EDTA (Figure 8). Lysates from the empty vector strain exhibited relatively slow depolymerization rates that were insensitive to EDTA, while lysates with overexpressed RNase R exhibited higher rates of depolymerization with increasing EDTA concentration, with l rates at 8 mM EDTA. Above 8 mM, depolymerization rates decreased, likely due to inactivation of Mg2+-dependent RNase R. Taken together, these results suggest that pressed RNase R is non-toxic and can be activated upon lysis.
NA/[P stability in s After RNA depolymerization, the resulting NMP pool is progressively phosphorylated to NTPs before polymerization into dsRNA. Deleterious enzymatic activities, such as NMP ation into sides and subsequent hydrolysis into sugars and bases, negatively impact dsRNA yields. Therefore, the stability of individual NMPs was assessed in lysates. Stability assessments were performed by adding isotopically-labeled "heavy" NMPs (hAMP, hCMP, , and hGMP) to lysates, and quantifying abundance over time using LC-MS (Figured 9A-9D, solid lines). In st to hAMP, which is relatively stable, hCMP, hIflVlP, and hGMP are actively degraded by the lysate, with approximate half-lives (ll/2) of 1 hour, 30 minutes, and 20 minutes, respectively.
One pathway for metabolism ofNMPs is phorylation into nucleosides.
To assess whether dephosphorylation was contributing to NMP degradation, stability assessments were repeated with the addition of nsive phosphatase inhibitors. Increased concentrations of phosphate (P04, 150 mM), as well as the structural mimic orthovandate (V04, 10 mM) were pre-incubated with lysates before hNMP on. sing phosphate concentration stabilized hUlVlP (t1/2 z 60 s), while minimally affecting hCMP and hGMP (Figures 9A-9D, dashed . In contrast, orthovanadate stabilized hCMP (t1/2 >> 60 minutes), hUMP (t1/2 z 60 minutes), and hGMP (t1/2 z 45 minutes) (Figures 9A-9D, dotted lines).Taken together, these stability assessments define an overall NMP degradation rate of 13 mM/hr in lysates, with 70% of exogenously-added NMPs present after 15 minutes. Even in the absence of phosphatase inhibitors, the relatively low rate of hNMP consumption (13 mM/hr) compared to the rate of RNase R-dependent depolymerization (> 200 , suggested that NMPs released from RNA should be available for polymerization into dsRNA.
Development ofneat inactivation To ize NMPs, as well as NDPs, NTPs, and dsRNA, a heat inactivation protocol was developed. The objective was to identify the lowest temperature and shortest incubation time that would eliminate nucleotide and RNA degradation activities in lysates.
To assess the efficacy of heat inactivation, NTP consumption rates (at 37°C) were compared across heat-inactivated s by LC-MS, where the time and temperature of heat inactivation was varied. Before heat inactivation, lysates consumed NTPs at approximately 120 mM/hr (Figure 10). Temperatures below 70°C did not affect NTPase activity, while incubation at 70°C produced a time-dependent decrease in NTPase activity. Complete inhibition ofNTPase activity occurred after a 15 minute tion at 70°C (Figure 10).
Next, these conditions were evaluated for their ability to stabilize NMPs and dsRNA in s. To evaluate the effects of heat inactivation on NMP degradation, lysates were d with exogenous RNase R to release RNA, then subjected to heat inactivation at 70°C. Post-inactivation, the temperature was lowered to 37°C, and the reaction incubated for an additional 60 minutes. As shown in Figure 11A, ent with RNase R for 5 minutes y depolymerized RNA. After heat inactivation and incubation at 37°C, NMP concentrations were unchanged, suggesting that the chosen heat-inactivation conditions rendered NMPs stable.
] Finally, these conditions were evaluated for their y to stabilize the reactants and products of an in vitro transcription reaction (including NTPs and dsRNA) in lysates. First, lysates were pre-incubated at elevated temperature for 15 minutes. Then, the temperature was lowered to 37°C and transcription reactants ding exogenous NTPs, DNA template, and purified T7 RNA rase) were added. As shown in Figure IIB, transcription reactions in lysates that were heat inactivated at 270°C yielded RNA products atively similar to the positive control reaction (performed in buffer). No RNA product was apparent in the reaction performed at 60°C.
Taken together, these results suggest that a 70°C incubation for 15 minutes is sufficient to ize NMPs, NTPs, and dsRNA in cell-free reactions.
WO 76963 ion and evaluation mostable kinases After heat-inactivation, a series of kinase activities are required to sequentially phosphorylate 5'—NMPs liberated from RNA to NTPs that can be polymerized to form dsRNA. These kinases, which use high-energy phosphate groups from ATP to phosphorylate NMPs and NDPs, must be sufficiently thermostable to remain active following high- temperature incubation, as well as sufficiently active to produce NTPs at high rates (21 mM/hr NTPs for l g dsRNA/L/hr). s from thermophilic organisms were chosen for evaluation (Table 9) based on literature reports of successful expression in E. coli and biochemical characterization of the recombinant enzymes.
Table 9. Origins of thermostable kinases tested for each class of activity.
Enzyme class Organism Prefix NMP kinase Escherichia coli Thermus ihermophilus Pyrococcusfuriosus synechococcus elongaius Thermoioga maritima NDP kinase ichia coli Thermus ihermophilus x aeolicus Polyphosphate kinase Escherichia coli Thermus ihermophilus Thermosynechococcus elongaius To evaluate the suitability of these enzymes for cell-free production of dsRNA, enzymes were cloned into an E. coli protein expression vector with an N—terminal hexahistidine tag, overexpressed, and purified using immobilized metal affinity chromatography (HVIAC). Activities of the purified enzymes were first quantified using luciferase-coupled assays, where the ption of ATP served as a proxy for NMP and NDP phosphorylation. Assays were performed at a range of incubation temperatures to determine the optimal reaction temperature for each enzyme.
Expression ofUMP s (encoded by the pyrH gene) from T ihermophilus andE. coli yielded insoluble protein under the tested induction and purification ions.
Purified PyrH from P. furiosus exhibited a specific activity of approximately 2 umol/min/mg protein that was largely temperature-independent (Figure 12). Based on this specific activity, a high-density cell lysate (90g dcw/L) sing PnyrH at 1% total protein would, in the ce of excess ATP, phosphorylate UTVIP at rates in excess of 50 mM/hr (Table 10). As dsRNA production at 1 g/L/hr requires approximately 5.25 mM/hr of UTVIP kinase activity, PnyrH was chosen for r tion. Table 10 shows predicted PyrH rates in high- y (90 g dcw/L) lysates, assuming PnyrH constitutes 1% of total lysate protein.
Table 10. Predicted PyrH reaction rates Temperature (°C) Predicted Rate (mM/hr) Expression of AMP kinases ed by the adk gene) from E. coli and T lhermophilus yielded soluble inant protein, while the Thermosynechococcus enzyme was insoluble under the tested expression and purification conditions. The purified E. coli enzyme was active at 37°C and 50°C, but exhibited no detectable activity at higher temperatures (Figure 13). The T. lhermophilus enzyme exhibited higher specific activity than the E. coli enzyme at all tested temperatures, with an optimal activity of nearly 1 mM/min per mg enzyme at 70°C. This activity, when the enzyme is expressed at 0.01% of total protein in a high-density lysate, translates to an expected rate in excess of 250 mM/hr of AMP phosphorylation in lysates (Table 11). As approximately 5.25 mM/hr of AMP kinase activity is required to synthesize 1 g/L/hr dsRNA, TthAdk was chosen for further study. Table 11 shows predicted Adk reaction rates in high-density (90 g dcw/L) lysates, assuming TthAdk constitutes 0.01% of total lysate protein.
Table 11. Predicted Adk on rates ature (°C) Predicted Rate (mM/hr) Expression of CMP kinases (encoded by the cmk gene) from E. coli and P. furiosus yielded insoluble protein, while expression of the T lhermophilus enzyme yielded soluble protein under the tested conditions. I Ihermophilus CMP kinase exhibited activity largely independent of temperature, although enzyme activity decreased slightly at temperatures above 60°C (Figure 14). Based on these results, expression of Tthka in high- density lysates at 0.02% of total protein would yield CMP kinase activities of 30-45 mM/hr (depending on temperature, Table 12), well in excess of the 5.25 mM/hr target. ore, Tthka was chosen for further evaluation. Table 12 shows predicted ka reaction rates in high-density (90 g dcw/L) lysates, assuming Tthka constitutes 0.02% of total lysate protein.
Table 12. Predicted ka reaction rates Temperature (°C) Predicted Rate (mM/hr) ] In contrast to the tested CMP kinases, expression of GMP kinases from E. coli, T philus, and T maritima d soluble recombinant protein. The E. coli enzyme had the highest tested specific activity at 37°C, but was less active at higher temperatures (Figure 14). While the T philus and T maritima s both exhibited optimal activity at higher temperatures, the T maritima enzyme was more active at all tested temperatures. Based on the measured specific activities of Tmek, expression in a high- density cell lysate at 0.1% of total n would yield an expected rate in excess of 60 mM/hr at 70°C in the presence of excess ATP, compared to a target rate of 5.25 mM/hr (Table 13). Therefore, Tmek was chosen for further evaluation. Table 13 shows predicted Gmk reaction rates in high-density (90 g dcw/L) lysates, assuming Tmek constitutes 0.1% of total lysate protein.
Table 13. Predicted Gmk on rates Temperature (°C) Predicted Rate (mM/hr) Unlike the NMP kinases, which are largely specific for a single substrate, NDP kinase phosphorylates ADP, CDP, UDP, and GDP. To compare NDP kinases, enzymes from the philes T lhermophilus and A. aeolicus were cloned and expressed in E. coli.
While the T lhermophilus enzyme was insoluble under the tested conditions, expression of the A. aeolicus enzyme yielded soluble protein. Activity measurements in a luciferase assay using ATP and GDP as substrates revealed that AaNdk is highly active across a broad range of temperatures, with a temperature optimum of 50°C e 16). Comparison across substrates revealed specific activities in excess of 100 umol/min/mg at 50°C for each nucleotide, confirming that AaNdk could phosphorylate multiple NDP ates (Table 14).
Based on these measurements, expression of AaNdk in high density lysates at 0.01% total protein translates to UDP kinase rates well in excess of 60 mM/hr. Given that 21 mM/hr of NDP kinase activity is required to support 1 g/L/hr dsRNA synthesis, AaNdk was chosen for further evaluation. Table 14 shows that at 50°C, AaNdk is highly active with CDP, UDP, and GDP substrates.
Table 14. AaNdk c activity by substrate.
Substrate Specific Activity (umol/min/mg) CDP 259.6 Polyphosphate kinase (Ppk) reversibly transfers high-energy phosphate groups n ric phosphate chains and adenosine nucleotides. Multiple Ppk s, belonging to the Type I family of polyphosphate kinases, were evaluated for activity, including enzymes from E. coli as well as the thermophilic organisms T. lhermophilus and Thermosynechococcus elongalus. These enzymes were selected for testing as they belonged to the haracterized Type I family or had previously been shown to be active.
Expression and purification of Ppk enzymes d soluble n, which was then tested for activity in a luciferase assay system using ADP and sodium hexametaphosphate as substrates. As shown in Figure 17, the specific activity of all tested Ppk enzymes was low ve to other kinase activities. The E. coli Ppk had the highest specific activity at lower atures (up to 60°C), while the Thermosynechococcus enzyme had the highest activity at 70°C. Additionally, incubation of the E. coli enzyme under heat inactivation conditions (70°C for 15 minutes) led to irreversible inactivation (not shown). Based on the c activity of the Wermosynechococcus enzyme, expression in a high density lysate at 2% of total protein would lead to an ed rate of 42 mM/hr at 70°C (Table 15), matching the required ATP production rate to support 1 g/L/hr dsRNA sis. However, cell-free dsRNA synthesis at lower temperatures (e.g., 50°C) would e higher expression of TePpk (in excess of 4% total protein). Table 15 shows predicted Ppk reaction rates in high- density (90 g dcw/L) lysates, ng TePpk constitutes 2% of total lysate protein.
Table 15. Predicted PPKl reaction rates (°C) (mM/hr) After evaluating each enzymatic activity in a purified system, enzymes were tested for activity in heat-inactivated lysates. Lysates expressing dual kinases were pre- incubated at 70°C for 15 minutes before substrates were added. As in the purified reactions, ATP consumption (for NMP and NDP kinases) or ATP production (for polyphosphate kinase) were quantified using a luciferase assay kit. As shown in Table 16 below, rates of NMP and NDP phosphorylation were well in excess of targets.
Table 16. Kinase activities in heat-inactivated lysates Enzyme Reaction Rate Target (mM/hr) (mM/hr) WATPSWWP TthAdk AMP+ATP:2ADP+2P—— ADP + Poly-Pn : ATP + ] After confirming that individual kinases were sufficiently active in lysates (with the exception of Ppk), kinases were evaluated in a multi-enzyme system for their ability to convert NMPs to NTPs. In these studies, equal volumes of s sing individual kinases (5) were combined, heat-inactivated, then assayed for ATP-dependent tion of NTPs from an lar mix ofNMPs by LC-MS. As shown in Table 17, l NTP tion rates exceeded 24 mM/hr for UTP, CTP, and GTP, suggesting that a simple mixture of lysates, without any optimization of reaction ions, could provide NTPs at sufficient rates to support synthesis of l g/L/hr dsRNA, in the presence of adequate ATP.
Table 17. Production ofNTPs in a heat-inactivated 1:1 mixture of lysates expressing individual kinase activities, using an equimolar mixture ofNMPs as substrates and ATP as a high-energy phosphate donor Rate (mM/hr) UMP -> UTP CMP -> CTP GMP —> GTP AMP —> ATP NlVlPs —> NTPs RNA polymerase downseleclion After depolymerization ofRNA into NMPs and phosphorylation ofNMPs to their corresponding NTPs, a RNA polymerase is required to convert NTPs into the dsRNA product. RNA polymerase from the bacteriophage T7 is an attractive enzyme for use in a recombinant system for several reasons. T7 RNA polymerase includes a single subunit (unlike many RNA polymerases from Bacteria and Eukarya) and has been extensively characterized by biochemical and molecular biology studies. Additionally, multiple T7 RNA polymerase mutants have been described that confer improved thermostability (see Table 18).
Table 18. List of T7 RNA polymerases evaluated for activity and thermostability EnzymeName MegaScript T7 ogen Component of high-yield transcription kit T7 RNA Polymerase New England s ThermoT7 RNA Polymerase Toyobo Life Sciences Claimed activity at 50°C <> 684 (Toyobo) — T7 RNA Polymerase (LVI) EP2377928 (Roche) Claimed activity at 50°C T7 RNA Polymerase (PPIY) EP1261696 (bioMérieux) Claimed activity at 50°C T7 RNA Polymerase Combination of LVI & PPIY Mutations potentially (LPPVIIY) synergistic First, the activities of commercially-available T7 RNA polymerases were evaluated using duplex DNA template (e.g. Figure 3B) and a 37°C reaction temperature. The production ofRNA was fied over time using the Quant-iT RNA Kit (Broad Range) (Thermo Fisher Scientific). Under conditions recommended by each manufacturer, the T7 and MegaScript enzymes were highly active, while the NEB enzyme yed significantly lower activity (Figure 18).
Next, the LVI mutant of T7 RNA polymerase was cloned with an N-terminal hexahistidine tag, expressed in E. coli, and purified using HVIAC.
Next, activities of the MegaScript and ThermoT7 polymerases were tested alongside the LVI mutant polymerase in dilute nactivated lysates (35% final lysate concentration) under standardized reaction conditions (Figure 19). As in a purified system, ThermoT7 exhibits higher specific ty at 37°C (3.1 nmol RNA/min/mg protein) than the MegaScript enzyme. The LVI mutant had the lowest specific activity (0.33 nmol/min/mg) of the three enzymes tested. When tested under otherwise identical conditions at 50°C, neither the MegaScript enzyme nor the LVI mutant exhibited any detectable activity. In contrast, activity of ThermoT7 was higher than at 37°C. With approximately 4% of total protein in the assay as ThermoT7 polymerase, RNA synthesis rates ed 11 g/L/hr at 50°C with duplex DNA template and ThermoT7 rase (Figure 19). ThermoT7 was then selected for further characterization.
After confirming the activity of ThermoT7 at 50°C in dilute heat-inactivated lysate, the activity of ThermoT7 was investigated under conditions representative of cell-free dsRNA production at scale. In addition to increased concentrations of , reactions at scale may include precipitated lysate components (e.g., protein) that arise from the heat inactivation s. To assess the performance of ThermoT7 under these conditions, RNA polymerization was quantified in nactivated high-density lysates (68% final lysate concentration) with and t clarification to remove precipitated proteins after heat inactivation (Figure 20). RNA synthesis rates were significantly higher in matrix than in buffer, with the t rates occurring in heat-inactivated matrix that had been clarified by WO 76963 centrifugation. In unclarified reactions, overall RNA synthesis rates (over a 2-hour reaction) were in excess of 2 g/L/hr with 1.4% of total protein in the assay as ThermoT7 polymerase.
Finally, the thermostability of ThermoT7 was tested at higher temperatures to evaluate ibility with the heat inactivation conditions established earlier in this program. In these studies, ThermoT7 enzyme was pre-incubated at elevated temperature (50- 70°C) for varying s of time (0-15 minutes), and the remaining activity quantified at 37°C. As shown in Figure 21, incubation at 50°C is well-tolerated by the enzyme, but higher temperatures lead to rapid irreversible inactivation of polymerase ty. Therefore, in these experiments, this particular Thermo T7 was not compatible with heat-inactivation at 50-70°C.
Thus, in some instances, purified ThermoT7 enzyme may be added to ree reactions following a thermal inactivation, or an alternate T7 RNA polymerase mutant may be used, having sufficient half-life at 70°C, for example.
Materials andMethods Nucleotide analysis Analysis of nucleotide monophosphates (AMP, CMP, UTVIP, and GMP) was med by liquid chromatography d with mass spectrometry (LC-MS). Samples were separated using an Agilent 1100 series HPLC equipped with a ZIC-cHILIC column (2.1 X 20 mm, 3 pm i.d.) (Merck) at room temperature with a flow rate of 0.5 mL/min and a 2 uL injection . Mobile phases consisted of 20 mM ammonium acetate (A) and 20 mM ammonium acetate in 90% acetonitrile (B). The separation method consisted of a gradient from 15-50% (B) for 3.5 minutes, followed by 50% (B) for 1.5 minutes, then 15% B for 3 minutes. Quantification was performed on an ABScieX API 3200 mass spectrometer using electrospray ionization (capillary voltage: -3000V, temperature: 600°C, desolvation gas: 20 psi) in multiple reaction monitoring (MRM) mode. Analysis of nucleotide monophosphate, diphosphate, and triphosphate species (NMPs, NDPs, and NTPs) used the method described above with the ing separation gradient: 15% B to 50% B for 3.5 minutes, followed by 50% B for 2.5 min, then 15% B for 4 minutes. Peak areas were compared to standard curves consisting of purified compounds -Aldrich). For analysis of samples in s, standard curves were prepared in lysate backgrounds that had been acid-quenched, clarified, pH-neutralized, and filtered as in the sample preparation steps described below.
Analysis of 2'-, 3'-, and s was performed by liquid tography using an Y H-Class UPLC (Waters) ed with an ACQUITY CSH fluoro- phenyl column (2.1 X 150 mm, 1.7 pm i.d.) (Waters) at 40°C with a flow rate of 0.5 mL/min and a 0.5 uL injection volume. Mobile phases consisted of 10 mM ammonium acetate in 0.2% formic acid (A) and 10 mM um acetate in 95% acetonitrile, 0.2% formic acid (B). The separation method consisted of 1% B for 2.8 s, followed by a gradient from 1%-30% B for 2.2 minutes, followed by 100% B for 7 minutes, then 1% B for 3 minutes.
Quantification was med using an Y UPLC PDA s) at 260, 254, and 210 nm. Peak areas were compared to standard curves ting of purified compounds (purchased from Sigma-Aldrich except for 2’ and 3’ CMP, UTVJP, and GMP which were purchased from Biolog Life Science Institute). For analysis of samples in lysates, standard curves were ed in lysate backgrounds that had been acid-quenched, clarified, pH- neutralized, and d as in the sample preparation steps described below.
Extraction andpurification ofE. coli RNA RNA was extracted and purified from high-density E. coli lysates (protein concentration: 40-50 mg/mL) ing to established protocols (Mohanty, B. K, Giladi, H., Maples, V. F., & Kushner, S. R. (2008). Analysis of RNA decay, processing, and polyadenylation in Escherichia coli and other prokaryotes. Methods in enzymology, 447, 3- 29). For every 400 uL of frozen E. coli lysate, 67 uL of 20 mM acetic acid was added to reduce RNase activity. Samples were thawed in a bead bath at 37°C. Immediately upon g, 400 uL of a 10% (w/v) solution of trimethyl(tetradecyl)ammonium bromide (Sigma-Aldrich) was added. The resulting suspensions were then clarified by centrifugation at 10,000 x g in a microcentrifuge at 4°C, and the supernatant removed. s were resuspended in 1 mL of a 2M solution of lithium chloride (Sigma-Aldrich) in 35% ethanol.
The suspensions were incubated at room temperature for 5 minutes, then clarified by fugation at 15,000 X g for 6 minutes at 4°C and the tants removed. Pellets were then resuspended in 1 mL of a 2M solution of lithium chloride in water, and incubated at room temperature for 2 minutes before clarification at 15,000 x g for 6 minutes. Supematants were then removed and the remaining pellets washed by resuspending in 70% ethanol and centrifuging at maximum speed (21,000 x g) for 5 minutes at 4°C. Supernatants were then removed and the pellets were air-dried for 15 minutes at room temperature. Pellets were then resuspended in 200 uL nuclease-free water, and incubated overnight at 4°C to solubilize RNA. RNA solutions were clarified by centrifugation (maximum speed for 5 minutes at 4°C) and supematants containing soluble RNA were transferred to sterile RNase-free tubes and stored at -20°C. se downselecll'on ] Nucleases were obtained from commercial sources as follows: Benzonase and Nuclease P1 were obtained from Sigma-Aldrich, RNase R, Terminator exonuclease, and RNase III were ed from Epicentre, RNase A was obtained from Thermo Fisher, and Exonuclease T was obtained from New England BioLabs. For screening assays, 1 uL of each enzyme solution was added to 100 uL of 2X assay buffer (100 mM potassium phosphate pH 7.4, 10 mM magnesium chloride, 1 mM zinc chloride), then combined with an equal volume of 1 mM RNA solution (~ 340 ng/uL) at time I: 0 and mixed well. Reactions were incubated at 37°C and periodically sampled by transferring 20 uL to acid quench solution (180 uL of 0.2M sulfuric acid) on ice. After completion of the time course, quenched samples were ed by centrifugation at 3,000 X g for 5 minutes at 4°C. 170 uL of supernatant from each sample was then transferred to a UV-transparent 96-well half area plate (Coming) and acid- soluble nucleotides were quantified by absorbance at 260 nm using a microplate reader and an tion coefficient of 10665 M'1 cm'l, estimated by averaging individual extinction coefficients for each mononucleotide. For subsequent analysis by LC-MS, 45 uL clarified supernatant was pH-neutralized with 5 uL of 2.5 M potassium hydroxide. The total nucleotide pool (i.e. 100% merization) was determined by alkaline hydrolysis of RNA: RNA was combined with an equal volume of 0.2M potassium hydroxide, then heated to 99°C for 20 minutes. Alkaline-hydrolyzed samples were then quenched and analyzed as described above. n expression andpurification Recombinant proteins were cloned from synthetic DNA encoding the relevant gene along with a hexahistidine tag into pETDuet-l (Novagen). Plasmids were ormed into E. coli T7Express (New England Biolabs), then grown in 1 L cultures using ZYM-505 media (Studier, F. W. (2005). Protein production by auto-induction in high-density shaking cultures. Protein expression and purification, 41(1), 207-234) supplemented with 50 ug/mL carbenicillin. Expression was induced at A600 = 0.6. For RNase R and kinases, expression was induced with 0.1 mM lPTG, the temperature lowered to 16°C, and the culture grown for 24 hours at 16°C. For T7 RNA polymerase, expression was d with 0.8 mM lPTG and the culture grown for 3 hours at 37°C. Biomass was harvested by fugation and the supernatant decanted before storing the cell pellets at -80°C. Cell pellets were thawed and lysed by resuspension into 4 volumes B-PER Complete o Fisher Scientific) supplemented with Benzonase (0.04 uL/mL) and incubation with gentle agitation for 15 minutes at room temperature. Lysates were then clarified by centrifugation at 16,000 x g for 1 hour at 4°C. ns were purified by immobilized metal y chromatography using His GraviTrap s (GE Healthcare) or HisTrap HP columns connected to an AKTAPrime Plus FPLC system (GE Healthcare). For both purification methods, columns were equilibrated in Equilibration/Wash buffer (50 mM phosphate buffer pH 7.4, 500 mM NaCl, mM imidazole), loaded with lysate, and then washed with 30 column volumes Equilibration/Wash Buffer. Proteins were eluted with Elution Buffer (50 mM phosphate buffer pH 7.4, 500 mM NaCl, 500 mM ole). For purification of kinases, Equilibration/Wash and Elution buffers used 50 mM Tri s-HCl pH 7.5 instead of phosphate buffer. Elution fractions were analyzed by SDS-PAGE and n content quantified by BCA (Thermo Fisher Scientific). Fractions were then ed and buffer exchanged by dialysis into 1000 volumes 2X Storage Buffer. For RNase R, 2X Storage Buffer consisted of 2X PBS supplemented with an additional 500 mM NaCl. For T7 RNA polymerase, 2X Storage Buffer consisted of 2X PBS. For kinases, 2X Storage Buffer consisted of 100 mM Tris-HCl pH 7.0 with 100 mM NaCl. After dialysis, ns were mixed with an equal volume of 100% glycerol (50% final concentration) and stored at -20°C.
Cell lysate preparation E. coli strains GL16-170 DE3).t526pgi.Aedd.Alle.AZolC_wt E1.AmgsA*-F3.AappA*.Aamn*-F1.nagD(keio)::zeoR-l.AphoA*.t352BAA1644.AushA*- C4.rna: :lolC-B04) and GL14-322 (BL21(DE3).t526pgi.Aedd.AZle.AZolC_wtE1.AmgsA *- F3 .AappA *.Aamn*-F1.nagD(keio)::zeoR-1.AphoA * .t3 52BAA1 644.AushA : :ZolC-AO 1) were grown in Korz media in 10L bioreactors until the end of batch phase, then harvested by centrifugation and frozen at -80°C. Pellets were resuspended to 10% dry cell weight in 58.8 mM potassium phosphate dibasic and lysed using 2 passes through a PandaPLUS homogenizer (GEA Niro Soavi) cooled to 4°C at 15,000 psi. Lysates were clarified by centrifugation at 16,000 x g for 1 hour at 4°C and protein content was analyzed by BCA assay (Thermo Fisher) before e at -80°C.
Depolymerizalion oflysate RNA with exogenous RNase R GL16-170 lysate (protein content 34.5 mg/mL) and RNase R solution (1 mg/mL in 300 mM ium phosphate buffer pH 7.4, 200 mM KCl, 2 mM MgC12) were pre-equilibrated at 2°C before initiating the reaction. At time I: 0, 50 uL of E. coli lysate and 50 uL RNase R solution were mixed and the reaction initiated by erring to a preheated 37°C block. ons including deoxycholate were assembled as described above, except that lysates were premixed with 0.2 volumes of 5X sodium deoxycholate solutions in water and incubated at 2°C for 15 minutes before tion. After initiation, reactions were incubated at 37°C and periodically sampled by transferring 10 uL to acid quench solution (90 uL of 0.2M sulfuric acid) on ice. After completion of the time course, quenched samples were clarified by fugation at 3,200 X g for 10 minutes at 2°C. Depolymerization was first quantified by ab sorbance of acid-soluble nucleotides: 10 uL of quenched and clarified reactions was added to 160 uL of 0.2M ic acid in a UV-transparent 96-well half area plate (Corning). Acid-soluble nucleotides were quantified by absorbance at 260 nm using a microplate reader (see above). Depolymerization was also quantified by UPLC analysis of 5’, 2’, and 3’ NMPs: 30 uL of each uenched sample was pH-neutralized by adding 10 uL of 1M KOH, then passed through a 0.2 pm filter before UPLC analysis. The total nucleotide pool (i.e. 100% merization) was determined by alkaline hydrolysis of lysate RNA: 50 uL lysate was combined with 150 uL of 0.2M potassium hydroxide, then heated to 99°C for minutes. Alkaline-hydrolyzed samples were then quenched and analyzed as described above.
Depolymerization ofRNA in lysates with pressedRNase R E. coli strain GL16-170 was transformed with pETDuet-l encoding the E. coli rnr gene with a C-terminal hexahistidine tag. This strain, alongside GL16-170 transformed with empty pETDuet-l, was grown in batch phase in Korz medium mented with 50 mg/L icillin. Cultures were induced with 0.8 mM lPTG at A600 = 20 and mented with an additional 10 g/L glucose at induction. One hour following induction, biomass was harvested by centrifugation and frozen. s were prepared from frozen biomass as described above (Protein concentrations: 36.6 mg/mL for GL16-170 biomass with empty pETDuet-l, 53.2 mg/mL for GL16-170 with pETDuet-l ng cloned RNase R).
Depolymerization in dilute lysates was assessed as described above with 50% final lysate concentration in the reaction. Depolymerization in concentrated s was assessed by pre- incubating 9 volumes lysate with 1 volume 10X EDTA solution for 5 minutes at 2°C.
Reactions were then initiated by transferring to a preheated 37°C block and sampling as described above.
NA/[P stability assessment Four volumes of GLl4-322 lysate (protein concentration: 50.5 mg/mL) were combined with one volume of phosphatase inhibitor solution (final concentrations of 50 mM potassium phosphate pH 7.4, 150 mM potassium phosphate pH 7.4, or 10 mM sodium orthovanadate) on ice. An equimolar solution of isotopically labeled NMPs (Adenosine- 13C10,15N5 5'-monophosphate, Cytidine-15N3-5'-monophosphate, e-15N2-5'- monophosphate, and Guanosine-15N5-5'-monophosphate [Sigma-Aldrich], 25 mM each) was prepared in water. Lysates and NMPs were equilibrated to 37°C for 10 minutes before reactions were initiated. To initiate reactions, 90 uL lysate solution was added to 10 uL NMP solution, and the reactions mixed well. Reactions were monitored by sampling at the indicated time points. During ng, 12 [LL of reaction mixture were transferred to 108 uL of 0.2M sulfuric acid on ice. Quenched reactions were then ed by centrifugation, pH- neutralized, and filtered for LC-MS analysis as described above.
Development ofheat inactivation GLl4-322 lysate was ted into 5 entrifuge tubes on ice, then transferred to a heat block brated at the desired heat inactivation temperature. At the indicated times, tubes were cooled on ice, then clarified by centrifugation (21,000 x g for 5 minutes) and the supernatants harvested. Supematants from heat-inactivated lysates, along with an equimolar mixture ofNTPs (Sigma-Aldrich, 25 mM each) were equilibrated at 37°C for 10 minutes. At time t= 0, 9 volumes of heat-inactivated lysate supernatant were combined with 1 volume ofNTP solution, and the reaction monitored by sampling into acid quench solution, tralized, filtered, and analyzed by LC-MS as described above. For transcription reactions in lysates, 10 uL reactions were performed using the MegaScript T7 ription Kit (Thermo Fisher) following kit instructions, except for a reduced amount of enzyme mix (5% of final reaction ), and including heat-inactivated lysate supernatant (40% of final reaction ). Positive control reactions were performed in ript reaction buffer alone, while negative control reactions included lysate but omitted enzyme mix. Reactions were analyzed by agarose gel electrophoresis stained with SYBR Safe (Invitrogen) ide the 1 kb DNA ladder (New England Biolabs).
Nucleotide kinase activity assays Nucleotide kinases were assayed at varying temperatures (37°C, 50°C, 60°C, 70°C, and 80°C) in a buffer ting of 50 mM Tris-HCl pH 7.0, 4 mM MgSO4, 4 mM ATP, and 4 mM of the corresponding NMP or NDP. on buffer (1.2X concentrate) and enzyme solution (0.5 mg/mL) were pre-equilibrated at reaction temperature for 1 minute before ons were initiated. At time I: 0, ons were initiated by mixing 80 uL reaction buffer with 20 uL enzyme. Reactions were monitored by sampling at the indicated time points. During sampling, 15 uL of reaction mixture were transferred to 135 uL of 0.2M sulfuric acid on ice. After completion of the reaction, samples were pH-neutralized with 1M KOH as described above, then diluted 1:10 in ice-cold water. ATP was quantified in each sample using the ATP Bioluminescent Assay Kit (Sigma-Aldrich), following kit instructions.
For reactions in lysates, the above protocol was modified as follows: s were aliquoted into individual reaction tubes, then nactivated by incubating at 70°C for 15 minutes.
Reaction buffer (2X concentrate) and heat-inactivated lysates were pre-equilibrated at reaction temperature, and the reactions initiated by combining equal volumes of lysate and reaction buffer. Reactions were sampled by quenching individual reaction tubes with 9 volumes acid quench solution, then analyzed as bed above.
To assay the combined ty of kinases in lysates (i.e. from NMPs to NTPs), lysates individually expressing each kinase were mixed in a 1:1 ratio, divided into 10 uL aliquots, then nactivated as bed above. Kinase activity was analyzed in a buffer consisting of 50 mM Cl pH 7.0, 16 mM MgSO4, 2 mM each nucleotide monophosphate (AMP, CMP, U1V1P, and GMP), and 16 mM ATP. Reaction buffer (2X concentrate) pre-equilibrated at reaction temperature was combined with an equal volume of lysate to initiate the on. Reactions were performed at 70°C and sampled by quenching individual reaction tubes with 9 volumes acid quench solution, then analyzed as described above.
Polyphosphate kinase activity assays Polyphosphate kinases were assayed at varying temperatures (37°C, 50°C, 60°C, 70°C, and 80°C) in a buffer consisting of 50 mM Tris-HCl pH 7.0, 4 mM MgSO4, 25 mM (NH4)ZSO4, 1 mM ADP, and 1 mM sodium hexametaphosphate. Reaction buffer (1.2X concentrate) and enzyme solution (0.25 mg/mL) were pre-equilibrated at reaction temperature for 1 minute before reactions were initiated. At time I: 0, reactions were initiated by mixing 80 uL reaction buffer with 20 uL enzyme. Reactions were red by sampling at the indicated time . During sampling, 15 uL of on mixture were transferred to 135 uL of 0.2M sulfuric acid on ice. After completion of the reaction, samples were pH-neutralized with 1M KOH as described above, then diluted 1:10 in ld water.
ATP was quantified in each sample using the ATP Bioluminescent Assay Kit (Sigma- Aldrich), following kit instructions. For reactions in lysates, the above protocol was modified as follows: lysates were aliquoted into dual reaction tubes, then heat-inactivated by incubating at 70°C for 15 minutes. Reaction buffer (2X concentrate) and heat-inactivated lysates were pre-equilibrated at reaction temperature, and the reactions initiated by combining equal s of lysate and reaction buffer. Reactions were sampled by quenching individual reaction tubes with 9 volumes acid quench solution, then analyzed as described above.
Reaction rates in lysates were ated by subtracting signal from a control lysate (without overexpressed polyphosphate kinase) under the same reaction conditions.
Generation scription templates Duplex DNA template was prepared by PCR amplification of tic gBlock DNA (Integrated DNA Technologies). ons were d and concentrated by isopropanol precipitation.
RNA polymerase downselection Commercially-available RNA polymerases were compared using conditions ended by each manufacturer. Each 50 [LL reaction consisted of 10X reaction buffer (supplied by the manufacturer), NTPs, DNA template (0.5 ug), and enzyme. For the NEB T7 RNA polymerase, reactions included 0.5 mM each NTP, 5 mM DTT, and 100 U enzyme.
Reactions with ThermoT7 polymerase were identical, except that DTT was omitted.
Reactions with ript T7 included 7.5 mM each NTP and 5 uL enzyme mix. Enzyme concentrations were ined by BCA assay (Thermo Fisher). ons were monitored by sampling at the indicated time . During sampling, 10 uL of reaction mixture were transferred to 90 uL ofRNA quench solution (10 mM Tris-HCl pH 8.0, 5 mM EDTA) and stored on ice. RNA samples in quench solution were fied using the Quant-iT RNA Broad Range Assay Kit (Thermo Fisher), following kit instructions. Serial dilutions of purified dsRNA, prepared using the MegaScript Kit and purified following kit instructions, were used to construct standard curves for quantitation. Reactions were qualitatively analyzed by agarose gel electrophoresis.
RNA polymerase evaluation in s GLl4-322 lysates were heat-inactivated and clarified by centrifugation as described previously. Each 20 [LL reaction consisted of clarified lysate (7 uL), 10X cofactor solution (300 mM MgC12, 20 mM spermidine), NTPs (7.5 mM each, prepared from pH- neutralized stock solutions), DNA template (0.6 ug), and enzyme (1 uL). Reactions were incubated for 1 hour at 37°C or 50°C, then quenched by adding 9 volumes RNA quench solution. Quenched reactions were further diluted d in quench solution (final dilution: 100-fold). Diluted reactions were then quantified using the iT kit (see above). RNA produced by the reaction was calculated by subtracting RNA quantified in a control reaction (omitting RNA rase).
RNA polymerase assays in high-density lysates were performed as described above, with the following modifications. Each 100 uL reaction consisted of lysate (67.5 uL), 10X cofactor solution (300 mM MgC12, 20 mM spermidine), NTPs (7.5 mM each, prepared from pH-neutralized stock solutions), DNA template (3 ug), and enzyme (10 uL). For reactions performed in unclarified reaction matrix, GLl4-322 lysates (67.5 uL) were ted into individual reaction tubes, then nactivated as described previously.
Additional reactants were added to heat-inactivated matrix, then mixed well by ing until homogenous. For reactions performed in , the 10X cofactor solution consisted of 300 mM MgC12, 20 mM spermidine, and 400 mM DTT. In addition, 50 mM potassium phosphate pH 7.4 was included in buffer-only reactions. All reactions were incubated for 2 hours at 50°C. Samples from each reaction were quenched by adding 9 volumes RNA quench solution, then clarified by fugation for 1 minute at maximum speed (21,000 x g). tants from these reactions were r diluted 40-fold in quench solution (final dilution: 400-fold), then quantified using the iT kit (see above).
Example 2 Thermostable PPK2 s were codon-optimized for expression in E. coli, synthesized, and cloned into pETDuet-l en). Plasmids were then ormed into GLl6-l70. To generate the Control strain, empty pETDuet-l plasmid was transformed into GLl6-l70. After overnight preculture in 5 mL Lysogeny Broth (LB), strains were cultivated in IL LB at 37°C until cell densities reached an OD600 of approximately 0.5. Cultures were then briefly chilled on ice, and PPK2 expression was induced by adding isopropyl lactopyranoside (IPTG) to a final concentration of 0.25 mM. Post-induction, cultures were grown at 20°C for approximately 16 hours. Cultures were harvested by centrifugation, and the cell pellets stored at -80°C. Lysates were produced by thawing frozen pellets, resuspending in 2 pellet volumes 150 mM MOPS-NaOH pH 7, and homogenizing using 4 passes through an EmulsiFlex C3 homogenizer (Avestin) at 15,000 psi. Lysates were then clarified by centrifugation at 15,000 x g for 1 hour at 4°C. Aliquots of lysates were frozen at - 80°C before use.
Therrnostable PPK2 activity was then measured in heat-inactivated s.
Thawed lysates expressing PPK2 enzymes were first diluted 1:100 into lysates prepared from the Control strain, except for the D. geothermalis PPK2 lysate, which was diluted 1:10. Pre- chilled solutions of manganese chloride (MnClz) and sodium hexametaphosphate (HlVIP) were added to final trations of 10 mM and 1 mM, respectively. Lysates were then heat-inactivated by incubation in a pre-heated 70°C cycler for 15 s. Reactions were then initiated by mixing heat-inactivated lysates with an equal volume of 2X Reaction Buffer, consisting of 10 mM MnClz, 2 mM adenosine diphosphate (ADP) or adenosine monophosphate (AMP), and 9 mM HMP. Reactions were incubated at 70°C, and time points were taken by removing an aliquot of reaction mixture and diluting with 9 parts Quench Solution (200 mM H2SO4) on ice. The initial timepoint (to) was taken by directly mixing lysate with Quench Solution, storing the quenched lysate on ice for 15 minutes, then adding 2X reaction . At the conclusion of the assay, quenched timepoint solutions were clarified by centrifugation at 3,200 x g for 10 minutes. Supernatants from the quenched reactions were then pH neutralized by mixing 3 parts quenched reaction solution with 1 part Neutralization Solution (1M KOH). Quenched and neutralized samples were then diluted 1:10 with water before quantitation using the ine 5’-triphosphate (ATP) inescent Assay Kit (Sigma-Aldrich cat #: FLAA), following kit instructions. Initial reaction rates were calculated based on the accumulation of ATP in PPK2-containing reactions, subtracting ATP concentrations from the Control lysate.
Five Class III PPK2 enzymes exhibited soluble expression, thermostability, and high reaction rates in lysates at 70°C. Representative expression and activity data is shown in Figures 22A-22B.
A y of expression and kinetic data for each tested enzyme is shown in Table 17. The C. aerophila, exus, A. Ihermophila, and R. castenholzii enzymes rapidly converted AMP and ADP to ATP using HMP as a ate. The D. geolhermalis enzyme exhibited conversion rates roughly 20x lower than other tested PPK2s for both AMP and ADP substrates.
Table I 7. Summary ofexpression and rate datafor lhermoslable Class 2 s in lysates.
Source sm Soluble Vmax (ADP) Vmax (AMP) Expression (mM ATP/hr) (mM ATP/hr) C. aerophila DSM 14535 + 600 350 Roseiflexus Sp. RS-l 680 470 A. thermophila UNI-1 530 480 D. geothermalis DSM 11300 +——+ 21 17 R. castenholzz'i DSM 13941 -- 530 370 Example 3 Thermostable C. aerophila PPK2 was then used to supply ATP for cell-free production of dsRNA from NMPs, ADP, and HMP. Cell-free dsRNA synthesis ons were performed with a mixture of six E. coli lysates individually overexpressing the kinases ed in Table 18.
Table 18. Kinases used to e dsRNA from NMPS andHMP.
ADP, CDP, GDP, UDP Aquifex aeolicus AMP, ADP, HMP Caldilinea aermhila DSM 14535 13ka First, s detailed in Table 18 were combined in equal volumes on ice. Pre- chilled solutions of manganese chloride (MnClz), magnesium sulfate (MgSO4), and sodium hexametaphosphate ) were added to final concentrations of O — 2.5 mM, 30 mM, and 1 mM, respectively. The lysate mixture was then then heat-inactivated by incubation in a pre- heated 70°C thermocycler for 15 minutes. To initiate the reactions, heat-inactivated lysates were combined with the following components: an equimolar mixture of nucleotide monophosphates (adenosine 5’-monophosphate, cytidine 5’-monophosphate, uridine 5’- monophosphate, and guanosine 5’-monophosphate, 2 mM each), 50 mM Tris pH 7.0, 30 mM MgSO4, O — 2.5 mM MnCl; 1 mM adenosine hosphate, 2 mM spermidine, 1.5 ug plasmid DNA template, and 3 ug thermostable T7 RNA polymerase (S43OP, F8491, F88OY) in a total volume of 20 uL. As a l, dsRNA was synthesized from an equimolar mixture of 2 mM NTPs (with lysates, ADP, and WP omitted). As an onal control, dsRNA was synthesized from an equimolar mixture of 2 mM NMPs (with PPK2-expressing lysate, ADP, and HMP omitted, but including 8 mM ATP as an energy source). As ve controls, duplicate reactions were performed omitting polymerase. All reactions were incubated at 50°C for 2 hours, then terminated by the on of 9 volumes TE+ buffer (10 mM Tri s-HCl pH 8.0, 5 mM EDTA). Samples were mixed with an equal volume of 2X RNA Loading Dye (New England Biolabs) and heated to 70°C for 10 s, followed by agarose/TAE gel electrophoresis.
As shown in Figure 23, the desired dsRNA t was produced in buffer using NTPs (left lanes), in nucleotide kinase-expressing lysates from NMPs and ATP (middle lanes), and in nucleotide kinase and polyphosphate -expressing s from NMPs and HMP (right lanes). Manganese chloride was not required in any reaction, demonstrating that the C. aerophila enzyme can utilize Mg2+ as a cofactor as well as Mn2+. Therefore, Mn2+ is not required apriori for cell-free reactions containing C. aerophila PPK2.
As shown in Figure 24, the d dsRNA product was produced in buffer using NTPs (left lanes), in nucleotide kinase-expressing s from NMPs and ATP (middle lanes), and in nucleotide kinase and polyphosphate kinase-expressing lysates from NMPs and HMP (right . dsRNA production from NMPs and HMPs did not require exogenous ADP or T lhermophilus AMP kinase. Therefore, C. aerophila PPK2 can be used as part of a -kinase system to produce dsRNA from NMPs and WP in cell-free reactions.
Other Embodiments In the claims articles such as "a," "an," and "the" may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include "or" between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or s unless indicated to the ry or otherwise evident from the context. The invention includes embodiments in which exactly one member of the group is present in, ed in, or otherwise relevant to a given product or process. The invention es embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.
] Furthermore, the invention encompasses all variations, combinations, and permutations in which one or more limitations, elements, clauses, and descriptive terms from one or more of the listed claims is introduced into r claim. For example, any claim that is dependent on another claim can be modified to include one or more limitations found in any other claim that is dependent on the same base claim. Where elements are presented as lists, e.g., in Markush group format, each subgroup of the elements is also disclosed, and any element(s) can be removed from the group. It should it be understood that, in general, where the invention, or aspects of the invention, is/are referred to as comprising particular elements and/or features, certain embodiments of the invention or aspects of the invention consist, or consist essentially of, such elements and/or features. For purposes of simplicity, those embodiments have not been cally set forth in haec verba herein. It is also noted that the terms "comprising" and "containing" are intended to be open and permits the inclusion of additional elements or steps. Where ranges are given, endpoints are included. Furthermore, unless otherwise indicated or otherwise evident from the context and tanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value or sub—range within the stated ranges in ent embodiments of the invention, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise.
This application refers to s issued patents, published patent applications, journal articles, and other publications, all of which are incorporated herein by reference. If there is a conflict between any of the incorporated references and the instant specification, the specification shall control. In addition, any particular embodiment of the present invention that falls within the prior art may be explicitly excluded from any one or more of the .
Because such embodiments are deemed to be known to one of ordinary skill in the art, they may be excluded even if the exclusion is not set forth explicitly herein. Any particular embodiment of the invention can be excluded from any claim, for any reason, whether or not related to the existence of prior art.
Those d in the art will recognize or be able to ascertain using no more than routine mentation many equivalents to the specific embodiments described herein. The scope of the t ments described herein is not intended to be limited to the above Description, but rather is as set forth in the appended claims. Those of ry skill in the art will appreciate that various s and modifications to this description may be made without departing from the spirit or scope of the present invention, as defined in the following claims.
References 1. Maekewa K, Tsunasawa S., Dibo G., Sakiyama F. 1991. "Primary structure of nuclease P1 from Penicillium um." Eur. J. Biochem. 200:651-661. 2. Volbeda A, Lahm A., Sakiyama F., Suck D. 1991. Crystal structure of Penicillium citrinum P1 nuclease at 2.8-A resolution. E1Vfl30 J. 10: 1607-1618(1991) 3. Romier C., Dominguez R., Lahm A., Dahl O., Suck D. 1998. Recognition of single- stranded DNA by nuclease P1: high resolution crystal ures of complexes with substrate analogs. Proteins 32:414-424 Cheng Z.F., Deutscher MP. 2002. Purification and characterization of the Escherichia coli exoribonuclease RNase R. ison with RNase II. J. Biol. Chem. 277 :21624- 21629.
Zilhao R., Camelo L., Arraiano CM. 1993. DNA sequencing and expression of the gene rnb encoding Escherichia coli ribonuclease 11. Mol. Microbiol. 8:43-51 March P.E., Ahnn J M. 1985. The DNA sequence of the gene (rnc) encoding ., Inouye ribonuclease III of Escherichia coli. Nucleic Acids Res. 13 :4677-4685 Chen S.M., TakiffH.E., Barber A.M., Dubois G.C., Bardwell J.C., Court D.L. 1990.
Expression and characterization of RNase III and Era proteins. Products of the mc operon ofEscherichia coli. J. Biol. Chem. 265:2888-2895 Robertson H.D., Webster R.E., Zinder ND. 1968. ation and properties of ribonuclease 111 from Escherichia coli. J. Biol. Chem. -91.
Molina L., Bernal P., Udaondo Z., Segura A., Ramos J.L.2013. Complete Genome Sequence of a Pseudomonas putida Clinical Isolate, Strain H8234. Genome Announc. 1:E00496-13, and Cheng, Z.F. and MP. Deutscher. 2002. Purification and characterization of the Escherichia coli exoribonuclease RNAse R. Comparison with RNAse 11. J Biol Chem. 277(24).
. Even S., Pellegrini 0., Zig L., Labas V., Vinh J., Brechemmier-Baey D., Putzer H. 2005.
Ribonucleases J 1 and J2: two novel endoribonucleases in B.subtilis with functional homology to E.coli RNase E. Nucleic Acids Res. 33 :2141-2152. 11. Li de la -Gallay I., Zig L., Jamalli A., Putzer H. 2008. Structural insights into the dual activity of RNase J. Nat. Struct. Mol. Biol. 15:206-212. 12. Ball T.K., Saurugger P.N., Benedick M.J. 1987. The extracellular nuclease gene of Serratia marcescens and its secretion from Escherichia coli. Gene 57: 183-192. 13. Biedermann K, Jepsen P.K., Riise E., Svendsen I. 1989. Purification and characterization of a Serratia marcescens nuclease produced by Escherichia coli. Carlsberg Res. Commun. 54:17-27. 14. Shlyapnikov S.V., Lunin V.V., Perbandt M., Polyakov K.M., Lunin V.Y., Levdikov V.M., Betzel C., Mikhailov AM. 2000. Atomic structure of the Serratia marcescens endonuclease at 1.1 A resolution and the enzyme reaction mechanism. Acta Crystallogr.
D -572.
. Zuo Y., Deutscher MP. 2002. Mechanism of action of RNase T. 1. Identification of residues required for catalysis, substrate binding, and zation. J. Biol. Chem. 277:50155-50159. 16. Zuo Y., Zheng H., Wang Y., Chruszcz M., Cymborowski M., Skarina T., Savchenko A., ra A., Minor W. 2007. Crystal ure of RNase T, an exoribonuclease involved in tRNA maturation and end turnover. Structure 15 :417-428. 17. Huang S., Deutscher MP. 1992. Sequence and riptional analysis of the ichia coli rnt gene encoding RNase T. J. Biol. Chem. 267:25609-25613. 18. Chauhan A.K., Miczak A., Taraseviciene L., Apirion D. 1991. Sequencing and expression of the me gene of Escherichia coli. Nucleic Acids Res. 19: 125-129. 19. Cormack R.S., Genereaux J.L., Mackie GA. 1993. RNase E activity is conferred by a single ptide: pression, ation, and ties of the ams/me/hmpl gene product.Proc. Natl. Acad. Sci. USA. 90:9006-9010.
. Meador J. 111, Kennell D. 1990. Cloning and sequencing the gene encoding ichia coli clease I: exact physical mapping using the genome library. Gene 95: 1-7. 21. Awano N., Raj agopal V., Arbing M., Patel S., Hunt J Phadtare S. 2010.
., Inouye M., Escherichia coli RNase R has dual activities, helicase and RNase. J. Bacteriol. 192: 1344- 1352. 22. Regnier P., Grunberg-Manago M., Portier C. 1987. Nucleotide sequence of the pnp gene of Escherichia coli encoding polynucleotide phosphorylase. Homology of the primary structure of the protein with the RNA-binding domain of ribosomal protein S1. J. Biol.
Chem. 262:63-68. 23. Kimhi Y., Littauer U.Z. 1968. Purification and properties of polynucleotide phosphorylase from Escherichia coli. J. Biol. Chem. 243 :23 1-240. 24. Shi Z., Yang W.Z., Lin-Chao S., Chak K.F., Yuan HS. 2008. Crystal structure of Escherichia coli PNPase: central channel es are involved in processive RNA degradation. RNA 14:2361-2371.
. Thaller M.C., Schippa S., Bonci A., Cresti S., Rossolini GM. 1997. fication of the gene (aphA) ng the class B acid atase/phosphotransferase of Escherichia coli MG1655 and characterization of its product. FEMS Microbiol. Lett. 146: 191-198. 26. Forleo C., Benvenuti M., Calderone V., Schippa S., Docquier J.D., Thaller M.C., Rossolini G.M., Mangani S. 2003. Expression, purification, crystallization and preliminary X-ray characterization of the class B acid phosphatase (AphA) from ichia coli. Acta Crystallogr. D 59: 1058-1060. 27. Shuttleworth H., Taylor J Minton N. 1986. ce of the gene for ne phosphatase from Escherichia coli JM83. Nucleic Acids Res. 14:8689-8689. 28. Bradshaw R.A., Cancedda F., on L.H., Neumann P.A., Piccoli S.P., Schlesinger M.J., Shriefer K, Walsh KA. 1981. Amino acid sequence of Escherichia coli alkaline phosphatase. Proc. Natl. Acad. Sci. USA. 78:3473-3477. 29. Li C., Ichikawa J.K., Ravetto J.J., Kuo H.-C., Fu J.C., Clarke S. 1994. A new gene involved in stationary-phase survival located at 59 minutes on the Escherichia coli chromosome. J. Bacteriol. 176:6015-6022.
. Kuznetsova E., Proudfoot M., Gonzalez C.F., Brown G., Omelchenko M.V., Borozan I., Carmel L., Wolf Y.I., Mori H., nko A.V., Arrowsmith C.H., Koonin E.V., Edwards A.M., Yakunin AF. 2006. Genome-wide analysis of substrate specificities of the Escherichia coli haloacid dehalogenase-like phosphatase family. J. Biol. Chem. 281 :36149-36161. 31. Burns D.M., Beacham IR. 1986. Nucleotide sequence and riptional analysis of the E. coli ushA gene, encoding periplasmic UDP-sugar hydrolase cleotidase): regulation of the ushA gene, and the signal sequence of its encoded protein product.
Nucleic Acids Res. 14:4325-4342. 32. Knoefel T., Straeter N. 1999. X-ray structure of the Escherichia coli asmic 5'- nucleotidase containing a dimetal catalytic site. Nat. Struct. Biol. 453. 33. Tremblay L.W., Dunaway-Mariano D., Allen KN. 2006. Structure and activity analyses of Escherichia coli K-12 NagD provide insight into the evolution of biochemical function in the haloalkanoic acid dehalogenase superfamily. Biochemistry 45: 1 183-1 193. 34. Golovan S., Wang G., Zhang J CW. 2000. Characterization and ., Forsberg overproduction of the ichia coli appA encoded bifunctional enzyme that exhibits both phytase and acid phosphatase activities. Can. J. Microbiol. 46:59-71.
. Greiner R., Jany K-D. 1991. Characterization of a phytase from Escherichia coli. Biol.
Chem. Hoppe-Seyler 372:664-665. 36. El Bakkouri M, e I, Kanjee U, Zhao B, Yu M, Goret G, Schoehn G, Burrneister WP, Houry WA. 2010. Structure of RavA MoxR AAA+ protein reveals the design principles of a molecular cage modulating the inducible lysine decarboxylase ty.
Proc Natl Acad Sci U S A 107(52),22499-504. PMID: 21148420 37. Tchigvintsev A, Tchigvintsev D, Flick R, Popovic A, Dong A, Xu X, Brown G, Lu W, Wu H, Cui H, Dombrowski L, J00 JC, azova N, Min J, Savchenko A, Caudy AA, Rabinowitz JD, Murzin AG, Yakunin AF. 2013. Biochemical and structural studies of conserved maf proteins revealed nucleotide pyrophosphatases with a preference for modified nucleotides. Chem Biol 20(11),1386-98. PMID: 24210219 38. Zhang J ., Inouye M. 2002. MazG, a nucleoside triphosphate pyrophosphohydrolase, interacts with Era, an essential GTPase in Escherichia coli. J. Bacteriol. 184:5323-5329. 39. Smallshaw J.E., Kelln RA. 1992. g, nucleotide sequence and expression of the Escherichia coli K-12 pyrH gene encoding U1V1P kinase. Life Sci. Adv. (Genet) 11:59- 40. Briozzo P., Evrin C., Meyer P., Assairi L., Joly N., Barzu O., Gilles A.-M. 2005.
Structure of Escherichia coli U1V1P kinase differs from that of other nucleoside monophosphate kinases and sheds new light on enzyme regulation. J. Biol. Chem. 533-25540. 41. Masui R., Kurokawa K, Nakagawa N., Tokunaga F., Koyama Y., Shibata T., Oshima T., Yokoyama S., Yasunaga T., Kuramitsu S. Complete genome sequence of Thermus thermophilus HB8. Submitted (NOV-2004) to the EMBL/GenBank/DDBJ databases. 42. Marin C., Escamilla-Honrubia J.M., Rubio V. 2005. First-time crystallization and preliminary X-ray crystallographic analysis of a bacterial-archaeal type U1V1P kinase, a key enzyme in microbial pyrimidine biosynthesis. Biochim. Biophys. Acta 1747:271-275. 43. Marco-Marin C., Escamilla-Honrubia J.M., Rubio V. 2005. First-time crystallization and inary X-ray crystallographic analysis of a ial-archaeal type U1V1P kinase, a key enzyme in ial pyrimidine biosynthesis. Biochim. Biophys. Acta 1747:271-275. 44. Fricke J Neuhard J Kelln R.A., en S. 1995. The cmk gene encoding cytidine ., ., osphate kinase is located in the rpsA operon and is required for normal ation rate in ichia coli. J. Bacteriol. 177:517-523. 45. Briozzo P., Golinelli-Pimpaneau B., Gilles A.M., Gaucher J.F., Burlacu-Miron S., Sakamoto H., Janin J Barzu O. 1998. Structures of Escherichia coli CMP kinase alone and in compleX with CDP: a new fold of the nucleoside monophosphate binding domain and insights into cytosine nucleotide specif1city. Structure 6: 1517-1527. 46. Maeder D.L., Weiss R.B., Dunn D.M., Cherry J.L., Gonzalez J.M., iero J., Robb ET. 1999. Divergence of the hyperthermophilic archaea Pyrococcus furiosus and P. horikoshii inferred from complete genomic sequences. Genetics 152: 1299-1305. 47. Gentry D, Bengra C, Ikehara K, Cashel M. 1993. Guanylate kinase of Escherichia coli K- 12." J Biol Chem 1993,268(19),14316-21. PMID: 8390989. 48. Hible G, Daalova P, Gilles AM, Cherfils J. 2006. Crystal structures of GMP kinase in complex with ganciclovir monophosphate and Ap5G." Biochimie 88(9),1157-64. PMID: 49. Nelson K.E., Clayton R.A., Gill S.R., Gwinn M.L., Dodson R.J., Haft D.H., Hickey E.K., Peterson J.D., Nelson W.C., Ketchum K.A., McDonald L.A., Utterback T.R., Malek J.A., Linher K.D., Garrett M.M., Stewart A.M., Cotton M.D., Pratt M.S. Fraser CM. 1999.
Evidence for lateral gene transfer between Archaea and Bacteria from genome sequence of Thermotoga maritima. Nature 399:323-329. 50. Brune M., Schumann R., Wittinghofer F. 1985. Cloning and sequencing of the ate kinase gene (adk) of Escherichia coli. Nucleic Acids Res. 13 :7139-715 1. 51. Berry M.B., Bae E., Bilderback T.R., Glaser M., Phillips G.N. Jr. 2006. Crystal structure of ADP/AMP complex of Escherichia coli adenylate kinase. Proteins 62:555-556. 52. Henne A., Brueggemann H., Raasch C., Wiezer A., Hartsch T., ang H., Johann A., Lienard T., Gohl 0., Martinez-Arias R., Jacobi C., StarkuViene V., czeck S., Dencker S., Huber R., Klenk H.-P., Kramer W., Merkl R., Gottschalk G., Fritz H.-J. 2004. The genome sequence of the extreme thermophile Thermus thermophilus. Nat.
Biotechnol. 22:547-553. 53. Tan ZW, Liu J, Zhang XF, Meng FG, Zhang YZ.Nan Fang Yi Ke Da Xue Xue Bao. 2010. Expression, purification and enzymatic characterization of adenylate kinase of Thermus thermophilus HB27 in ichia coli..Jan,30(1):1-6 54. Moffatt B.A., Dunn J.J r FW. 1984. Nucleotide sequence of the gene for bacteriophage T7 RNA rase. J. Mol. Biol. 173:265-269. 55. Sousa R., Chung Y.J., Rose J.P., Wang B.-C. 1993. Crystal structure of bacteriophage T7 RNA rase at 3.3-A resolution. Nature 364:593-599. 56. Mindich L., Nemhauser I., eb P., Romantschuk M., Carton J Frucht S., Strassman J Bamford D.H., Kalkkinen N. 1988. Nucleotide sequence of the large double-stranded RNA segment of iophage phi 6: genes specifying the Viral replicase and transcriptase. J. Virol. 62: 1 180-1 185. 57. McGraw N.J., Bailey J.N., Cleaves G.R., Dembinski D.R., Gocke C.R., Joliffe L.K., Macwright R.S., McAllister WT. 1985. Sequence and analysis of the gene for bacteriophage T3 RNA polymerase. Nucleic Acids Res. 13 :6753-6766. 58. Kotani H., ki Y., a N., Obayashi A. 1987. Nucleotide sequence and expression of the cloned gene of bacteriophage SP6 RNA polymerase. Nucleic Acids Res. :2653-2664.
Sequences E. coli RNase R MSQ3P14'Q41R41A41 VLQGWT3TAG TQ -TVFRAV\TPQGVRVT S F < {PTALTLLAH3YLT/\TQVHRHAPARG *1 G J:'\TQ S -TY.L'T3VLVVQV-T *1T.VPB *1VT/\TGQQY3 -T \TAJ:' .AT3 * G1TQ VKJ:'J:'T. -T SKT3 *1QKQTQT. *1ART. .L '.
NPR < {WKFNPAT3L SEQAQWGT3YAAAYAEAL SQT S S T3QAPT/\TYAVPAT3QKT/\TQQ\TR TTVAQVLVT3A T.TT.AW3PRFPQVT3FT3PASVRVE (SEQ ID NO: 15) Roseiflexus caslenholzii DSM 13941 PPK2 MYAQRVVPGMQVQT.HT3TT T3PT3AT\TGGT.NT3YVPPTR (SEQ ID NO 18)
Claims (26)
1. A cell-free method of biosynthesizing ribonucleic acid (RNA), the method comprising: (a) incubating a cell lysate mixture that comprises RNA and at least one enzymatic ty selected from the group consisting of enzymatic activities that depolymerize RNA, thermostable kinase activities, and thermostable RNA polymerase activities, under conditions that result in depolymerization of RNA to produce a cell lysate mixture that comprises nucleoside monophosphates; (b) g the cell lysate mixture produced in step (a) to a temperature that inactivates or partially inactivates endogenous nucleases and phosphatases without completely inactivating the thermostable kinase ties and stable RNA polymerase activities, to produce a cell lysate mixture that comprises heat-inactivated nucleases and phosphatases; and (c) ting the cell lysate mixture produced in (b) in the presence of an energy source and a ibonucleic acid (DNA) template encoding a RNA of interest, under conditions that result in production of nucleoside triphosphates and rization of the nucleoside triphosphates to produce a cell lysate mixture that comprises the RNA of interest.
2. The method of claim 1, wherein the cell lysate e comprises a single cell lysate obtained from cells that comprise RNA and express at least one enzyme or fusion enzyme that acts as a ribonuclease, acts as a kinase, and/or acts as a RNA polymerase.
3. The method of claim 1, wherein the cell lysate mixture comprises at least two cell lysates, wherein at least one cell lysate is obtained from cells that comprise RNA, and at least one cell lysate is ed from cells that express at least one enzyme or fusion enzyme that acts as a nuclease, acts as a kinase, and/or acts as a RNA polymerase.
4. The method of any one of claims 1-3, wherein the RNA of step (a) is messenger RNA (mRNA), transfer RNA (tRNA), or ribosomal RNA (rRNA).
5. The method of any one of claims 1-4, wherein the cell lysate mixture comprises at least one ribonuclease, at least one thermostable kinase, and/or at least one stable RNA polymerase.
6. The method of claim 5, wherein the at least one ribonuclease is selected from the group consisting of S1 nuclease, Nuclease P1, RNase II, RNase III, RNase R, RNase JI, NucA, PNPase, RNase T, RNase E, and RNaseG.
7. The method of claim 6, wherein the at least one ribonuclease is Escherichia coli RNase R.
8. The method of any one of claims 5-7, wherein the at least one thermostable kinase is selected from the group consisting of thermostable nucleoside monophosphate kinases, thermostable nucleoside diphosphate kinases, and thermostable polyphosphate kinases.
9. The method of claim 8, wherein the thermostable side monophosphate kinases are selected from the group consisting of thermostable uridylate kinases, thermostable cytidylate kinases, thermostable guanylate kinases, and thermostable adenylate kinases.
10. The method of claim 9, wherein the thermostable side monophosphate s are selected from the group consisting of thermostable Pyrococcus furiosus uridylate kinases encoded by a pyrH gene (PfPyrH), thermostable Thermus thermophilus adenylate kinases encoded by a adk gene (TthAdk), thermostable Thermus thermophilus late kinases encoded by a cmk gene (TthCmk), and thermostable Thermotoga maritima guanylate kinases encoded by a gmk gene (TmGmk).
11. The method of any one of claims 8-10, wherein the thermostable nucleoside phate kinases are selected from the group ting of thermostable side diphosphate s encoded by a Aquifex aeolicus ndk gene.
12. The method of any one of claims 8-10, wherein the thermostable polyphosphate kinases are selected from the group ting of thermostable polyphosphate kinase 1 (PPK1) enzymes and thermostable polyphosphate kinase 2 (PPK2) enzymes.
13. The method of claim 12, wherein the thermostable PPK1 enzymes are selected from the group consisting of thermostable Thermosynechococcus elongatus PPK1 enzymes.
14. The method of claim 12 or 13, wherein the thermostable PPK2 s are selected from the group consisting of thermostable Class III PPK2 enzymes.
15. The method of claim 14, n the thermostable Class III PPK2 enzymes are selected from the group ting of Meiothermus ruber, Meiothermus silvanus, Deinococcus geothermalis, Thermosynechococcus tes, Anaerolinea thermophile, Caldilinea aerophila, Chlorobaculum tepidum, Oceanithermus profundus, Roseiflexus castenholzii, Roseiflexus sp., and Truepera radiovctrix PPK2 enzymes.
16. The method of claim 15, wherein the thermostable Class III PPK2 enzymes are selected from the group consisting of thermostable Class III PPK2 enzymes that comprise an amino acid sequence that is at least 70% identical to the amino acid sequence identified by any one of SEQ ID NO: 8-18.
17. The method of claim 16, n the thermostable Class III PPK2 enzymes are selected from the group consisting of thermostable Class III PPK2 enzymes that comprise an amino acid sequence that is identical to the amino acid sequence identified by any one of SEQ ID NO: 8-18.
18. The method of any one of claims 1-17, wherein the cell lysate mixture comprises at least one ribonuclease, at least one stable nucleoside monophosphate kinase, at least one stable nucleoside diphosphate kinase, and at least one polyphosphate kinase.
19. The method of any one of claims 5-18, wherein the at least one thermostable RNA rase is selected from the group consisting of thermostable DNA-dependent RNA polymerases.
20. The method of claim 19, wherein the thermostable DNA-dependent RNA polymerases are selected from the group consisting of thermostable T7 RNA polymerases, thermostable SP6 RNA rases, and stable T3 RNA polymerases.
21. The method of claim 20, wherein the at least one thermostable RNA polymerase is a thermostable T7 RNA polymerase.
22. The method of any one of claims 1-21, wherein the energy source is adenosine triphosphate (ATP) or an ATP regeneration system, optionally wherein the ATP regeneration system comprises polyphosphate, optionally taphosphate, nucleoside monophosphates, and polyphosphate kinase.
23. The method of any one of claims 1-22, wherein the cell lysate e of step (a) comprises the DNA template encoding the RNA of interest and/or the DNA template encoding the RNA of interest is added to the cell lysate mixture of step (c).
24. The method of any one of claims 1-23, wherein the RNA of interest is a singlestranded RNA or a double-stranded RNA.
25. An engineered cell comprising at least one thermostable nucleoside monophosphate kinase, at least one thermostable nucleoside phate kinase, and at least one thermostable polyphosphate .
26. A cell lysate comprising side triphosphates, a deoxyribonucleic acid (DNA) encoding a ribonucleic acid (RNA) of interest, and RNA polymerase activity. (ZN—mt 22,5356:on m cozommm mBEmoEgmfi mmmquboqk_n_ON: :0.cm>.co< mfiz N . mamtmezm cozommm mEEmoEES mmmmEx C F Eféon. cozommm mmmmfisc cocozboi mkmhmezm o_._mE>_On_ <2”. SUBSTITUTE SHEET (RULE 26) A—‘ICV_O_I>_OH_ _on_ ACV_O_I>_OO_ mmmEx mmex n_ D< ACV_O_I>_On_ n__>_Z n_._.< FTEOQX AFICV_O_I>_OO_ Evaéon.X n_n_< :éaéon. n_._.< 31-201“X n_n_< >_on_ n_._.< -mumcawocabom mmex >95;me 32250.20 A| Ea
Publications (1)
Publication Number | Publication Date |
---|---|
NZ786906A true NZ786906A (en) | 2022-04-29 |
Family
ID=
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20220064688A1 (en) | Cell-free production of ribonucleic acid | |
US20210309691A1 (en) | Methods and compositions for nucleoside triphosphate and ribonucleic acid production | |
AU2016243623B2 (en) | Cell-free production of ribonucleic acid | |
US20220162659A1 (en) | Cell-free production of ribonucleic acid | |
US20240018559A1 (en) | Genetically engineered bacterium capable of producing cytokinins with isoprenoid side chains | |
NZ786906A (en) | Cell-free production of ribonucleic acid | |
RU2777282C2 (en) | Methods and compositions for the production of nucleoside triphosphate and ribonucleic acid | |
RU2776637C2 (en) | Acellular sugar production |