NZ785676A - Vaccine against rsv - Google Patents
Vaccine against rsvInfo
- Publication number
- NZ785676A NZ785676A NZ785676A NZ78567617A NZ785676A NZ 785676 A NZ785676 A NZ 785676A NZ 785676 A NZ785676 A NZ 785676A NZ 78567617 A NZ78567617 A NZ 78567617A NZ 785676 A NZ785676 A NZ 785676A
- Authority
- NZ
- New Zealand
- Prior art keywords
- rsv
- protein
- nucleic acid
- adenovirus
- fusion
- Prior art date
Links
- 229960005486 vaccine Drugs 0.000 title claims abstract description 34
- 241000725643 Respiratory syncytial virus Species 0.000 claims abstract description 264
- 108010068327 4-hydroxyphenylpyruvate dioxygenase Proteins 0.000 claims abstract description 112
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 67
- 230000004927 fusion Effects 0.000 claims abstract description 63
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 62
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 62
- 239000013598 vector Substances 0.000 claims abstract description 60
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract 3
- 210000004027 cell Anatomy 0.000 claims description 127
- 241000701161 unidentified adenovirus Species 0.000 claims description 74
- 108090000623 proteins and genes Proteins 0.000 claims description 46
- 238000000034 method Methods 0.000 claims description 43
- 102000004169 proteins and genes Human genes 0.000 claims description 39
- 239000000203 mixture Substances 0.000 claims description 32
- 150000001413 amino acids Chemical class 0.000 claims description 31
- 239000012634 fragment Substances 0.000 claims description 19
- 241000282414 Homo sapiens Species 0.000 claims description 16
- 238000012217 deletion Methods 0.000 claims description 15
- 230000037430 deletion Effects 0.000 claims description 15
- 208000015181 infectious disease Diseases 0.000 claims description 15
- 230000010076 replication Effects 0.000 claims description 15
- 241000598171 Human adenovirus sp. Species 0.000 claims description 8
- 108020004705 Codon Proteins 0.000 claims description 6
- 239000002253 acid Substances 0.000 claims description 6
- 239000008194 pharmaceutical composition Substances 0.000 claims description 4
- 230000001902 propagating effect Effects 0.000 claims description 4
- 210000005260 human cell Anatomy 0.000 claims description 3
- 241000700605 Viruses Species 0.000 description 24
- 238000010186 staining Methods 0.000 description 16
- 241001465754 Metazoa Species 0.000 description 15
- 230000035772 mutation Effects 0.000 description 15
- 238000003556 assay Methods 0.000 description 14
- 230000002950 deficient Effects 0.000 description 13
- 239000000872 buffer Substances 0.000 description 12
- 238000000684 flow cytometry Methods 0.000 description 12
- 230000003472 neutralizing effect Effects 0.000 description 12
- 238000006467 substitution reaction Methods 0.000 description 12
- 241000726306 Irus Species 0.000 description 10
- 239000000427 antigen Substances 0.000 description 10
- 108091007433 antigens Proteins 0.000 description 10
- 102000036639 antigens Human genes 0.000 description 10
- 102220082314 rs863224177 Human genes 0.000 description 10
- 241000144282 Sigmodon Species 0.000 description 9
- 230000003053 immunization Effects 0.000 description 9
- 238000002649 immunization Methods 0.000 description 9
- 108090000765 processed proteins & peptides Proteins 0.000 description 9
- 241000699670 Mus sp. Species 0.000 description 8
- 201000010099 disease Diseases 0.000 description 8
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 8
- 230000028993 immune response Effects 0.000 description 8
- 239000002773 nucleotide Chemical group 0.000 description 8
- 125000003729 nucleotide group Chemical group 0.000 description 8
- 230000037452 priming Effects 0.000 description 8
- 108091028043 Nucleic acid sequence Proteins 0.000 description 7
- 108700019146 Transgenes Proteins 0.000 description 7
- 239000002671 adjuvant Substances 0.000 description 7
- 239000003599 detergent Substances 0.000 description 7
- 230000001965 increasing effect Effects 0.000 description 7
- 102200142660 rs7565275 Human genes 0.000 description 7
- 230000000087 stabilizing effect Effects 0.000 description 7
- 238000002255 vaccination Methods 0.000 description 7
- 241000144290 Sigmodon hispidus Species 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 239000012537 formulation buffer Substances 0.000 description 6
- 238000007918 intramuscular administration Methods 0.000 description 6
- 150000002500 ions Chemical class 0.000 description 6
- 210000004072 lung Anatomy 0.000 description 6
- 239000013612 plasmid Substances 0.000 description 6
- 238000002360 preparation method Methods 0.000 description 6
- 238000000746 purification Methods 0.000 description 6
- 230000004044 response Effects 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 210000001519 tissue Anatomy 0.000 description 6
- 230000003612 virological effect Effects 0.000 description 6
- 238000002965 ELISA Methods 0.000 description 5
- 108700039887 Essential Genes Proteins 0.000 description 5
- 101710163270 Nuclease Proteins 0.000 description 5
- 206010061603 Respiratory syncytial virus infection Diseases 0.000 description 5
- 230000009089 cytolysis Effects 0.000 description 5
- 239000002245 particle Substances 0.000 description 5
- 230000008569 process Effects 0.000 description 5
- 102000004196 processed proteins & peptides Human genes 0.000 description 5
- 102220069695 rs794727722 Human genes 0.000 description 5
- 239000000523 sample Substances 0.000 description 5
- 206010001889 Alveolitis Diseases 0.000 description 4
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 4
- 229940024606 amino acid Drugs 0.000 description 4
- 238000004113 cell culture Methods 0.000 description 4
- 238000003776 cleavage reaction Methods 0.000 description 4
- 230000000694 effects Effects 0.000 description 4
- 201000001155 extrinsic allergic alveolitis Diseases 0.000 description 4
- 238000009472 formulation Methods 0.000 description 4
- 238000003306 harvesting Methods 0.000 description 4
- 208000022098 hypersensitivity pneumonitis Diseases 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 210000001331 nose Anatomy 0.000 description 4
- 239000000546 pharmaceutical excipient Substances 0.000 description 4
- 229920001184 polypeptide Polymers 0.000 description 4
- XJMOSONTPMZWPB-UHFFFAOYSA-M propidium iodide Chemical compound [I-].[I-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CCC[N+](C)(CC)CC)=C1C1=CC=CC=C1 XJMOSONTPMZWPB-UHFFFAOYSA-M 0.000 description 4
- 230000007017 scission Effects 0.000 description 4
- 238000011282 treatment Methods 0.000 description 4
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 3
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 3
- 108020004414 DNA Proteins 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 108010034546 Serratia marcescens nuclease Proteins 0.000 description 3
- 230000010530 Virus Neutralization Effects 0.000 description 3
- 230000002411 adverse Effects 0.000 description 3
- 230000005875 antibody response Effects 0.000 description 3
- 230000000890 antigenic effect Effects 0.000 description 3
- 230000006037 cell lysis Effects 0.000 description 3
- 238000011210 chromatographic step Methods 0.000 description 3
- 238000004587 chromatography analysis Methods 0.000 description 3
- 238000010276 construction Methods 0.000 description 3
- 238000012258 culturing Methods 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 239000012091 fetal bovine serum Substances 0.000 description 3
- 108020001507 fusion proteins Proteins 0.000 description 3
- 102000037865 fusion proteins Human genes 0.000 description 3
- 238000010438 heat treatment Methods 0.000 description 3
- 230000028996 humoral immune response Effects 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 230000006698 induction Effects 0.000 description 3
- 239000006166 lysate Substances 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 3
- 239000013642 negative control Substances 0.000 description 3
- 238000006386 neutralization reaction Methods 0.000 description 3
- 244000052769 pathogen Species 0.000 description 3
- 230000000644 propagated effect Effects 0.000 description 3
- 230000001681 protective effect Effects 0.000 description 3
- 238000011552 rat model Methods 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 238000002741 site-directed mutagenesis Methods 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 238000001890 transfection Methods 0.000 description 3
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- 101100165660 Alternaria brassicicola bsc6 gene Proteins 0.000 description 2
- 101100499295 Bacillus subtilis (strain 168) disA gene Proteins 0.000 description 2
- 206010006448 Bronchiolitis Diseases 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 108091006027 G proteins Proteins 0.000 description 2
- 102000030782 GTP binding Human genes 0.000 description 2
- 108091000058 GTP-Binding Proteins 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 241000711920 Human orthopneumovirus Species 0.000 description 2
- 101150007210 ORF6 gene Proteins 0.000 description 2
- 108700026244 Open Reading Frames Proteins 0.000 description 2
- 102400001093 PAK-2p27 Human genes 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- 101100226894 Phomopsis amygdali PaGT gene Proteins 0.000 description 2
- 206010035664 Pneumonia Diseases 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 229940124679 RSV vaccine Drugs 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 108091081024 Start codon Proteins 0.000 description 2
- 230000024932 T cell mediated immunity Effects 0.000 description 2
- 210000001744 T-lymphocyte Anatomy 0.000 description 2
- 239000007983 Tris buffer Substances 0.000 description 2
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 2
- 229910052782 aluminium Inorganic materials 0.000 description 2
- 239000004411 aluminium Substances 0.000 description 2
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 2
- 229910021502 aluminium hydroxide Inorganic materials 0.000 description 2
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 2
- 229940001007 aluminium phosphate Drugs 0.000 description 2
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- AIYUHDOJVYHVIT-UHFFFAOYSA-M caesium chloride Chemical compound [Cl-].[Cs+] AIYUHDOJVYHVIT-UHFFFAOYSA-M 0.000 description 2
- 150000001768 cations Chemical class 0.000 description 2
- 239000013592 cell lysate Substances 0.000 description 2
- 239000006285 cell suspension Substances 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 230000036755 cellular response Effects 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 238000005352 clarification Methods 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 230000034994 death Effects 0.000 description 2
- 231100000517 death Toxicity 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 238000011026 diafiltration Methods 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 2
- 238000001415 gene therapy Methods 0.000 description 2
- 210000004124 hock Anatomy 0.000 description 2
- 230000036039 immunity Effects 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 229910001629 magnesium chloride Inorganic materials 0.000 description 2
- 239000003068 molecular probe Substances 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 230000001717 pathogenic effect Effects 0.000 description 2
- 108091033319 polynucleotide Proteins 0.000 description 2
- 102000040430 polynucleotide Human genes 0.000 description 2
- 239000002157 polynucleotide Substances 0.000 description 2
- 230000002516 postimmunization Effects 0.000 description 2
- 230000003389 potentiating effect Effects 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 210000002345 respiratory system Anatomy 0.000 description 2
- 208000023504 respiratory system disease Diseases 0.000 description 2
- 102220320732 rs1554306350 Human genes 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 238000001542 size-exclusion chromatography Methods 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 239000008174 sterile solution Substances 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 238000004114 suspension culture Methods 0.000 description 2
- LWIHDJKSTIGBAC-UHFFFAOYSA-K tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- 238000000108 ultra-filtration Methods 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 210000002845 virion Anatomy 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 1
- 241000701242 Adenoviridae Species 0.000 description 1
- 208000010370 Adenoviridae Infections Diseases 0.000 description 1
- 206010060931 Adenovirus infection Diseases 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 231100000699 Bacterial toxin Toxicity 0.000 description 1
- 102100037084 C4b-binding protein alpha chain Human genes 0.000 description 1
- 101710159767 C4b-binding protein alpha chain Proteins 0.000 description 1
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 1
- 102000009016 Cholera Toxin Human genes 0.000 description 1
- 108010049048 Cholera Toxin Proteins 0.000 description 1
- 108700010070 Codon Usage Proteins 0.000 description 1
- 241000557626 Corvus corax Species 0.000 description 1
- 108010053770 Deoxyribonucleases Proteins 0.000 description 1
- 102000016911 Deoxyribonucleases Human genes 0.000 description 1
- OJIYIVCMRYCWSE-UHFFFAOYSA-M Domiphen bromide Chemical compound [Br-].CCCCCCCCCCCC[N+](C)(C)CCOC1=CC=CC=C1 OJIYIVCMRYCWSE-UHFFFAOYSA-M 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 101150034814 F gene Proteins 0.000 description 1
- 102000004961 Furin Human genes 0.000 description 1
- 108090001126 Furin Proteins 0.000 description 1
- 208000028523 Hereditary Complement Deficiency disease Diseases 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 101710087110 ORF6 protein Proteins 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 241000711904 Pneumoviridae Species 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 108010001267 Protein Subunits Proteins 0.000 description 1
- 102000002067 Protein Subunits Human genes 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 108010083644 Ribonucleases Proteins 0.000 description 1
- 102000006382 Ribonucleases Human genes 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- 101710095001 Uncharacterized protein in nifU 5'region Proteins 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 208000011589 adenoviridae infectious disease Diseases 0.000 description 1
- 108700010877 adenoviridae proteins Proteins 0.000 description 1
- 229940021704 adenovirus vaccine Drugs 0.000 description 1
- 238000004115 adherent culture Methods 0.000 description 1
- 230000001464 adherent effect Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000013019 agitation Methods 0.000 description 1
- 159000000013 aluminium salts Chemical class 0.000 description 1
- 210000001776 amniocyte Anatomy 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 208000006673 asthma Diseases 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 239000000688 bacterial toxin Substances 0.000 description 1
- 238000010923 batch production Methods 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 238000010364 biochemical engineering Methods 0.000 description 1
- 229920001222 biopolymer Polymers 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 108010006025 bovine growth hormone Proteins 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 230000034303 cell budding Effects 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 229940001442 combination vaccine Drugs 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 238000010924 continuous production Methods 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 229960003067 cystine Drugs 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 210000000852 deltoid muscle Anatomy 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 229960001859 domiphen bromide Drugs 0.000 description 1
- 108010067396 dornase alfa Proteins 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 230000001516 effect on protein Effects 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 238000001125 extrusion Methods 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 238000012395 formulation development Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 230000009931 harmful effect Effects 0.000 description 1
- 230000008642 heat stress Effects 0.000 description 1
- 238000007489 histopathology method Methods 0.000 description 1
- 238000002744 homologous recombination Methods 0.000 description 1
- 230000006801 homologous recombination Effects 0.000 description 1
- 230000003301 hydrolyzing effect Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 229960001438 immunostimulant agent Drugs 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 238000000126 in silico method Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 239000012678 infectious agent Substances 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 208000037797 influenza A Diseases 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 101150085091 lat-2 gene Proteins 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 230000002934 lysing effect Effects 0.000 description 1
- 230000002101 lytic effect Effects 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 229960001521 motavizumab Drugs 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 230000004719 natural immunity Effects 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 239000007764 o/w emulsion Substances 0.000 description 1
- 238000006384 oligomerization reaction Methods 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 244000045947 parasite Species 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 229940023041 peptide vaccine Drugs 0.000 description 1
- 230000010412 perfusion Effects 0.000 description 1
- 229940124531 pharmaceutical excipient Drugs 0.000 description 1
- 101150088856 pix gene Proteins 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 229940068968 polysorbate 80 Drugs 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 229910000160 potassium phosphate Inorganic materials 0.000 description 1
- 235000011009 potassium phosphates Nutrition 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 230000001376 precipitating effect Effects 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 230000004845 protein aggregation Effects 0.000 description 1
- 229940023143 protein vaccine Drugs 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 229940107568 pulmozyme Drugs 0.000 description 1
- 210000003314 quadriceps muscle Anatomy 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 239000001397 quillaja saponaria molina bark Substances 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 210000001525 retina Anatomy 0.000 description 1
- 229930182490 saponin Natural products 0.000 description 1
- 150000007949 saponins Chemical class 0.000 description 1
- 238000013341 scale-up Methods 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000004904 shortening Methods 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 210000004988 splenocyte Anatomy 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 230000035882 stress Effects 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 229940031626 subunit vaccine Drugs 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- 239000012096 transfection reagent Substances 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 210000000689 upper leg Anatomy 0.000 description 1
- 229940125575 vaccine candidate Drugs 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 230000029812 viral genome replication Effects 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
Abstract
The present invention relates to novel nucleic acid molecules encoding a pre- fusion RSV F protein or immunologically active part thereof, wherein the pre-fusion RSV F protein comprises the amino acid sequence of SEQ ID NO: 1 or 2. The invention further relates to the use of the nucleic acid molecules, or vectors comprising said nucleic acid molecules, as a vaccine against respiratory syncytial virus (RSV).
Description
Vaccine against RSV This application is a divisional of New Zealand patent application 746345, which is the national phase entry in New Zealand of PCT ational application (published as which are incorporated herein by reference.
The invention relates to the field of medicine. More in particular, the invention relates to vaccines against RSV.
Background of the invention Respiratory syncytial virus (RSV) is a highly contagious childhood pathogen of the respiratory tract which is believed to be responsible for ~200,000 childhood deaths annually. In children younger than 2 years, RSV accounts for approximately 50% of the hospitalizations due to atory infections, with a peak of hospitalization occurring at 2-4 months of age. It has been reported that almost all en will have experienced infection with RSV by the age of two, and ed infection during life is attributed to low natural immunity. In the elderly, the RSV disease burden is similar to those caused by non-pandemic influenza A infections. A vaccine against RSV is currently not available, but is desired due to the high e burden.
RSV is a paramyxovirus, belonging to the subfamily of pneumovirinae. Its genome encodes for s proteins, including the membrane proteins known as RSV Glycoprotein (G) and RSV fusion (F) n which are the major antigenic targets for neutralizing dies.
Unlike the RSV G protein, the F protein is conserved between RSV strains; which makes it an attractive vaccine candidate able to elicit y neutralizing antibodies. The F protein is a transmembrane protein and it is incorporated in the virion membrane from cellular membrane during virus budding. The RSV F protein facilitates infection by fusing the viral and host-cell nes. In the process of fusion, the F protein refolds irreversibly from a labile sion mation to a stable post-fusion conformation. The protein precursor, F0, requires cleavage during intracellular maturation by a like protease. There are two furin sites, cleavage of which results in removal of a p27 peptide and formation of two domains: an N- al F2 domain and a C-terminal F1 domain (Fig. 1). The F2 and F1 domains are connected by two cystine bridges. Antibodies against the fusion protein can prevent virus uptake in the cell and thus have a neutralizing effect. Besides being a target for neutralizing dies, RSV F ns cytotoxic T cell epitopes (Pemberton et al, 1987, J. rol. 68: 2177-2182). e 50 years of research, there is still no licensed vaccine against RSV.
One major le to the vaccine development is the legacy of vaccine-enhanced disease in a clinical trial in the 1960s with a formalin-inactivated (FI) RSV vaccine.
FI-RSV vaccinated en were not protected against natural infection and infected children experienced more severe illness than non-vaccinated children, including two deaths. This enon is referred to as ‘enhanced disease’.
Since the trial with the FI-RSV vaccine, various approaches to generate an RSV e have been pursued. Attempts include classical live attenuated cold passaged or temperature sensitive mutant strains of RSV, (chimeric) protein subunit vaccines, peptide vaccines and RSV proteins expressed from recombinant viral vectors, including adenoviral s. Although some of these vaccines showed promising pre-clinical data, no e has been licensed for human use due to safety concerns or lack of efficacy.
Therefore, a need remains for efficient vaccines and methods of vaccinating against RSV, in particular vaccines that do not lead to enhanced disease. The present invention aims at providing such vaccines and methods for vaccinating against RSV in a safe and efficacious .
Summary of the invention The t invention provides novel nucleic acid molecules encoding stable RSV pre-fusion F proteins, wherein the RSV pre-fusion F proteins se the amino acid ce of SEQ ID NO: 1 or 2.
In certain embodiments, the nucleic acid molecules encoding the RSV prefusion F proteins are codon optimized for expression in human cells.
In certain embodiments, the nucleic acid molecules encoding the RSV prefusion F proteins comprise the nucleic acid sequence of SEQ ID NO: 3 or 4.
The invention further provides vectors comprising the nucleic acid molecules encoding RSV pre-fusion F proteins, wherein the RSV F protein comprises the amino acid sequence of SEQ ID NO: 1 or 2.
In certain embodiments, the vector is a a human recombinant irus.
In certain embodiments, the recombinant adenovirus is of serotype 26 or 35.
In certain embodiments, the recombinant human adenovirus has a deletion in the E1 region, a on in the E3 region, or a on in both the E1 and the E3 region of the adenoviral genome.
In certain embodiments, the recombinant adenovirus has a genome comprising at its 5’ terminal ends the sequence CTATCTAT.
The invention also provides itions, e.g. vaccines against respiratory syncytial virus (RSV), sing a nucleic acid molecule or a vector according to the invention.
The invention further provides a method for vaccinating a subject against RSV, the method comprising stering to the subject a composition according to the invention.
In certain embodiments, the method of vaccinating a t against RSV further comprises administering RSV F protein rably formulated as a pharmaceutical composition, thus a protein vaccine) to the subject.
The invention also provides a method for reducing infection and/or replication of RSV in, e.g. the nasal tract and lungs of, a subject, comprising administering to the subject a composition comprising a nucleic acid or vector according to the invention.
This will reduce adverse effects resulting from RSV infection in a subject, and thus bute to protection of the subject against such adverse effects upon administration of the composition. In certain embodiments, adverse effects of RSV infection may be ially prevented, i.e. reduced to such low levels that they are not clinically relevant.
The invention also provides an isolated host cell comprising a nucleic acid le encoding a RSV pre-fusion F protein, wherein the RSV pre-fusion F protein comprises the amino acid sequence of SEQ ID NO: 1 or 2. In certain ments, the nucleic acid molecule encoding the RSV pre-fusion F protein comprises the nucleic acid sequence of SEQ ID NO: 3 or 4.
The invention further provides a method for making a vaccine t respiratory syncytial virus (RSV), comprising providing a recombinant human irus that comprises nucleic acid encoding a RSV pre-fusion F protein or fragment thereof, propagating said inant adenovirus in a culture of host cells, isolating and purifying the recombinant adenovirus, and formulating the recombinant irus in a pharmaceutically acceptable composition, wherein the RSV ion F protein comprises the amino acid sequence of SEQ ID NO: 1 or 2. In certain embodiments, the recombinant adenovirus is of pe 26 or 35.
Brief description of the Figures Schematic representation of the RSV F protein. A protein precursor includes F2 and F1 s and p27 peptide that is removed from the mature proteins by cleavage with furin-like proteases. The cleavage sites are indicated by arrows. The numbers on top of the boxes indicate amino acid positions in the full length n excluding signal peptide. In the F1, structural ts are shown: fusion peptide (FP), refolding region 1 (RR1) including heptad repeat A (HRA) and refolding region 2 (RR2) ing heptad repeat B (HRB).
Relative surface expression of F protein variants. Full length variants of F protein were expressed in HEK293T cells. The cell were stained with anti-RSV F antibody (CR9503) and analyzed by Flow Cytometry . The Mean Fluorescent Intensity (MFI) values were calculated and normalized to MFI of control F wild type (Fwt)-transfected cell sample. The MFI of Fwt was set to 1. Bars represent mean values, error bars represent range of values.
Fraction of pre-fusion F protein on cell surface. Full length variants of F protein were expressed in HEK293T cells. The cell were stained with anti-RSV F antibody CR9503 and anti-pre-fusion RSV F antibody CR9501 and analyzed by Flow Cytometry. The Mean Fluorescent ity (MFI) values were calculated and MFI ed by CR9501 was normalized to MFI ed by CR9503. The normalized MFI values indicate on of the pre-F on the cell surface. Bars represent mean , error bars represent range of values.
Relative surface sion of F protein variants. Soluble versions with the transmembrane region and cytoplasmic region deleted (Fsl) and full length variants of F protein were expressed in HEK293T cells. The expression level of the soluble protein was measured in the culture supernatant by octet and the full length variants were tested by cell staining using anti-RSV F antibody (CR9503) and analyzed by Flow Cytometry. The Mean Fluorescent Intensity (MFI) values were calculated and normalized to MFI of control F wild type (Fwt)-transfected cell sample. The MFI of Fwt was set to 1. Bars represent mean values, error bars represent range of values.
Temperature stability of the F protein ts. Full length variants of F protein were expressed in HEK293T cells. After heat-shock, the cell were stained with anti-RSV F antibody (CR9501 – solid lines and CR9503 – dashed lines) and analyzed by Flow Cytometry. The tage of cells positive for the staining was determined. Symbols represent mean , error bars represent range of values. (A) The percentage of cells positive for the staining was determined. (B) The Mean Fluorescent Intensity (MFI) values were calculated and normalized to MFI of 37C cell sample. The MFI of 37ºC sample was set to 1. Dotted lines correspond to background staining at 60°C.
Stability of the F proteins. PreF is more stable than FA2 protein in prefusion conformation on the cell surface in the heat-stress assay. A549 cells were infected with Ad26 and Ad35 comprising the insert FA2 (wt RSV F, grey bars) or prefusion F stabilized insert (preF2.2, black bars) at the indicated MOI. The cells were temperature treated at the ted temperature for 15 minutes before staining. Top: percentage of cells presenting prefusion F on their surface (detected by CR9501 antibody); bottom: percentage of cells presenting any form of the F protein, prefusion and post fusion (detected by CR9503 antibody). The values were normalized to 37°C samples. All bars represent a single measurement.
Ad26.RSV.preF2.1 and F2.2 elicit a cellular immune response after single administration in mice. Horizontal bars depict the geometric mean of the response within a group. The background level is calculated as the 95% percentile of the spot forming units (SFU) observed in non-stimulated cytes, and is indicated with a dotted line.
Ad26.RSV.preF2.1 and F2.2 induce increased virus lizing dies when ed to Ad26.RSV.FA2, after single immunization in mice.
Balb/c mice (n=4 per group) were immunized with the indicated dose of 108 to 1010 viral particles (vp) SV.FA2 or Ad26.RSV.preF2.1 or Ad26.RSV.preF2.2, or with formulation buffer, and humoral immune ses were assayed in the serum isolated 8 weeks after immunization. (A) Virus neutralizing antibodies were determined against RSV A Long using a micro-neutralization assay with an ELISA based read out. Titers are given as the log2 value of the IC50. (B)Pre-fusion or postfusion F dy titers were ined by ELISA, and the ratio between pre- and post-fusion F antibodies for all samples that showed pre- and post-fusion F titers above lower limit of quantification (LLoQ) was calculated. (C) Subclass ELISA was performed using usion RSV F A2 as coating reagent, and the IgG2a/IgG1 ratio (log10) is plotted. Ratio’s observed for Th1 (serum derived from animals immunized with RSV F expression Adenoviral s) and Th2 (serum derived from FI-RSV immunized animals) references samples are indicated with dashed lines. The LLoQ is indicated with a dotted lines s A), and horizontal bars ent the mean responses per group.
Ad26.RSV.preF2.2 elicits antibody responses that neutralize a wide range of RSV es. Sera from Balb/c mice that were immunized with 1010 viral particles (vp) Ad26.RSV.FA2 (n=3) or Ad26.RSV.preF (n=4) or formulation buffer (n=2) were used in virus neutralization assays (micro-neutralization assay with an ELISA based read out) with the RSV A (upper panels) and B strains (lower panels) indicated. Titers are given as the log2 value of the IC50, and horizontal bars represent the mean response per group. LLoQ is indicated with a dashed line.
: Single immunization with Ad26.RSV.preF2.2 or Ad35.RSV.preF2.2 at low doses protects cotton rats against challenge with the gous RSV A2.
Cotton rats (Sigmodon us) (n=7 to 9 per group) were immunized with the ted doses (in mal) of Ad26.RSV.preF2.2, Ad26.RSV.FA2 (left panels), Ad35.RSV.preF2.2 or Ad35.RSV.FA2 (right panels) by single intramuscular administration. Control immunizations were performed with formulation buffer, FI- RSV, or intranasal application of a low dose of RSV A2. At seven weeks postimmunization animals were challenged intranasally with 105 pfu RSV A2. The lung (A-B) and nose viral titers (C-D) were determined by plaque assay 5 days after challenge. (E-F) Sera taken just before challenge were used to perform a virus neutralizing assay with the RSV A Long strain (micro-neutralization assay with an ELISA based read out). The dotted line represents the lower level of fication (LLoQ). Horizontal bars represent the mean titer per group.
: Ad26.RSV.preF2.2 or Ad35.RSV.preF2.2 immunization of cotton rats does not result in increased alveolitis scores after RSV A2 challenge. Cotton rats (Sigmodon hispidus) (n=7 to 9 per group) were immunized with the indicated doses (in vp/animal) of Ad26.RSV.preF2.2, Ad26.RSV.FA2 (upper panel), Ad35.RSV.preF2.2, or Ad35.RSV.FA2 (lower panel) by single intramuscular stration. Control immunizations were performed with formulation buffer, FIRSV , or intranasal application of a low dose of RSV A2. At seven weeks postimmunization animals were challenged intranasally with 105 pfu RSV A2. Alveolitis was scored by histopathological examination of one lung lobe 5 days after challenge on a non-linear scale from 0 to 4. The ntal dotted line marks the maximal score of the control animals that were pre-exposed to RSV-A2 before challenge to mimic a natural exposure to RSV that does not lead to ERD.
Detailed description of the invention RSV vaccines comprising human adenovirus sing nucleic acid encoding RSV F protein have usly been described in WO2013/139911 and /139916. It was shown therein that recombinant adenoviruses of serotype 26 or 35 that comprise a nucleic acid encoding an RSV F protein are very effective vaccines against RSV in a well established cotton rat model and have improved efficacy as ed to data described earlier for Ad5 encoding RSV F protein. It was demonstrated that a single administration, even administered uscularly, of Ad26 or Ad35 encoding RSV F is sufficient to provide complete protection against nge RSV replication.
Because of the instability of the RSV F protein, however, the RSV F protein has the propensity to prematurely refold into its more stable post-fusion conformation.
This phenomenon is an intrinsic feature of the protein both in solution and on the surface of the virions. In human sera most RSV neutralizing antibodies are, however, directed against the RSV F in the the pre-fusion conformation. In the research that led to the present invention, effort was therefore undertaken to identify modifications that stabilize RSV F protein in its sion conformation in the full length protein.
Several possible ons stabilizing RSV F protein in the pre-fusion conformation have previously been described in WO2014/174018 and WO2014/202570. The nucleic acid molecules according to the present invention encode RSV F proteins sing a unique and specific subset of mutations. ing to the invention it has been shown that this unique combination of mutations of the present invention results in sed RSV F protein expression levels and stability of the RSV F protein in the pre-fusion conformation. In addition, it has been shown that the nucleic acid molecules according to the invention encode RSV F protein which is stabilized in the pre-fusion conformation, and which induces higher titers of neutralizing antibody as compared to wild type RSV F protein (as disclosed in WO2013/139911 and WO2013/139916).
In a first aspect, the present invention thus provides novel nucleic acid molecules encoding a pre-fusion respiratory ial virus F protein (RSV pre-fusion F protein, or RSV pre-F protein), wherein the RSV pre-F protein comprises the amino acid sequence of SEQ ID NO: 1 or 2.
In certain embodiments, the nucleic acid molecules encode the RSV pre-F proteins of SEQ ID NO: 1 or SEQ ID NO: 2.
As used herein, the terms nucleic acid, nucleic acid molecule, nucleic acid or nucleotide sequence, and polynucleotide are used interchangeably and all refer to the linear biopolymers (chains) made from nucleotides, including DNA and RNA.
It is understood by a skilled person that us different nucleic acid molecules can encode the same polypeptide as a result of the racy of the genetic code. It is also understood that skilled persons may, using routine techniques, make nucleotide substitutions that do not affect the polypeptide sequence encoded by the polynucleotides described there to t the codon usage of any particular host organism in which the polypeptides are to be expressed. Therefore, unless otherwise specified, a "nucleic acid molecule encoding an amino acid sequence" includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence. Nucleotide sequences that encode proteins and RNA may include introns. Sequences herein are provided from 5’ to 3’ ion, as custom in the art.
In certain ments, the nucleic acid molecule encodes a fragment of pre- fusion RSV F comprising the amino acid sequence of SEQ ID NO: 1 or 2.
In certain embodiments, the nucleic acid molecules encoding the RSV prefusion F protein, or fragment thereof, are codon zed for expression in mammalian cells, such as human cells. s of codon-optimization are known and have been described previously (e.g. WO 96/09378).
In certain embodiments, the nucleic acid molecule encoding the RSV prefusion F n ses the nucleic acid ce of SEQ ID NO: 3. In n embodiments, the the nucleic acid encoding the RSV F protein comprises the nucleic acid sequence of SEQ ID NO: 4.
In certain embodiments, the nucleic acid encoding the RSV F n consists of the the nucleic acid sequence of SEQ ID NO: 3 or 4.
The term "fragment" as used herein refers to a peptide that has an erminal and/or carboxy-terminal and/or internal deletion, but where the remaining amino acid sequence is identical to the corresponding positions in the sequence of the full length RSV F protein, for example, the RSV F protein of SEQ ID NO. 1 or 2. It will be appreciated that for inducing an immune response and in general for vaccination es, a protein needs not to be full length nor have all its wild type functions, and fragments of the protein are equally useful. The person skilled in the art will also appreciate that changes can be made to a n, e.g. by amino acid substitutions, deletions, ons, etc, e.g. using routine lar biology procedures. Generally, conservative amino acid substitutions may be d without loss of function or immunogenicity of a polypeptide. This can easily be checked ing to routine procedures well known to the skilled person.
The present invention also relates to s comprising a c acid molecule encoding a pre-fusion RSV F protein comprising the amino acid sequence of SEQ ID NO: 1 or 2, or a fragment thereof.
According to the invention, the vector may be any vector that can be conveniently subjected to recombinant DNA procedures and can bring about expression of the nucleic acid molecule of the invention. The choice of the vector will typically depend on the compatibility of the vector with the host cell into which the vector is to be introduced.
In certain embodiments, the vector is a human recombinant adenovirus, also referred to as recombinant adenoviral vectors. The preparation of inant adenoviral vectors is well known in the art. The term ‘recombinant’ for an irus, as used herein implicates that it has been modified by the hand of man, e.g. it has altered terminal ends actively cloned n and/or it comprises a heterologous gene, i.e. it is not a naturally occurring wild type adenovirus.
In certain embodiments, an adenoviral vector according to the invention is deficient in at least one essential gene function of the E1 region, e.g. the E1a region and/or the E1b region, of the adenoviral genome that is required for viral replication.
In certain embodiments, an adenoviral vector ing to the invention is deficient in at least part of the non-essential E3 region. In certain embodiments, the vector is deficient in at least one essential gene function of the E1 region and at least part of the non-essential E3 region. The adenoviral vector can be "multiply deficient," meaning that the adenoviral vector is deficient in one or more essential gene functions in each of two or more regions of the iral genome. For example, the aforementioned E1-deficient or E1-, E3-deficient adenoviral vectors can be further deficient in at least one essential gene of the E4 region and/or at least one essential gene of the E2 region (e.g., the E2A region and/or E2B region).
Adenoviral vectors, methods for construction thereof and methods for propagating thereof, are well known in the art and are described in, for example, U.S.
Pat. Nos. 5,559,099, 5,837,511, 5,846,782, 5,851,806, 106, 5,994,128, ,965,541, 5,981,225, 6,040,174, 6,020,191, and 6,113,913, and Thomas Shenk, "Adenoviridae and their Replication", M. S. z, "Adenoviruses", Chapters 67 and 68, respectively, in Virology, B. N. Fields et al., eds., 3d ed., Raven Press, Ltd., New York (1996), and other references mentioned herein. lly, construction of adenoviral vectors involves the use of standard molecular biological techniques, such as those described in, for e, Sambrook et al., Molecular Cloning, a Laboratory , 2d ed., Cold Spring Harbor Press, Cold Spring Harbor, N.Y. (1989), Watson et al., Recombinant DNA, 2d ed., Scientific American Books (1992), and l et al., Current Protocols in Molecular Biology, Wiley Interscience Publishers, NY (1995), and other references mentioned herein.
In certain embodiments, the adenovirus is a human adenovirus of the serotype 26 or 35. The vaccines according to the invention based on these serotypes appear more potent than the ones described in the prior art that were based on Ad5, since those failed to e te protection against RSV challenge replication after a single intramuscular administration (Kim et al, 2010, e 28: 3801-3808; Kohlmann et al, 2009, J Virol 83: 12601-12610; Krause et al, 2011, Virology Journal 8:375). The serotype of the invention further generally has a low seroprevalence and/or low pre-existing neutralizing dy titers in the human population.
Recombinant adenoviral vectors of these serotypes with different enes are evaluated in clinical trials, and thus far shows to have an excellent safety profile. ation of rAd26 vectors is described, for example, in Abbink et al., (2007) Virol 81(9): 4654-63. Exemplary genome sequences of Ad26 are found in GenBank Accession EF 153474 and in SEQ ID NO:1 of Preparation of rAd35 vectors is described, for example, in US Patent No. 7,270,811, in WO 00/70071, and in Vogels et al., (2003) J Virol 77(15): 8263-71. Exemplary genome ces of Ad35 are found in GenBank ion AC_000019 and in Fig. 6 of WO 00/70071.
A recombinant adenovirus according to the invention may be replicationcompetent or replication-deficient. In certain embodiments, the irus is replication deficient, e.g. because it contains a deletion in the E1 region of the genome. As known to the skilled person, in case of deletions of essential regions from the adenovirus genome, the functions encoded by these regions have to be provided in trans, preferably by the producer cell, i.e. when parts or whole of E1, E2 and/or E4 s are deleted from the adenovirus, these have to be t in the producer cell, for instance integrated in the genome thereof, or in the form of led helper adenovirus or helper ds. The adenovirus may also have a deletion in the E3 region, which is dispensable for replication, and hence such a deletion does not have to be complemented.
A producer cell (sometimes also referred to in the art and herein as ‘packaging cell’ or ‘complementing cell’ or ‘host cell’) that can be used can be any producer cell n a desired adenovirus can be propagated. For example, the propagation of recombinant adenovirus vectors is done in producer cells that complement deficiencies in the adenovirus. Such producer cells preferably have in their genome at least an adenovirus E1 ce, and thereby are capable of complementing recombinant adenoviruses with a deletion in the E1 region. Any E1-complementing producer cell can be used, such as human retina cells immortalized by E1, e.g. 911 or PER.C6 cells (see US patent 5,994,128), nsformed amniocytes (See EP patent 1230354), E1-transformed A549 cells (see e.g. WO 98/39411, US patent 5,891,690), GH329:HeLa (Gao et al, 2000, Human Gene Therapy 11: 213-219), 293, and the like.
In certain embodiments, the producer cells are for ce HEK293 cells, or PER.C6 cells, or 911 cells, or IT293SF cells, and the like.
For non-subgroup C E1-deficient adenoviruses such as Ad35 (subgroup B) or Ad26 (subgroup D), it is preferred to exchange the E4-orf6 coding sequence of these non-subgroup C adenoviruses with the E4-orf6 of an adenovirus of subgroup C such as Ad5. This allows ation of such adenoviruses in well known complementing cell lines that express the E1 genes of Ad5, such as for example 293 cells or PER.C6 cells (see, e.g. Havenga et al, 2006, J. Gen. Virol. 87: 2135-2143; WO 03/104467, incorporated in its entirety by reference herein). In certain embodiments, an adenovirus that can be used is a human adenovirus of serotype 35, with a deletion in the E1 region into which the nucleic acid encoding RSV F protein antigen has been cloned, and with an E4 orf6 region of Ad5. In n embodiments, the adenovirus in the vaccine composition of the invention is a human irus of serotype 26, with a deletion in the E1 region into which the nucleic acid encoding RSV F protein antigen has been cloned, and with an E4 orf6 region of Ad5.
In alternative ments, there is no need to place a heterologous E4orf6 region (e.g. of Ad5) in the iral vector, but instead the E1-deficient nonsubgroup C vector is propagated in a cell line that expresses both E1 and a compatible E4orf6, e.g. the 293-ORF6 cell line that expresses both E1 and E4orf6 from Ad5 (see e.g. Brough et al, 1996, J Virol 70: 6497-501 bing the generation of the 293- ORF6 cells; Abrahamsen et al, 1997, J Virol 71: 8946-51 and Nan et al, 2003, Gene Therapy 10: 326-36 each describing generation of E1 deleted non-subgroup C iral vectors using such a cell line). atively, a complementing cell that expresses E1 from the serotype that is to be propagated can be used (see e.g. WO 00/70071, WO 02/40665).
For subgroup B adenoviruses, such as Ad35, having a deletion in the E1 region, it is preferred to retain the 3’ end of the E1B 55K open reading frame in the adenovirus, for instance the 166 bp directly upstream of the pIX open reading frame or a fragment comprising this such as a 243 bp fragment directly upstream of the pIX start codon (marked at the 5’ end by a Bsu36I restriction site in the Ad35 ), since this increases the stability of the adenovirus because the promoter of the pIX gene is partly ng in this area (see, e.g. Havenga et al, 2006, J. Gen. Virol. 87: 2135-2143; "Heterologous nucleic acid" (also referred to herein as ‘transgene’) in adenoviruses of the invention is nucleic acid that is not naturally present in the adenovirus. It is introduced into the adenovirus for instance by rd molecular biology techniques. In the present invention, the heterologous nucleic acid s the RSV pre-F protein (or fragment thereof) comprising the amino acid sequence of SEQ ID NO: 1 or 2. It can for ce be cloned into a deleted E1 or E3 region of an adenoviral vector. A transgene is generally operably linked to expression control sequences. This can for ce be done by placing the nucleic acid encoding the transgene(s) under the control of a promoter. Further regulatory sequences may be added. Many promoters can be used for sion of a transgene(s), and are known to the skilled person. A non-limiting example of a suitable promoter for obtaining expression in eukaryotic cells is a CMV-promoter (US 5,385,839), e.g. the CMV immediate early promoter, for instance comprising nt. –735 to +95 from the CMV ate early gene enhancer/promoter. A polyadenylation signal, for example the bovine growth hormone polyA signal (US 5,122,458), may be present behind the transgene(s).
In n embodiments, the recombinant adenovectors of the invention comprise as the 5’ terminal nucleotides the nucleotide sequence: CTATCTAT. These embodiments are advantageous because such vectors display improved replication in production processes, resulting in batches of adenovirus with improved homogeneity, as compared to vectors having the original 5’ terminal sequences (generally CATCATCA) (see also patent ation nos. and US 13/794,318, entitled ‘Batches of recombinant adenovirus with altered al ends’ filed on 12 March 2012 in the name of Crucell Holland B.V.), incorporated in its ty by reference herein. The invention thus also provides batches of recombinant adenovirus encoding RSV F protein or a part thereof, wherein the RSV F protein comprises the amino acid sequence of SEQ ID NO: 1 or 2, and wherein essentially all (e.g. at least 90%) of the adenoviruses in the batch comprise a genome with terminal nucleotide ce CTATCTAT.
In certain embodiments, the nucleic acid molecule may encode a fragment of the pre-fusion F protein of RSV. The fragment may result from either or both of amino-terminal and carboxy-terminal deletions. The extent of on may be determined by a person skilled in the art to, for e, achieve better yield of the inant adenovirus. The fragment will be chosen to comprise an immunologically active fragment of the F protein, i.e. a part that will give rise to an immune response in a subject. This can be easily determined using in silico, in vitro and/or in vivo methods, all routine to the d person.
The invention furthermore provides compositions comprising a nucleic acid molecule encoding a pre-fusion RSV F comprising the amino acid sequence of SEQ ID NO: 1 or 2.
Also, the invention provides compositions comprising a vector as described herein.
In certain embodiments, the itions comprising a nucleic acid le and/or a vector are for use in reducing infection and/or replication of RSV in a subject. In certain preferred embodiments, the compositions are for use as a vaccine against RSV. The term "vaccine" refers to an agent or composition containing an active ent effective to induce a therapeutic degree of immunity in a subject t a certain pathogen or disease. In the present invention, the vaccine ses an effective amount of a nucleic acid molecule that encodes an RSV pre-fusion F protein sing SEQ ID NO: 1 or 2, or an antigenic fragment thereof, which results in an immune response against the F protein of RSV. This es a method of ting s lower atory tract disease leading to hospitalization and the decrease the frequency of complications such as pneumonia and bronchiolitis due to RSV infection and replication in a subject. Thus, the invention also provides a method for ting or ng serious lower atory tract disease, preventing or reducing (e.g. shortening) hospitalization, and/or reducing the frequency and/or severity of pneumonia or bronchiolitis caused by RSV in a t, comprising administering to the subject a ition comprising a nucleic acid molecule encoding a RSV pre-F protein or fragment thereof, wherein the RSV F protein comprises the amino acid sequence of SEQ ID NO: 1 or 2. The term "vaccine" ing to the invention implies that it is a pharmaceutical composition, and thus typically includes a ceutically acceptable t, carrier or excipient. It may or may not comprise further active ingredients. In certain embodiments it may be a combination vaccine that further comprises other components that induce an immune response, e.g. against other proteins of RSV and/or against other infectious agents.
In certain embodiments the compositions comprising the nucleic acid molecule or vector further comprise, or are administered together with, one or more adjuvants. nts are known in the art to further increase the immune response to an applied antigenic determinant, and pharmaceutical itions comprising adenovirus and suitable nts are for instance disclosed in incorporated by reference herein. The terms "adjuvant" and "immune stimulant" are used interchangeably herein, and are defined as one or more substances that cause stimulation of the immune system. In this context, an adjuvant is used to enhance an immune response to the RSV prefusion F proteins of the invention. Examples of suitable adjuvants include aluminium salts such as aluminium hydroxide and/or aluminium phosphate; oil-emulsion compositions (or oil-in-water compositions), including squalene-water emulsions, such as MF59 (see e.g. WO 90/14837); saponin formulations, such as for example QS21 and Immunostimulating Complexes (ISCOMS) (see e.g. US 5,057,540; WO 90/03184, WO 96/11711, monophosphoryl lipid A (MPL), 3-O-deacylated MPL (3dMPL), CpG-motif containing oligonucleotides, ADP-ribosylating bacterial toxins or mutants thereof, such as E. coli heat labile toxin LT, cholera toxin CT, and the like. It is also possible to use vector-encoded adjuvant, e.g. by using heterologous nucleic acid that encodes a fusion of the oligomerization domain of C4-binding n (C4bp) to the antigen of interest (e.g. Solabomi et al, 2008, Infect Immun 76: 3817-23). In certain embodiments the itions of the invention se aluminium as an adjuvant, e.g. in the form of aluminium hydroxide, aluminium phosphate, ium potassium phosphate, or combinations f, in concentrations of 0.05 – 5 mg, e.g. from 0.075- 1.0 mg, of aluminium content per dose.
In other embodiments, the compositions do not comprise adjuvants.
It is also possible according to the invention to administer further active components, in combination with the compositions, e.g. vaccines, according to the invention. Such further active components may comprise e.g. other RSV antigens or vectors comprising nucleic acid encoding these. Such vectors again may be nonadenoviral or adenoviral, of which the latter can be of any serotype. An example of other RSV antigens includes RSV F or G protein or immunologically active parts thereof. For instance, intranasally applied recombinant replication-deficient Ad5 based adenovector rAd/3xG, expressing the soluble core domain of G glycoprotein (amino acids 130 to 230) was protective in a murine model (Yu et al, 2008, J Virol 82: 2350-2357), and although it was not protective when applied uscularly, it is clear from these data that RSV G is a suitable antigen for ng tive responses. Further active components may also comprise non-RSV antigens, e.g. from other pathogens such as viruses, bacteria, parasites, and the like. The administration of further active components may for instance be done by separate administration or by administering combination products of the vaccines of the invention and the further active ents. In certain embodiments, further non-adenoviral antigens (besides RSV.F), may be encoded in the vectors of the ion. In certain embodiments, it may thus be desired to express more than one protein from a single adenovirus, and in such cases more coding sequences for instance may be linked to form a single transcript from a single expression cassette or may be present in two separate expression cassettes cloned in different parts of the adenoviral genome.
The compositions of the invention, e.g. the adenovirus compositions, may be administered to a subject, e.g. a human subject. The total dose of the irus provided to a subject during one administration can be varied as is known to the d practitioner, and is generally n 1x107 viral particles (vp) and 1x1012 vp, preferably between 1x108 vp and 1x1011 vp, for ce n 3x108 and 5x1010 vp, for instance between 109 and 3x1010 vp.
Administration of the compositions can be performed using standard routes of administration. miting embodiments include parenteral administration, such as by injection e.g. intradermal, intramuscular, etc, or subcutaneous, transcutaneous, or mucosal administration, e.g. intranasal, oral, and the like. Intranasal administration has generally been seen as a preferred route for vaccines against RSV. The most important advantage of the live intrasal strategy is the direct stimulation of local respiratory tract immunity and the lack of associated disease enhancement. The only vaccines under clinical evaluation for ric use at the present time are live intranasal vaccine (Collins and Murphy. Vaccines against human respiratory syncytial virus). In: Perspectives in Medical Virology 14: Respiratory Syncytial Virus (Ed.
Cane, P.), Elsevier, dam, the Netherlands, pp233-277). Intranasal administration is a suitable preferred route according to the present invention as well.
The advantage of uscular administration is that it is simple and wellestablished , and does not carry the safety concerns for asal application in s r than 6 . In one ment a composition is administered by intramuscular injection, e.g. into the deltoid muscle of the arm, or vastus lateralis muscle of the thigh. The skilled person knows the s possibilities to administer a composition, e.g. a vaccine in order to induce an immune response to the antigen(s) in the vaccine.
A subject as used herein preferably is a mammal, for instance a rodent, e.g. a mouse, a cotton rat, or a non-human-primate, or a human. Preferably, the t is a human subject. The subject can be of any age, e.g. from about 1 month to 100 years old, e.g. from about 2 months to about 80 years old, e.g. from about 1 month to about 3 years old, from about 3 years to about 50 years old, from about 50 years to about 75 years old, etc.
It is also possible to provide one or more booster administrations of one or compositions, e.g. the es, of the invention. If a ng vaccination is performed, typically, such a boosting vaccination will be administered to the same subject at a moment between one week and one year, preferably between two weeks and four months, after administering the composition to the subject for the first time (which is in such cases referred to as ‘priming vaccination’). In alternative boosting regimens, it is also possible to ster different vectors, e.g. one or more adenoviruses of different serotype, or other vectors such as MVA, or DNA, or protein, to the subject after the priming vaccination. It is for instance possible to administer to the subject a recombinant adenoviral vector comprising a nucleic acid sequence encoding the pre-fusion RSV F n as a prime, and to boost with a composition comprising a RSV F protein. In certain embodiments, the RSV F protein also is stabilized in the pre-fusion conformation.
In certain ments, the administration comprises a priming and at least one booster administration. In certain ments, the composition is administered as a priming composition and/or as a boosting composition in a prime-boost vaccination regimen. In n embodiments thereof, the priming stration is with a rAd35 comprising nucleic acid encoding RSV pre-F protein or a fragment thereof (‘rAd35-RSV.pre-F’), wherein the RSV F pre-F protein comprises the amino acid sequence of SEQ ID NO: 1 or 2, and the r administration is with a rAd26 comprising nucleic acid encoding RSV F protein (‘rAd26-RSV.pre-F’), wherein the RSV pre-F protein comprises the amino acid sequence of SEQ ID NO: 1 or 2. In other embodiments thereof, the priming administration is with rAd26-RSV.pre-F and the booster administration is with rAd35-RSV.pre-F. In other embodiments, both the priming and booster administration are with rAd26.RSV.pre-F. In certain embodiments, the priming stration is with rAd26-RSV.pre-F or rAd35- RSV.pre-F and the booster administration is with RSV F protein. In all these embodiments, it is possible to provide further booster administrations with the same or other vectors or protein. Embodiments where boosting with RSV F protein may be ularly beneficial include e.g. in elder subjects in risk groups (e.g. having COPD or asthma) of 50 years or older, or e.g. in healthy subjects of 60 years or older or 65 years or older.
In certain embodiments, the administration comprises a single administration of a composition according to the invention, without further (booster) administrations.
Such embodiments are ageous in view of the reduced complexity and costs of a single administration regimen as compared to a prime-boost regimen. te protection is already observed after single administration of the recombinant adenoviral vectors of the invention without booster strations in the cotton rat model in the examples herein.
In a r aspect, the invention provides methods for making a vaccine t respiratory syncytial virus (RSV), comprising providing a recombinant human adenovirus that comprises c acid encoding a RSV F protein or nt thereof, propagating said recombinant adenovirus in a culture of host cells, isolating and purifying the recombinant adenovirus, and bringing the recombinant irus in a pharmaceutically acceptable composition, wherein the RSV F protein comprises the amino acid sequence of SEQ ID NO: 1 or 2.
Recombinant adenovirus can be prepared and ated in host cells, according to well known methods, which entail cell culture of the host cells that are infected with the adenovirus. The cell culture can be any type of cell culture, including adherent cell culture, e.g. cells attached to the surface of a culture vessel or to arriers, as well as suspension culture.
Most large-scale suspension cultures are operated as batch or fed-batch processes because they are the most htforward to operate and scale up.
Nowadays, continuous processes based on perfusion principles are becoming more common and are also suitable (see e.g. incorporated by reference herein, which describe le methods for obtaining and purifying large amounts of recombinant adenoviruses). er cells are cultured to increase cell and virus numbers and/or virus titers. Culturing a cell is done to enable it to metabolize, and/or grow and/or divide and/or produce virus of interest according to the invention. This can be accomplished by methods as such well known to persons skilled in the art, and includes but is not limited to providing nts for the cell, for ce in the appropriate e media. Suitable culture media are well known to the skilled person and can lly be obtained from cial sources in large quantities, or custom-made according to standard protocols. Culturing can be done for instance in dishes, roller bottles or in bioreactors, using batch, fed-batch, continuous systems and the like. Suitable conditions for culturing cells are known (see e.g. Tissue Culture, Academic Press, Kruse and Paterson, editors (1973), and R.I. Freshney, Culture of animal cells: A manual of basic technique, fourth edition (Wiley-Liss Inc., 2000, ISBN 034889- Typically, the adenovirus will be d to the appropriate producer cell in a e, permitting uptake of the virus. Usually, the optimal agitation is between about 50 and 300 rpm, typically about 100-200, e.g. about 150, typical DO is , e.g.40%, the optimal pH is between 6.7 and 7.7, the optimal temperature between 30 and 39ºC, e.g. 34-37°C, and the optimal MOI between 5 and 1000, e.g. about 50-300.
Typically, adenovirus infects er cells spontaneously, and bringing the producer cells into contact with rAd particles is sufficient for infection of the cells. Generally, an adenovirus seed stock is added to the culture to initiate infection, and subsequently the adenovirus ates in the producer cells. This is all routine for the person skilled in the art.
After ion of an adenovirus, the virus replicates inside the cell and is thereby amplified, a process referred to herein as propagation of adenovirus.
Adenovirus infection results finally in the lysis of the cells being infected. The lytic characteristics of adenovirus therefore permits two different modes of virus production. The first mode is ting virus prior to cell lysis, employing external factors to lyse the cells. The second mode is harvesting virus supernatant after (almost) complete cell lysis by the produced virus (see e.g. US patent 6,485,958, describing the harvesting of adenovirus without lysis of the host cells by an external ). It is preferred to employ external factors to actively lyse the cells for ting the irus.
Methods that can be used for active cell lysis are known to the person skilled in the art, and have for instance been discussed in WO 98/22588, p. 28-35. Useful methods in this respect are for example, freeze-thaw, solid shear, hypertonic and/or hypotonic lysis, liquid shear, sonication, high pressure extrusion, detergent lysis, ations of the above, and the like. In one embodiment of the invention, the cells are lysed using at least one ent. Use of a detergent for lysis has the age that it is an easy , and that it is easily scalable.
Detergents that can be used, and the way they are employed, are generally known to the person skilled in the art. Several examples are for instance discussed in WO 98/22588, p. 29-33. Detergents can include anionic, cationic, zwitterionic, and ic detergents. The concentration of the detergent may be varied, for instance within the range of about 0.1%-5% (w/w). In one embodiment, the ent used is Triton X-100.
Nuclease may be employed to remove contaminating, i.e. mostly from the producer cell, nucleic acids. Exemplary nucleases suitable for use in the present invention include Benzonase®, Pulmozyme®, or any other DNase and/or RNase commonly used within the art. In preferred embodiments, the se is Benzonase®, which rapidly hydrolyzes nucleic acids by hydrolyzing internal phosphodiester bonds between specific nucleotides, thereby reducing the viscosity of the cell lysate.
Benzonase® can be commercially obtained from Merck KGaA (code W214950). The concentration in which the nuclease is employed is preferably within the range of 1- 100 ml. Alternatively, or in addition to nuclease treatment, it is also possible to selectively precipitate host cell DNA away from adenovirus preparations during adenovirus purification, using selective precipitating agents such as domiphen bromide (see e.g. US 7,326,555; Goerke et al., 2005, Biotechnology and bioengineering, Vol. 91: 12-21; WO 45378; Methods for harvesting adenovirus from es of producer cells have been extensively described in In certain embodiments, the harvested adenovirus is further purified.
Purification of the adenovirus can be performed in several steps comprising clarification, ultrafiltration, diafiltration or separation with chromatography as described in for instance WO 05/080556, incorporated by reference herein.
Clarification may be done by a filtration step, removing cell debris and other impurities from the cell lysate. Ultrafiltration is used to concentrate the virus solution.
Diafiltration, or buffer exchange, using ultrafilters is a way for removal and exchange of salts, sugars and the like. The person skilled in the art knows how to find the optimal conditions for each purification step. Also WO 88, incorporated in its entirety by reference herein, describes methods for the production and purification of iral vectors. The methods se growing host cells, infecting the host cells with adenovirus, harvesting and lysing the host cells, concentrating the crude lysate, exchanging the buffer of the crude , ng the lysate with nuclease, and further purifying the virus using chromatography.
Preferably, purification employs at least one chromatography step, as for instance discussed in WO 98/22588, p. 61-70. Many processes have been described for the further cation of adenoviruses, n chromatography steps are included in the process. The person skilled in the art will be aware of these ses, and can vary the exact way of employing chromatographic steps to optimize the process. It is for instance possible to purify adenoviruses by anion exchange chromatography steps, see for instance Gene Ther 16: 1346-1353. Many other adenovirus cation methods have been described and are within the reach of the skilled person. r methods for producing and purifying adenoviruses are disclosed in for example (WO 54; WO 04/020971; US 5,837,520; US 6,261,823; Methods Mol Biol 434: 13-23; Altaras et al, 2005, Adv Biochem Eng Biotechnol 99: 193-260), all incorporated by reference herein.
For administering to humans, the invention may employ pharmaceutical compositions comprising the rAd and a pharmaceutically acceptable carrier or ent. In the present context, the term "Pharmaceutically acceptable" means that the carrier or excipient, at the dosages and concentrations employed, will not cause any unwanted or harmful effects in the subjects to which they are administered. Such pharmaceutically acceptable carriers and ents are well known in the art (see Remington's Pharmaceutical Sciences, 18th edition, A. R. Gennaro, Ed., Mack Publishing Company [1990]; ceutical Formulation Development of Peptides and ns, S. Frokjaer and L. Hovgaard, Eds., Taylor & Francis [2000]; and Handbook of Pharmaceutical Excipients, 3rd edition, A. Kibbe, Ed., Pharmaceutical Press [2000]). The purified rAd preferably is formulated and administered as a sterile solution although it is also possible to utilize lyophilized preparations. Sterile solutions are prepared by e filtration or by other methods known per se in the art.
The solutions are then lyophilized or filled into pharmaceutical dosage containers.
The pH of the solution generally is in the range of pH 3.0 to 9.5, e.g pH 5.0 to 7.5.
The rAd typically is in a solution having a suitable pharmaceutically acceptable , and the solution of rAd may also n a salt. Optionally stabilizing agent may be present, such as albumin. In certain embodiments, detergent is added. In certain embodiments, rAd may be formulated into an able ation. These formulations contain effective amounts of rAd, are either sterile liquid solutions, liquid suspensions or lyophilized versions and optionally contain stabilizers or excipients. An adenovirus vaccine can also be aerosolized for intranasal administration (see e.g.
For ce, adenovirus may be stored in the buffer that is also used for the Adenovirus World Standard (Hoganson et al, Development of a stable adenoviral vector formulation, Bioprocessing March 2002, p. : 20 mM Tris pH 8, 25 mM NaCl, 2.5% glycerol. Another useful formulation buffer suitable for administration to humans is 20 mM Tris, 2 mM MgCl2, 25 mM NaCl, sucrose 10% w/v, polysorbate-80 0.02% w/v. Obviously, many other buffers can be used, and several examples of le formulations for the storage and for pharmaceutical administration of purified (adeno)virus preparations can for instance be found in European patent no. 0853660, US patent 6,225,289 and in international patent applications WO 99/41416, WO 99/12568, WO 00/29024, WO 01/66137, WO 03/049763, WO 03/078592, WO 03/061708.
The invention is further explained in the following examples. The es do not limit the invention in any way. They merely serve to clarify the invention.
EXAMPLES Example 1. Stabilizing the RSV F protein in its pre-fusion conformation Plasmids encoding basic RSV F sequences were synthesized and the amino acid substitutions were introduced in the protein by site-directed mutagenesis. The protein variants were transiently expressed in HEK293 cells. The ve protein expression on the cell surface was assessed by Flow Cytometry. The stability of the F proteins in pre-fusion conformation was evaluated in a heat-stability assay.
The protein sequence used for RSV A2 F protein variants was retrieved from the GenBank, accession number ACO83301.1. The amino acid substitutions were introduced in the sequence by site-directed mutagenesis (QuikChange II XL Site- Directed Mutagenesis Kit, t technologies). The mutagenesis s were designed using on-line tool PrimerX. HEK293T cells (CRL-11268) were purchased from American Tissue Culture Collection and cultured under rd cell e conditions (37°C, 10% CO2).
Fully human IgG1 anti-RSV F protein dies CR9501 and CR9503 were constructed by cloning the heavy (VH) and light (VL) chain variable regions into a single IgG1 expression vector. PER.C6® cells (Crucell) were transfected with the IgG1 expression constructs and the expressed antibodies were purified from e supernatants using POROS Mabcapture A chromatography (Applied Biosystems) and then buffer exchanged to 50mM NaAc, 50mM NaCl, pH 5.5. Antibody concentration was ed by optical absorption at 280 nm. dy quality was also confirmed by size-exclusion chromatography (SEC), SDS–PAGE and isoelectric ng. The dy CR9501 comprises VH and VL regions of 58C5 (as bed in WO2011/020079) which binds specifically to RSV F protein in its pre-fusion conformation and not to the post-fusion conformation. CR9503 comprises VH and VL regions of motavizumab, which recognizes both the pre-fusion and post-fusion conformation of RSV F.
Protein expression and temperature treatment: The plasmids were transiently transfected into adherent T cells using 293fectine (Cat# 12347-019) transfection reagents (Life Technologies) according to suppliers recommendations. 48 hours post transfection the cells were harvested by detaching with EDTA-containing FACS buffer (no trypsin, see next section) and cell sion was heat-treated for 10 s either in a water bath or in PCR block for the temperature stability experiments. After the heat-treatment, the cells were prepared for the Flow Cytometry analysis.
For analysis of adeno expressed F proteins, A549 cells were infected with Ad26 virus at a MOI of 10 000 or 5000 and Ad35 viruses at a MOI of 5000, 2500 or 1.250. After 48h, the cells were detached and heat treated for 15 minutes at 37°C, 50°C and 56°C. Upon heat treatment cells were stained using CR9501-Alexa647 or CR9503-Alexa647 and Propidium Iodide (PI). After staining, the cells were fixed and analyzed using the BD FACS CANTO II cell analyzer.
Flow Cytometry analysis: For each staining, the following ls were included: 1) negative control sample. i.e. cells that were not subjected to any treatment and not stained with any antibody labeled with a phore; 2) ve control samples, i.e. cells that are stained with only one fluorophore (one of each that are used for the experiment).
The cells were resuspended in the Flow Cytometry (FC Buffer, 5mM EDTA, 1% FBS in PBS) and distributed in volumes of 50 µl of the cell suspension per well in a 96-well plate with a lid (U- or V-bottom plates). Two-step or one-step protocols were used for staining.
In case of the two-step protocol 50 µl of the first Abs (or buffer for negative controls) was added to the wells and incubated at RT for 30min. Biotinylated CR9501and CR9503 were used at 2 µg/ml (final concentration in a well 1 µg/ml).
After tion, the cells were washed 2 times with the FC . Afterwards 50 µl of Streptavidin-APC (Molecular Probes cat#SA1005, 0.1 mg/ml is used at 1:100) or buffer for negative controls was added to the wells and incubated at RT for 30min.
The cells were washed again 2 times with the FC buffer. After the last wash, the cells were resuspended in 100 µl of FC buffer +/- live-dead stain (PI from Invitrogen, cat#P1304MP, used at 2 µg/ml) and ted at RT for 15 minutes. The cells were centrifuged at 200g (1000rpm) for 5 min., the buffer with PI was removed and the cells were resuspended in 150 µl of the FC buffer.
In case of a one- step protocol, CR9501 and CR9503 antibodies were labeled with fluorescent probe Alexa647 (Molecular Probes, cat#A-20186) according to manufacturer’s instructions. Cells were stained according to the protocol above ing the Streptavidin-APC step.
From the live cell population, the percentage of cells positive for CR9501/CR9503 antibody binding was determined. The cells positive for CR9503 binding express RSV F protein on their surface. The cells ve for CR9501 binding express pre-fusion RSV F on their surface.
The intensity of the antibody staining (Median fluorescence ity – MFI) is proportional to the amount of F protein on the cell e. MFI was calculated from the live cell population expressing F protein.
Results: Surface cell expression of the full length F protein variants: A subset of ons that was previously identified to increase sion or stability of the RSV F protein ectodomain in pre-fusion mation was introduced in the wild type full length RSV A2 F sequence (accession number Genbank ACO83301). The mutations were introduced alone or in multiple combinations, and the effect on protein expression and stability was assessed.
The expression level of the protein was measured as mean fluorescence intensity (MFI) by Flow Cytometry after staining with the CR9503 antibody that is recognizing both pre-fusion and post-fusion F n. The combination of the two amino acid substitutions that were usly described for stabilization of the soluble RSV pre-F protein (i.e. N67I and S215P) also increased the expression level of the full length RSV F protein by 2.3-fold, relative to wilde type full length RSV F (Fig.
A prominent increase in expression was observed for ts with 3 amino acid substitutions combined. Interestingly, combination of more than three mutations in one variant did not further increase protein expression. This may be due to limited capacity of the cellular membrane to accommodate multiple copies of F protein.
The amount of the pre-fusion F on the e of the cell was assessed by staining with pre-fusion specific antibody CR9501 (Fig. 3). Transfection of the cells with all F variants resulted in a more or less r amount of pre-fusion F protein on the cell e. Presence of the transmembrane domain stabilizes the full length protein to n extent and therefore differences in the pre-fusion stability are not as apparent under ambient conditions between the full length F proteins. Therefore the heat-stability assay was developed to better discriminate stability of full length variants, as ed below.
The A2 strain that was used as a parental sequence for the previously bed F protein variants (WO2014/174018 and WO2014/202570) is a cell line adapted laboratory strain which has accumulated two unique and rare mutations (i.e. of Lysine 66 and Isoleucine 76). In the present invention, these two residues were mutated to match the natural al isolates (K66E, I76V). The K66E and I76V mutations were included in selected protein designs. In comparison to variants with Lys66 and Ile76, variants with glutamate at 66 (K66E) have a tendency to express slightly higher. Addition of valine at residue 76 (a double tution of K66E and I76V) does not influence expression level when compared to variants with K66E substitution alone (Fig. 4).
Stability of the full length F protein variants on the cell surface: In ambient conditions on a short time scale, no significant difference in stability of sion conformation was observed between full length F variants with the different combinations of stabilizing mutations. An elevated temperature is known to serve as an efficient in vitro trigger for refolding of RSV F protein from pre-fusion to post-fusion conformation. Therefore, a hock assay was established and used to assess stability of the membrane-bound full length proteins. Shortly, the T cells were transfected with the F protein constructs and used for the assay 48 hours after transfection. The cells were detached from cell e dishes and the cell suspension was heat-treated at increasing temperatures for 10 minutes. After the heattreatment , cells were stained with the anti-RSV F antibodies and analyzed by Flow Cytometry. The Flow Cytometry data was ed in two ent ways. The percentage of the cells, positive for staining with the anti-F antibodies was analyzed, and also mean fluorescence intensity (MFI) of the positive cells was calculated (Fig.
Both ng with CR9501 (antibody recognizing only pre-fusion F n) and CR9503 (antibody recognizing both pre- and post-fusion F protein) were used in the Flow Cytometry assays. CR9503 antibody served as a positive control. In case when F protein loses pre-fusion conformation but still is on the surface of the cell, the protein is still detected with the CR9503 antibody. Loss of staining with both antibodies tes that protein is not available on the cell surface for antibody binding, e.g. due to aggregation.
Full length proteins with three of more amino acid substitutions were tested in the assay and ed to the wild type RSV F. The expression of these variants was the highest and therefore these ts were preferred ates. All of the proteins contained the N67I and S215P substitutions, and one or two extra stabilizing mutations were added.
The fied wild type protein had a rather stable staining with CR9503 antibody. The MFI of the CR9503 staining was elevated at higher temperatures however the spread of values was also very high. This indicated that no protein aggregation occurred after the heat-shock. Half of the pre-fusion conformation was lost after incubation of cells at approximately 55°C, after incubation of at 60°C all pre-fusion conformation was lost as was demonstrated by decreased CR9501 binding to the wild type F samples after hock at increasing temperatures.
All tested sion F protein variants were more stable than the wild type RSV F with majority of the CR9501 staining retaining also after treatment at higher temperatures (Fig. 5 and 6). Proteins with K498R amino acid substitution were less stable than the others. Addition of the K66E mutation further stabilized the proteins as also variants with K498R amino acid substitution became as stable as others and no loss of the pre-fusion conformation was observed at 60°C. Only selected combinations of the stabilizing mutations were tested with K66E and I76V combined.
All four tested proteins were stable when percentage of positive cells was analyzed, however when MFI was ed variant with K498R showed clear decrease in CR9501 binding after ent with 60°C, indicating that this variant is less stable when evaluated in the ature stress assay.
In conclusion, a combination of three stabilizing mutations (including N67I and S215P) was considered sufficient for high expression level and stability. The S46G or D486N ons was selected as a third stabilizing mutation because of their position in the protein structure. K66E and I76V were included in the as they did not have negative effect on the protein expression and stability but made the ce closer to naturally occurring ones.
Thus, the pre-fusion RSV F protein with the mutations K66E, N67I, I76V, S215P and D486N (F2.2) (SEQ ID NO: 2) and the pre-fusion RSV F protein with the mutations K66E, N67I, I76V, S215P and S46G (F2.1) (SEQ ID NO: 1) were selected for the construction adenoviral s. These proteins were shown to be stable in the pre-fusion conformation in the temperature stability assay up to 60°C, and to be expressed in high levels.
Example 2. Preparation of adenoviral s Cloning RSV F gene into E1 region of Ad35 and Ad26: The c acid sequences, coding for the pre-fusion F proteins of the invention were gene optimized for human expression and synthesized, by t. A Kozak sequence (5’ GCCACC 3’) was included directly in front of the ATG start codon, and two stop codons (5’ TGA TAA 3’) were added at the end of the RSV.pre- F coding sequence. The RSV.pre-F genes were inserted in the pAdApt35BSU plasmid and in the pAdApt26 plasmid via HindIII and XbaI sites.
Cell culture: PER.C6 cells ux et al., 1998, Hum Gene Ther 9: 1909-1917) were maintained in Dulbecco’s modified Eagle’s medium (DMEM) with 10% fetal bovine serum (FBS), supplemented with 10mM MgCl2.
Adenovirus generation, infections and ing: All iruses were generated in PER.C6® cells by single homologous recombination and produced as previously described (for rAd35: Havenga et al., 2006, J. Gen. Virol. 87: 2135–2143; for rAd26: Abbink et al., 2007, J. Virol. 81: 4654-4663). Briefly, PER.C6 cells were transfected with Ad vector plasmids, using Lipofectamine according to the instructions provided by the manufacturer (Life Technologies). For rescue of e.g. Ad35 vectors carrying the RSV.pre-F transgenes expression cassette, the pAdApt35BSU.RSV.pre-F d and pWE/Ad35.pIX- rITR.dE3.5orf6 cosmid were used, whereas for Ad26 vectors carrying the RSV.pre-F transgene expression te, the pAdApt26.RSV.pre-F plasmid and pWE.Ad26.dE3.5orf6.cosmid were used. Cells were harvested one day after full CPE, freeze-thawed, centrifuged for 5 min at 3,000 rpm, and stored at 20°C. Next the viruses were plaque purified and amplified in PER.C6 cultured on a single well of a ell 24 tissue culture plate. Further amplification was carried out in PER.C6 cultured using a T25 tissue culture flask and a T175 tissue culture flask. Of the T175 crude lysate, 3 to 5 ml was used to inoculate 20×T175 triple-layer tissue e flasks containing 70% confluent layers of PER.C6 cells. The virus was purified using a twostep CsCl purification method. Finally, the virus was stored in aliquots at 85°C.
Example 3. Induction of ty against RSV F using inant adenovirus serotypes 26 and 35 expressing pre-fusion RSV F in vivo.
The immunogenicity of Ad26.RSV.preF2.1 and Ad26.RSV.preF.2.2 was evaluated in mice, comparing ar and humoral immune responses to responses induced by identical doses of Ad26.RSV.FA2 (i.e. expressing the wild type RSV F protein). Balb/c mice (n=4 per group) were immunized with the indicated dose of 108 to 1010 viral particles (vp) Ad26.RSV.FA2 or Ad26.RSV.preF2.1 or SV.preF2.2, or with formulation buffer. At 8 weeks after prime, the number of RSV F A2 specific IFNγ spot forming units (SFU) per 106 splenocytes was ined using ELISpot. It was shown that Ad26.RSV.preF2.1 and Ad26.RSV.preF.2.2 induced increased humoral immune responses in mice when compared to Ad26.RSV.FA2, with broad neutralizing capacity and maintained cellular responses. A single intramuscular immunization with Ad26.RSV.preF2.1 and Ad26.RSV.preF.2.2 ed a cellular response (Fig. 7) which was characterized by induction of CD8+ T cells positive for IFNγ, IL2 and/or TNFα (data not shown).
The quantity and quality of the ar responses were comparable between Ad26.RSV.preF2.1, Ad26.RSV.preF.2.2 and Ad26.RSV.FA2. In contrast, Ad26.RSV.preF2.1 and Ad26.RSV.preF.2.2 induced significantly higher RSV neutralizing antibody titers than Ad26.RSV.FA2. Closer analysis of the antibody responses demonstrated that SV.preF2.1 and Ad26.RSV.preF.2.2 induced higher levels of antibodies against pre-fusion F, while post-fusion F titers remained comparable to SV.FA2, resulting in significantly increased preF/postF antibody ratios. In addition, the IgG2a/IgG1 ratio of the antibody response remained unaltered, demonstrating a similar Th1 skewing of the humoral se as usly demonstrated for Ad26.RSV.FA2 (Fig. 8).
For Ad26.RSV.preF2.2 it was furthermore demonstrated that the dies elicited were capable of neutralizing various RSV A and B strains, laboratory strains as well as clinical isolates, r as observed for Ad26.RSV.FA2 (Fig. 9).
Subsequently, the efficacy and immunogenicity of Ad26.RSV.preF2.2 and Ad35.RSV.preF2.2 vector constructs was evaluated in the cotton rat model. These animals are sive to replication of human RSV, with peak RSV titers in the lungs at days 4 and 5. Control groups in the experiments included groups intranasally infected with a low dose RSV A2, thereby mimicking natural exposure, as well as groups immunized with FI-RSV, using the original lot 100 that induced enhanced respiratory disease (ERD) in clinical studies in the dilution that was shown to induce ERD in cotton rats.
Single intramuscular immunization of animals with Ad26.RSV.preF2.2 in doses ranging from 105 to 108 vp/animal, or Ad35.RSV.preF2.2 in doses ranging from 106 to 109 vp/animal ed in complete protection of the lungs from infection with the vaccine homologous RSV A2 strain, except for 3 s immunized with 105 vp Ad26.RSV.preF2.2 (Fig. 10A and 10B). Dose ent protection of RSV replication in the nose was observed for both vectors. This ranged from full protection at 108 vp/animal, to partial protection at 105 vp for Ad26.RSV.preF2.2, s for Ad35.RSV.preF2.2, noses of animals immunized with 109 vp were fully protected from RSV A2, and 106 vp ed in partial protection (Fig. 10C and 10D) Noses of animals immunized with Ad26.RSV.preF2.2 and Ad35.RSV.preF2.2 were better protected from RSV A2 infection than when immunized with their respective wild type F counterparts Ad26.RSV.FA2 and Ad35.RSV.FA2, when analyzed across dose 003, and p=0,0001). Protection from RSV infection was accompanied by dosedependent induction of virus neutralization titers against RSV A Long, already elicited by the lowest doses of SV.preF2.2 or Ad35.RSV.preF2.2 applied (Figure 10E and 10F). Across dose statistical comparisons of VNA A Long titers revealed that Ad26.RSV.preF2.2 is more immunogenic than Ad26.RSV.FA2 (p=0.0414), whereas elicitation of VNA titers was not significantly different between Ad35.RSV.preF2.2 and Ad35.RSV.FA2.
It was further demonstrated that SV.preF and Ad35.RSV.preF do not induce histopathological signs of Enhanced Respiratory Disease (ERD) after RSV A2 challenge, at any of the trations tested. The cotton rat is the most used and best studied model to monitor ERD. In this animal model, vaccination with FI-RSV consistently s ERD after RSV challenge, which is visible by histopathological analysis of sections of the infected lungs for parameters as alveolitits, consisting primarily of phil infiltrates, and onchiolitis, consisting primarily of lymphocyte infiltrates. In cotton rats, FI-RSV-induced scores for these parameters can be ed from day 1 after RSV infection, and peak at 4 to 5 days after RSV ERD was analyzed 5 days after challenge with RSV A2 by scoring 4 parameters of pulmonary inflammatory changes (peribronchiolitis, sculitis, interstitial nia, alveolitis). Immunization with FI-RSV resulted in enhanced scores for most histopathological markers, which was especially apparent for alveolitis (Fig. 11), the marker that was previously shown to be the most discriminating marker for ERD. No increases in itis or any other ERD histopathological marker was observed in animals immunized by either Ad26.RSV.preF2.2 or Ad35.RSV.preF2.2 in a prime-only regimen after RSV challenge, even at low vaccine doses that may induce low affinity and/or low levels of antibodies (Fig. 11). This is confirming our previous results with Ad26.RSV.FA2 and Ad35.RSV.FA2 vectors.
According to the invention, it has thus been shown that Ad26.RSV.preF and SV.preF are potent adenoviral vectors expressing RSV F A2 which is stabilized in the pre-fusion conformation. These vectors induce strong humoral and cellular immune responses. The immune response elicited is protective against RSV A2 challenge and provides a wide range of virus neutralization in vitro against clinical and tory isolates of RSV. No ERD ion was observed in cotton rats after RSV exposure of vaccinated animals and therefore confirms the data generated with Ad26 and Ad35 encoding for the wild type RSV F A2 antigen. Neither mice nor cotton rats showed overt signs of reactogenicity after injection of either Ad26.RSV.preF or Ad35.RSV.preF.
Table 1. Amino acid sequences of the RSV pre-fusion F proteins encoded by the nucleic acid molecules of the invention (mutations are underlined) SEQ ID NO: 1: RSV preF2.1 amino acid sequence: MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLGALRTGWYTSVITIELSNIKEIKCNGTDA KVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGV GSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSIPNIE TVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIM SIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKV QSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGII KTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLA FIRKSDELLHNVNAVKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN SEQ ID NO: 2: RSV 2 amino acid ce: MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKEIKCNGTDAK VKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVG SAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSIPNIET VIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMS IIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQ DTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKT FSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSNEFDASISQVNEKINQSLAFI RKSDELLHNVNAVKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN Table 2. Nucleotide sequence of preferred nucleic acid molcules of the invention SEQ ID NO: 3: codon optimized nucleic acid ng the RSV F pre-F2.1 pre-fusion protein PreF2.1 ATGGAGCTGCTGATCCTGAAGGCCAACGCCATCACCACCATCCTGACCGCCG TGACCTTCTGCTTCGCCAGCGGCCAGAACATCACCGAGGAGTTCTACCAGAG CACCTGCAGCGCCGTGAGCAAGGGCTACCTGGGCGCCCTGAGAACCGGCTG CAGCGTGATCACCATCGAGCTGAGCAACATCAAGGAGATCAAGTG CAACGGCACCGACGCCAAGGTGAAGCTGATCAAGCAGGAGCTGGACAAGTA CAAGAACGCCGTGACCGAGCTGCAGCTGCTGATGCAGAGCACCCCCGCCAC CAACAACAGAGCCAGAAGAGAGCTGCCCAGATTCATGAACTACACCCTGAAC AACGCCAAGAAGACCAACGTGACCCTGAGCAAGAAGAGAAAGAGAAGATTC CTGGGCTTCCTGCTGGGCGTGGGCAGCGCCATCGCCAGCGGCGTGGCCGTG 40 GTGCTGCACCTGGAGGGCGAGGTGAACAAGATCAAGAGCGCCCTG CTGAGCACCAACAAGGCCGTGGTGAGCCTGAGCAACGGCGTGAGCGTGCTG ACCAGCAAGGTGCTGGACCTGAAGAACTACATCGACAAGCAGCTGCTGCCC ATCGTGAACAAGCAGAGCTGCAGCATCCCCAACATCGAGACCGTGATCGAG TTCCAGCAGAAGAACAACAGACTGCTGGAGATCACCAGAGAGTTCAGCGTG 45 AACGCCGGCGTGACCACCCCCGTGAGCACCTACATGCTGACCAACAGCGAG CTGCTGAGCCTGATCAACGACATGCCCATCACCAACGACCAGAAGAAGCTGA TGAGCAACAACGTGCAGATCGTGAGACAGCAGAGCTACAGCATCATGAGCA TCATCAAGGAGGAGGTGCTGGCCTACGTGGTGCAGCTGCCCCTGTACGGCG TGATCGACACCCCCTGCTGGAAGCTGCACACCAGCCCCCTGTGCACCACCAA 50 CACCAAGGAGGGCAGCAACATCTGCCTGACCAGAACCGACAGAGGCTGGTA CTGCGACAACGCCGGCAGCGTGAGCTTCTTCCCCCAGGCCGAGACCTGCAA GGTGCAGAGCAACAGAGTGTTCTGCGACACCATGAACAGCCTGACCCTGCC CAGCGAGGTGAACCTGTGCAACGTGGACATCTTCAACCCCAAGTACGACTGC AAGATCATGACCAGCAAGACCGACGTGAGCAGCAGCGTGATCACCAGCCTG GGCGCCATCGTGAGCTGCTACGGCAAGACCAAGTGCACCGCCAGCAACAAG AACAGAGGCATCATCAAGACCTTCAGCAACGGCTGCGACTACGTGAGCAAC AAGGGCGTGGACACCGTGAGCGTGGGCAACACCCTGTACTACGTGAACAAG CAGGAGGGCAAGAGCCTGTACGTGAAGGGCGAGCCCATCATCAACTTCTAC GACCCCCTGGTGTTCCCCAGCGACGAGTTCGACGCCAGCATCAGCCAGGTG AACGAGAAGATCAACCAGAGCCTGGCCTTCATCAGAAAGAGCGACGAGCTG CTGCACAACGTGAACGCCGTGAAGAGCACCACCAACATCATGATCACCACCA TCATCATCGTGATCATCGTGATCCTGCTGAGCCTGATCGCCGTGGGCCTGCT GCTGTACTGCAAGGCCAGAAGCACCCCCGTGACCCTGAGCAAGGACCAGCT GAGCGGCATCAACAACATCGCCTTCAGCAACTGA SEQ ID NO: 4: codon zed nucleic acid encoding the RSV F pre-F2.2 pre-fusion protein PreF2.2 ATGGAGCTGCTGATCCTGAAGGCCAACGCCATCACCACCATCCTGACCGCCG TGACCTTCTGCTTCGCCAGCGGCCAGAACATCACCGAGGAGTTCTACCAGAG CACCTGCAGCGCCGTGAGCAAGGGCTACCTGAGCGCCCTGAGAACCGGCTG GTACACCAGCGTGATCACCATCGAGCTGAGCAACATCAAGGAGATCAAGTG CAACGGCACCGACGCCAAGGTGAAGCTGATCAAGCAGGAGCTGGACAAGTA CGCCGTGACCGAGCTGCAGCTGCTGATGCAGAGCACCCCCGCCAC CAACAACAGAGCCAGAAGAGAGCTGCCCAGATTCATGAACTACACCCTGAAC AACGCCAAGAAGACCAACGTGACCCTGAGCAAGAAGAGAAAGAGAAGATTC CTGGGCTTCCTGCTGGGCGTGGGCAGCGCCATCGCCAGCGGCGTGGCCGTG AGCAAGGTGCTGCACCTGGAGGGCGAGGTGAACAAGATCAAGAGCGCCCTG ACCAACAAGGCCGTGGTGAGCCTGAGCAACGGCGTGAGCGTGCTG ACCAGCAAGGTGCTGGACCTGAAGAACTACATCGACAAGCAGCTGCTGCCC ATCGTGAACAAGCAGAGCTGCAGCATCCCCAACATCGAGACCGTGATCGAG TTCCAGCAGAAGAACAACAGACTGCTGGAGATCACCAGAGAGTTCAGCGTG AACGCCGGCGTGACCACCCCCGTGAGCACCTACATGCTGACCAACAGCGAG CTGCTGAGCCTGATCAACGACATGCCCATCACCAACGACCAGAAGAAGCTGA TGAGCAACAACGTGCAGATCGTGAGACAGCAGAGCTACAGCATCATGAGCA TCATCAAGGAGGAGGTGCTGGCCTACGTGGTGCAGCTGCCCCTGTACGGCG TGATCGACACCCCCTGCTGGAAGCTGCACACCAGCCCCCTGTGCACCACCAA CACCAAGGAGGGCAGCAACATCTGCCTGACCAGAACCGACAGAGGCTGGTA CTGCGACAACGCCGGCAGCGTGAGCTTCTTCCCCCAGGCCGAGACCTGCAA GGTGCAGAGCAACAGAGTGTTCTGCGACACCATGAACAGCCTGACCCTGCC 40 CAGCGAGGTGAACCTGTGCAACGTGGACATCTTCAACCCCAAGTACGACTGC AAGATCATGACCAGCAAGACCGACGTGAGCAGCAGCGTGATCACCAGCCTG GGCGCCATCGTGAGCTGCTACGGCAAGACCAAGTGCACCGCCAGCAACAAG GGCATCATCAAGACCTTCAGCAACGGCTGCGACTACGTGAGCAAC GTGGACACCGTGAGCGTGGGCAACACCCTGTACTACGTGAACAAG 45 CAGGAGGGCAAGAGCCTGTACGTGAAGGGCGAGCCCATCATCAACTTCTAC GACCCCCTGGTGTTCCCCAGCAACGAGTTCGACGCCAGCATCAGCCAGGTG AACGAGAAGATCAACCAGAGCCTGGCCTTCATCAGAAAGAGCGACGAGCTG CTGCACAACGTGAACGCCGTGAAGAGCACCACCAACATCATGATCACCACCA TCATCATCGTGATCATCGTGATCCTGCTGAGCCTGATCGCCGTGGGCCTGCT 50 GCTGTACTGCAAGGCCAGAAGCACCCCCGTGACCCTGAGCAAGGACCAGCT GAGCGGCATCAACAACATCGCCTTCAGCAACTGA
Claims (17)
1. Nucleic acid molecule encoding an RSV F protein that is stabilized in the prefusion conformation (pre-fusion RSV F protein), wherein the RSV F protein 5 comprises the amino acid sequence of SEQ ID NO: 1 or 2.
2. Nucleic acid molecule according to claim 1, wherein the nucleic acid encoding the pre-fusion RSV F protein is codon optimized for expression in human cells.
3. Nucleic acid molecule according to claim 1 or 2, wherein the nucleic acid 10 encoding the pre-fusion RSV F protein comprises the c acid sequence of SEQ ID NO: 3 or 4.
4. Vector comprising the c acid molecule according to claim 1, 2 or 3.
5. Vector according to claim 4, n the vector is a human recombinant adenovirus. 15
6. Vector according to claim 5, wherein the recombinant human adenovirus has a deletion in the E1 region, a deletion in the E3 region, or a deletion in both the E1 and the E3 region of the adenoviral genome.
7. Vector according to claim 5 or 6, wherein the adenovirus is of serotype 26 or 20
8. Vector ing to claim 5, 6 or 7, wherein the inant adenovirus has a genome comprising at its 5’ terminal ends the sequence CTATCTAT.
9. Pharmaceutical ition comprising a nucleic acid molecule ing to claim 1, 2 or 3.
10. Pharmaceutical composition comprising a vector accroding to any one of the 25 claims 5-8.
11. A method for vaccinating a subject against RSV, the method comprising administering to the subject a ition according to claim 9 or 10.
12. A method according to claim 11, further comprising administering RSV F protein to the subject. 30
13. A method for reducing infection and/or replication of RSV in a subject, comprising stering to the subject a ition comprising a nucleic acid encoding a pre-fusion RSV F protein or fragment thereof according to claim 1, 2 or 3.
14. A method for reducing infection and/or replication of RSV in a subject, comprising administering to the subject a composition comprising a vector according to any one of the claims 5-8.
15. An isolated host cell comprising a c acid encoding a pre-fusion RSV F 5 protein or fragment thereof according to claim 1, 2 or 3.
16. A method for making a vaccine against respiratory syncytial virus (RSV), comprising providing a recombinant human adenovirus that comprises nucleic acid ng a pre-fusion RSV F protein or nt f, propagating said recombinant adenovirus in a culture of host cells, isolating and purifying 10 the recombinant adenovirus, and formulating the recombinant adenovirus in a ceutically acceptable composition, wherein the pre-fusion RSV F protein comprises the amino acid ce of SEQ ID NO: 1 or 2.
17. An isolated recombinant nucleic acid that forms the genome of a recombinant human adenovirus that comprises nucleic acid encoding a pre-fusion RSV F 15 protein or fragment thereof, wherein the pre-fusion RSV F protein comprises the amino acid sequence of SEQ ID NO: 1 or 2. – ued
Publications (1)
Publication Number | Publication Date |
---|---|
NZ785676A true NZ785676A (en) | 2022-03-25 |
Family
ID=
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11801297B2 (en) | Vaccine against RSV | |
US20220133878A1 (en) | Method for the safe induction of immunity against rsv | |
CA2867950C (en) | Vaccine against rsv | |
US9125870B2 (en) | Vaccine against RSV | |
NZ785676A (en) | Vaccine against rsv | |
OA18878A (en) | Vaccine against RSV | |
EA043031B1 (en) | RSV VACCINE | |
PH12014502013B1 (en) | Vaccine against rsv |