NZ786229A - Extended release conjugates of exenatide analogs - Google Patents

Extended release conjugates of exenatide analogs

Info

Publication number
NZ786229A
NZ786229A NZ786229A NZ78622917A NZ786229A NZ 786229 A NZ786229 A NZ 786229A NZ 786229 A NZ786229 A NZ 786229A NZ 78622917 A NZ78622917 A NZ 78622917A NZ 786229 A NZ786229 A NZ 786229A
Authority
NZ
New Zealand
Prior art keywords
optionally substituted
alkyl
aryl
arylalkyl
agonist
Prior art date
Application number
NZ786229A
Inventor
Eric L Schneider
Brian Hearn
Jeffrey C Henise
Gary W Ashley
Daniel V Santi
Original Assignee
Prolynx Llc
Filing date
Publication date
Application filed by Prolynx Llc filed Critical Prolynx Llc
Publication of NZ786229A publication Critical patent/NZ786229A/en

Links

Abstract

Extended-release conjugates of stabilized GLP 1 agonists balance agonist stability with release rates to provide long lasting administration to treat diabetes and related conditions on once-a-month or less frequent dosing schedules.

Description

ED RELEASE CONJUGATES OF EXENATIDE ANALOGS Technical Field The invention is in the field of drug-delivery and sustained-release formulations.
More particularly, it concerns ned-release compositions that deliver stabilized forms of GLP-1 agonists over periods of one month or more. [0001a] The entire disclosure in the complete specification of our Australian Patent Application No. 746648 is by this cross-reference incorporated into the present specification.
Background Art ide is a 39-amino acid e that is a potent agonist of the GLP-1 receptor, making it an insulin secretagogue with glucoregulatory effects. It is widely used in the treatment of type 2 diabetes as the free peptide, marketed as Byetta® (Astra- Zeneca), the peptide is injected twice-daily due to the short in vivo half-life of 2.5 hours.
It is highly desirable to extend the ife of exenatide and related GLP-1 agonist peptides so as to improve their efficacy, decrease side effects, and ease the treatment burden on patients.
Peptide half-life is traditionally extended by one or a combination of several methods: (i) chemical modification of the peptide to slow metabolism; (ii) encapsulation to e a slow-release depot formulation; and (iii) conjugation with a macromolecule to slow clearance. See, for example, Cai, et al., Drug Design, Development, and y (2013) 7:963-970.
Chemical cations of the peptide to increase half-life have resulted in ily GLP-1 agonists, for example lixisenatide (Lyxumia®) and liraglutide (Victoza®).
Encapsulation of the e into PLGA (poly lactic-coglycolic acid) microparticles has been used to produce a slow-release formulation, marketed as Bydureon® (Astra-Zeneca), that allows for once-weekly subcutaneous injection. Attempts to extend the duration of Bydureon to once-monthly administrations using triglyceride formulations have not yet proven successful. Conjugation of GLP-1 peptide agonists with Fc antibody domains or with random-sequence polypeptides (XTEN) has been able to extend the half-life only up to 5-6 days. 18563198_1 (GHMatters) P109745.NZ.1 It is convenient to consider the plasma half-life, the time required to lose one half of the drug from the system, in understanding dosing requirements. Dosing frequency is determined by the need to maintain drug levels at or above a certain efficacious level. If dosing is to occur once every half-life, then the dose must be such as to give an initial drug level 2x the efficacious level; similarly, if dosing to occur once every 2 half-lives, then the dose must be such as to give an initial drug level 4x the efficacious level. In theory, dosing could be made as infrequent as desired regardless of the ife simply by increasing the amount of drug given per dose. Many drugs show ties that are related to high initial concentrations, however, placing a practical limitation on dosing frequency as a function of half-life. Dosing intervals of approximately 1-2 half-lives are typical. While l preparations of GLP-1 agonist peptides having suitable effective half-lives for once-monthly administration have been disclosed, these suffer several disadvantages. Encapsulating microspheres and ransition lipid formulations may suffer from initial burst-phase release of the peptide, exposing the patient to an initial undesirably high drug level. table pumps require surgery for implantation and removal.
Initial bursts of drug release can be avoided through the use of ntly linked conjugates. While soluble, circulating conjugates typically do not have a sufficient halflife themselves to support once-monthly drug administration (the maximal half-life of poly(ethylene glycol) in humans is about 1 week), insoluble conjugate implants such as hydrogels are suitable. Compositions wherein drugs such as exenatide are covalently linked to various matrices through linkers having controllable rates of drug e have been previously disclosed, for example in U.S. Patents 315; U.S. 8,754,190; U.S. 8,703,907, including insoluble matrices as disclosed in U.S. 8,946,405 and from hydrogels as disclosed in US2014/0288190 (‘190). In one ment in the ‘190 publication, exenatide is linked to a hydrogel matrix wherein upon injection into the subcutaneous space, the hydrogel es a depot from which exenatide is released by beta-eliminative ge of the linker to provide a long-acting source of the drug. Such hydrogels are by definition composed ily of water, and the exenatide is therefore exposed to an aqueous nment for the duration of the depot. While this aqueous environment is considered ageous for maintaining the complex structure of proteins, certain peptide sequences may suffer ilities under such long-term conditions. 98_1 (GHMatters) P109745.NZ.1 It has been found that the rate of degradation of exenatide in hydrogels under physiological conditions makes once-monthly or even less frequent administration of such formulations impractical. Exenatide has been reported to show chemical instabilities under stressed conditions (pH 7.9, 40°C for 6 days) resulting from ion at M14 and W25 and from side-chain amide hydrolysis at Q13 and N28 (US patent application 2006/0194719; Zealand). Detailed kinetics of the instability were not disclosed. While a detailed model for ation of Asn residues in peptides has been described (Geiger & Clarke, J. Biol. Chem. (1987) 262:785-794), the rate of deamidation of peptides and proteins under physiological conditions is known to be highly le son & Robinson, Proc Natl Acad Sci (2010) 98:12409-12413). Exenatide itself is sufficiently stable for twice-daily administration (Byetta®), and for once-weekly administration via a PLGA implant (Bydureon®).
Stabilized forms of exenatide have been disclosed. For e, PCT application WO2008/116294 (Matregen) discloses stabilized exenatide s modified at three positions: Q13, M14 and N28. While multiple amino acid substitutions in the exenatide sequence can be tolerated, it has now been found that replacement of N28 by a more stable residue is sufficient for effective stabilization of the e at pH 7.4, 37 oC.
Several products of exenatide deamidation, for example N28D and oD, have been disclosed in the cited US patent ation 2006/0194719 (Zealand) and found to maintain y for GLP-1 receptor activation. These products form an interconverting system, however, and are unstable towards equilibration to the original mixture of products. ed igations of the fate of exenatide in aqueous buffers at pH 7.4, 37°C, (i.e., physiological pH and temperature) have shown that it undergoes deamidation at Asn28 (N28) with a half-life of between 8 and 14 days, depending on the buffer. A hydrogel conjugate designed for once-monthly administration would thus be releasing primarily degradation products of exenatide after 8-14 days. It is thus essential for the stabilized GLP-1 agonist to have a sufficient resistance toward chemical degradation to minimize the amount of degraded forms released by the end of the administration period.
This is ed when the GLP-1 agonist forms less than 10% degradation products after one month at pH 7.4, 37°C, preferably less than 5% degradation products after one month at pH 7.4, 37°C. 18563198_1 (GHMatters) P109745.NZ.1 Disclosure of the Invention The present invention is directed to conjugates that provide extended release of stabilized GLP-1 agonist peptides that t once-monthly or even less frequent administration of these es and are useful in the treatment of metabolic diseases and ions such as metabolic syndrome, diabetes and obesity. The conjugates combine the extended stability of the GLP-1 agonist with the controlled release time provided by a suitable linker to a oir matrix that serves as a depot for release.
In one aspect, the present invention provides extended release conjugates sing an insoluble matrix with a multiplicity of covalently attached linker-peptides, wherein the linkers cleave under logical ions of pH and temperature to release the free peptide and wherein the peptide is a stabilized GLP-1 agonist which shows degradation of less than 10% over one month at pH 7.4, 37°C. The conjugates of the invention can be illustrated schematically as formula (1) M-(L-E)x (1) wherein M is an insoluble matrix connected to a multiplicity (x) of GLP-1 agonist peptides E through cleavable linker L. E is a GLP-1 t stabilized with respect to degradation that occurs under physiological conditions of pH and temperature to show ation of less than 10% over one month. x is an integer that represents the number of L-E moieties that yield suitable concentrations in the volume of the matrix. Suitable concentrations are 1-1000 mg peptide per ml matrix. The linker L releases free peptide with a half-life suitable for the desired period of administration.
In a second aspect, the present invention provides linker-peptides L-E having the formula (4) R 2 R 5 O R 1 C C O C N E (4) H R 5 wherein at least one, or both R1 and R2 is ndently CN; NO2; optionally substituted aryl; optionally substituted heteroaryl; optionally substituted alkenyl; ally substituted alkynyl; COR3 or SOR3 or SO2R3 wherein 98_1 (GHMatters) P109745.NZ.1 R3 is H or optionally substituted alkyl; aryl or arylalkyl, each optionally substituted; heteroaryl or heteroarylalkyl, each optionally substituted; or R3 is OR9 or NR92 wherein each R is independently H or ally substituted alkyl, or both R9 groups taken together with the nitrogen to which they are attached form a heterocyclic ring; SR4 wherein R4 is optionally substituted alkyl; aryl or arylalkyl, each optionally substituted; or heteroaryl or heteroarylalkyl, each optionally tuted; wherein R1 and R2 may be joined to form a 3-8 membered ring; and wherein one and only one of R1 and R2 may be H or alkyl, kyl or heteroarylalkyl, each optionally substituted; and wherein one of R5 is (CH2)yZ, (CH2CH2O)xCH2CH2Z or (CH2)yNH-CO-(CH2CH2O)x CH2CH2Z, wherein x is 1-100, y = 1-6, and the other R5 is H, alkyl, alkenylalkyl, alkynylalkyl, aryl, arylalkyl, heteroaryl or heteroarylalkyl, each ally substituted; Z is a functional group for mediating coupling to the insoluble matrix, and NH is the residue of an amino group of GLP-1 agonist E.
In one embodiment, R1 is CN or R3SO2, n R3 is alkyl or R92N, wherein each R9 is H, alkyl or substituted alkyl, one R5 is H and the other R5 is (CH2)nZ wherein n = 1-6 and Z is a functional group through which the linker-peptide can be attached to M.
In one embodiment, E is [N28Q]exenatide (SEQ ID NO:2). The invention also es this peptide and any pharmaceutically acceptable salts and pharmaceutical compositions thereof, as well as a ol for stering a GLP-1 agonist which comprises administering to a subject having a condition benefited by a GLP-1 agonist, a composition that employs this peptide on its salt.
In a third aspect, the invention is ed to protocols for administering the conjugates of formula (1). In one embodiment, the conjugates are prepared as hydrogel microspheres suitable for subcutaneous injection using a narrow-gauge needle. It is expected that the conjugates of the invention are useful for the treatment of lic diseases and conditions in both humans and s. Extended dosages of 1-3 months are achieved. 18563198_1 (GHMatters) P109745.NZ.1 Brief Description of the gs Figures 1-6 are schematic representations of various embodiments of the extended-release conjugates of the invention.
Figures 1A and 1B show an l view of the conjugate in outline form. In Figure 1A one of the components is an 8-arm macromonomer and the other is a 4-arm macromonomer and wherein the linker attached to the GLP-1 agonist is coupled to arms of the 8-arm macromonomer. In Figure 1B, the structure provides for attachment of the linker-agonist to the crosslinkers themselves.
Figure 2 shows more detail of the linkages in Figure 1A.
Figure 3 is a schematic of an embodiment wherein a crosslinking moiety that couples the different macromonomers is provided with a reactive group for attachment of the linker-associated agonist.
Figure 4 shows the matrix of Figure 3 with the linker peptide attached.
Figures 5 and 6 show specific embodiments set forth in Example 4 herein.
Figures 7A-7B show the relationship between the e rate of a drug from a conjugate depot relative to the administration frequency and the ve dose required to achieve a set final concentration (Cmin).
Figures 8A-8C show exenatide and exenatide stability in 200 mM phosphate buffer, pH 7.4, 37°C.
Figure 9 shows the results of peptide isoaspartate methyl erase (PIMT) assays for iso-aspartate (isoAsp) content in the isolated peaks from the 56 days exenatide degradation reaction shown in Figures 8A and 8B. IsoAsp determinations of exenatide reaction mixture at t = 0 and 56 days, and isolated components of the degradation mix at 56 days. Values for L-Asp- and D-isoAsp-containing peptides were adjusted for the small amounts of L-isoAsp-peptide detected by HPLC in the samples. The residual PIMT-positive peaks at RV 9.9 and 10.4 are attributed to low-level [L-isoAsp28]exenatide impurities in the isolated HPLC fractions. Error bars are ±SD.
Figure 10 shows the pharmacokinetics of exenatide in the rat after dosing with a hydrogel-linked fied exenatide (R1 = CN; R2 = H). An expected concentration vs. time curve was ted (dashed line) based on the results of in vitro e kinetics (t1/2 = 1400 h) and the known pharmacokinetic parameters of exenatide. Experimental data (squares) are better fit to a model accounting for degradation of exenatide on the hydrogel (solid line) where the overall t1/2 = 190 h. 18563198_1 ters) P109745.NZ.1 Figure 11 shows the pharmacokinetics of [N28Q]exenatide in the rat after s.c. dosing with hydrogel-linked [N28Q]exenatides. Panel A shows a hydrogel wherein the peptide is linked using L with R1 = MeSO2 and gives t1/2 = 350 h. Panel B shows a hydrogel wherein the e is linked to L with R1 = CN and gives t1/2 = 760 h. Thus plasma levels of [N28Q]exenatide can be maintained for at least one month after a single dose.
Figure 12 shows the comparative s of exenatide and [N28Q]exenatide in an oral glucose tolerance test.
Figure 13 shows the AUC analysis for the oral glucose tolerance test data shown in Figure 7.
Figures E show the results of once-monthly dosing of a hydrogel microsphere preparation comprising [N28Q]exenatide ("PL-cmpd") in diabetic ZDF rats.
Figures 15A-15B show the cokinetics of [N28Q]exenatide in rat serum after s.c. dosing of el microsphere preparations comprising exenatide as described in Example 8A.
Figures 16A-16B show serum [N28Q]exenatide levels after SC injection of mice with microsphere conjugates as bed in Example 8B.
Modes of Carrying Out the Invention In order to achieve once-monthly administration of a e, the peptide must be supplied in the form of an insoluble matrix that is not circulating, but that operates as a depot for release of the drug. Circulating macromolecule conjugates of drugs are unsatisfactory as the conjugates lves are cleared from the system, e.g., plasma, per se. Therefore, the peptide must be supplied within a matrix that is on a macro scale and wherein the peptide (or other drug) is present in the volume of the matrix at a tration of 1-1000 mg peptide/ml matrix, preferably 1-100 mg peptide/ml matrix and more preferably 1-50 mg peptide/ml matrix. Thus, the matrix is of discernible volume, and may conveniently and collectively be administered in the form of microspheres. (The "volume of the matrix" is the total volume of the dose however supplied, ing a dose of microspheres.) In order to put the nature of the structures involved in the invention into perspective, applicants supply Figures 1-6 that provide an overview of typical embodiments that fall within the scope of the invention. 18563198_1 (GHMatters) P109745.NZ.1 A depiction of a typical insoluble hydrogel matrix comprising a linked peptide according to the invention is shown in Figure 1A. This is an idealized structure of a matrix formed by crosslinking an 8-arm onomer P with a 4-arm macromonomer T with a stoichiometry such that half of the arms of P are crosslinked with arms of T. The remaining non-crosslinked arms of P are ted to linker-peptide. Preparation of hydrogels of this type is bed in PCT Publication WO2013/036847, and illustrated as described below in Preparation E.
Figure 1B shows an alternative wherein the releasable linker-drug is coupled to the degradable crosslinker. Figure 1B shows an idealized illustrative structure of a matrix formed by crosslinking a 4-arm macromonomer A, wherein each arm of A is ated by a group comprising orthogonal first and second functional groups, with a second 4-arm macromonomer B, wherein each arm of B is terminated with a functional group that is reactive with only one of the first or second functional groups of macromonomer A. The ing functional group of onomer A is available for on with a linkerpeptide comprising a functional group that is reactive with the remaining functional group of the macromonomer. Attachment of the linker-peptide can be performed either prior to gel ion by reaction of macromonomer A with the linker-peptide ed by inking with macromonomer B, or uent to gel formation by crosslinking of A and B to form the hydrogel followed by reaction with linker-peptide. As described above, the crosslinking reaction to form the insoluble hydrogel matrix can be performed either as a bulk material or in a suspension or emulsion so as to form a finely-divided particulate polymer, for example microspheres as described in e 2 herein.
Figure 2 shows a c structure of a crosslink between an 8-arm macromonomer P and a 4-arm macromonomer T in a matrix further comprising n linkerpeptides for each P, as outlined in Figure 1A. An alternative, wherein the linker-agonist is coupled to the crosslinker moieties of the hydrogel is set forth in Figure 1B and Example 4 below.
A generic description of this alternative is provided in Figures 3 and 4. Figure 3 shows an example of derivatization of an insoluble matrix having accessible amine groups with a reagent to introduce cyclooctyne groups. In this example, macromonomer A used in preparation of a matrix as illustrated in Preparation D herein below comprises a lysine residue. Upon formation of the matrix by crosslinking with macromonomer B, the 18563198_1 (GHMatters) P109745.NZ.1 resulting matrix has accessible amine groups suitable for further functionalization, e.g., by reaction with a reagent that introduces a ctyne group.
Figure 4 shows the generic structure of a degradable hydrogel comprising the releasable linker-peptides. Two macromonomers A and B (e.g., as rated in Preparation D herein below) are crosslinked, such that each crosslink comprises a releasable linker-peptide. In the m, each A and B is d by the illustrated crosslink to form an insoluble matrix. Y and Z are connecting functionalities.
Figures 5 and 6 show the structures of the linkages in the extended-release conjugates prepared in Example 4. In Figure 5, the hydrogel matrix comprises crosslinks having degradation controlled by the modulator ethoxy)aminosulfonyl, while e of the peptide of SEQ ID NO: 2 from the hydrogel is controlled by the modulator CN. The connecting functionalities are the triazoles resulting from addition of an azide group to the cyclooctyne MFCO.
Figure 6 shows the same structure as Figure 5 except degradation of both the hydrogel crosslinks and release of the peptide from the hydrogel are controlled by the modulator CN and the connecting functionalities are the les ing from reaction of an azide group to 5-hydroxycyclooctyne.
Matrix M: Matrix M is an insoluble t to which the linker-peptide L-E is attached that serves as the reservoir from which E is released over the duration of treatment. M must be suitable for the attachment of the linker-peptide L-E, or otherwise comprise functional groups that can be derivatized so as to allow for such ment. M must allow for free diffusion of peptide E once ed through cleavage of linker L. M must furthermore be biodegradable to soluble products, and degrade slowly enough to allow for release of E without formation of excessive quantities of soluble M-L-E fragments yet quickly enough to minimize the burden of drug-free M-L remaining after E release in a multiple-dosing scenario.
In one embodiment, M is a biodegradable hydrogel prepared as disclosed in PCT Patent Publication WO2013/036847 and US2014/0288190 both incorporated herein by reference for their ption of such hydrogels. These hydrogels comprise betaeliminative crosslinkers that provide control over the rate of degradation. Thus, in some 18563198_1 (GHMatters) P109745.NZ.1 embodiments, the crosslinkers are of Formula (1) or (2) as follows. wherein m is 0 or 1; and wherein X and one of R1, R2 and R5 each comprise a functional group for coupling to polymer, and with the proviso that at least one of R1 and R2 is CN; NO2; optionally tuted aryl; optionally substituted heteroaryl; optionally substituted alkenyl; optionally substituted alkynyl; COR3 or SOR3 or SO2R3 wherein R3 is H or optionally substituted alkyl; aryl or arylalkyl, each optionally substituted; heteroaryl or heteroarylalkyl, each ally substituted; or OR9 or NR92 wherein each R9 is independently H or optionally substituted alkyl, or both R9 groups taken together with the nitrogen to which they are attached form a heterocyclic ring; SR4 wherein R4 is optionally substituted alkyl; aryl or arylalkyl, each optionally substituted; or aryl or heteroarylalkyl, each optionally substituted; wherein R1 and R2 may be joined to form a 3-8 membered ring; and wherein any remaining R1 and R2 is H or is alkyl, arylalkyl or arylalkyl, each optionally substituted; and any remaining R5 is independently H or is alkyl, alkenylalkyl, alkynylalkyl, (OCH2CH2)p O-alkyl wherein p=1-1000, aryl, arylalkyl, heteroaryl or heteroarylalkyl, each optionally substituted; or said crosslinker is of formula (2) 98_1 (GHMatters) P109745.NZ.1 wherein two of R1, R2 and R5 comprise a functional group for binding to polymer; m is 0-1; n is 1-1000; s is 0-2; t is 2,4, 8, 16 or 32; Q is a core group having the valency t; W is O(C=O)O, O(C=O)NH, O(C=O)S, O C N CH2 O , or O C N CH2 S ; wherein R6 is H, ally substituted alkyl, ally substituted aryl, optionally substituted aryl, optionally substituted arylalkyl, or optionally substituted heteroarylalkyl; and with the proviso that at least one of R1 and R2 is CN; NO2; optionally substituted aryl; optionally substituted heteroaryl; optionally substituted alkenyl; ally substituted alkynyl; COR3 or SOR3 or SO2R3 wherein R3 is H or optionally substituted alkyl; aryl or arylalkyl, each optionally substituted; heteroaryl or heteroarylalkyl, each optionally substituted; or OR9 or NR92 wherein each R9 is independently H or optionally substituted alkyl, or both R9 groups taken together with the nitrogen to which they are ed form a heterocyclic ring; SR4 wherein R4 is optionally substituted alkyl; aryl or arylalkyl, each optionally substituted; or heteroaryl or heteroarylalkyl, each optionally substituted; wherein R1 and R2 may be joined to form a 3-8 ed ring; and 18563198_1 (GHMatters) P109745.NZ.1 wherein any remaining R1 and R2 is H or is alkyl, arylalkyl or heteroarylalkyl, each optionally substituted; and any remaining R5 is independently H or is alkyl, alkenylalkyl, alkynylalkyl, (OCH2CH2)p O-alkyl wherein p=1-1000, aryl, arylalkyl, aryl or heteroarylalkyl, each optionally substituted.
The functional groups used to couple these crosslinkers to the matrix include N3, NH2, NH-CO2tBu, SH, StBu, maleimide, CO2H, CO2tBu, ene, cyclopentadiene, furan, alkyne, cyclooctyne, acrylate, aminooxy, keto and acrylamide. The two onal groups on Formulas (1) and (2) are different from each other, but not cognates. For example, if one is azide, the other is not cyclooctyne or alkyne.
By choosing a beta-eliminative crosslinker that results in M degradation and solubilization at a rate several-fold slower than the rate of E release from cleavage of L-E, the formation of soluble M-L-E fragments is minimized while providing for effective solubilization and clearance of the matrix. In one embodiment of the invention, these hydrogels are prepared by crosslinking multi-arm poly(ethylene glycol)s. The invention further contemplates other useful matrices, including crosslinked dextrans and onic acids.
Such matrices may be ageously made as a slurry of microspheres that is amenable to injection using a narrow-gauge . Such slurries may be prepared using known methods, for example either bulk-phase emulsification or more ely by microfluidic droplet emulsification of ymer mixtures. Particle size distribution can be refined through known methods if necessary, for example through sieving.
Peptide E: The peptides (E) that are red by the invention are GLP-1 ts, by which is meant a peptide capable of binding to and activating the GLP-1 receptor.
Examples of GLP-1 agonists e the naturally-occurring exendins, for example exenatide (exendin-4; SEQ ID NO:1), liraglutide (SEQ ID NO:13), lixisenatide (SEQ ID NO:7), taspoglutide (SEQ ID , and sequence variants thereof. Synthetic sequences that bind and activate the GLP-1 receptor are also contemplated, for example sequences derived by in vitro screening and/or selection (Zhang, et al., Nature Commun. (2015) 6:8918). 18563198_1 (GHMatters) P109745.NZ.1 SEQ ID NO:1 HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 tide] SEQ ID NO:2 HGEGTFTSDL SKQMEEEAVR LFIEWLKQGG PSSGAPPPS-NH2 [N28Q]exenatide SEQ ID NO:3 HGEGTFTSDL SKQMEEEAVR KAGG PSSGAPPPS-NH2 [N28A]exenatide SEQ ID NO:4 HGEGTFTSDL SKQMEEEAVR LFIEWLKKGG PSSGAPPPS-NH2 [N28K]exenatide SEQ ID NO:5 HGEGTFTSDL SKQMEEEAVR LFIEWLKDGG PSSGAPPPS-NH2 [N28D]exenatide SEQ ID NO:7 HGEGTFTSDLSKQMEEEAVRLFIEWLKΝGGPSSGAPPSKKKKKKNH2 [lixisenatide] SEQ ID NO:8 HGEGTFTSDLSKQMEEEAVRLFIEWLKQGGPSSGAPPSKKKKKKNH2 [N28Q]lixisenatide SEQ ID NO:9 HGEGTFTSDLSKQMEEEAVRLFIEWLKAGGPSSGAPPSKKKKKKNH2 lixisenatide SEQ ID NO:10 HGEGTFTSDLSKQMEEEAVRLFIEWLKKGGPSSGAPPSKKKKKKNH2 [N28K]lixisenatide SEQ ID NO:11 ELVDNAVGGDL SKQMEEEAVR LFIEWLKQGG PSSGAPPPS-NH2 18563198_1 (GHMatters) P109745.NZ.1 SEQ ID NO:12 HUEGTFTSDV SSYLEGQAAK EFIAWLVKUR-NH2 [taspoglutide] U = 2-aminoisobutyric acid SEQ ID NO:13 HAEGTFTSDVSSYLEGQAAK*EFIAWLVRGRG-OH K* = Lys(y-Glu-palmitoyl) It is essential that the peptide agonist E be chemically stable under physiological conditions during the period of administration. While this may not be an issue for direct administration of peptides, given their rapid clearance and frequent administration, extended-release preparations place more stringent requirements on peptide stability. For example, a e that degrades under physiological ions with a half-life of 14 days may be tly suitable for once-daily administration as only 5% of the peptide will have degraded in 1 day. The same peptide under extended-release conditions of 30 days (i.e., once-monthly administration) would be 80% ed by the end of the dosing period, and thus would be unsuitable.
The mechanism of degradation of peptides that n the sequence Asn-Gly, for example the N28-G29 dipeptide in exenatide is shown below. As shown, an initial L-succinimide is formed which results in sion of the asparagine residue to aspartic or isoaspartic acid. Both the D and L forms of these modified amino acids are obtained. 18563198_1 (GHMatters) P109745.NZ.1 Examination of sequence ts of exenatide itself has revealed that replacement of N28 with other amino acids can provide an agonist of sufficient stability to support once-monthly administration via an extended-release conjugate while having minimal effects on the y of the peptide to band and activate the GLP-1 receptor.
Thus, agonists having SEQ ID NOS:2-4 wherein N28 of SEQ ID NO:1 is replaced by Q, A or K, respectively, have been found to bind and activate the GLP-1 receptor with comparable affinity and potency as native exenatide, while showing <10% or <9% chemical degradation over a one-month .
The present invention further plates the use of suitably stabilized GLP-1 agonists other than exenatide. The above-described ilities are expected to occur with other GLP-1 agonists having the Asn-Gly dipeptide sequence, for example lixisenatide and other synthetic peptide sequences. These peptides would be expected to o the same sequence of degradation reactions as shown above. Suitably stabilized forms of these GLP-1 agonists useful in the present invention e SEQ ID NOS:8-11.
Taspoglutide (SEQ ID NO:13) and liraglutide (SEQ ID NO:14) do not have the unstable 18563198_1 (GHMatters) P109745.NZ.1 Asn-Gly dipeptide and are suitable for use in the invention. Other causes of instability may also be corrected. For the agonist of the present ion the stabilized form produces less than 10% degradation products after one month at pH 7.4, 37°C, preferably less than 9% degradation products after one month at pH 7.4, 37°C.
Cleavable linker L: The cleavable linker connects the GLP-1 agonist E to the ble matrix M and is cleaved under physiological ions to release free E. The rate of linker cleavage determines the effective half-life of the peptide and is selected based on the desired frequency of administration. It is r important that the degradation rate of the matrix and the release rate of the peptide be coordinated with the desired frequency of administration. Previously, no attempt has been made to balance these features which balance is necessary for the success of the compositions of the invention in permitting administration on a y or less-frequent basis. Any linker which results in achieving this balance will be satisfactory. While there are no hard and fast rules as to the relationship between the rate of release of the drug and the rate of degelation of the matrix, a convenient rule of thumb is that the degelation rate should be approximately three times the rate of e of the free peptide. If the peptide is released too rapidly before degelation occurs, the subject is left with a deposit of gel at the time of the subsequent dosing. If the release is too slow in ison to the degelation rate, the peptide remains bound to portions of the gel that are freed into the circulation. Neither circumstance is desirable. This relationship is bed by Reid, R., et al.
Macromolecules (2015) 48:7359-7369. ural features that dictate the degelation rate of various matrices depend on crosslinking moieties and structural correlations can be used to e suitable degelation rate for the matrix.
The balance of degradation and release rates is visualized as s: e of a relatively rapidly-cleared drug from a depot through cleavage of a covalent linker imparts the half-life of the linker cleavage to the half-life of the drug in the plasma. As the dosing frequency is dependent upon drug plasma half-life, there is thus also a relationship between the linker cleavage rate and the dosing frequency. It is typically desired to minimize the difference between the maximum (Cmax) and minimum (Cmin) plasma concentrations of drug to which a patient is exposed in order to reduce the 18563198_1 ters) P109745.NZ.1 potential for toxicities arising from excessively high drug concentrations while maintaining the amount ed for efficacy between doses.
If the dosing frequency is set equal to the plasma half-life of the drug, for example, there will be a 2-fold difference between Cmax and Cmin, while if the drug is dosed once every 2 plasma half-lives the difference increases to 4-fold. It is thus usual to minimize the number of drug half-lives between doses to ze Cmax. For an extended-release ate, this is achieved by decreasing the e rate.
For an extended-release conjugate, however, the steady-state level of drug from a depot is inversely tional to the release rate. While the Cmax/Cmin ratio may be arbitrarily reduced by slowing the release rate of the drug from the conjugate, the need to maintain a certain value for Cmin while using an acceptable dosage places a limit on this approach. For a single administration, the dose can be ated by where CL = drug clearance rate, F = bioavailability, k1 = the rate of drug release from the conjugate depot, and tmin = time to reach Cmin. From this it can be shown that the lowest dose required to maintain Cmin for a given tmin is ed when k1 = 1/tmin. Alternatively stated, this is when the drug release half-life (= ln(2)/k1) = ln(2)*tmin. The optimal drug release half-life for a particular dosing frequency is thus given as ln(2)*(dosing interval).
When the release half-life is shorter than optimal, the ed dose increases due to the depot being depleted prior to reaching tmin.
Generally speaking, drug release rates that are slower than optimal are more tolerable than ones that are too fast. Thus, a conjugate with a drug release rate ting once-monthly administration could also be useful for biweekly or once-weekly administration regimens. Further, the relationship between the drug release rate and the required dose to maintain Cmin is such that some deviation from ideal is tolerable. This is ed in accordance with the parameters set forth above in Figures 7A and 7B. As shown in Figure 7A, the l dose (1) is observed when the ratio of the release halflife to the administration frequency is ln(2) = 0.693. This depiction in Figure 7A, indicates the range of release rates that can be tolerated depending on dosage levels. A higher dosage level will tolerate both a higher release rate since a concentration above the minimum required is still ined as well as a lower release rate as the drug is 18563198_1 (GHMatters) P109745.NZ.1 ed at a higher level for this longer time. Specifically, if the dosage is increased by up to 10%, release ives between 0.45x – 1.1x the dosing frequency are acceptable.
If the dosage can be increased by up to 20%, release half-lives n 0.4x – 1.4x the dosing frequency are acceptable. If the dosage can be increased by up to 50%, release half-lives between 0.3x – 2x the dosing ncy are acceptable.
In detail as shown in Figure 7B: for a single dose lasting one month (tmin = 720 hours), the optimal drug release rate is 500 hours, yet any release rate between 320 and 800 hours with a ~10% increase in dose, between 280 and 1000 hours with a ~20% increase in dose, or between 220 and 1440 hours with a ~50% increase in dose may also be used. Similarly for a single dose lasting 3 months (tmin = 720 hours), the optimal drug release rate is 1500 hours, yet any release rate n 320 and 2400 hours with a ~10% increase in dose, n 840 and 3000 hours with a ~20% increase in dose, or between 660 and 4350 hours with a ~50% increase in dose may also be used. For a single dose lasting 2 weeks (tmin = 336 hours), the optimal drug release rate is 230 hours, yet any release rate n 150 and 380 hours with a ~10% increase in dose, between 130 and 470 hours with a ~20% increase in dose, or between 100 and 680 hours with a ~50% increase in dose may also be used.
Similarly, the dose required to maintain the drug concentration above Cmin at steady-state in a repeat-dosing scenario is given as: In a repeat-dosing scenario, there is no optimal dose as described above, but rather the required dose decreases with decreasing release rate since higher proportions of drug remain from previous doses, thus adding to the total drug depot present.
There are practical limits to the use of slower release rates to decrease dose, however, given a need to minimize the e of drug-bearing gel fragments from the biodegradable matrix, a desire to minimize the total depot burden on the patient, and an increased time to attain steady-state drug levels.
In one embodiment, the cleavable linker L has the formula (3) H R 5 O R 1 C C O C (3) R 2 R 5 18563198_1 (GHMatters) P109745.NZ.1 wherein at least one, or both R1 and R2 is independently CN; NO2; optionally tuted aryl; optionally substituted heteroaryl; ally substituted alkenyl; optionally substituted alkynyl; COR3 or SOR3 or SO2R3 wherein R3 is H or optionally substituted alkyl; aryl or arylalkyl, each optionally substituted; aryl or arylalkyl, each optionally substituted; or R3 is OR9 or NR92 wherein each R is independently H or optionally substituted alkyl, or both R9 groups taken together with the nitrogen to which they are ed form a heterocyclic ring; SR4 wherein R4 is optionally substituted alkyl; aryl or arylalkyl, each optionally substituted; or heteroaryl or heteroarylalkyl, each optionally substituted; wherein R1 and R2 may be joined to form a 3-8 ed ring; and wherein one and only one of R1 and R2 may be H or alkyl, arylalkyl or heteroarylalkyl, each optionally substituted; and wherein one of R5 is (CH2)yZ, (CH2CH2O)xCH2CH2Z or (CH2)yNH-CO-(CH2CH2O)x CH2CH2Z, wherein x is 1-100, y = 1-6, and the other R5 is H, alkyl, alkenylalkyl, alkynylalkyl, aryl, arylalkyl, heteroaryl or heteroarylalkyl, each optionally substituted; Z is a functional group for mediating coupling to the matrix.
Such linkers cleave by beta-elimination. In preferred embodiments of the invention, R1 is CN or R3SO2, wherein R3 is substituted or unsubstituted alkyl or (R9)2N, wherein each R9 is independently substituted or unsubstituted alkyl; R2 is H; one R5 is (CH2)yZ and the other R5 is H. Z is N3, SH, NH-C(=O)CH2ONH2, or O-NH2. In particularly preferred embodiments, R1 is CN or CH3SO2 and/or Z is N3.
Other types of ble linkers may be used, for example, linkers that cleave by enzymatic or non-enzymatic ysis, such as those in PCT Publication /136586 incorporated herein by reference. The sole requirement is that the 18563198_1 (GHMatters) P109745.NZ.1 linker cleavage rate be appropriate for the required administration regimen as described above.
In one embodiment of the present invention, the linker cleaves and releases E with a half-life under physiological conditions suitable to t once-monthly administration, i.e., the linker cleaves and releases E with of half-life between 220 and 1440 hours. In a more preferred embodiment, the linker cleaves and releases E with a half-life n 280 and 1000 hours, more preferably between 320 and 800 hours. In other embodiments of the invention, the linker s and es E with a half-life under physiological conditions suitable to support administration once every 3 months or biweekly.
In a ic embodiment of the invention, linker L has the formula (5) wherein R1 is CN. As demonstrated in e 5, this linker releases peptide from the hydrogel in the rat with a half-life of 760 h.
In another specific embodiment, linker L has the formula (5) wherein R1 is CH3SO2. As demonstrated in e 5, this linker releases peptide from the hydrogel in the rat with a half-life of 350 h.
Linker L is connected to peptide E h formation of a carbamate linkage between the C=O group of L and an amino group of E. The amino group may be either the N-terminal alpha-amino group or an epsilon-amino group of a lysine side chain.
Methods for preparing both are known in the art. In one embodiment, L is attached to the alpha-amino group of E during solid-phase synthesis of the peptide.
Linker L further comprises a group Z that allows for attachment of the linkerpeptide L-E to matrix using chemistry that is compatible and selective in the presence of the onal groups on peptide E. Z may be azide, in which case L-E is connected to the matrix using either a 1,3-dipolar cycloaddition reaction to form a 1,2,3-triazole linkage, or a phosphine-mediated Staudinger ligation to form an amide; both reactions are well-documented in the art. The cycloaddition reaction may be either a copper-catalyzed addition to an alkyne-derivatized matrix or a strain-promoted addition to a cyclooctyneor bicyclononyne-derivatized . Z may also be an aminooxy or aminooxyacetamido group, in which case L-E is connected to a keto-derivatized matrix using an oximation reaction. Or Z itself may be a keto group, connecting to an aminooxy group on the matrix. Z may also be a thiol group, in which case L-E is connected to a haloacetyl- 98_1 (GHMatters) P109745.NZ.1 derivatized, maleimide-derivatized, or epoxy-derivatized matrix h formation of a thioether.
Thus, the functional groups used to couple L to the matrix include N3, NH2, NH-CO2tBu, SH, StBu, maleimide, CO2H, CO2tBu, 1,3-diene, cyclopentadiene, furan, , cyclooctyne, acrylate, aminooxy, keto or acrylamide.
Preparation of the conjugates: The conjugates are prepared by connecting a peptide E, a cleavable linker L, and a matrix M. In one embodiment, the connections are made pairwise with the order of connection being flexible. Thus, peptide E may be first connected to linker L, and the resulting L-E connected to matrix M. Alternately, linker L may be connected to matrix M, and E then connected to M-L. When M is a matrix prepared by polymerization of monomer units, M-L or M-L-E may be the result of the polymerization s by using a crosslinkable monomer-L or monomer-L-E unit in the reaction.
For biological use, the conjugates must meet stringent criteria for sterility and endotoxin contamination. While in certain cases it may be possible to use a terminal sterilization s, in general the conjugates of the invention are not le to this.
Insoluble els, for example, are also not amenable to sterile filtration. Thus, it may be desirable that the conjugates of the invention are prepared under c conditions.
The conjugates may be prepared either as injectable microsphere suspensions or they may be formed in situ by coinjection of the monomer units.
Formulations: The conjugates may be ated using standard pharmaceutically acceptable buffers and excipients to e injectability and storage stability. Typical formulations e a buffer to maintain pH between 4 and 7, preferably n 5 and 6. Excipients may include stabilizing agents for the peptide drug, for example antibacterial and/or antioxidant agents such as meta-cresol, tonicity-adjusting agents such as a polyol like mannitol, and viscosity-reducing agents such as taurine, theanine, sarcosine, citrulline, and betaine. s of use: The conjugates of the invention are useful in the treatment of metabolic conditions and diseases in both humans and animals in which the administration of a 18563198_1 (GHMatters) P109745.NZ.1 GLP-1 agonist is known to be effective, including but not limited to type-2 diabetes, metabolic syndrome, and obesity. The greatly increased effective half-life enables oncemonthly dosing, thus improving patient compliance ting missed doses) and improving patient quality of life. Dosing is preferentially by subcutaneous injection, and may be performed using an autoinjector.
The following examples are d to illustrate but not to limit the invention.
Preparation A In Vitro Degradation of Exenatide A solution of 2.4 mM exenatide (1 mL), 0.1% NaN3 and 200 uM Lys(DNP)OH as internal standard in 200 mM NaPi, pH 7.4, was kept at 37°C. At intervals, 50 uL aliquots were removed and frozen at -20°C until assay. Various samples were thawed and analyzed a) by HPLC, b) for GLP1R agonist activity, and c) for protein isoaspartate methyl transferase activity. The sample incubated for 56 days was subjected to HPLC and samples at RV 9.9, 10.4 and 10.8 were ted and dually analyzed for purity by analytical RP-HPLC, GLP1R agonist and PIMT activities. (a) HPLC es of the deamidation of exenatide vs. time are shown in Figures 8A-8C. Each peak from the reaction at 56 days was ed by RP-HPLC.
Panel A shows HPLC traces obtained at 0 (top), 7, 28, and 56 (bottom) days for native exenatide. The initial single peak for exenatide is gradually replaced by peaks for several degradation products. Panel B shows the time course of the ation of exenatide as derived from the data in panel A. The decrease in exenatide (squares) and the increase in the major degradation product show a t1/2 of approximately 10 days. Panel C shows the HPLC traces obtained with [N28Q]exenatide corresponding to those for exenatide in panel A. Analytical HPLC of isolated degradation products showed that the L-Asp and D-isoAsp peaks contained ~7 and 12% inating IsoAsp, respectively; the isolated IsoAsp showed a single peak. (b) Time points were ed for GLP-1 receptor tion by GLP1R cAMP ™ bioassay (DiscoverX). The EC50 values are summarized below in Table 1. 18563198_1 (GHMatters) P109745.NZ.1 Table 1 EC50 values of exenatide degradation products in GLP1R cAMP Hunter™ assay.
Xaa28 EC50, pM Xaa/Asn EC50 (M) Asn, Exenatide (t = 0) 130 1 Product mixture (t = 56 days) 173 1.3 L-Asp (RV 9.8) 197 1.5 D-isoAsp (RV 10.4) 244 1.9 L-IsoAsp (RV 10.8) 324 2.5 Peptide concentrations calculated from A280 and ε280 = 5,500 M-1 cm-1; L-Asp and D-isoAsp values uncorrected for the small s isoAsp impurity.
The Asp e isolated from the deamidation mixture contained a small amount of potentially interfering isoAsp peptide, but synthetic [Asp28]exenatide showed agonist activity comparable to exenatide. The amount of D-isoAsp formed in the deamidation reaction at 56 days is so small (~12%) it cannot contribute significantly to agonist activity of the mixture. (c) To assay the presence of isoaspartate, protein isoaspartate methyl transferase (PIMT) assays were performed using the ISOQUANT® isoaspartate detection kit as recommended by the supplier (Promega). Sample mixtures at t = 0 and t = 56 days, as well as individual samples purified from the t= 56 day mixture were assayed for isoAsp peptides. Figure 9 shows the AdoHCys/peptide specific activity formed in a) the total mixture and in b) isolated peaks RV 9.9 and RV 10.4 corrected for small amounts of inating isoAsp from the peak with RV 10.8.
Preparation B ation of Exenatide Analogs The Ala, Asp, Gln and Lys substitutions for Asn28 of exenatide were ed by SPPS. All [Xaa28]exenatides had EC50 values (17- to 41 pM) comparable to ide (17 pM) in a GLP-1RA assay. Upon extended incubation (~3 months) of these [Xaa28]exenatides in 200 mM Pi, pH 7.4, 37 °C, major new peaks were not observed, except for [Asp28]exenatide which slowly isomerized to [isoAsp28]exenatide. At low peptide concentrations (~0.2 mM), small losses were observed in A280 consistent with non-specific adsorption to vessel surfaces. At 2 mM ]exenatide, the t1/2 for loss of 18563198_1 (GHMatters) P109745.NZ.1 peptide was estimate at >/= 30 weeks. Hence, [Gln28]exenatide is very stable under physiological conditions. A t1/2 of 30 weeks would give a < 9% loss in one month.
Preparation C In Vitro Receptor Binding and Activity of Exendin Analogs The y of various exenatide analogs to activate the GLP-1 receptor was d using a cAMP assay (GLP1R cAMP Hunter™ bioassay verX)). The N28D, N28A, N28K, and N28Q analogs were found to have comparable ability to exenatide.
Analog EC50 Exenatide 29 pM N28D 41 N28A 25 N28K 35 N28Q 17 When the mixture of degradation products (Figure 8A, 56 days) was tested in the cAMP assay, it had an equivalent EC50 to the starting ide (Figure 8A, 0 days).
Likewise, the putative [IsoAsp]28- and [Asp]28exenatides purified from the mixtures as well as synthetic [Asp]28exenatide showed EC50 values similar to exenatide. However, when tested in an ELISA assay (Peninsula Lab) the isolated deamidation products and synthetic [N28D]-exenatide showed greatly decreased affinity (EC50 exenatide, 0.2 nM; N28A = 6 nM; N28Q = 10 nM; N28D > 100 nM; N28K > 100 nM). Hence, the major degradation products have equivalent agonist activity as exenatide, but would not have been measured by the LC-MS/MS or ELISA assays used for serum ide.
Preparation D ation of Degradable Microspheres Preparation of Macromonomer A (a) A solution of 1-(bis-(2-methoxyethyl)aminosulfonyl)azidoheptyl succinimidyl ate (prepared using the methods described in WO2013/036847; 1.12 mmol) in 5 mL of acetonitrile was added to a solution of H-Lys(Boc)-OH (300 mg, 1.22 mmol) and NaHCO3 (420 mg, 5.0 mmol) in 10 mL of water and 5 mL of 18563198_1 (GHMatters) P109745.NZ.1 acetonitrile. After 0.5 h, the solution was concentrated under vacuum to remove acetonitrile, acidified with 1 N HCl, and extracted with ethyl acetate. The extract was washed with water and brine, then dried over MgSO4, filtered, and evaporated to provide crude Na-[1-(bis-(2-methoxyethyl)aminosulfonyl)azidoheptyloxy)carbonyl]-Ne- lysine ("azido-linker[mod]-Lys(Boc)-OH").
Prepared according to this method were linker[mod]-Lys(Boc)-OH wherein the modulator is bis(2-methoxyethyl)aminosulfonyl, dimethylaminosulfonyl, cyano, methylsulfonyl, 4-methylpiperidinylsulfonyl, morpholinosulfonyl or phenylsulfonyl. (b) The above crude azido-linker[mod]-Lys(Boc)-OH was ved in 25 mL of CH2Cl2 and treated with N-hydroxysuccinimide (138 mg, 1.2 mmol) and dicyclohexylcarbodiimide (0.5 mL of a 60 wt% solution in xylenes) for 2 h. The mixture was filtered and chromatographed on SiO2 using a gradient of acetone in hexane to provide the succinimidyl ester azido-linker[mod]-Lys(Boc)-OSu.
Prepared according to this method were azido-linker[mod]-Lys(Boc)-OSu n the modulator is bis(2-methoxyethyl)aminosulfonyl, dimethylaminosulfonyl, cyano, methylsulfonyl, 4-methylpiperidinylsulfonyl, linosulfonyl or phenylsulfonyl. (c) A solution of 20-kDa 4-arm PEG-tetraamine in acetonitrile (10 mL, 200 mg/mL, 40 mM amine, 0.4 mmol, 1 equiv) containing N,N-diisopropylethylamine (80 mM, 0.8 mmol, 2 equiv), was treated with a solution of azido-linker[mod]-Lys(Boc)- OSu in acetonitrile (3.3 mL, 145.5 mM, 0.48 mmol, 1.2 equiv). The resulting mixture was kept at room ature for 1 h, then a 0.010 mL sample was assessed for amine content by TNBS assay using the PEG-tetraamine as a standard; typically <1% of the starting amines remain. The reaction was then treated with acetic anhydride (40.8 mg, 0.0378 mL, 0.4 mmol, 1 equiv) for 15 minutes prior to concentration under vacuum to a viscous syrup (~4 mL) that was slowly added to MTBE (350 mL). The resulting suspension was stirred for 1 h, then the precipitate was recovered by filtration, washed with MTBE (150 mL), and dried under vacuum to give macromonomer A as a white solid.
Prepared according to this method were macromonomer A wherein the modulator is bis(2-methoxyethyl)aminosulfonyl, dimethylaminosulfonyl, cyano, sulfonyl, 4-methylpiperidinylsulfonyl, morpholinosulfonyl or phenylsulfonyl. 18563198_1 (GHMatters) P109745.NZ.1 Preparation of onomer B A 4-mL, screw top vial was charged with PEG20kDa-[NH2]4 (SunBright PTE- 200PA; 150 mg, 7.6 µmol PEG, 30.2 µmol NH2, 1.0 equiv, 20 mM final amine concentration), MeCN (1.5 mL), and iPr2NEt (7 μL, 40 µmol, 1.3 equiv, 27 mM final concentration). A on of the activated ester cyclooctyne (39 µmol, 1.3 equiv, 27 mM final concentration) was added and the reaction mixture was stirred at ambient temperature. Reactions were monitored by C18 HPLC (20-80%B over 11 min) by ELSD.
When complete, Ac2O (3 μL, 30 µmol, 1 equiv per starting NH2) was added to the reaction mixture and the e was stirred for 30 min. The reaction mixture was then concentrated to a thick oil and ded in MTBE (20 mL). The resulting suspension as vigorously stirred for 10 min. The resulting solids were triturated three times with MTBE (20 mL) by vigorously , pelleting in a centrifuge (2800 rpm, 4°C, 10 min), and removal of the supernatant by pipette. The resulting solids were dried under vacuum at ambient temperature for no more than 30 min. Stock solutions were prepared in 20 mM NaOAc (pH 5) with a target amine concentration of 20 mM. Cyclooctyne tration was then ed by treatment with PEG7-N3 (2 equiv) and back-titration of the unreacted PEG7-N3 with DBCO-CO2H.
Macromonomers prepared using this procedure include those wherein the cyclooctyne group is MFCO, 5-hydroxycyclooctyne, 3-hydroxycyclooctyne, BCN, DIBO, 3-(carboxymethoxy)cyclooctyne, and 3-(2-hydroxyethoxy)cyclooctyne, prepared using MFCO pentafluorophenyl ester, 5-((4-nitrophenoxy-carbonyl)oxy)cyclooctyne, 3-(4-nitrophenoxycarbonyl)oxycyclooctyne, BCN hydroxysuccinimidyl carbonate, DIBO 4-nitrophenyl carbonate, 3-(carboxymethoxy)cyclooctyne succinimidyl ester or 3-(hydroxyethoxy)cyclooctyne 4-nitrophenyl carbonate.
Preparation E Preparation of Illustrative Hydrogel of Figure 1A The derivatized 8-arm macromonomer P, is prepared as s: Macromonomer P is an 8-arm PEG with each arm terminated with a cyclooctyne. A solution of 200 mg of 40-kDa 8-arm PEG-amine•HCl (JenKem Technologies; 40 umol NH2), 20 mg of BCN p-nitrophenyl carbonate (SynAffix; 63 umol), and 20 uL of N,N- diisopropylethylamine (115 umol) in 2 mL of DMF was stirred 16 h at ambient temperature. After quenching with 0.5 mL of 100 mM taurine in 0.1 M KPi, pH 7.5, for 1 98_1 (GHMatters) P109745.NZ.1 h, the mixture was dialyzed tially against water, 1:1 methanol/water, and methanol using a 12-kDa membrane. After evaporation, the residue was dissolved in 2 mL of THF and precipitated with 10 mL of methyl tbutyl ether. The t was collected and dried (190 mg). Macromonomers P comprising other cyclooctynes may be prepared similarly by using the appropriate activated cyclooctyne.
The derivatized 4-arm macromonomer T is prepared as follows: T comprises a 4- arm PEG with each arm terminated with a releasable linker-azide. A solution of 25 umol of the azido-linker-succinimidyl carbonate (prepared using the methods described in WO2013/036847) in 1 mL of ACN was added to a mix of 5 umol (100 mg) of 20-kDa 4- arm PEG-amine hloride (pentaerythritol core, JenKem Technologies) in 1 mL of water and 40 uL of 1.0 M NaHCO3 (40 umol). After 1 hr at ambient temperature the solution was dialyzed (12-14 k MWCO) against 1 L of 50% methanol followed by 1 L of methanol. After evaporation, the residue (109 mg) was ved in 2.12 mL of sterilefiltered mM NaOAc, pH 5.0, and stored frozen at -20 °C. The azide tration determined by reaction with DBCO-acid was 9.5 mM. Macromonomers T comprising linker-azides having alternate modulators may be prepared similarly by using the appropriate azide-linker-succinimidyl carbonates.
The peptide-releasing els may be prepared from the derivatized macromonomers in at least two different ways. (a) In one embodiment, linker-peptide is ed to macromonomer P prior to formation of the insoluble hydrogel . An azido-linker-peptide of formula (4) such as that illustrated in Example 1 herein is mixed with macromonomer P in a stoichiometry such that some on of the arms of P are derivatized with linker-peptide. The resulting material is then crosslinked using sufficient macromonomer T to react the remaining arms of P with arms of T and thus form an insoluble matrix. Thus, n moles of azido-linkerpeptide of formula (4) is mixed with n/(8f) moles of macromonomer P, where f = the desired fractional loading of arms with linker-peptide (i.e., for 50% loading of arms, f = 0.5) in a suitable solvent, typically buffered s media. After allowing sufficient time for the azido-linker-peptide to react, the resulting solution is mixed with n(1/f – 1)/4 moles of macromonomer T to form the insoluble hydrogel matrix. Typically, f is chosen such that there are > 3 crosslinked arms to each P residue in the hydrogel matrix (f < 0.625). The crosslinking reaction to form the insoluble hydrogel matrix can be performed 98_1 (GHMatters) P109745.NZ.1 either as a bulk material or in a sion or emulsion so as to form a finely-divided particulate polymer, for example microspheres as bed in Example 2 herein. (b) Alternatively, the insoluble hydrogel matrix can be prepared, followed by ment of the linker-peptide. For a final hydrogel comprising 8f equivalents of linker-peptide for each P macromonomer residue in the matrix, an insoluble hydrogel matrix is formed by reaction of n/(8f) moles of macromonomer P with n(1/f – 1)/4 moles of macromonomer T. The inking reaction to form the insoluble el matrix can be performed either as a bulk material or in a suspension or emulsion so as to form a finely-divided particulate polymer, for example microspheres as described in Example 2 herein. The polymerized matrix is then allowed to react with a solution of at least n moles of azido-linker-peptide of formula (4), such that the linker-peptide is covalently attached to the matrix. Unreacted azido-linker-peptide is washed from the matrix to provide the e-releasing el.
Example 1 Preparation of Azido-linker-[N28Q]exenatides of Formula (4) wherein R1 = CN or MeSO2; R2 = H; one R5 = H and the other R5 = (CH2)5N3; P = Nα-[N28Q]exenatide Peptides were synthesized by standard solid-phase methodology using Chemmatrix® Rink amide resin (0.5 meq/g) on a Symphony® peptide synthesizer. Fmocamino acids (5 eq per coupling) were double-coupled to the N-terminus of the peptide chain using HCTU (4.9 eq per coupling) and N,N-diisopropylethylamine (10 eq per coupling) in DMF at ambient temperature. Fmoc groups were removed using 20% 4-methylpiperidine in DMF. [N28Q]exenatide was deprotected and cleaved from the resin using 95:2.5:2.5 trifluoroacetic riisopropylsilane/dithiothreitol.
Crude [N28Q]exenatide (22 mg) was purified on a reparative scale using a Shimadzu™ LC-20AD system equipped with a Peak ific HiQ® 5 μ C18 column (50 x 20 mm ID) eluting with a linear gradient of 30%-60% MeCN (0.1% TFA) in water (0.1% TFA). The purest fractions, as judged by analytical C18 HPLC, were combined, concentrated by ~40% to remove MeCN, and lyophilized to provide exenatide (6.4 mg, 1.4 mmol) as a fluffy white solid. C18 HPLC purity determined at 280 nm: 86% pure (RV = 9.4 min); [N28Q]exenatide; m/z = 4200. 18563198_1 (GHMatters) P109745.NZ.1 On-resin N-terminal carbamoylation of peptides was performed by a modification of a previously described method (Schneider, E. L. et al, Biocong. Chem (2016) 1 March on line prepublication) and is exemplified by the following.
Nα-(7-Azidocyanoheptyloxycarbonyl)-[Gln28]exenatide. In a septum- capped 125 mL Erlenmeyer flask, 8Q]exenatide (free α-amine) Chemmatrix® Rink amide resin (0.5 meq/g substitution, 0.48 mmol peptide/g peptide-resin, 4.00 g e-resin, 0.48 mmol e) was gently stirred in 40 mL of DMF for 30 min at ambient temperature under N2. The swollen resin was then treated with 8 mL of zidocyanoheptyl)-O’-succinimidyl carbonate (0.18 M in DMF, 1.44 mmol, mM final) and 4-methyl-morpholine (158 μL, 1.44 mmol). The reaction mixture was gently stirred under N2 for 2 h then vacuum filtered. The resin was washed with successively DMF (3 x 30 mL) and CH2Cl2 (4 x 50 mL) then dried under high vacuum.
Kaiser test was negative for free amines in intermediate linker-modified resin (3.84 g).
The resin was then treated with 40 mL of 90:5:5 TFA:TIPS:H2O with stirring under N2.
After 2.5 h, the resin was vacuum filtered and washed with TFA (2 x 10 mL). The filtrate was concentrated to ~20 mL. The crude linker-peptide was precipitated by drop-wise addition of the TFA concentrate to ice-cold Et2O:hexane (2:1, 160 mL) in 4 tared 50 mL Falcon tubes. After incubating on ice for 30 min, the crude linker-peptide was pelleted by fugation (3 min at 2000 x g), and the supernatant was decanted. The pellet was triturated/vortexed with ice-cold Et2O:hexane (2:1, 160 mL), incubated on ice, centrifuged, and decanted as above. After drying under high vacuum, the crude linkerpeptide was isolated as an off-white solid (1.76 g) then dissolved in 5% AcOH. After heating at 40°C for 1 h, the crude al was purified by preparative HPLC. MS: m/z = 4408.
Nα-[1-(methylsulfonyl)azidoheptyloxycarbonyl]-exenatide was similarly prepared using O-(7-azido(methylsulfonyl)heptyl)-O’-succinimidyl carbonate. MS: m/z = 4461.
Example 2 Preparation of PEG Hydrogel Microspheres ] A 2-reagent Telos® hydrophobic flow-focusing microfluidic chip ite) with seven parallel 50 um drop forming channels was used. Fluid flow was controlled by a gas-pressure driven pump, similar in function to the Mitos Pressure Pumps 18563198_1 ters) P109745.NZ.1 ctured by Dolomite Microfluidics. These pumps use pressurized gas to drive the flow of liquid h the microfluidic chip. The driving pressure is computer lled using proportional pressure regulators (Proportion Air, MPV series) to maintain a stable flow rate by using a ck loop from a liquid flow sensor (Sensirion, SLI-0430). This type of flow control is scalable to deliver liquid from multi-liter reservoirs, and produces flow rates with ~1% standard deviation, superior to syringe pumps that often have up to a % oscillation in their flow rate. This system was used to deliver the two hydrogel ymer solutions and the uous phase. Typical flow rates were 2.1 ml/h for each prepolymer solution and 14 mL/h for the uous phase. The continuous phase was composed of decane containing 1% w/v Abil® EM90 (Evonik) and 1% w/v PGPR (Danisco). The outlet tube of the device was connected to a fraction collector (Gilson FC203B), and fractions were collected in 10 minute als. Quality control was performed by photographing the chip at 5x magnification with a high speed camera ain®, Fire-I 580b) attached to a microscope (Nikon™, EQ-51436) equipped with an automated stage to visualize the seven channels of the chip. Images of each channel were collected every 5 minutes. Fractions ning large particles resulting from device failure could be eliminated from the batch.
Microspheres washes were conducted in 50 mL Teflon® (FEP) centrifuge tubes (Oak Ridge, 3114-0050). After g, the microspheres were recovered by centrifugation. Centrifugation is conducted for 5 min at 3000 g’s for separation of organic phases, and 20 min for separation of aqueous phases. All solutions and wash solvents were filtered through 0.2 um Nylon-66 filters (Tisch, SPEC17984).
A suspension of microspheres from a microfluidics run (30 mL) in decane containing surfactant were allowed to cure at room temperature for 24 h. The decane layer was removed, and the pheres were partitioned between 0.1% (w/v) aqueous NaN3 (15 mL) and pentane. The mixture was agitated for 30 min then the pentane phase was separated by centrifugation. The microsphere suspension was then treated with water (30 mL) and washed with five consecutive (39 mL) portions of pentane. After centrifugation, the excess aqueous phase was removed and the microsphere slurry was treated with an equal volume of 50 % w/v TFA for 30 min for sterilization. The microspheres were recovered by centrifugation at 1000 g’s (note: the spheres shrink in TFA and form a compact pellet, so ive force should be avoided). The pellet was treated with 0.125 M Na2HPO4 (150 mL) to give a suspension of pH ~6.5. After swelling 18563198_1 (GHMatters) P109745.NZ.1 for 18 h the spheres were recovered by centrifugation, then washed with five 100 mL portions of water and finally five 100 mL portions of 70% ethanol. The slurry was pelleted to final concentration at 3000 g’s for 30 min. After aspiration of the supernatant, the microsphere slurry was transferred to a 60 mL syringe (BD No. 309653) that was connected by a Luer coupling to another 60 mL syringe and homogenized by several back-and-forth passages to disperse small clumps. The syringe containing the slurry was used to load individual 10 mL es through the Luer coupling that were stored at 4°C until use.
Three 0.100 mL ns of amino-microsphere slurry in acetonitrile were weighed to determine their density (0.79 ± 0.2 g/mL), then each portion was then treated with 0.900 mL of 50 mM NaOH for 18 h at room temperature to cleave inks and form [H2N-Lys(NH2)-NH]4-PEG20kDa rs. Each sample was assayed for total amine concentration by TNBS assay by diluting 0.030 mL to 0.120 mL with borate buffer (100 mM, pH 9.3) then ng with 0.150 mL of borate buffer containing 0.04% w/v sodium 2,4,6-trinitrobenzenesulfonate in a iter plate. The change in absorbance of the TNBS reactions at 420 nm was monitored for 3 h in a plate reader at 25°C then the final ance at 420 nM was recorded. Equivalent reactions containing TNBS alone were used for background ction and reactions containing 40, 20, or 10 uM lysine were used for amine concentration standards. The total amine concentration/2 of the microsphere digests provides the free e-amine content of the gel.
Example 3 Preparation of Cyclooctyne-Microspheres The reaction is performed in the syringe reaction vessel as follows. For each 4 mL of a packed suspension of amino-microspheres in MeCN containing 2 µmol amine/mL gel slurry are added 32 µmol DIPEA (4 equivalents) in 1 mL MeCN, and 9.6 µmol (1.2 lents) of 1-fluorocyclooctynecarboxylate pentafluorophenyl ester (MFCO-PFP) in 1 mL MeCN. After 1 h rocking at t temperature, a small amount (~50 uL) of microspheres is expelled from the syringe outlet and treated with 0.5 mL of 0.04% w/v TNBS in 0.1 M sodium borate, pH ~9.3 (1) for 30 min; complete reaction is indicated by a microsphere color matching the TNBS solution compared to ng amino-microspheres which stain an intense orange. After reaction, the microspheres are capped by the addition of 8 µmol (1 equivalent) of Ac2O in 1 mL 18563198_1 (GHMatters) P109745.NZ.1 MeCN for 10 min. After removal of the supernatant, ~2 mL of the microspheres is transferred to a second 10 mL e, each slurry is washed with 4 x 3 volumes MeCN per packed slurry volume and the slurries combined.
Example 4 Preparation of Peptide-Releasing PEG Hydrogel Microspheres The coupling of the azido-linker-[N28Q]exenatides prepared in Example 1 was performed in the syringe on vessel bed in (Schneider, et al, supra). To a sion of 2.4 g of a slurry of MFCO-derivatized microsphere of e 3 (11.2 µmol MFCO) in 30% MeCN in a 10 mL syringe was added a solution of 46 mg (10.4 µmol) of Nα-[1-(methylsulfonyl)azidoheptyloxycarbonyl]-[N28Q]exenatide in 2 mL 30% MeCN. The mixture was slowly rotated until the OD280 of an aliquot was constant at ~24 hr. About 50% of the slurry was transferred to a second syringe, and both samples were washed with 4 x 2 mL of 30% MeCN and then 5 x 5 mL of 10 mM NaPi, 0.04% Tween® 20, pH 6.2. The [N28Q]exenatide-loaded microspheres were then syringe-to-syringe transferred to several 1.0 mL dosing syringes. The total loading of the microsphere was 1.9 µmol e gm-1 of slurry as determined by the total peptide released at pH 8.4. e of free exenatide from the microspheres was measured in vitro by suspending a sample of the conjugate in 0.1 M borate, pH 9.4, and following the solubilization by the increase in OD280 at 37°C (Figure 5). A first-order release was observed showing a half-life = 6.7 h at pH 9.4. This olates to 670 h at pH 7.4.
Microspheres loaded with Nα-[1-cyanoazidoheptyloxycarbonyl]-[N28Q]exenatide were ed similarly. Release of free [N28Q]exenatide from these microspheres was measured in vitro by suspending a sample of the conjugate in 0.1 M borate, pH 9.4, and following the solubilization by the increase in OD280 at 37°C. A first-order release was observed showing a half-life = 16.5 h at pH 9.4. This extrapolates to 1650 h at pH 7.4.
Microspheres comprising [N28Q]exenatide attached via a linker wherein R1 = CN and R2 = H were prepared similarly, using Nα-[1-cyanoazido heptyloxycarbonyl]-[N28Q]exenatide (Example 1). The final preparation comprised 2.2 µmol peptide gm-1 in isotonic acetate buffer (10 mM acetate, 120 mM NaCl, pH 5.0) with 0.05% Tween® 20. 18563198_1 (GHMatters) P109745.NZ.1 Example 5 Rat Pharmacokinetics The contents of tared 1 mL dosing syringes containing the microsphere slurries prepared in Example 4 were administered h a 27 gauge needle s.c. into the flank of cannulated male Sprague Dawley rats, ~350 g. Each syringe contained 0.45 or 0.98 μmol peptide at 1.9 μmol peptide g-1 slurry. The syringes were weighed prior to and after dosing to verify the mass delivered to each rat. Blood s (300 μL) were drawn and the serum was frozen at -80°C until analysis.
Exenatide concentrations were ed by ELISA according to the cturer’s protocol (Peninsula Laboratories Inc., #S-1311). Frozen serum samples were thawed on ice and diluted between 5 and 20-fold in the provided rat serum. The standard exenatide showed an EC50 = 0.22 nM (reported 0.19 nM). Data replicates were averaged and fitted to appropriate pharmacokinetic models. [N28Q]Exenatide concentrations in sera were measured by LC-MS/MS.
The results are shown in Figures 10 and 11.
Figure 10 shows the pharmacokinetics of exenatide in the rat after dosing with a el-linked (same as those in Example 4 except using exenatide that is in the native form and where R1 = MeSO2). An ed concentration vs. time curve was generated (dashed line) based on the results of in vitro release kinetics (t1/2 = 1400 h) and the known pharmacokinetic parameters of exenatide. mental data (squares) show a better fit to a model accounting for degradation of exenatide on the hydrogel (solid line) where the overall t1/2 = 190 h.
Figure 11 shows the pharmacokinetics of exenatides of e 4 in the rat after s.c. dosing. Panel A shows a hydrogel wherein the peptide is linked using L wherein R1 = MeSO2 and gives t1/2 = 350 h. Panel B shows a hydrogel wherein the peptide is linked using L wherein R1 = CN and gives t1/2 = 760 h. Thus plasma levels of [N28Q]exenatide can be maintained for at least one month after a single dose, while the data in Figure 11 show a much r t1/2.
Example 6 Oral Glucose Tolerance Test The ability of [N28Q]exenatide to provide tolerance to a bolus of oral glucose relative to exenatide was determined in mice. A total of 54 male, 8-week old C57BL/6J 18563198_1 (GHMatters) P109745.NZ.1 mice (JanVier France) were acclimatized for 2 weeks then stratified into 9 groups (n = 6).
On day 0, mice were fasted for 4 h then dosed with test article by subcutaneous injection at t = -15 minutes followed by glucose at 0 minutes. Blood e was measured at -60, -15, 0, 15, 30, 60, and 120 minutes. Blood samples for insulin ements were taken at 0 and 15 minutes. Results are shown in Figures 12 and 13. Exenatide and [N28Q]exenatide showed comparable activity in the oral glucose tolerance test.
Figure 12 shows the comparative results of exenatide and exenatide in an oral glucose tolerance test. A clear and similar dose response was observed for exenatide and [N28Q]exenatide in an oral glucose tolerance test in C57BL/J mice dosed at -30 min with exendin-4 and [N28Q]exenatide in 5 different concentrations. Each line represents a significant difference from vehicle. Two-way repeated measurement ANOVA compared to vehicle. P<0.05 Bonferroni post hoc test. e bolus was 2 g/kg in 10 ml, per oral.
Figure 13 shows the AUC analysis for the oral glucose nce test data shown in Figure 7. A clear and similar dose response was observed for exenatide and [N28Q]exenatide in area under the curve data after an oral glucose tolerance test (OGTT).
One-way ANOVA, Bonferroni post hoc test vs. vehicle. ***p < 0.001.
Example 7 Chronic Glucoregulatory Effects of Hydrogel Microsphere-Conjugated [N28Q]Exenatide Injected Q4Wk vs. ide uous Infusion A total of 55 male Zucker diabetic fatty rats (ZDF-Leprfa/Crl) 6 weeks of age, and 180-200 gram (Charles River, USA) were single-housed and blood glucose and body weight were monitored bi-weekly for 2-4 weeks. Based on morning-fed blood e, outliers were excluded and 40 diabetic rats ge weight 340 g, blood glucose 9.7 to 22.5 mM, average 16.2 mM) were stratified into 4 groups of n = 10.
At t = 0: Group I ed vehicle in an Alzet® pump (2ML4); Group II received exenatide Alzet® pump (30 μg/kg/day, in AcOH, pH 4.5); Group III received s.c. hydrogel microsphere-[N28Q]exenatide having drug-release modulator R1 = CN described in Example 4, 0.37 mg peptide) plus vehicle pump; Group IV received s.c. hydrogel microsphere-[N28Q]exenatide (3.7 mg e) plus vehicle pump. 18563198_1 (GHMatters) P109745.NZ.1 On day 29, two days after the 4 week OGTT, pumps were replaced and the hydrogel microsphere-[N28Q]exenatide was re-dosed s.c. at the same levels. On day 56, the pumps were removed and animals were allowed to recover for 4 wks. Six rats that became diabetic at a later age received [N28Q]exenatide in osmotic pumps (30 μg/kg/day, in AcOH, pH 4.5) on day 28 that were discontinued on day 56, after which animals were allowed to recover for 4 weeks.
Body-weights were monitored daily from day -3 hout the study. Food and water intake were monitored on day -3 and daily for the first 11 days after the first dose then bi-weekly for the rest of the study period. Blood sampling was performed for pharmacokinetic studies 2 days after the first dose and then once weekly. HbA1c was measured day -3, and days 26 and 55 before OGTT, and the gastric ng test was performed on day 26. For the OGTT, rats were semi-fasted overnight (60%) then PO glucose (2 g/kg in 10 mL) was administered at t = 0. Blood glucose and n were measured at t = -60, -15, 0, 15, 30, 60 and 120 minutes after the glucose challenge.
Gastric emptying was measured by stration of acetaminophen (100 mg/kg) with the OGTT on day 26, and blood levels were measured at 15, 30, 60 and 120 min.
The results are shown in Figures 14A-14E. In these s, for vehicle control (black), exendin-4 delivered by continuous infusion using a subcutaneous pump at ug/kg/day (pink), PL-cmpd dosed at 220 nmol peptide/kg (gray), PL-cmpd dosed at 2200 nmol peptide/kg (blue), and [N28Q]exenatide free peptide delivered by continuous infusion using a subcutaneous pump at 30 ug/kg/day (green).
Figure 14A shows body weights.
Figure 14B shows blood glucose in mmol/L.
Figure 14C shows the results of oral glucose tolerance tests performed at 4 and 8 weeks.
Figure 14D shows levels of ylated hemoglobin HbA1c at 4 and 8 weeks.
Figure 14E shows levels of peptides in plasma as a function of time.
A single dose of a hydrogel microsphere preparation comprising [N28Q]exenatide was effective at controlling blood glucose for at least one month. 18563198_1 ters) P109745.NZ.1 Example 8 Pharmacokinetics of Hydrogel-Microsphere ates in the Rat and Mouse A. Syringes (0.5 mL U-100 insulin syringe with fixed 29 g x ½" needle, BD) were filled under sterile conditions with the [N28Q]exenatide-microsphere slurry prepared in Example 4 in isotonic acetate (10 mM Na Acetate, 143 mM NaCl) pH 5.0 0.05% Tween® 20. Microspheres using drug-release modulator R1 = MeSO2 contained 1.3 µmol peptide/g slurry, and microspheres using drug-release modulator R1 = CN contained 1.4 µmol peptide/g slurry. The content of each syringe was stered SC in the flank of six cannulated male Sprague Dawley rats (average weight 270 g).
The needle assembly was purged of air and d prior to and following dosing to determine the mass of the slurry delivered to each rat; with the MeSO2 modulator 130 mg slurry containing 0.7 mg peptide (170 nmol) was administered to each rat, and with the CN modulator 400 mg slurry containing 2.5 mg peptide (580 nmol) was administered.
Blood samples (300 μL) were drawn at 0, 1, 2, 4, 8, 24, 48, 72, 120, 168, 240, 336, 432, 504, 600, 672 hours for both s and additional samples were obtained at 840, 1008, 1176, 1344, 1512, 1680, 1848, and 2016 hours for the linker with the CN modulator. Serum was prepared and frozen at -80°C until analysis. Serum [N28Q]exenatide was analyzed by MS.
The results are shown in Figures 15A and 15B. Figure 15A shows the results after injection with hydrogel-[N28Q]exenatide pheres with a drug release modulator R1 = MeSO2 (170 nmol [N28Q]exenatide/rat or 2.6 mg/kg); t1/2,β was 310 hr.
Figure 15B shows the results after injection with hydrogel-[N28Q]exenatide microspheres with a drug release modulator R1 = CN (600 nmol [N28Q]exenatide/rat or 8.9 mg/kg); t1/2,β was 880 hr. Error bars are ±SEM.
B. The small amounts of microspheres needed in the mouse required a diluent to allow accurate . Using a dual syringe-based reaction vessel {Schneider, 2016 #24} the buffer of a [N28Q]exenatide-microsphere slurry (~1 mL for drug-release modulator R1 = MeSO2, 4 mL for R1 = CN) was aseptically exchanged for a on of isotonic acetate pH 5.0 (10 mM NaOAc, 143 mM NaCl), 25% glycerol and 0.05% Tween® 20.
This diluent served to keep the microspheres in a homogeneous suspension prior to and during administration and d dosing of convenient volumes. The slurry was then diluted with the same mixture to give 264 nmol e/mg slurry (R1 = MeSO2) or 18563198_1 (GHMatters) P109745.NZ.1 720 nmol peptide/mg slurry [R1 = CN). Syringes (0.5 mL U-100 insulin syringe with fixed 29 g x ½" needle, BD) were filled with the suspended microspheres under aseptic ions. The needle assembly of each syringe was purged of air and weighed prior to and ing dosing to determine the average mass of slurry delivered to each mouse.
For R1 = MeSO2, 120 mg of slurry ning 130 ug peptide (30 nmol) was administered SC in the flank of each of 18 CD-1 mice (average weight 30 g). Blood s (100 μL) were drawn from the orbital sinus at 8, 24, 48, 72, 96, 120, 168, 240, 336, 408, 504, 576 and 672 hours on a staggered schedule to give 6 replicates at each time-point, and sera of each were prepared. For R1 = CN, 200 mg slurry containing 605 μg peptide (144 nmol) was se administered SC to 24 CD-1 mice. Blood samples (100 μL) were drawn from the orbital sinus at the same times as above, and also at 840, 1008, 1176, 1344, 1512, 1680, 1848, and 2016 hours on a staggered le to give 6 replicates at each time-point. Serum was prepared and frozen at -80°C until analysis. Serum [N28Q]exenatide was analyzed by MS.
Serum samples were d with 3 vol of ACN and centrifuged. The supernatant was dried, reconstituted and applied to a HPLC MS/MS system. The sample was eluted by a water/ACN gradient containing 0.1% formic acid. The calibration curve for [N28Q]exenatide was linear over the range of 0.25-100 ng/mL. HPLC-MS/MS analyses were d out on a Sciex 5500 QTrap® mass ometer coupled with a Shimadzu HPLC system. The Shimadzu HPLC system consisted of two LC-30AD HPLC pumps and a SIL-30AC autosampler with a 100-μL loop installed. The chromatographic separations were achieved on a 3-μm C18, 2.1 × 50 mm HPLC column, with mobile phase gradients. The mass spectrometer was operated in positive electrospray ionization mode and the resolution setting used was the unit for both Q1 and Q3. The multiple-reactions monitoring (MRM) transition was m/z = 841.1 ->396.3 for [N28Q]exenatide. Peak-area integrations were performed using Analyst software (version 1.5.2) from Sciex.
The results are shown in Figures 16A and 16B. Figure 16A shows the results after injection with hydrogel-[N28Q]exenatide microspheres with a drug release modulator R1 = MeSO2 (30 nmol [N28Q]exenatide/mouse or 4.2 mg/kg). Figure 16B shows the results after injection with hydrogel-[N28Q]exenatide microspheres with a drug release tor R1 = CN (144 nmol [N28Q]exenatide/mouse or 20.2 mg/kg). 18563198_1 (GHMatters) P109745.NZ.1 Early points were icient to ate absorption phase kinetics, and were not used in fitting the β-phase shown. Error bars are ±SEM.
C vs. t curves (text) were analyzed using GraphPad Prism by non-linear regression of eq X (text) with weighting by 1/SD2; since ka >>k1 we modeled the single exponential phase of the terminal half-life using data points later than the first few days.
Table 2 Pharmacokinetic Properties of Hydrogel-[N28Q]Exenatide Microspheres in the Mouse and Rat Mouse Rat Modulator MeSO2- -CN MeSO2- -CN Dose, µmol/kg 0.94 4.5 0.69 2.1 k x 104 ± SE, h-1 28.4 ± 3.9 9.5 ± 1.0 22.3 ±1.6 7.8 ± 1.3 t1/2, hr 244 730 310 883 Cmax,0, nM 2.2 0.81 1.5 0.36 AUCinf, nM-hr 841± 275 800 ± 323 786 ± 37 448 ± 91 Dose adjusted: Cmax,0, nM/(µmol/kg) 2.3 0.18 2.2 0.17 18563198_1 (GHMatters) P109745.NZ.1

Claims (25)

Claims
1. An extended-release conjugate of a GLP-1 agonist comprising an insoluble matrix with a multiplicity of covalently attached -agonist peptide, wherein the linkers cleave under physiological conditions of pH and temperature to release free peptide agonist and wherein the agonist e of said linker-agonist peptide is said GLP-1 agonist that shows a degradation of less than 10% over one month under physiological conditions of pH and temperature.
2. The extended-release conjugate of claim 1 having the formula M-(L-E)x wherein M is an insoluble ; L is a ble linker having a half-life of cleavage at 37°C, pH 7.4, of between 320 and 2400 hours; and E is a GLP-1 agonist that shows less than 10% chemical ation after 1 month at pH 7.4, 37°C and x is an integer representing the number of L-E units required to provide a concentration of 1-1000 mg e in one ml of the volume occupied by the matrix.
3. The ed-release conjugate of claim 1 wherein the GLP-1 agonist is a stabilized exendin comprising an amino acid substitution at the position corresponding to N28 in a native exendin sequence, wherein the native exendin consists of SEQ ID NO:1 or SEQ ID NO:7.
4. The extended-release conjugate of Claim 3 wherein the GLP-1 agonist is N29D, N28A, N28K or N28Q substituted SEQ ID NO:1 or SEQ ID NO:7.
5. The ed-release conjugate of Claim 4 n the GLP-1 agonist is SEQ ID NO:2 or SEQ ID NO:8.
6. The extended-release conjugate of any of Claims 1-5 wherein the insoluble matrix is a biodegradable crosslinked hydrogel comprising polymers coupled by crosslinkers.
7. The extended-release conjugate of Claim 6 wherein the hydrogel is a biodegradable crosslinked poly(ethylene glycol). 18563198_1 (GHMatters) P109745.NZ.1
8. The extended-release conjugate of Claim 6 wherein the hydrogel is in the form of microspheres.
9. The extended-release conjugate of claim 6 wherein the polymers comprising the hydrogel are crosslinked by crosslinkers that are d by beta elimination.
10. The extended-release conjugate of claim 9 wherein said crosslinkers contained in the hydrogel are of formula (1) wherein m is 0 or 1; and n X and one of R1, R2 and R5 is coupled to a r contained in the hydrogel, with the proviso that at least one of R1 and R2 is CN; NO2; optionally substituted aryl; optionally substituted heteroaryl; optionally substituted alkenyl; optionally substituted l; COR3 or SOR3 or SO2R3 wherein R3 is H or optionally substituted alkyl; aryl or arylalkyl, each optionally substituted; heteroaryl or heteroarylalkyl, each optionally substituted; or OR9 or NR92 wherein each R9 is independently H or optionally tuted alkyl, or both R9 groups taken together with the nitrogen to which they are attached form a heterocyclic ring; SR4 n R4 is optionally substituted alkyl; aryl or arylalkyl, each optionally substituted; or aryl or heteroarylalkyl, each optionally substituted; wherein R1 and R2 may be joined to form a 3-8 membered ring; and 18563198_1 (GHMatters) P109745.NZ.1 wherein any remaining R1 and R2 is H or is alkyl, arylalkyl or heteroarylalkyl, each optionally substituted; and any remaining R5 is independently H or is alkyl, alkenylalkyl, alkynylalkyl, (OCH2CH2)p O-alkyl wherein p=1-1000, aryl, arylalkyl, heteroaryl or heteroarylalkyl, each optionally substituted; or said crosslinkers when contained in the hydrogel are of a (2) wherein two of R1, R2 and R5 are d to a r contained in the hydrogel; m is 0-1; n is 1-1000; s is 0-2; t is 2,4, 8, 16 or 32; Q is a core group having the valency t; W is O(C=O)O, O(C=O)NH, O(C=O)S, O C N CH2 O , or O C N CH2 S ; wherein R6 is H, optionally substituted alkyl, ally substituted aryl, optionally substituted heteroaryl, optionally tuted arylalkyl, or optionally substituted heteroarylalkyl; and with the proviso that at least one of R1 and R2 is CN; NO2; optionally substituted aryl; optionally substituted heteroaryl; optionally substituted alkenyl; optionally substituted alkynyl; COR3 or SOR3 or SO2R3 wherein 18563198_1 (GHMatters) P109745.NZ.1 R3 is H or optionally substituted alkyl; aryl or arylalkyl, each optionally substituted; heteroaryl or heteroarylalkyl, each optionally substituted; or OR9 or NR92 wherein each R9 is independently H or optionally substituted alkyl, or both R9 groups taken together with the nitrogen to which they are attached form a heterocyclic ring; SR4 wherein R4 is optionally substituted alkyl; aryl or arylalkyl, each optionally substituted; or heteroaryl or heteroarylalkyl, each optionally substituted; wherein R1 and R2 may be joined to form a 3-8 membered ring; and wherein any remaining R1 and R2 is H or is alkyl, arylalkyl or heteroarylalkyl, each ally tuted; and any remaining R5 is independently H or is alkyl, alkenylalkyl, alkynylalkyl, (OCH2CH2)p O-alkyl wherein 00, aryl, arylalkyl, heteroaryl or heteroarylalkyl, each optionally substituted.
11. The extended-release ate of Claim 2 wherein L is a linker of the formula (3) H R5 O R1 C C O C (3) R2 R5 wherein at least one, or both R1 and R2 is ndently CN; NO2; optionally substituted aryl; optionally substituted heteroaryl; optionally substituted alkenyl; optionally substituted l; COR3 or SOR3 or SO2R3 wherein R3 is H or optionally substituted alkyl; aryl or arylalkyl, each optionally substituted; heteroaryl or heteroarylalkyl, each optionally tuted; or R3 is OR9 or NR92 wherein each R is independently H or optionally substituted alkyl, or both R9 groups taken er with the nitrogen to which they are attached form a heterocyclic ring; 18563198_1 (GHMatters) P109745.NZ.1 SR4 wherein R4 is optionally substituted alkyl; aryl or arylalkyl, each optionally substituted; or aryl or heteroarylalkyl, each optionally substituted; wherein R1 and R2 may be joined to form a 3-8 membered ring; and wherein one and only one of R1 and R2 may be H or alkyl, arylalkyl or heteroarylalkyl, each optionally substituted; and wherein one of R5 is (CH2)yZ*, (CH2CH2O)xCH2CH2Z* or (CH2)yNH-CO-(CH2CH2O)x CH2CH2Z*, wherein x is 1-100, y = 1-6, and the other R5 is H, alkyl, alkenylalkyl, lalkyl, aryl, arylalkyl, heteroaryl or heteroarylalkyl, each optionally substituted; and Z* indicates coupling to the insoluble matrix.
12. The extended-release ate of Claim 11 wherein R1 is CN or R3SO2, wherein R3 is optionally substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, or (R9)2N, wherein each R9 is independently H or optionally tuted alkyl; wherein one of R5 is Z*, 2O)xCH2CH2Z* or (CH2)yNH-CO-(CH2CH2O)x CH2CH2Z*, wherein x is 1-100, y = 1-6, and the other R5 is H or unsubstituted alkyl.
13. The extended-release conjugate of Claim 12 wherein R1 is CN or CH3SO2; R2 is H; one R5 is Z* wherein y is 5; and the other R5 is H.
14. The extended-release conjugate of claim 6 wherein the linker-agonist peptide is covalently coupled to the crosslinkers.
15. A compound of formula (4) R 2 R 5 O R 1 C C O C N E (4) H R 5 wherein E is a GLP-1 agonist that shows less than 10% chemical degradation after 1 month at pH 7.4, 37°C 18563198_1 (GHMatters) P109745.NZ.1 wherein at least one, or both R1 and R2 is independently CN; NO2; optionally substituted aryl; optionally tuted heteroaryl; optionally substituted alkenyl; optionally substituted alkynyl; COR3 or SOR3 or SO2R3 wherein R3 is H or optionally substituted alkyl; aryl or arylalkyl, each optionally substituted; heteroaryl or arylalkyl, each optionally substituted; or R3 is OR9 or NR92 wherein each R is independently H or optionally substituted alkyl, or both R9 groups taken together with the nitrogen to which they are ed form a heterocyclic ring; SR4 wherein R4 is optionally tuted alkyl; aryl or arylalkyl, each optionally substituted; or heteroaryl or arylalkyl, each optionally substituted; wherein R1 and R2 may be joined to form a 3-8 membered ring; and wherein one and only one of R1 and R2 may be H or alkyl, arylalkyl or heteroarylalkyl, each optionally substituted; and wherein one of R5 is (CH2)yZ, (CH2CH2O)xCH2CH2Z or (CH2)yNH-CO-(CH2CH2O)x CH2CH2Z, n x is 1-100, y = 1-6, and the other R5 is H, alkyl, alkenylalkyl, alkynylalkyl, aryl, arylalkyl, heteroaryl or heteroarylalkyl, each optionally substituted; and Z is a functional group for coupling to said insoluble matrix.
16. The compound of claim 15 wherein said functional group comprises N3, NH2, NH-CO2tBu, SH, StBu, maleimide, CO2H, CO2tBu, 1,3-diene, cyclopentadiene, furan, alkyne, cyclooctyne, acrylate, aminooxy, keto or acrylamide.
17. The nd of Claim 15 n R1 is CN or R3SO2, wherein R3 is optionally substituted alkyl, optionally substituted aryl, optionally substituted heteroaryl, or (R9)2N, wherein each R9 is independently H or optionally substituted alkyl; 18563198_1 (GHMatters) P109745.NZ.1 wherein one of R5 is (CH2)yZ, (CH2CH2O)xCH2CH2Z or (CH2)yNH-CO-(CH2CH2O)x Z, wherein x is 1-100, y = 1-6, and the other R5 is H or unsubstituted alkyl.
18. The compound of Claim 17 wherein R1 is CN or CH3SO2; R2 is H; one R5 is Z wherein y is 5; and the other R5 is H.
19. The compound of any of Claims 15-18 wherein E is a stabilized exendin comprising an amino acid substitution at the position corresponding to N28 in the native exendin sequence, wherein the native n ts of SEQ ID NO:1 or SEQ ID NO:7.
20. The compound of Claim 19 wherein E is N29D, N28A, N28K or N28Q substituted SEQ ID NO:1 or SEQ ID NO:7.
21. The compound of Claim 20 wherein E is SEQ ID NO:2.
22. A protocol for stering a GLP-1 agonist which comprises administering to a subject having a condition benefited by a GLP-1 agonist the conjugate of any of claims 1-5 one dosage per one to three months.
23. A peptide of the a: HGEGTFTSDL SKQMEEEAVR LFIEWLKQGG PSSGAPPPS-NH2 (SEQ ID NO:2) ([N28Q]exenatide) or a pharmaceutically acceptable salt thereof.
24. A pharmaceutical composition comprising as active ingredient the peptide or salt of claim 23.
25. A protocol for administering a GLP-1 agonist which comprises administering to a subject having a ion benefited by a GLP-1 agonist the peptide or salt of claim 23 or the pharmaceutical composition of claim 24. 18563198_1 (GHMatters) P109745.NZ.1 fix.»..: sssssssssskkg {xxxxxxxxxk
NZ786229A 2017-03-16 Extended release conjugates of exenatide analogs NZ786229A (en)

Publications (1)

Publication Number Publication Date
NZ786229A true NZ786229A (en) 2022-03-25

Family

ID=

Similar Documents

Publication Publication Date Title
AU2021232810A1 (en) Extended release conjugates of exenatide analogs
EP3660041B1 (en) Insulin receptor partial agonists
JP2023166021A (en) Suspension formulations of insulinotropic peptides and uses thereof
KR101466933B1 (en) Pharmaceutical compositions for sustained release delivery of peptides
US10413594B2 (en) Conjugates of somatostatin analogues
TW201832783A (en) Conjugates comprising an glp-1/glucagon dual agonist, a linker and hyaluronic acid
KR20220020821A (en) Pharmaceutical parenteral composition of dual GLP1/2 agonist
KR101104574B1 (en) Human growth hormone derivative linked with polyethyleneglycol, method for the preparation thereof and pharmaceutical composition comprising the same
NZ786229A (en) Extended release conjugates of exenatide analogs
CN115634285A (en) Application of polypeptide conjugate in preparation of medicines for treating diseases related to glycometabolism
EA041034B1 (en) PARTIAL INSULIN RECEPTOR AGONISTS
MXPA06012009A (en) Sustained release formulations