NZ769422A - Dll3-cd3 bispecific antibodies - Google Patents
Dll3-cd3 bispecific antibodiesInfo
- Publication number
- NZ769422A NZ769422A NZ769422A NZ76942219A NZ769422A NZ 769422 A NZ769422 A NZ 769422A NZ 769422 A NZ769422 A NZ 769422A NZ 76942219 A NZ76942219 A NZ 76942219A NZ 769422 A NZ769422 A NZ 769422A
- Authority
- NZ
- New Zealand
- Prior art keywords
- seq
- dll3
- amino acid
- binding
- heavy chain
- Prior art date
Links
- 108010071919 Bispecific Antibodies Proteins 0.000 title abstract description 3
- 101700003144 DLL3 Proteins 0.000 claims description 1048
- 102100013694 DLL3 Human genes 0.000 claims description 1048
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 535
- 230000027455 binding Effects 0.000 claims description 482
- 239000000427 antigen Substances 0.000 claims description 296
- 102000038129 antigens Human genes 0.000 claims description 295
- 108091007172 antigens Proteins 0.000 claims description 295
- 150000001413 amino acids Chemical class 0.000 claims description 121
- 102000004169 proteins and genes Human genes 0.000 claims description 116
- 108090000623 proteins and genes Proteins 0.000 claims description 116
- 239000002253 acid Substances 0.000 claims description 10
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 claims description 6
- 102000004965 antibodies Human genes 0.000 abstract description 187
- 108090001123 antibodies Proteins 0.000 abstract description 187
- 239000000203 mixture Substances 0.000 abstract description 32
- 201000011510 cancer Diseases 0.000 abstract description 29
- 230000001225 therapeutic Effects 0.000 abstract description 8
- 101700073818 CDR1 Proteins 0.000 description 255
- 102100009178 RUNX1T1 Human genes 0.000 description 255
- 101710034060 RUNX1T1 Proteins 0.000 description 255
- 229920001184 polypeptide Polymers 0.000 description 240
- 210000004027 cells Anatomy 0.000 description 217
- 102000024070 binding proteins Human genes 0.000 description 191
- 108091007650 binding proteins Proteins 0.000 description 191
- 235000001014 amino acid Nutrition 0.000 description 120
- 235000018102 proteins Nutrition 0.000 description 115
- 241000282414 Homo sapiens Species 0.000 description 99
- 230000014509 gene expression Effects 0.000 description 65
- 230000035693 Fab Effects 0.000 description 61
- 150000002500 ions Chemical class 0.000 description 40
- 150000007523 nucleic acids Chemical class 0.000 description 39
- 210000001744 T-Lymphocytes Anatomy 0.000 description 37
- 108020004707 nucleic acids Proteins 0.000 description 35
- 230000002934 lysing Effects 0.000 description 30
- 229920001850 Nucleic acid sequence Polymers 0.000 description 28
- 238000004166 bioassay Methods 0.000 description 23
- 102000018358 Immunoglobulins Human genes 0.000 description 21
- 108060003951 Immunoglobulins Proteins 0.000 description 21
- 229920003013 deoxyribonucleic acid Polymers 0.000 description 20
- 206010028980 Neoplasm Diseases 0.000 description 19
- 208000000587 Small Cell Lung Carcinoma Diseases 0.000 description 18
- 206010041067 Small cell lung cancer Diseases 0.000 description 16
- 201000010099 disease Diseases 0.000 description 14
- 239000012528 membrane Substances 0.000 description 14
- 241000699666 Mus <mouse, genus> Species 0.000 description 13
- 235000004279 alanine Nutrition 0.000 description 13
- 210000004881 tumor cells Anatomy 0.000 description 13
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 12
- 239000008194 pharmaceutical composition Substances 0.000 description 12
- 210000001519 tissues Anatomy 0.000 description 12
- 108091006028 chimera Proteins 0.000 description 11
- 210000004962 mammalian cells Anatomy 0.000 description 11
- 239000000243 solution Substances 0.000 description 11
- 238000000034 method Methods 0.000 description 10
- 230000035772 mutation Effects 0.000 description 10
- 239000002773 nucleotide Substances 0.000 description 10
- 125000003729 nucleotide group Chemical group 0.000 description 10
- MTCFGRXMJLQNBG-UWTATZPHSA-N D-serine Chemical compound OC[C@@H](N)C(O)=O MTCFGRXMJLQNBG-UWTATZPHSA-N 0.000 description 9
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 9
- 230000009089 cytolysis Effects 0.000 description 9
- 238000005516 engineering process Methods 0.000 description 9
- 201000011519 neuroendocrine tumor Diseases 0.000 description 9
- 229920000023 polynucleotide Polymers 0.000 description 9
- 239000002157 polynucleotide Substances 0.000 description 9
- 239000004474 valine Substances 0.000 description 9
- QIVBCDIJIAJPQS-SECBINFHSA-N D-tryptophane Chemical compound C1=CC=C2C(C[C@@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-SECBINFHSA-N 0.000 description 8
- 102000004851 Immunoglobulin G Human genes 0.000 description 8
- 108090001095 Immunoglobulin G Proteins 0.000 description 8
- 230000015572 biosynthetic process Effects 0.000 description 8
- 230000000875 corresponding Effects 0.000 description 8
- 230000002708 enhancing Effects 0.000 description 8
- 238000004519 manufacturing process Methods 0.000 description 8
- 241000894007 species Species 0.000 description 8
- 229960005190 Phenylalanine Drugs 0.000 description 7
- 125000000539 amino acid group Chemical group 0.000 description 7
- 230000000694 effects Effects 0.000 description 7
- 239000003623 enhancer Substances 0.000 description 7
- 210000003527 eukaryotic cell Anatomy 0.000 description 7
- 238000005755 formation reaction Methods 0.000 description 7
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 7
- 108010045030 monoclonal antibodies Proteins 0.000 description 7
- 102000005614 monoclonal antibodies Human genes 0.000 description 7
- COLNVLDHVKWLRT-QMMMGPOBSA-N phenylalanine group Chemical group N[C@@H](CC1=CC=CC=C1)C(=O)O COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 7
- 230000002829 reduced Effects 0.000 description 7
- 239000000523 sample Substances 0.000 description 7
- 239000004475 Arginine Substances 0.000 description 6
- 101710044990 EGF3 Proteins 0.000 description 6
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 6
- 241000282567 Macaca fascicularis Species 0.000 description 6
- 239000004473 Threonine Substances 0.000 description 6
- 239000003795 chemical substances by application Substances 0.000 description 6
- 238000002512 chemotherapy Methods 0.000 description 6
- 230000003013 cytotoxicity Effects 0.000 description 6
- 231100000135 cytotoxicity Toxicity 0.000 description 6
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- 238000003364 immunohistochemistry Methods 0.000 description 6
- 238000001990 intravenous administration Methods 0.000 description 6
- 238000002360 preparation method Methods 0.000 description 6
- 238000002965 ELISA Methods 0.000 description 5
- 208000005017 Glioblastoma Diseases 0.000 description 5
- 108020004999 Messenger RNA Proteins 0.000 description 5
- 101700063429 NID1 Proteins 0.000 description 5
- 108010070144 Single-Chain Antibodies Proteins 0.000 description 5
- 102000005632 Single-Chain Antibodies Human genes 0.000 description 5
- 229940035295 Ting Drugs 0.000 description 5
- -1 excipient Substances 0.000 description 5
- 230000001404 mediated Effects 0.000 description 5
- 229920002106 messenger RNA Polymers 0.000 description 5
- 230000000955 neuroendocrine Effects 0.000 description 5
- 230000001105 regulatory Effects 0.000 description 5
- 238000002560 therapeutic procedure Methods 0.000 description 5
- 101700018087 DLL4 Proteins 0.000 description 4
- 102100019888 DLL4 Human genes 0.000 description 4
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 4
- 108010004729 Phycoerythrin Proteins 0.000 description 4
- 241000700159 Rattus Species 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 125000000511 arginine group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 4
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 4
- 230000001809 detectable Effects 0.000 description 4
- 239000003814 drug Substances 0.000 description 4
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 4
- 230000012010 growth Effects 0.000 description 4
- 230000002163 immunogen Effects 0.000 description 4
- 239000002609 media Substances 0.000 description 4
- 210000003071 memory T lymphocyte Anatomy 0.000 description 4
- 230000000275 pharmacokinetic Effects 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 230000028327 secretion Effects 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- 238000002626 targeted therapy Methods 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- 108020004705 Codon Proteins 0.000 description 3
- 108009000280 Complement Activation Proteins 0.000 description 3
- 241000196324 Embryophyta Species 0.000 description 3
- 241000238631 Hexapoda Species 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 3
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 3
- 229940055729 Papain Drugs 0.000 description 3
- 108090000526 Papain Proteins 0.000 description 3
- 210000003819 Peripheral blood mononuclear cell Anatomy 0.000 description 3
- 239000004365 Protease Substances 0.000 description 3
- 108010033725 Recombinant Proteins Proteins 0.000 description 3
- 102000007312 Recombinant Proteins Human genes 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- 210000000225 Synapses Anatomy 0.000 description 3
- 239000004480 active ingredient Substances 0.000 description 3
- 238000010171 animal model Methods 0.000 description 3
- 239000000611 antibody drug conjugate Substances 0.000 description 3
- 108091008116 antibody drug conjugates Proteins 0.000 description 3
- 229960000070 antineoplastic Monoclonal antibodies Drugs 0.000 description 3
- 239000007864 aqueous solution Substances 0.000 description 3
- 230000001580 bacterial Effects 0.000 description 3
- 239000012472 biological sample Substances 0.000 description 3
- UIIMBOGNXHQVGW-UHFFFAOYSA-M buffer Substances [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 3
- 230000024203 complement activation Effects 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 238000000684 flow cytometry Methods 0.000 description 3
- 210000004602 germ cell Anatomy 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 230000001976 improved Effects 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 238000001802 infusion Methods 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 230000000051 modifying Effects 0.000 description 3
- 229960000060 monoclonal antibodies Drugs 0.000 description 3
- 239000000178 monomer Substances 0.000 description 3
- 235000019834 papain Nutrition 0.000 description 3
- 239000000825 pharmaceutical preparation Substances 0.000 description 3
- 238000001556 precipitation Methods 0.000 description 3
- 238000000159 protein binding assay Methods 0.000 description 3
- 102000005962 receptors Human genes 0.000 description 3
- 108020003175 receptors Proteins 0.000 description 3
- 238000003259 recombinant expression Methods 0.000 description 3
- 238000010186 staining Methods 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 3
- 238000001890 transfection Methods 0.000 description 3
- 230000003442 weekly Effects 0.000 description 3
- NFGXHKASABOEEW-UHFFFAOYSA-N (+)-methoprene Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 2
- 241000269328 Amphibia Species 0.000 description 2
- 206010005003 Bladder cancer Diseases 0.000 description 2
- 229920002574 CR-39 Polymers 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- 241000282693 Cercopithecidae Species 0.000 description 2
- 241000283074 Equus asinus Species 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 102100014838 FCGRT Human genes 0.000 description 2
- 101710003435 FCGRT Proteins 0.000 description 2
- 210000001035 Gastrointestinal Tract Anatomy 0.000 description 2
- 206010018338 Glioma Diseases 0.000 description 2
- 229940072221 IMMUNOGLOBULINS Drugs 0.000 description 2
- 101700063927 LL3 Proteins 0.000 description 2
- 210000004072 Lung Anatomy 0.000 description 2
- 206010061289 Metastatic neoplasm Diseases 0.000 description 2
- 241000699660 Mus musculus Species 0.000 description 2
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 2
- 108091005503 Nucleic proteins Proteins 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 210000001672 Ovary Anatomy 0.000 description 2
- 108090000284 Pepsin A Proteins 0.000 description 2
- 210000002307 Prostate Anatomy 0.000 description 2
- 206010060862 Prostate cancer Diseases 0.000 description 2
- 108091008153 T cell receptors Proteins 0.000 description 2
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 2
- 210000001685 Thyroid Gland Anatomy 0.000 description 2
- 210000003932 Urinary Bladder Anatomy 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- 230000000240 adjuvant Effects 0.000 description 2
- 239000012062 aqueous buffer Substances 0.000 description 2
- 201000009030 carcinoma Diseases 0.000 description 2
- 230000004663 cell proliferation Effects 0.000 description 2
- 230000001413 cellular Effects 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 230000004154 complement system Effects 0.000 description 2
- 239000000356 contaminant Substances 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- 125000000151 cysteine group Chemical class N[C@@H](CS)C(=O)* 0.000 description 2
- 230000001461 cytolytic Effects 0.000 description 2
- 230000001472 cytotoxic Effects 0.000 description 2
- 238000002784 cytotoxicity assay Methods 0.000 description 2
- 231100000263 cytotoxicity test Toxicity 0.000 description 2
- 230000001419 dependent Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 239000000539 dimer Substances 0.000 description 2
- 239000006185 dispersion Substances 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 230000002349 favourable Effects 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 230000005714 functional activity Effects 0.000 description 2
- 230000002538 fungal Effects 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 239000000833 heterodimer Substances 0.000 description 2
- 238000002649 immunization Methods 0.000 description 2
- 238000000099 in vitro assay Methods 0.000 description 2
- 230000001965 increased Effects 0.000 description 2
- 238000001764 infiltration Methods 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 230000000670 limiting Effects 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- XJENLUNLXRJLEZ-UHFFFAOYSA-M lissamine rhodamine Chemical compound [Na+].C=12C=C(C)C(N(CC)CC)=CC2=[O+]C=2C=C(N(CC)CC)C(C)=CC=2C=1C1=CC=C(S([O-])(=O)=O)C=C1S([O-])(=O)=O XJENLUNLXRJLEZ-UHFFFAOYSA-M 0.000 description 2
- 201000005202 lung cancer Diseases 0.000 description 2
- 201000005244 lung non-small cell carcinoma Diseases 0.000 description 2
- 239000006166 lysate Substances 0.000 description 2
- 230000001394 metastastic Effects 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- 210000000056 organs Anatomy 0.000 description 2
- 239000012188 paraffin wax Substances 0.000 description 2
- 229940111202 pepsin Drugs 0.000 description 2
- 238000002823 phage display Methods 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 230000001402 polyadenylating Effects 0.000 description 2
- 108010054442 polyalanine Proteins 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 210000001236 prokaryotic cell Anatomy 0.000 description 2
- DNIAPMSPPWPWGF-UHFFFAOYSA-N propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 2
- 230000002285 radioactive Effects 0.000 description 2
- 238000001959 radiotherapy Methods 0.000 description 2
- 230000003248 secreting Effects 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 230000033451 somitogenesis Effects 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 238000010254 subcutaneous injection Methods 0.000 description 2
- 239000007929 subcutaneous injection Substances 0.000 description 2
- 238000001356 surgical procedure Methods 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- 201000005112 urinary bladder cancer Diseases 0.000 description 2
- 239000008215 water for injection Substances 0.000 description 2
- BYXHQQCXAJARLQ-ZLUOBGJFSA-N (2S)-2-[[(2S)-2-[[(2S)-2-aminopropanoyl]amino]propanoyl]amino]propanoic acid Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(O)=O BYXHQQCXAJARLQ-ZLUOBGJFSA-N 0.000 description 1
- FJKROLUGYXJWQN-UHFFFAOYSA-M 4-hydroxybenzoate Chemical class OC1=CC=C(C([O-])=O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-M 0.000 description 1
- 206010069754 Acquired gene mutation Diseases 0.000 description 1
- 241001316595 Acris Species 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- ZKHQWZAMYRWXGA-KQYNXXCUSA-N Adenosine triphosphate Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O ZKHQWZAMYRWXGA-KQYNXXCUSA-N 0.000 description 1
- 241000288575 Astomaea Species 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 230000037177 Biodistribution Effects 0.000 description 1
- 210000004556 Brain Anatomy 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 210000000481 Breast Anatomy 0.000 description 1
- 210000001736 Capillaries Anatomy 0.000 description 1
- 231100000023 Cell-mediated cytotoxicity Toxicity 0.000 description 1
- 206010057250 Cell-mediated cytotoxicity Diseases 0.000 description 1
- 210000003679 Cervix Uteri Anatomy 0.000 description 1
- LZZYPRNAOMGNLH-UHFFFAOYSA-M Cetrimonium bromide Chemical compound [Br-].CCCCCCCCCCCCCCCC[N+](C)(C)C LZZYPRNAOMGNLH-UHFFFAOYSA-M 0.000 description 1
- 229960004926 Chlorobutanol Drugs 0.000 description 1
- OSASVXMJTNOKOY-UHFFFAOYSA-N Chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 1
- 229920001405 Coding region Polymers 0.000 description 1
- 210000001072 Colon Anatomy 0.000 description 1
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 1
- 229920002676 Complementary DNA Polymers 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N D-sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229950009791 Durvalumab Drugs 0.000 description 1
- 101700079760 EFCB Proteins 0.000 description 1
- 101700033006 EGF Proteins 0.000 description 1
- 102100010813 EGF Human genes 0.000 description 1
- 229940110715 ENZYMES FOR TREATMENT OF WOUNDS AND ULCERS Drugs 0.000 description 1
- 101710005090 ERVFC1-1 Proteins 0.000 description 1
- 101710013371 ERVS71-1 Proteins 0.000 description 1
- 210000004696 Endometrium Anatomy 0.000 description 1
- 108010067770 Endopeptidase K Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 229940116977 Epidermal Growth Factor Drugs 0.000 description 1
- 102000018651 Epithelial Cell Adhesion Molecule Human genes 0.000 description 1
- 108010066687 Epithelial Cell Adhesion Molecule Proteins 0.000 description 1
- 208000006168 Ewing Sarcoma Diseases 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- 210000002683 Foot Anatomy 0.000 description 1
- 230000036328 Free drug Effects 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 102000006395 Globulins Human genes 0.000 description 1
- 108010044091 Globulins Proteins 0.000 description 1
- BCCRXDTUTZHDEU-VKHMYHEASA-N Gly-Ser Chemical group NCC(=O)N[C@@H](CO)C(O)=O BCCRXDTUTZHDEU-VKHMYHEASA-N 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 210000002288 Golgi Apparatus Anatomy 0.000 description 1
- 208000006359 Hepatoblastoma Diseases 0.000 description 1
- 206010073071 Hepatocellular carcinoma Diseases 0.000 description 1
- 210000004754 Hybrid Cells Anatomy 0.000 description 1
- 210000004408 Hybridomas Anatomy 0.000 description 1
- 210000000987 Immune System Anatomy 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 102000012745 Immunoglobulin Subunits Human genes 0.000 description 1
- 108010079585 Immunoglobulin Subunits Proteins 0.000 description 1
- 210000003000 Inclusion Bodies Anatomy 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 210000004020 Intracellular Membrane Anatomy 0.000 description 1
- 229920002459 Intron Polymers 0.000 description 1
- 108020004391 Introns Proteins 0.000 description 1
- 210000004153 Islets of Langerhans Anatomy 0.000 description 1
- 241000229754 Iva xanthiifolia Species 0.000 description 1
- 210000003734 Kidney Anatomy 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- 101700081293 LMX1A Proteins 0.000 description 1
- 210000004185 Liver Anatomy 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 231100000070 MTS assay Toxicity 0.000 description 1
- 231100000002 MTT assay Toxicity 0.000 description 1
- 229920002521 Macromolecule Polymers 0.000 description 1
- 206010025650 Malignant melanoma Diseases 0.000 description 1
- 208000007054 Medullary Carcinoma Diseases 0.000 description 1
- 240000000233 Melia azedarach Species 0.000 description 1
- 210000003716 Mesoderm Anatomy 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 108060004843 Mical Proteins 0.000 description 1
- 210000003097 Mucus Anatomy 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 229940097496 Nasal Spray Drugs 0.000 description 1
- 206010052399 Neuroendocrine tumour Diseases 0.000 description 1
- 108010019706 Nivolumab Proteins 0.000 description 1
- 206010025310 Other lymphomas Diseases 0.000 description 1
- 102100019764 PDCD1 Human genes 0.000 description 1
- 210000000496 Pancreas Anatomy 0.000 description 1
- 208000008443 Pancreatic Carcinoma Diseases 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 210000001322 Periplasm Anatomy 0.000 description 1
- 241000577979 Peromyscus spicilegus Species 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 210000003491 Skin Anatomy 0.000 description 1
- 239000004268 Sodium erythorbin Substances 0.000 description 1
- 229940075582 Sorbic Acid Drugs 0.000 description 1
- CZMRCDWAGMRECN-GDQSFJPYSA-N Sucrose Natural products O([C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](CO)O1)[C@@]1(CO)[C@H](O)[C@@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-GDQSFJPYSA-N 0.000 description 1
- 102400000368 Surface protein Human genes 0.000 description 1
- 210000001550 Testis Anatomy 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L Thiomersal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 210000001541 Thymus Gland Anatomy 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N Trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H Tricalcium phosphate Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 108091005908 Type I transmembrane proteins Proteins 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K [O-]P([O-])([O-])=O Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 230000001919 adrenal Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 1
- 108010017893 alanyl-alanyl-alanine Proteins 0.000 description 1
- 229910052783 alkali metal Inorganic materials 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminum Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 239000010775 animal oil Substances 0.000 description 1
- 230000003042 antagnostic Effects 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 230000000844 anti-bacterial Effects 0.000 description 1
- 230000000259 anti-tumor Effects 0.000 description 1
- 102000025417 antigen binding proteins Human genes 0.000 description 1
- 108091000829 antigen binding proteins Proteins 0.000 description 1
- 239000007900 aqueous suspension Substances 0.000 description 1
- 108010072668 atezolizumab Proteins 0.000 description 1
- 229960003852 atezolizumab Drugs 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 239000003729 cation exchange resin Substances 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 238000000423 cell based assay Methods 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 231100000096 clonogenic assay Toxicity 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 230000001447 compensatory Effects 0.000 description 1
- 230000000295 complement Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 230000001808 coupling Effects 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 238000010192 crystallographic characterization Methods 0.000 description 1
- 230000001086 cytosolic Effects 0.000 description 1
- 230000002939 deleterious Effects 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 238000009509 drug development Methods 0.000 description 1
- 229940079593 drugs Drugs 0.000 description 1
- 108010016436 durvalumab Proteins 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N edta Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 210000000750 endocrine system Anatomy 0.000 description 1
- 230000002357 endometrial Effects 0.000 description 1
- WSFSSNUMVMOOMR-UHFFFAOYSA-N formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 238000005194 fractionation Methods 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 230000002496 gastric Effects 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 150000002334 glycols Chemical class 0.000 description 1
- 239000001963 growth media Substances 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 229940020899 hematological Enzymes Drugs 0.000 description 1
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 1
- 230000003118 histopathologic Effects 0.000 description 1
- 102000031144 human DLL3 protein Human genes 0.000 description 1
- 108091005385 human DLL3 protein Proteins 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000003365 immunocytochemistry Methods 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 238000005462 in vivo assay Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 229960003130 interferon gamma Drugs 0.000 description 1
- 230000003834 intracellular Effects 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 238000002843 lactate dehydrogenase assay Methods 0.000 description 1
- 201000003445 large cell neuroendocrine carcinoma Diseases 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 201000005296 lung carcinoma Diseases 0.000 description 1
- 230000003211 malignant Effects 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000006011 modification reaction Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 230000004001 molecular interaction Effects 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 239000007922 nasal spray Substances 0.000 description 1
- 229960003301 nivolumab Drugs 0.000 description 1
- 239000012457 nonaqueous media Substances 0.000 description 1
- 230000002246 oncogenic Effects 0.000 description 1
- 231100000590 oncogenic Toxicity 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- LFGREXWGYUGZLY-UHFFFAOYSA-N oxophosphanyl Chemical group [P]=O LFGREXWGYUGZLY-UHFFFAOYSA-N 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 229960002621 pembrolizumab Drugs 0.000 description 1
- 108010026276 pembrolizumab Proteins 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 230000036231 pharmacokinetics Effects 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 101700016463 pls Proteins 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 230000003389 potentiating Effects 0.000 description 1
- 230000002335 preservative Effects 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 230000002062 proliferating Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000036678 protein binding Effects 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 238000001273 protein sequence alignment Methods 0.000 description 1
- 239000012460 protein solution Substances 0.000 description 1
- 238000000575 proteomic Methods 0.000 description 1
- 210000001938 protoplasts Anatomy 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 238000003127 radioimmunoassay Methods 0.000 description 1
- 239000012429 reaction media Substances 0.000 description 1
- 230000000268 renotropic Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 238000003559 rna-seq method Methods 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 231100000486 side effect Toxicity 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- WSWCOQWTEOXDQX-UHFFFAOYSA-N sorbic acid Chemical compound CC=CC=CC(O)=O WSWCOQWTEOXDQX-UHFFFAOYSA-N 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 239000008174 sterile solution Substances 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 230000001954 sterilising Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000008362 succinate buffer Substances 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 125000000472 sulfonyl group Chemical group *S(*)(=O)=O 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 230000004083 survival Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000002194 synthesizing Effects 0.000 description 1
- 229960004906 thiomersal Drugs 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001052 transient Effects 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 230000003612 virological Effects 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
Abstract
The present disclosure relates to DLL3-CD3 bispecific antibodies, characterized by their sequences. The application further relates to uses of the antibodies and their compositions, in particular for therapeutic purposes in the field of cancer diseases.
Description
DLL3-CD3 BISPECIFIC ANTIBODIES
OUND OF THE INVENTION
TECHNICAL FIELD
The present invention relates to multi-specific binding proteins comprising a first antigen
binding unit specific for DLL3 and a second antigen binding unit specific for CD3. The
ion also relates to nucleic acids encoding such g proteins, to methods for
ing such g proteins; host cells expressing or capable of expressing such
binding proteins, compositions comprising such binding ns and to uses of such
binding proteins or such compositions, in particular for therapeutic purposes in the field of
cancer diseases.
BACKGROUND INFORMATION
DLL3 is a type I transmembrane protein that belongs to the Notch ligand family. DLL3 is
primarily involved in somitogenesis, where it predominantly is localized in the Golgi
apparatus and acts as an inhibitor ofNotch signalling, in contrast to the other DLL family
members, DLLl and DLL4, which are localized on the cell surface. Only in cancer cells,
where DLL3 is overexpressed, some DLL3 molecules escape to the cell surface (Dylla,
Molecular & Cellular Oncology 2016, Vol. 3, No. 2). DLL3 has been identified as a tumor
—specific target by using l methods, e. g. LC/MS analysis of tumor tissues (W0
2014/125273), RNA sequencing (), and immunohistochemistry
(Saunders et al., Sci Transl Med. 2015 Aug 26;?(302):302ral36; Saunders et al., AACR
2017; ) analysis.
DLL3 expression has been described in neuroendocrine tumors such as large cell
ndocrine carcinoma (LCNEC), small cell lung cancer , small cell bladder
cancer, neuroendocrine prostate cancer, neuroendocrine pancreatic cancer and
glioblastoma (Saunders et al., Sci Transl Med. 2015 Aug 26,7(3 02):302ra136; Saunders et
al., AACR 2017).
SCLC represents an indication of extremely high medical need. SCLC accounts for 13% of
Lung Cancer diagnoses and has a worse sis than NSCLC. tional treatments
WO 34220 2019/064942
for these cancers mainly include chemotherapy, radiotherapy, surgery or combinations
thereof, there are no targeted therapies available yet. While the initial response rate to
chemotherapy is high, many patients quickly e with chemo-resistant disease, for
which there are no treatment options available. Although there have been improvements in
treating these cancers over the last years, overall survival rates for these tumor types
remain unchanged, thus, there is an unmet medical need for more targeted and potent
therapies.
One ch for a targeted therapy is provided by antibody drug conjugates (ADCs)
However, for DLL3 this gy is not preferred due to low cell surface expression of
DLL3 and high rate of resistance to chemotherapy. As the ty of patients relapse after
chemotherapy treatment and due to the low expression of DLL3 on the cell surface,
targeting DLL3 with ADCs might have limitations. In addition ADC approaches often
have rget toxicities caused by free drug as a result of linker instability or ation.
There have been attempts to combine DLL3 targeting with targeting of other ns. For
example, WO2017/021349 describes a bispecific antibody construct combining binding to
human DLL3 on the surface of a target cell and binding to human CD3 on the surface of a
T cell. It is however unproven whether such approaches will be successful and to date, no
targeted therapies for SCLC and glioblastoma as well as other DLL3 expressing tumors are
available.
In view of the poor outlook for such cancer patients, there is a need to identify more
efficacious therapies, particularly efficacious therapies with improved bility. Thus, it
is an object of the invention to provide pharmacologically active agents, compositions
and/or methods of treatment that provide certain advantages compared to the agents,
compositions and/or methods currently used and/or known in the art. These advantages
include in vivo y, ed therapeutic and pharmacological properties, increased
specificity, improved safety profile, less side effects, reduced immunogenicity, and other
advantageous properties such as improved ease of preparation or reduced costs of goods,
higher stability/longer ife, need for less frequent administration ns especially
as compared to candidate drugs already known in the art.
BRIEF SUMMARY OF THE INVENTION
The present invention is based on a bispecific T cell engaging approach employing multi-
c binding proteins with a binding arm to CD3 on T cells and a binding arm to DLL3
on the cell surface of tumor cells. h simultaneously binding to T cells and tumor
cells, the T cell engagers force formation of a cytolytic synapse n the two cells and
so, redirect the T cell activity selectively to the targeted tumor cells.
In one aSpect, the invention provides a multi-specific binding protein comprising a first
antigen binding unit specifically binding to DLL3 and a second antigen g unit
specifically binding to CD3, said first antigen binding unit specifically binding to DLL3
ed from the group ting of i) to xviii):
i) an antigen binding unit comprising light chain CDRs comprising the amino acid
sequences of SEQ ID NO:1 (CDRl), SEQ ID NO:2 (CDR2) and SEQ ID NO:3
(CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID
N024 (CDRl), SEQ ID NO:5 (CDR2) and SEQ ID NO:6 (CDR3);
ii) an antigen binding unit comprising light chain CDRs sing the amino acid
sequences of SEQ ID NO:7 , SEQ ID NO:8 (CDR2) and SEQ ID NO:9
(CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID
NO:10 (CDRl), SEQ ID NO:11 (CDR2) and SEQ ID NO: 12 (CDR3);
iii) an antigen binding unit comprising light chain CDRs comprising the amino acid
sequences of SEQ ID NO:13 (CDRl), SEQ ID NO: 14 (CDR2) and SEQ ID NO:15
(CDR3) and heavy chain CDRs comprising the amino acid ces of SEQ ID
NO:16 (CDRI), SEQ ID NO:17 (CDR2) and SEQ ID NO:18 (CDR3);
iv) an antigen binding unit comprising light chain CDRs comprising the amino acid
sequences of SEQ ID NO:l9 (CDRl), SEQ ID NO:20 (CDR2) and SEQ ID NO:21
(CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID
NO:22 (CDRI), SEQ ID NO:23 (CDR2) and SEQ ID NO:24 (CDR3);
an antigen binding unit comprising light chain CDRs comprising the amino acid
sequences of SEQ ID NO:25 , SEQ ID NO:26 (CDR2) and SEQ ID
NO:27 (CDR3) and heavy chain CDRs comprising the amino acid sequences of
SEQ ID NO:28 (CDRl), SEQ ID NO:29 (CDR2) and SEQ ID NO:30 (CDR3);
Vi) an n binding unit comprising light chain CDRs comprising the amino acid
sequences of SEQ ID NO:3l (CDRl), SEQ ID NO:32 (CDR2) and SEQ ID
NO:33 (CDR3) and heavy chain CDRs sing the amino acid sequences of
SEQ ID NO:34 (CDRl), SEQ ID NO:35 (CDR2) and SEQ ID NO:36 ;
Vii) an antigen binding unit comprising light chain CDRs comprising the amino acid
sequences of SEQ ID NO:133 (CDRl), SEQ ID NO:134 (CDR2) and SEQ ID
NO:135 (CDR3) and heavy chain CDRs comprising the amino acid sequences of
SEQ ID NO:136 (CDRl), SEQ ID NO:137 (CDR2) and SEQ ID NO:138
(CDR3);
viii) an antigen binding unit comprising light chain CDRs comprising the amino acid
sequences of SEQ ID NO:139 (CDRl), SEQ ID NO:140 (CDR2) and SEQ ID
NO:141 (CDR3) and heavy chain CDRs comprising the amino acid sequences of
SEQ ID NO:142 (CDRl), SEQ ID NO:143 (CDR2) and SEQ ID NO:144
(CDR3);
ix) an n binding unit comprising light chain CDRs comprising the amino acid
sequences of SEQ ID NO:145 (CDRl), SEQ ID NO:146 (CDR2) and SEQ ID
NO:147 (CDR3) and heavy chain CDRs comprising the amino acid ces of
SEQ ID NO:148 (CDRl), SEQ ID NO:149 (CDR2) and SEQ ID NO:150
(CDR3);
an n binding unit comprising light chain CDRs comprising the amino acid
sequences of SEQ ID NO:151 (CDRl), SEQ ID NO:152 (CDR2) and SEQ ID
NO:153 (CDR3) and heavy chain CDRs comprising the amino acid sequences of
SEQ ID NO:154 (CDRl), SEQ ID NO:155 (CDR2) and SEQ ID NO:156
(CDR3);
Xi) an antigen binding unit comprising light chain CDRs comprising the amino acid
sequences of SEQ ID NO:157 (CDRl), SEQ ID NO:158 (CDR2) and SEQ ID
NO:159 (CDR3) and heavy chain CDRs comprising the amino acid sequences of
SEQ ID NO:160 (CDRl), SEQ ID NO:161 (CDR2) and SEQ ID NO:162
(CDR3);
xii) an antigen g unit comprising light chain CDRs comprising the amino acid
sequences of SEQ ID NO:163 (CDRl), SEQ ID NO:164 (CDR2) and SEQ ID
NO:165 (CDR3) and heavy chain CDRs comprising the amino acid sequences of
SEQ ID NO:166 (CDRl), SEQ ID NO:167 (CDR2) and SEQ ID NO:168
(CDR3);
xiii) an antigen binding unit comprising light chain CDRS comprising the amino acid
sequences of SEQ ID NO:169 (CDRl), SEQ ID NO:170 (CDR2) and SEQ ID
NO:171 (CDR3) and heavy chain CDRS comprising the amino acid sequences of
SEQ ID NO:172 (CDRl), SEQ ID NO:173 (CDR2) and SEQ ID NO:174
(CDR3);
xiv) an antigen g unit comprising light chain CDRS comprising the amino acid
sequences of SEQ ID NO:175 (CDRl), SEQ ID NO:176 (CDR2) and SEQ ID
NO:177 (CDR3) and heavy chain CDRS comprising the amino acid sequences of
SEQ ID NO:178 (CDRl), SEQ ID NO:179 (CDR2) and SEQ ID NO:180
(CDR3);
xv) an antigen binding unit comprising light chain CDRS comprising the amino acid
sequences of SEQ ID NO:181 (CDRl), SEQ ID NO:182 (CDR2) and SEQ ID
NO:183 (CDR3) and heavy chain CDRS comprising the amino acid sequences of
SEQ ID NO:184 (CDRl), SEQ ID NO:185 (CDR2) and SEQ ID NO:186
(CDR3);
xvi) an n binding unit comprising light chain CDRS comprising the amino acid
ces of SEQ ID NO:187 (CDRl), SEQ ID NO:188 (CDR2) and SEQ ID
NO:189 (CDR3) and heavy chain CDRS comprising the amino acid sequences of
SEQ ID NO:190 (CDRl), SEQ ID NO:191 (CDR2) and SEQ ID NO:192
(CDR3);
xvii) an n binding unit comprising light chain CDRS sing the amino acid
sequences of SEQ ID NO:193 (CDRl), SEQ ID NO:194 (CDR2) and SEQ ID
NO:195 (CDR3) and heavy chain CDRS comprising the amino acid sequences of
SEQ ID NO:196 (CDRl), SEQ ID NO:197 (CDR2) and SEQ ID NO:198
(CDR3); and
xviii) an antigen binding unit comprising light chain CDRS comprising the amino acid
sequences of SEQ ID NO:199 (CDRl), SEQ ID NO:200 (CDR2) and SEQ ID
NO:201 (CDR3) and heavy chain CDRS comprising the amino acid ces of
SEQ ID NO:202 (CDRl), SEQ ID NO:203 (CDR2) and SEQ ID NO:204
(CDR3).
WO 34220
In some ments of the binding n of the invention, the first antigen g unit
specifically binding to DLL3 comprises a first light chain variable domain and a first heavy
chain variable domain and is selected from the group consisting of i) to xviii):
i) an antigen binding unit comprising a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:37 and heavy chain variable domain
comprising the amino acid sequence of SEQ ID NO:3 8;
ii) an antigen binding unit comprising a light chain variable domain comprising the
amino acid sequences of SEQ ID NO:39 and heavy chain variable domain
comprising the amino acid sequences of SEQ ID NO:40;
iii) an antigen binding unit comprising a light chain le domain comprising the
amino acid sequence of SEQ ID NO:4l and heavy chain variable domain
comprising the amino acid sequence of SEQ ID NO:42;
iv) an antigen binding unit comprising a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:43 and heavy chain variable domain
comprising the amino acid ce of SEQ ID NO:44;
v) an n binding unit comprising a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:45 and heavy chain variable domain
comprising the amino acid sequence of SEQ ID NO:46;
vi) an antigen binding unit comprising a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:47 and heavy chain variable domain
sing the amino acid sequence of SEQ ID NO:48;
vii) an antigen binding unit comprising a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:205 and heavy chain variable domain
comprising the amino acid sequence of SEQ ID NO:206;
viii) an antigen binding unit comprising a light chain le domain comprising the
amino acid sequence of SEQ ID NO:207 and heavy chain variable domain
comprising the amino acid sequence of SEQ ID NO:208;
ix) an antigen binding unit sing a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:209 and heavy chain variable domain
comprising the amino acid sequence of SEQ ID NO:210;
an antigen binding unit comprising a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:211 and heavy chain variable domain
comprising the amino acid sequence of SEQ ID NO:212;
xi) an antigen binding unit comprising a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:213 and heavy chain variable domain
comprising the amino acid sequence of SEQ ID ;
IO xii) an antigen binding unit comprising a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:215 and heavy chain variable domain
comprising the amino acid sequence of SEQ ID ;
xiii) an antigen g unit comprising a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:217 and heavy chain variable domain
comprising the amino acid sequence of SEQ ID NO:218;
xiv) an antigen binding unit comprising a light chain le domain comprising the
amino acid sequence of SEQ ID NO:219 and heavy chain variable domain
comprising the amino acid sequence of SEQ ID NO:220;
xv) an antigen g unit comprising a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:221 and heavy chain variable domain
comprising the amino acid ce of SEQ ID NO:222;
xvi) an antigen binding unit comprising a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:223 and heavy chain variable domain
comprising the amino acid ce of SEQ ID NO:224;
xvii) an antigen g unit comprising a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:225 and heavy chain variable domain
comprising the amino acid sequence of SEQ ID NO:226; and
xviii) an antigen binding unit comprising a light chain le domain comprising the
amino acid sequence of SEQ ID NO:227 and heavy chain variable domain
comprising the amino acid sequence of SEQ ID NO:228.
2019/064942
In some embodiments of the binding protein of the invention, the second antigen binding
unit specifically binding to CD3 is selected from the group consisting of i) to iii):
i) an antigen binding unit sing light chain CDRs comprising the amino acid
sequences of SEQ ID NO:55 (CDRl), SEQ ID NO:56 (CDR2) and SEQ ID NO:57
(CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID
NO:58 (CDRl), SEQ ID NO:59 (CDR2) and SEQ ID NO:6O ;
ii) an antigen g unit comprising light chain CDRs comprising the amino acid
sequences of SEQ ID NO:61 (CDRl), SEQ ID NO:62 (CDR2) and SEQ ID NO:63
(CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID
NO:64 (CDRl), SEQ ID NO:65 (CDR2) and SEQ ID NO:66 (CDR3); and
iii) an n binding unit comprising light chain CDRs comprising the amino acid
sequences of SEQ ID NO:96 (CDRl), SEQ ID NO:97 (CDR2) and SEQ ID NO:98
(CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID
NO:99 (CDRl), SEQ ID NO:100 (CDR2) and SEQ ID NO:101 (CDR3).
In some embodiments of the binding protein of the invention, the second antigen binding
unit specifically binding to CD3 ses a second light chain variable domain and a
second heavy chain variable domain and is selected from the group consisting of:
i) an antigen binding unit comprising a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:67 and a heavy chain variable domain
comprising the amino acid sequence of SEQ ID NO:68;
ii) an antigen binding unit comprising a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:69 and a heavy chain variable domain
comprising the amino acid sequence of SEQ ID NO:70; and
iii) an antigen binding unit comprising a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:102 and a heavy chain variable domain
comprising the amino acid sequence of SEQ ID NO: 103.
In some embodiments of the invention, the first antigen binding unit specifically binding to
DLL3 comprises from its N— to C-terminus: a first light chain variable , a first light
chain constant domain, a first e linker, a first heavy chain variable domain and a first
heavy chain constant CH1 domain; and the second antigen binding unit specifically
binding to CD3 comprises from its N— to C—terminus: a second light chain le domain,
a second light chain constant domain, a second peptide linker, a second heavy chain
variable domain and a second heavy chain constant CH1 domain. In some embodiments of
the invention, the first and/or second peptide linker comprises 26 to 42 amino acids,
preferably any one of 30 to 40 amino acids, 34 to 40 amino acids, or 36 to 39 amino acids,
more preferably 38 amino acids. In some embodiments of the invention, the first linker
and/or second linker is a Gly—Ser , preferably comprising the amino acid sequence of
SEQ ID NO:89, more preferably said first and second peptide linker comprise the same
sequence.
In some embodiments, the binding protein of the invention further comprises a first and a
second Fc domain, said first PC domain ntly linked to said first antigen binding unit,
and said second Fc domain covalently linked to said second antigen binding unit.
In some embodiments of the invention,
i) the first PC domain comprises a ne (Y) at position 366 [T3 66Y], and the
second Fc domain ses a threonine (T) at position 407 [Y407T], or
ii) the first Fc domain comprises a phan (W) at position 366 ], and the
second Fc domain comprises a serine (S) at position 366 [T366S], an alanine (A) at
position 368 [L368A] and a valine (V) at position 407 [Y407V], or
iii) the second Fc domain comprises a tyrosine (Y) at position 366 [T366Y], and the
first PC domain comprises a threonine (T) at position 407 [Y407T], or
iv) the second Fc domain comprises a tryptophan (W) at position 366 [T366W], and
the first Fc domain comprises a serine (S) at position 366 [T366S], an alanine (A) at
position 368 ] and a valine (V) at position 407 [Y407V],
preferably the first or the second Fc domain further comprises an arginine at on 435
[H435R] and a phenylalanine at position 436 [Y436F]. In some embodiments, the first
and/or second Fc domain further ses an alanine at position 234[L234A] and at
position 235 ]. In some embodiments, the first light chain constant domain and the
second light chain constant domain comprise a human kappa or lambda domain.
In preferred embodiments, the g protein of the invention comprises a first
polypeptide chain specifically binding to DLL3 comprising an amino acid sequence
selected from the group consisting of SEQ ID NO:73, SEQ ID NO:74, SEQ ID NO:75,
SEQ ID NO:76, SEQ ID NO:77, SEQ ID NO:78, SEQ ID NO:241, SEQ ID NO; 242, SEQ
ID NO:243, SEQ ID NO:244, SEQ ID NO: 245, SEQ ID NO: 246, SEQ ID NO: 247, SEQ
ID NO: 248, SEQ ID NO: 249, SEQ ID NO: 250, SEQ ID NO: 251, and SEQ ID NO: 252
WO 34220
and a second polypeptide chain specifically binding to CD3 comprising the amino acid
sequence of SEQ ID NO:79, SEQ ID NO:80 or SEQ ID .
In a further aspect, the invention provides an ed nucleic acid molecule i) encoding a
first antigen binding unit and/or a second antigen binding unit of a protein of the invention,
optionally further encoding a first and/or a second Fc domain, or ii) encoding a first and/or
a second polypeptide chain of a protein of the invention. In further aspects provided herein
are expression vectors sing the c acid molecule of the ion, host cells
transfected with such expression vectors, and methods of manufacturing a protein of the
invention.
In a further aspect of the ion, provided herein is a multi-specific binding protein
comprising a first ptide chain specifically binding to DLL3 and a second
ptide chain specifically binding to CD3, where the first polypeptide chain comprises
a first light chain, a first linker, and a first heavy chain and the second polypeptide chain
comprises a second light chain, a second linker, and a second heavy chain, preferably the
C-terminus of said first light chain is covalently bound to the N—terminus of said first
heavy chain via said first peptide linker and the C-terminus of said second light chain is
covalently bound to the inus of said second heavy chain Via said second peptide
linker.
In some embodiments of the g protein of the invention, the first polypeptide chain
specifically binding to DLL3 comprises a light chain variable domain and heavy chain
variable domain comprising CDR sequences and/or VH/VL sequences as defined for the
antigen binding units of DLL3#1, DLL3#2, DLL3#3, DLL3#4, DLL3#5, DLL3#6,
DLL3#7, DLL3#8, DLL3#9, DLL3#10, DLL3#ll, DLL3#12, DLL3#13, DLL3#14,
DLL3#15, DLL3#16, DLL3#17, or DLL3#18 described herein. In some embodiments, the
second polypeptide chain specifically binding to CD3 comprises a light chain variable and
heavy chain variable domain comprising CDR sequences and/or VH/VL sequences as
defined for the n binding units of CD3#1, CD3#2, or CD3#3 described herein.
Further s, embodiments, uses and methods involving the binding proteins of the
invention will become clear from the following detailed description of the invention and
from the appended claims.
_10_
The ion provides for novel binding proteins that allow a more efficient treatment of
DLL3 expressing cancers, such as SCLC, glioblastoma or a DLL3 expressing
neuroendocrine tumor.
BRIEF DESCRIPTION OF THE DRAWINGS
Figure 1: Schematic entation of a bispecific binding protein of the invention
Figure 2: Schematic representation of the DLL3 full length protein and DLL3 domain
constructs expressed on HEK293 cells for epitope domain mapping. For the DLL3 domain
ucts, the transmembrane and the intracellular domains are derived from EpCAM.
Figure 3A: DLL3 epitope domain mapping of seven exemplary DLL3/CD3 binding
proteins. ary DLL3/CD3 binding proteins recognizing the membrane proximal
peptide, EGF4, EGFl and DSL domains of DLL3. The y-axis depicts , the x-axis
depicts PE—A (phycoerythrin signal area).
Figure 3B: DLL3 epitope domain mapping of six exemplary DLL3/CD3 binding ns.
Exemplary DLL3/CD3 binding proteins recognizing the EGFl, EGF3, EGF4 or EGF6 of
DLL3. The y—axis depicts counts, the x-axis depicts PE-A erythrin signal).
Figure 3C: DLL3 epitope domain mapping of six exemplary DLL3/CD3 binding proteins.
ary DLL3/CD3 binding proteins recognizing the DSL domains or neither DSL,
EGF, nor membrane proximal peptide of DLL3. The y-axis depicts counts, the x-axis
depicts PE—A (phycoerythrin signal).
Figure 4: Binding of seven exemplary DLL3/CD3 binding proteins to cell lines expressing
human and cyno DLL3. The y—axis s counts, the x-axis depicts PE-A (phycoerythrin
signal area).
Figure 5: Binding of seven exemplary DLL3/CD3 g ns to cell lines expressing
human DLLl and DLL4, no binding to human DLLl and DLL4 detected. The y—axis
depicts , the x-axis depicts PE-A (phycoerythrin signal area).
Figure 6A: Binding of seven exemplary DLL3/CD3 binding proteins to SCLC cell lines
and human T cells by flow cytometry analysis.
Figure 6 B: Binding of exemplary DLL3/CD3 binding proteins (directed to a peptide that
is neither the DSL nor the EGFl-6 nor the membrane proximal peptide) to SHP77 cells.
_11_
Figure 6 C: Binding of exemplary DLL3/CD3 binding proteins (directed against the DSL
domain) to SHP77 cells.
Figure 6 D: Binding of exemplary DLL3/CD3 binding proteins (directed against the EGFl
domain) to SHP77 cells.
Figure 6 E: Binding of ary DLL3/CD3 binding ns (directed against the
EGF3 domain) to SHP77 cells.
Figure 6 F: Binding of exemplary D3 binding proteins (directed against the EGF4
domain) to SHP77 cells.
Figure 6 G: Binding of exemplary D3 binding proteins (directed against the DSL
domain) to SHP77 cells.
Figure 6 H: Binding of exemplary DLL3/CD3 binding proteins ted against the
membrane al peptide ) to SHP77 cells.
Figure 6 1: Binding of exemplary DLL3/CD3 binding proteins (directed to a peptide that is
neither the DSL nor the EGFl-6 nor the membrane proximal peptide) to NCI—H82 cells.
Figure 6 J: Binding of exemplary DLL3/CD3 binding proteins (directed against the DSL
domain) to NCI-H82 cells.
Figure 6 K: Binding of exemplary DLL3/CD3 binding proteins (directed t the EGFl
domain) to NCI—H82 cells.
Figure 6 L: Binding of exemplary DLL3/CD3 binding proteins (directed against the
EGF3 domain) to 2 cells.
Figure 6 M: Binding of exemplary DLL3/CD3 binding ns ted against the
EGF4 domain) to NCI—H82 cells.
Figure 6 N: Binding of exemplary D3 binding proteins (directed against the DSL
domain) to NCI—H82 cells.
Figure 6 0: Binding of exemplary DLL3/CD3 binding proteins (directed against the
membrane proximal peptide domain) to NCI-H82 cells.
Figure 6 P: Binding of exemplary DLL3/CD3 binding ns (directed to a peptide that
is neither the DSL nor the EGFl-6 nor the membrane proximal peptide) to T cells.
_12_
Figure 6 Q: Binding of exemplary D3 binding proteins (directed against the DSL
domain) to T cells.
Figure 6 R: Binding of exemplary DLL3/CD3 binding proteins (directed against the EGFl
domain) to T cells.
Figure 6 S: g of exemplary DLL3/CD3 binding proteins (directed t the
EGF3 domain) to T cells.
Figure 6 T: Binding of exemplary DLL3/CD3 binding proteins (directed against the EGF4
domain) to T cells.
Figure 6 U: g of exemplary DLL3/CD3 binding proteins ted against the EGF6
domain) to T cells.
Figure 6 V: g of exemplary D3 binding ns (directed against the
membrane proximal peptide domain) to T cells.
Figure 7 A: Potency in lysing cells of seven D3 binding proteins redirecting non-
stimulated PBMCs towards human SCLC cell lines.
Figure 7 B: Potency in lysing cells of exemplary DLL3/CD3 binding proteins (directed to
a peptide that is neither the DSL nor the EGF1-6 nor the membrane proximal peptide)
redirecting non-stimulated T cells towards human SHP77 cells.
Figure 7 C: Potency in lysing cells of exemplary DLL3/CD3 binding proteins ted
against the DSL domain) redirecting non-stimulated T cells towards human SHP77 cells.
Figure 7 D: Potency in lysing cells of exemplary DLL3/CD3 binding proteins (directed
against the EGFl domain redirecting non-stimulated T cells towards human SHP77 cells.
Figure 7 E: Potency in lysing cells of exemplary DLL3/CD3 binding proteins (directed
against the EGF3 domain) redirecting non—stimulated T cells towards human SHP77 cells.
Figure 7 F: Potency in lysing cells of exemplary DLL3/CD3 binding proteins (directed
against the EGF4 domain) redirecting non-stimulated T cells s human SHP77 cells.
Figure 7 G: Potency in lysing cells of exemplary DLL3/CD3 binding proteins (directed
against the EGF6 domain) redirecting non-stimulated T cells towards human SHP77 cells.
Figure 7 H: Potency in lysing cells of exemplary DLL3/CD3 binding ns (directed
against the membrane proximal peptide redirecting imulated T cells towards human
SHP77 cells.
_13_
Figure 7 I: Potency in lysing cells of exemplary DLL3/CD3 binding proteins (directed to a
peptide that is neither the DSL nor the EGF1-6 nor the membrane proximal peptide)
redirecting non-stimulated T cells towards human NCI-H82 cells.
Figure 7 J: Potency in lysing cells of exemplary DLL3/CD3 binding proteins (directed
against the DSL domain) redirecting imulated T cells towards human NCI—H82 cells.
Figure 7 K: Potency in lysing cells of exemplary DLL3/CD3 g proteins (directed
against the EGFl domain redirecting non-stimulated T cells towards human NCI-H82
cells.
Figure 7 L: Potency in lysing cells of exemplary DLL3/CD3 binding proteins (directed
against the EGF3 domain) redirecting non—stimulated T cells towards human NCI-H82
cells.
Figure 7 M: Potency in lysing cells of ary DLL3/CD3 binding proteins (directed
against the EGF4 domain) redirecting non-stimulated T cells towards human NCI-H82
cells.
Figure 7 N: Potency in lysing cells of exemplary D3 binding ns (directed
against the EGF6 domain) redirecting non-stimulated T cells towards human 2
cells.
Figure 7 O: Potency in lysing cells of exemplary D3 binding ns (directed
against the membrane proximal peptide cting non-stimulated T cells towards human
NCI—H82 cells.
Figure 8: In vitro internalization assay with two ary DLL3/CD3 binding proteins.
DLL3/CD3 binding proteins were pre-incubated with DLL3-positive SHP77 cells for 2 and
4 hours before co—incubation for 48 hours with human PBMCs.
Figure 9: Pharmacokinetics of two exemplary DLL3/CD3 binding proteins. Mean
cokinetic s of DLL3#3/CD3#1 (open squares) and DLL3#3/CD3#2 (closed
squares) in male C57BL/6 mice following a single 1 mg/kg intravenous dose.
Figure 10: Anti-tumor activity of two exemplary DLL3/CD3 binding proteins. The y—axis
depicts median tumor volumes and the x—axis depicts time.
Figure 11: Potency in lysing cells of an exemplary DLL3/CD3 binding protein redirecting
imulated PBMCstowards human SHP77 and RKO—E6 cells.
_14_
Figure 12: Potency in activation of T cells in presence of SHP77 cells of an ary
DLL3/CD3 binding protein
Figure 13: Potency in degranulation of T cells in presence of SHP77 cells of an exemplary
D3 binding protein
Figure 14A: Potency secretion of Interferon gamma by PBMCsin presence of SHP77l cells
of an exemplary DLL3/CD3 binding protein
Figure 143: Potency secretion of MCP—l by PBMCsin presence of SHP77 cells of an
exemplary DLL3/CD3 g protein
Figure 15: Potency in proliferation of T cells in presence of SHP77 cells of an exemplary
DLL3/CD3 binding protein
Figure 16: Potency in lysing cells of an exemplary DLL3/CD3 binding protein redirecting
imulated pan T cells and na't've T cells towards human SHP77 cells
Figure 17: Potency in lysing cells of an exemplary DLL3/CD3 g protein redirecting
non—stimulated CD4+ and CD4+ central memory T cells towards human SHP77 cells
Figure 18: Potency in lysing cells of an exemplary DLL3/CD3 binding protein redirecting
non—stimulated CD4+ and CD4+ effector memory T cells towards human SHP77 cells
Figure 19: Potency in lysing cells of an exemplary DLL3/CD3 binding protein redirecting
non-stimulated CD8+ and CD8+CD45RA+ effector memory T cells s human SHP77
cells
Figure 20: y in lysing cells of an exemplary DLL3/CD3 binding protein redirecting
non-stimulated CD8+ and CD8+ memory T cells towards human SHP77
Figure 21: T cell infiltration in SHP77 xenograft tumor tissue with an exemplary
DLL3/CD3 binding protein.
Figure 22: Binding of three exemplary anti-DLL3 antibodies to recombinant DLL3
protein in ELISA assay. The y-axis depicts , the x-axis depicts concentration of
DLL3 protein.
Figure 23: Binding of six exemplary anti-DLL3 antibodies to DLL3-positive SCLC cell
lines determined by flow cytometry. The y—axis depicts , the x—axis depicts
concentration of anti-DLL3 antibody.
Figure 24: Representative staining of a SCLC tissue sample with 5 exemplary anti-DLL3
dies. Anti-DLL3 antibodies DLL3#1 and DLL3#5 showed that the tumor cells
exhibit a te and/or diffuse cytoplasmic and/or nous DLL3 staining. Images
_15_
have been electronically generated by LEICA SCN400 automated scanner with a
magnification of 10x.
Figure 25: Representative staining of cell pellets from SCLC cell lines with different
DLL3 expression levels. Anti-DLL3 antibody DLL3#5
DETAILED DESCRIPTION OF THE INVENTION
USED TERMS AND DEFINITIONS
The above and other aspects and embodiments of the invention will become clear from the
further description herein, in which:
Unless indicated or defined ise, all terms used have their usual meaning in the art,
which will be clear to the skilled person. nce is for example made to the rd
handbooks, such as Sambrook et al, "Molecular Cloning: A Laboratory Manual" (2nd Ed.),
Vols. 1—3, Cold Spring Harbor Laboratory Press (1989); Lewin, "Genes IV", Oxford
sity Press, New York, (1990), and Roitt et al., "Immunology" (2nd Ed.), Gower
Medical Publishing, London, New York (1989), as well as to the general ound art
cited herein. Furthermore, unless indicated otherwise, all methods, steps, techniques and
manipulations that are not specifically described in detail can be performed and have been
performed in a manner known per se, as will be clear to the skilled person. nce is for
example again made to the standard handbooks, to the general background art referred to
above and to the further references cited n.
When used herein the term “comprising” and variations thereof such as “comprises” and
“comprise” can be substituted with the term “containing” or ding” or “having.”
The term "sequence" as used herein (for example in terms like "heavy/light chain
II N antibody sequenceH “
sequence variable domain sequence37 ant domain sequence”
, , ,
or "protein sequence"), should generally be understood to include both the relevant amino
acid sequence as well as nucleic acid sequences or nucleotide sequences encoding the
same, unless the context requires a more limited interpretation.
An “antigen binding unit” as used herein refers to a polypeptide capable of binding to its
specific target or antigen and comprising the l structural requirements derived from
an antibody (typically present in an antibody) which allow for target binding. Thus, an
antigen g unit comprises at least the presence of three light chain and three heavy
—l6—
chain CDR sequences, preferably at least a light chain variable domain and a heavy chain
variable domain.
The generalized structure of an antibody or immunoglobulin is well known to those of skill
in the art. These molecules are heterotetrameric glycoproteins, typically of about 150,000
daltons, composed of two cal light (L) chains and two identical heavy (H) chains and
are typically referred to as full length antibodies. Each light chain is covalently linked to a
heavy chain by one disulfide bond to form a heterodimer, and the heterotetrameric
le is formed through a covalent disulflde linkage between the two identical heavy
chains of the dimers. Although the light and heavy chains are linked together by one
disulfide bond, the number of disulflde linkages between the two heavy chains varies by
immunoglobulin isotype. Each heavy and light chain also has regularly spaced intrachain
disulfide bridges. Each heavy chain has at the inus a variable domain (VH),
followed by three or four (in case of IgE) constant s (CH1, CH2, CH3, and CH4),
as well as a hinge region between CH1 and CH2. Each light chain has two domains, an N-
terminal variable domain (VL) and a C-terminal constant domain (CL). The VL domain
associates non-covalently with the VH domain, s the CL domain is ly
covalently linked to the CH1 domain via a disulfide bond. Particular amino acid residues
are believed to form an interface between the light and heavy chain variable domains
(Chothia et al., 1985, J. Mol. Biol. 186:651—663). Variable s are also referred to
herein as variable regions or Fv and denote the part that confers specificity to an antibody
for the antigen by carrying the antigen-binding site.
The “light chain variable domain” (or “light chain le region”) and “heavy chain
variable domain” (or “heavy chain variable region”) as used herein have the same general
structure and each domain essentially consists of four framework (FR) regions whose
sequences are widely conserved, which are referred to in the art and hereinbelow as
"framework region 1" or "FRI"; as "framework region 2" or"FR2"; as "framework region
3" or "FR3"; and as "framework region 4" or "FR4", respectively; which framework
regions are upted by three hypervariable regions, HVRs (or CDRs), which are
referred to in the art and herein below as ementarity determining region l"or
"CDRl"; as "complementarity determining region 2" or "CDR2"; and as "complementarity
ining region 3" or "CDR3", respectively. Thus, the general structure or sequence of
an immunoglobulin variable domain can be indicated as follows: FRl - CDRl - FR2 —
CDR2 - FR3 - CDR3 - FR4. The framework regions adopt a beta-sheet conformation and
_17_
WO 34220
the CDRs may form loops connecting the beta-sheet structure. The CDRs in each chain are
held in their three-dimensional structure by the framework s and form together with
the CDRs from the other chain the antigen binding site.
Within the context of this invention, reference to CDR’s is based on the ion of CCG,
also referred to as IMGT (Lefranc MP, Pommie’ C, Ruiz M, elli V, Foulquier E,
Truong L, Thouvenin—Contet V, Lefranc G. “IMGT unique numbering for immunoglobulin
and T cell receptor variable domains and Ig superfamily V-like domains.“ Dev Comp
Immunol. 2003 Jan;27(l):55-77; Giudicelli V, Brochet X, Lefranc MP. “IMGT/V-QUEST:
IMGT rdized analysis of the globulin (IG) and T cell receptor (TR)
nucleotide sequences“. Cold Spring Harb Protoc. 2011;2011(6):695—715. An alternative
definition of CDRs known in the art is based on Chothia (Chothia and Lesk, J. Mol. Biol.
1987, 196: 901—917), together with Kabat (E.A. Kabat, T.T. Wu, H. Bilofsky, M. Reid-
Miller and H. Perry, ce of Proteins of logical Interest, National Institutes of
Health, Bethesda (1983)).
The term “constant domains” or “constant ” as used within the current application
denotes the sum of the domains of an antibody other than the variable region. Such
constant domains and regions are well known in the state of the art and e.g. described by
Kabat et a1. (“Sequence of proteins of immunological interest”, US Public Health Services,
NIH Bethesda, MD, Publication No. 91).
The "Fc part" or “Fc domain” of an antibody is not involved directly in binding of an
antibody to an antigen, but ts various effector functions. An "Fc part/domain of an
antibody" is a term well known to the d artisan and defined on the basis of papain
cleavage of antibodies. Depending on the amino acid sequence of the constant region of
their heavy chains, antibodies or immunoglobulins are divided in the classes: IgA, IgD,
IgE, IgG and IgM. According to the heavy chain constant s the different classes of
immunoglobulins are called 0t, 5, 8, y, and u respectively. Several of these may be further
divided into subclasses pes), e.g. IgGl, IgG2, IgG3, and IgG4, IgAl, and IgA2. The
Fc part of an dy is directly involved in ADCC (antibody dependent cell—mediated
cytotoxicity) and CDC (complement—dependent cytotoxicity) based on complement
activation, Clq binding and Fc receptor binding. Complement activation (CDC) is initiated
by binding of complement factor Clq to the F0 part of most IgG antibody subclasses. While
the influence of an antibody on the complement system is dependent on certain conditions,
—18-
binding to Clq is caused by defined binding sites in the Fc part. Such binding sites are e. g.
L234, L235, D270, N297, E318, K320, K322, P331 and P329 (numbering according to EU
numbering (Edelman et al, Proc Natl Acad Sci U S A. 1969 May;63(l):78—85)). Most
crucial among these residues in mediating Clq and chamma receptor binding in IgGl are
L234 and L235 (Hezareh et al., J. Virology 75 (2001) 12161- 12168, Shields et a1 (2001)
JBC, 276 (9): 6591—6604). Antibodies of subclass IgG1 and IgG3 usually show
complement activation and Clq and C3 binding, s IgG2 and IgG4 do not te
the ment system and do not bind Clq and C3.
The term “antibody” or “antibody molecule” (used synonymously herein) encompasses a
monoclonal antibody, a polyclonal dy, a human antibody, a humanized antibody, a
chimeric antibody, peciflc antibodies (e.g., bispeciflc antibodies), a fragment of an
antibody, in particular a Fv, Fab, Fab’, or F(ab’)2 fragment, a single chain antibody, in
particular a single chain variable nt (scFv), a single chain Fab fragment (scFab), a
Small Modular Immunopharmaceutical , a domain antibody, a nanobody, a
diabody. The dy may have an effector function, such as ADCC or CDC, that is
usually mediated by the Fc part (antibody constant ) of the antibody, or it may have
no effector function, e. g. by lacking a PC part or having a blocked, masked Fc part, in
essence a PC part that is not or insufficiently recognized by immune cells or immune
system components, like the complement system.
Monoclonal antibodies (mAb) are monospecific antibodies that are identical in amino acid
sequence. They may be produced by hybridoma technology from a hybrid cell line (called
oma) representing a clone of a fusion of a specific antibody-producing B cell with a
myeloma (B cell cancer) cell (Kohler G, Milstein C. Continuous es of fused cells
secreting antibody of predefined specificity. Nature 1975;256:4957). Alternatively,
monoclonal antibodies may be produced by recombinant sion in host cells
(Norderhaug L, Olafsen T, Michaelsen TE, Sandlie I. (May 1997). "Versatile vectors for
transient and stable expression of recombinant antibody molecules in mammalian cells." J
l Methods 204 (1): 77—87; see also below). A binant antibody” or
“recombinant binding protein” is an antibody or binding n which has been produced
by a recombinantly engineered host cell. It is optionally isolated or purified.
Full length antibodies can be treated with enzymes such as papain or pepsin to generate
useful antibody fragments. Papain digestion is used to produces two identical antigen—
_19_
binding antibody fragments called "Fab" fragments, each with a single antigen—binding
site, and a al "Fc" fragment. The Fab fragment also contains the constant domain of
the light chain and the CH1 domain of the heavy chain. Pepsin treatment yields a F(ab')2
fragment that has two antigen-binding sites and is still capable of cross-linking antigen.
Fab' fragments differ from Fab fragments by the presence of additional residues including
one or more cysteines from the antibody hinge region at the C-terminus of the CH1
domain. F(ab')2 antibody fragments are pairs of Fab‘ fragments linked by cysteine residues
in the hinge region. Other chemical couplings of antibody fragments are also known.
"Fv" fragment contains a te antigen-recognition and g site ting of a
dimer of one heavy and one light chain le domain in tight, non-covalent ation.
In this configuration, the three CDRs of each variable domain interact to define an antigen-
biding site on the surface of the VH—VL dimer. Collectively, the six CDRs confer antigen-
g specificity to the dy.
A "single—chain FV" or "scFv" antibody fragment is a single chain FV variant comprising
the VH and VL s of an antibody where the domains are present in a single
polypeptide chain. The single chain Fv is capable of recognizing and binding an antigen.
The scFV polypeptide may optionally also contain a ptide linker positioned between
the VH and VL domains in order to facilitate formation of a desired three-dimensional
ure for antigen binding by the scFV (see, e.g., Pluckthun, 1994, In The cology
of monoclonal Antibodies, Vol. 113, Rosenburg and Moore eds., Springer—Verlag, New
York, pp. 269-315).
A "single-chain Fab" or "scFab" antibody fragment is a single chain Fab variant
comprising the VL, CL, VH and CH1 domains of an antibody where the domains are
present in a single polypeptide chain. The single chain Fab is capable of recognizing and
binding an antigen. The scFab polypeptide may optionally also contain a polypeptide
linker positioned between the CL and VH domains (Hust et al (2007) BMC
Biotechnology).
For application in man, it is often desirable to reduce immunogenicity of therapeutic
molecules, such as antibodies or binding ns comprising an antigen binding unit as
described herein, originally derived from other species, like mouse. This can be done by
construction of chimeric dies/binding proteins, or by a process called
“humanization”. In this context, a “chimeric antibody”; or “chimeric antigen binding unit”
_20_
WO 34220
is understood to be an antibody or an n binding unit comprising a sequence part (e. g.
a variable domain) derived from one species (e. g. mouse) fused to a sequence part (e.g. the
constant domains) d from a different species (e. g. human). In this context, a
“humanized antibody”, “a humanized binding protein” or a “humanized antigen binding
unit” is an antibody, a protein or antigen binding unit comprising a le domain
originally derived from a non-human s, wherein n amino acids have been
mutated to make the overall sequence of that variable domain more closely resemble a
sequence of a human variable domain. Methods of humanization of antibodies are well-
known in the art (Billetta R, Lobuglio AF. “Chimeric antibodies”. Int Rev Immunol.
l993;lO(2—3): 165-76; Riechmann L, Clark M, Waldmann H, Winter G . "Reshaping
human antibodies for therapy". Nature: 332:323).
An “optimized antibody” or an “optimized antigen binding unit or protein” is a specific
type of humanized dy or humanized antigen binding unit/protein which includes an
immunoglobulin amino acid sequence variant, or fragment thereof, which is capable of
binding to a predetermined n and which comprises one or more FRs having
substantially the amino acid sequence of a human immunoglobulin and one or more CDRs
having substantially the amino acid sequence of a non-human immunoglobulin. This non-
human amino acid sequence often referred to as an "import" sequence is typically taken
from an "import" antibody domain, particularly a variable domain. In general, an optimized
antibody includes at least the CDRs (or HVLs) of a non-human antibody or derived from a
non-human antibody, inserted between the FRs of a human heavy or light chain variable
domain. It will be understood that certain mouse FR residues may be important to the
function of the optimized antibodies and therefore certain of the human ne sequence
heavy and light chain variable domains es are modified to be the same as those of the
corresponding mouse ce. During this s undesired amino acids may also be
removed or changed, for e to avoid deamidation, undesirable charges or
lipophilicity or non—specific binding. An “optimized dy”, an “optimized antibody
fragment” or “optimized” may sometimes be referred to as “humanized antibody”,
“humanized antibody nt” or “humanized”, or as “sequence-optimized”.
Furthermore, technologies have been developed for creating antibodies or VH/VL domains
based on sequences derived from the human genome, for example by phage display or use
of transgenic animals (WWW. Ablexis.com/technology—alivamab.php; WO 90/05144; D.
Marks, H.R. Hoogenboom, T.P. Bonnert, J. McCafferty, A.D. Griffiths and G. Winter
_21_
2019/064942
(1991) "By—passing immunisation. Human antibodies from V—gene libraries displayed on
phage." J.Mol.Biol., 222, 581—597; Knappik et al., J. M01. Biol. 296: 57—86, 2000; S.
Carmen and L. Jermutus, "Concepts in antibody phage display". Briefings in Functional
Genomics and Proteomics 2002 1(2):189-203; Lonberg N, Huszar D. "Human antibodies
from transgenic mice". Int Rev Immunol. 1995;13(1):65-93.; Brfiggemann M, Taussig MJ.
"Production of human antibody repertoires in transgenic mice”. Curr Opin hnol.
1997 Aug;8(4):455-8.). Such antibodies or antigen binding units or VH/VL domains are
“human antibodies,” “human n binding units,” or “human VH/VL domains” in the
context of the present invention.
The term "human antibody", “human antigen binding unit”, or “ human VH/VL ”
as used herein, is intended to include antibodies, antigen g units or VH/VL domains
having variable (and constant, if applicable) regions d from human germline
immunoglobulin sequences. The human antibodies, antigen binding units, proteins or
VH/VL domains of the present technology may include amino acid residues not encoded
by human germline immunoglobulin sequences (e.g., mutations introduced by random or
site- specific mutagenesis in vitro or by somatic mutation in vivo). However, the term
"human antibody", “human n g unit”, or “ human VH/VL domain”as used
herein, is not intended to e antibodies in which CDR sequences derived from the
germline of r lian species), such as a mouse, rat or rabbit, have been grafted
onto human framework sequences. Thus, as used herein, the term "human antibody",
“human antigen binding unit”, or “human VH/VL ” refer to an antibody, antigen
binding unit or VH/VL domain in which substantially every part of the protein (e.g., CDR,
framework, CL, CH domains (e.g., CHI is substantially non-
, CH2, CH3), hinge, VL, VH)
immunogenic in humans, with only minor sequence changes or variations. Such changes or
variations optionally and preferably retain or reduce the immunogenicity in humans or
other species relative to non—modified antibodies or antigen binding units.
Thus, a human antibody, human n binding unit or human VH/VL domain is distinct
from e.g., a chimeric or humanized antibody. It is d out that a human antibody,
human antigen binding unit or human VH/VL domain can be produced by a non—human
animal or prokaryotic or eukaryotic cell that is capable of expressing functionally
rearranged human immunoglobulin (e.g., heavy chain and/or light chain) genes.
_22_
The term er” refers to a homogenous form of an antibody or a multispeciflc
protein as described herein. For example, for a full-length antibody, monomer means a
monomeric antibody having two identical heavy chains and two identical light . In
the context of the t invention, a monomer means a protein of the present invention
having a single antigen binding unit specific for DLL3, and a single antigen binding unit
specific for CD3 as described herein. For example, a r of a g protein
bed herein may have two chains, a first chain comprising a single chain Fab with a
first antigen binding unit and ally a first PC domain and a second chain comprising a
single chain Fab with a second antigen binding unit and optionally a second Fc domain.
An epitope is a region of an antigen that is bound by an antibody or n binding moiety
(e.g. the antigen binding unit of the proteins described herein). The term “epitope” includes
any polypeptide determinant capable of specific binding to an antibody or antigen binding
moiety. In certain embodiments, epitope determinants include chemically active surface
groupings of molecules such as amino acids, glycan side , phosphoryl, or sulfonyl,
and, in certain embodiments, may have specific three dimensional structural
characteristics, and/or specific charge characteristics. Conformational and non-
conformational epitopes are distinguished in that the g to the former but not the latter
is lost in the presence of denaturing solvents.
An n binding molecule/protein (such as an globulin, an antibody, an antigen
binding unit, or a fragment of such antigen binding molecule/protein) that can “bind”,
"bind to", “specifically bind”, or "Specificaz’b/ bind to", that "has afliniU/for", “is specific
for” and/or that "has specificilyfor" a certain epitope, antigen or protein (or for at least one
part, fragment or epitope thereof) is said to be "against" or "directed againsi" said epitope,
antigen or protein or is a "binding" molecule/protein with respect to such epitope, antigen
or protein.
As used herein, the terms “binding” and “specific binding” refer to the binding of the
antibody or antigen binding moiety (such as an immunoglobulin, an dy, an antigen
binding unit, or a fragment of such antigen binding le/protein) to an epitope of the
n in an in vitro assay, preferably in a plasmon resonance assay ((Malmqvist M.,
"Surface plasmon resonance for detection and measurement of antibody-antigen affinity
and kinetics", Curr Opin Immunol. 1993 Apr;5(2):282-6.)) with purified wild—type
antigen. Antibody y can also be ed using kinetic exclusion assay (KinExA)
_23_
technology (Darling, R.J., and Brault P—A., “Kinetic exclusion assay technology:
Characterization of Molecular Interactions.” ASSAY and Drug Development
Technologies. 2004, Dec 2(6): 647-657).
Generally, the term "specificity" refers to the number of ent types of antigens or
epitopes to which a particular antigen binding molecule/protein (such as an
globulin, an antibody, an antigen binding unit, or a fragment of such n
binding molecule/protein) can bind. The city of an antigen-binding molecule/protein
can be determined based on its affinity and/or avidity. The affinity, ented by the
equilibrium constant for the dissociation of an n with an antigen-binding protein
(KD), is a measure for the binding strength between an epitope and an antigen—binding site
on the antigen-binding molecule/protein: the lesser the value of the K13, the stronger the
binding strength between an epitope and the antigen—binding molecule/protein
(alternatively, the affinity can also be expressed as the affinity constant (KA), which is
l/KD). As will be clear to the skilled person (for example on the basis of the further
disclosure herein), affinity can be determined in a manner known per se, ing on the
c antigen of interest. y is the measure of the th of binding between an
antigen-binding molecule/protein (such as an immunoglobulin, an antibody, an antigen
binding unit, or fragment of such n binding molecule/protein) and the pertinent
antigen. Avidity is related to both the affinity between an epitope and its n binding
site on the antigen—binding molecule/protein and the number of pertinent g sites
present on the antigen-binding molecule/protein.
The term "isolated," as used herein, refers to material that is removed from its original or
native environment (e.g. the l environment if it is naturally occurring). For example,
a naturally-occurring polynucleotide or polypeptide present in a living animal is not
isolated, but the same polynucleotide or polypeptide, separated by human intervention
from some or all of the co-existing materials in the natural system, is isolated. Such
polynucleotides could be part of a vector and/or such polynucleotides or polypeptides
could be part of a composition, and still be isolated in that such vector or composition is
not part of the environment in which it is found in nature. For example, a nucleic acid,
protein/polypeptide molecule is considered to be "(in) essentially isolated (form)" - when
compared to its native biological source and/or the reaction medium or cultivation medium
from which it has been obtained - when it has been separated from at least one other
ent with which it is usually associated in said source or medium, such as another
_24_
nucleic acid, another protein/polypeptide, another biological ent or macromolecule
or at least one contaminant, impurity or minor component. In particular, a nucleic acid or
protein/polypeptide molecule is considered "essentially isolated" when it has been d
at least , in ular at least 10- fold, more in particular at least ld, and up to
old or more. A nucleic acid or protein/polypeptide molecule that is "in essentially
isolated form" is preferably essentially homogeneous, as determined using a suitable
technique, such as a suitable chromatographical technique, e. g., polyacrylamide-
gelelectrophoresis.
As used , the terms "identical" or "percent identity, " in the context of two or more
nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences
that are the same or have a specified percentage of nucleotides or amino acid residues that
are the same, when compared and d for maximum correspondence. To determine the
percent identity, the sequences are aligned for optimal comparison purposes (e.g., gaps can
be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal
alignment with a second amino or nucleic acid sequence). The amino acid residues or
nucleotides at corresponding amino acid positions or nucleotide positions are then
compared. When a position in the first ce is occupied by the same amino acid
residue or nucleotide as the corresponding on in the second sequence, then the
molecules are identical at that position. The t identity between the two sequences is
a on of the number of identical positions shared by the sequences (i.e., % identity=#
of identical positions/total # of positions (e.g., overlapping positions)x100). In some
embodiments, the two sequences that are compared are the same length after gaps are
introduced within the sequences, as appropriate (e.g., excluding additional sequence
extending beyond the sequences being compared). For example, when variable region
sequences are ed, the leader and/or constant domain sequences are not considered.
For sequence comparisons between two sequences, a "corresponding" CDR refers to a
CDR in the same on in both sequences (e.g., CDR—H1 of each sequence).
The determination of percent identity or percent similarity between two sequences can be
accomplished using a mathematical thm. A preferred, non-limiting example of a
mathematical algorithm utilized for the comparison of two sequences is the thm of
Karlin and Altschul, 1990, Proc. Natl. Acad. Sci. USA 87:2264—2268, modified as in
Karlin and Altschul, 1993, Proc. Natl. Acad. Sci. USA 90:5873—5877. Such an algorithm is
incorporated into the NBLAST and XBLAST programs of Altschul et al., 1990, J. M01.
_25_
Biol. 215:403 —410. BLAST nucleotide searches can be performed with the NBLAST
program, score=100, wordlength=12, to obtain nucleotide sequences homologous to a
nucleic acid encoding a n of interest. BLAST protein searches can be performed with
the XBLAST program, score=5 0, ngth=3, to obtain amino acid sequences
gous to a protein of st. To obtain gapped alignments for comparison purposes,
Gapped BLAST can be ed as described in Altschul et al., 1997, c Acids Res.
:3389—3402. Alternatively, PSI—Blast can be used to m an iterated search which
detects distant onships between molecules (Id). When utilizing BLAST, Gapped
BLAST, and PSI—Blast programs, the default parameters of the respective programs (e. g.,
XBLAST and NBLAST) can be used. Another preferred, non-limiting example of a
mathematical algorithm utilized for the comparison of sequences is the algorithm of Myers
and Miller, CABIOS (1989). Such an algorithm is incorporated into the ALIGN program
(version 2.0) which is part of the GCG sequence alignment software package. When
utilizing the ALIGN program for comparing amino acid sequences, a PAM120 weight
residue table, a gap length y of 12, and a gap penalty of 4 can be used. Additional
algorithms for sequence analysis are known in the art and include ADVANCE and ADAM
as described in Torellis and Robotti, 1994, Comput. Appl. Biosci. 10:3—5; and FASTA
described in Pearson and Lipman, 1988, Proc. Natl. Acad. Sci. USA 85:2444-8. Within
FASTA, ktup is a control option that sets the sensitivity and speed of the search. If ktup=2,
similar regions in the two sequences being compared are found by looking at pairs of
aligned residues; if ktup=l, single aligned amino acids are examined. ktup can be set to 2
or 1 for protein sequences, or from 1 to 6 for DNA sequences. The default if ktup is not
specified is 2 for proteins and 6 for DNA. Alternatively, protein sequence alignment may
be carried out using the CLUSTAL W thm, as described by Higgins et al., 1996,
Methods l. 266:3 83—402.
The term “covalently linked” as used herein means either a direct covalent bond between
es, or an indirect association where two es are not directly bonded but are both
covalently bonded to an intermediate molecule or domain, e. g. an intermediate domain of
an immunoglobulin.
The terms "compete" or "cross—compete" are used interchangeably herein to refer to the
ability of an antibody molecule to ere with binding of an antibody molecule, e.g., an
anti-DLL3 dy molecule of the invention, to a target, e.g., human DLL3. The
interference with binding can be direct or indirect (e.g., through an eric modulation of
—26—
the antibody molecule or the target). The extent to which an antibody molecule is able to
interfere with the binding of another antibody molecule to the , and ore r
it can be said to compete, can be determined using a competition binding assay, for
example, a FACS assay, an ELISA or BIACORE assay. In some embodiments, a
competition binding assay is a quantitative competition assay. In some embodiments, a
first anti-DLL3 antibody molecule is said to compete for binding to the target with a
second anti- DLL3 antibody molecule when the binding of the first antibody molecule to
the target is reduced by 10% or more, e.g., 20% or more, 30% or more, 40% or more, 50%
or more, 55% or more, 60% or more, 65% or more, 70% or more, 75% or more, 80% or
more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more in a
competition binding assay (e. g., a competition assay described herein).
It is to be inferred without explicit recitation and unless otherwise intended, that when the
present technology relates to a polypeptide, protein, polynucleotide or antibody, an
equivalent or a biologically equivalent of such is intended within the scope of the present
technology.
As used herein, the term "biological equivalent f” is intended to be synonymous with
"equivalent thereof” when referring to a reference protein, antibody, polypeptide,
polynucleotide or nucleic acid, and intends those having l homology while still
maintaining desired ure or functionality. Unless specifically recited herein, it is
plated that any nucleic acid, polynucleotide, polypeptide, protein or antibody
mentioned herein also includes equivalents thereof. For example, an equivalent intends at
least about 80 % homology or identity and alternatively, at least about 85 %, or
atively at least about 90 %, or alternatively at least about 95 %, or alternatively 98 %
percent homology or identity and exhibits ntially equivalent biological activity to the
reference protein, polypeptide, antibody or nucleic acid.
As used herein, the term "detectable label" refers to a molecule, compound or composition
that can produce a detectable , i.e. physical or chemical signal including a
metric, cent, electrical, radioactive and chemiluminescent signal, which can be
measured by visual or instrumental methods, and which indicates the presence and/or
quantity/concentration of the label in a sample.
A “detectable signal” can be generated by various mechanism ing tion,
emission and/or scattering of a photon (including radio frequency, microwave frequency,
_27_
infrared frequency, visible frequency and ultra—violet frequency photons) and includes but
is not limited to colorimetric, fluorescent, electrical, radioactive and chemiluminescent
signals.
As used herein, "expression" refers to the s by which polynucleotides are transcribed
into mRNA and/or the process by which the ribed mRNA is subsequently being
translated into es, polypeptides, or proteins. If the polynucleotide is derived from
genomic DNA, expression may e splicing of the mRNA in an eukaryotic cell. The
expression level of a gene may be determined by measuring the amount of mRNA or
protein in a cell or tissue sample.
As used herein the term “biological sample” means a sample material derived from or
contacted by living cells. The term is intended to include s, cells and biological fluids
isolated from a subject. As used herein, the term e sample" shall refer to a cellular
sample that preserves the cross-sectional spatial relationship between the cells as they
existed within the t from which the sample was obtained. Biological samples can
also be obtained from es of internal organs or from cancers.
“Histochemistry” and cytochemistry” are techniques used to identify a le within the
t of intact cells by labeling the samples with an agent that binds specifically to the
molecule in a manner than can be visualized on a microscope. ”Immunohistochemistry”
and “immunocytochemistry” are types of histochemistry and cytochemistry that use
antibodies to label the molecules.
MULTI—SPECIFIC BINDING PROTEINS OF THE INVENTION
The present ion provides multi-specific binding proteins comprising at least one
antigen binding unit specifically binding to DLL3 (a first antigen binding unit), and at least
one antigen binding unit specifically binding to CD3 (a second antigen binding unit). Such
(multi-specific) binding proteins are also referred to herein as (multi—specific) binding
molecules or DLL3/CD3 g proteins or DLL3/CD3 binding molecules.
The ors have surprisingly found that multi-specific binding proteins of the invention
induce selective lysis of DLL3—positive SCLC cell lines in the presence of T cells and are
already active at low effector to target cell ratios. Importantly, the binding proteins of the
—28-
invention do not cause T cell activation, T cell proliferation, and Cytokine secretion in the
absence of DLL3—positive cells or lysis of DLL3 —negative cells.
For avoidance of doubt, DLL3 as used herein refers to human DLL3 of UniProt Q9NYJ7
and the nucleic acid sequence encoding that n. CD3 as used herein refers to human
CD3epsilon (UniProt P07766) and CD3 gamma (Uniprot: P09693) complexes (human
CD38y xes).
Targeting DLL3 with a bispecific T cell engaging approach is expected to provide
advantages over an ADC approach, as redirecting T cells is not influenced by resistance to
chemotherapy and low expression levels on the cell e are less critical for this mode
of action. T cell engagers are multi-specific binding proteins with g arms to CD3 on
T cells and binding arms to an antigen on the cell surface oftumor cells. Through
simultaneously binding to T cells and tumor cells, the T cell engagers force formation of a
cytolytic synapse between the two cells and so, redirect the T cell activity selectively to the
targeted tumor cells.
In one aspect, the multi-specific binding protein of the invention comprises a first antigen
binding unit specifically g to DLL3 and a second antigen binding unit specifically
binding to CD3, wherein said first g unit is selected from the group consisting of i)
to xviii):
i) an antigen binding unit comprising light chain CDRs comprising the amino
acid sequences of SEQ ID NO:1 (CDRl), SEQ ID NO:2 (CDR2) and SEQ ID
NO:3 (CDR3) and heavy chain CDRs comprising the amino acid sequences of
SEQ ID NO:4 , SEQ ID NO:5 (CDR2) and SEQ ID NO:6 (CDR3)
(antigen binding unit );
ii) an antigen binding unit comprising light chain CDRs comprising the amino
acid ces of SEQ ID NO:7 (CDRl), SEQ ID N028 (CDR2) and SEQ ID
NO:9 (CDR3) and heavy chain CDRs comprising the amino acid sequences of
SEQ ID NO:10 (CDRl), SEQ ID NO:11 (CDR2) and SEQ ID NO:12 (CDR3)
(antigen binding unit DLL3#2);
iii) an antigen binding unit comprising light chain CDRs sing the amino
acid ces of SEQ ID NO:l3 (CDRl), SEQ ID NO:l4 (CDR2) and SEQ
ID N0215 (CDR3) and heavy chain CDRs comprising the amino acid
_29_
WO 20191234220
sequences of SEQ ID NO:16 (CDRl), SEQ ID NO]? (CDR2) and SEQ ID
NO:18 (CDR3) (antigen binding unit DLL3#3);
iv) an antigen binding unit comprising light chain CDRs comprising the amino
acid sequences of SEQ ID NO:19 (CDRl), SEQ ID NO:20 (CDR2) and SEQ
ID NO:2l (CDR3) and heavy chain CDRs comprising the amino acid
sequences of SEQ ID NO:22 (CDRl), SEQ ID NO:23 (CDR2) and SEQ ID
NO:24 (CDR3) (antigen binding unit DLL3#4);
an antigen binding unit sing light chain CDRs comprising the amino
acid ces of SEQ ID NO:25 (CDRl), SEQ ID NO:26 (CDR2) and SEQ
ID NO:27 (CDR3) and heavy chain CDRs comprising the amino acid
sequences of SEQ ID NO:28 (CDRl), SEQ ID NO:29 (CDR2) and SEQ ID
NO:30 (CDR3) (antigen g unit DLL3#5);
vi) an antigen binding unit comprising light chain CDRs comprising the amino
acid sequences of SEQ ID NO:3l (CDRl), SEQ ID NO:32 (CDR2) and SEQ
ID NO:33 (CDR3) and heavy chain CDRs sing the amino acid
sequences of SEQ ID NO:34 (CDRl), SEQ ID NO:35 (CDR2) and SEQ ID
NO:36 (CDR3) (antigen binding unit DLL3#6);
vii) an antigen binding unit comprising light chain CDRs comprising the amino
acid sequences of SEQ ID NO:133 (CDRl), SEQ ID NO:134 (CDR2) and
SEQ ID NO:135 (CDR3) and heavy chain CDRs comprising the amino acid
ces of SEQ ID NO:136 (CDRl), SEQ ID NO:137 (CDR2) and SEQ ID
NO:138 (CDR3) (antigen binding unit DLL3#7);
viii) an antigen binding unit comprising light chain CDRs comprising the amino
acid sequences of SEQ ID NO:139 (CDRI), SEQ ID NO:140 (CDR2) and
SEQ ID NO:14l (CDR3) and heavy chain CDRs comprising the amino acid
sequences of SEQ ID NO:142 (CDRl), SEQ ID NO:143 (CDR2) and SEQ ID
NO: 144 (CDR3) (antigen binding unit );
ix) an antigen binding unit comprising light chain CDRs comprising the amino
acid sequences of SEQ ID NO:145 (CDRl), SEQ ID NO:146 (CDR2) and
SEQ ID NO:147 (CDR3) and heavy chain CDRs comprising the amino acid
sequences of SEQ ID NO:148 (CDRl), SEQ ID NO:149 (CDR2) and SEQ ID
NO:150 (CDR3) (antigen binding unit DLL3#9);
_30_
WO 20191234220
X) an antigen g unit comprising light chain CDRs comprising the amino
acid sequences of SEQ ID NO:151 (CDRl), SEQ ID NO:152 (CDR2) and
SEQ ID NO:153 (CDR3) and heavy chain CDRs comprising the amino acid
sequences of SEQ ID NO:154 (CDRl), SEQ ID NO:155 (CDR2) and SEQ ID
NO:156 (CDR3) (antigen binding unit DLL3#10);
xi) an antigen binding unit sing light chain CDRs comprising the amino
acid sequences of SEQ ID NO:157 (CDRl), SEQ ID NO:158 (CDR2) and
SEQ ID NO:159 (CDR3) and heavy chain CDRs comprising the amino acid
sequences of SEQ ID NO:160 (CDRl), SEQ ID NO:161 (CDR2) and SEQ ID
NO:162 (CDR3) (antigen binding unit DLL3#1 1);
xii) an antigen binding unit comprising light chain CDRs comprising the amino
acid sequences of SEQ ID NO:163 (CDRl), SEQ ID NO:164 (CDR2) and
SEQ ID NO:165 (CDR3) and heavy chain CDRs comprising the amino acid
sequences of SEQ ID NO:166 (CDRl), SEQ ID NO:167 (CDR2) and SEQ ID
NO:168 (CDR3) (antigen binding unit DLL3#12);
xiii) an antigen binding unit comprising light chain CDRs comprising the amino
acid sequences of SEQ ID NO:169 (CDRl), SEQ ID NO:170 (CDR2) and
SEQ ID NO:171 (CDR3) and heavy chain CDRs comprising the amino acid
sequences of SEQ ID NO:172 (CDRl), SEQ ID NO:173 (CDR2) and SEQ ID
NO:174 (CDR3) (antigen binding unit DLL3#13);
xiv) an antigen binding unit comprising light chain CDRs comprising the amino
acid ces of SEQ ID NO:175 (CDRl), SEQ ID NO:176 (CDR2) and
SEQ ID NO:177 (CDR3) and heavy chain CDRs comprising the amino acid
sequences of SEQ ID NO:178 (CDRl), SEQ ID NO:179 (CDR2) and SEQ ID
NO:180 (CDR3) (antigen binding unit 4);
xv) an antigen g unit comprising light chain CDRs comprising the amino
acid ces of SEQ ID NO:181 (CDRl), SEQ ID NO:182 (CDR2) and
SEQ ID NO:183 (CDR3) and heavy chain CDRs comprising the amino acid
sequences of SEQ ID NO:184 (CDRl), SEQ ID NO:185 (CDR2) and SEQ ID
NO:186 (CDR3) (antigen binding unit DLL3#15);
xvi) an antigen binding unit comprising light chain CDRs comprising the amino
acid sequences of SEQ ID NO:187 (CDRl), SEQ ID NO:188 (CDR2) and
_31_
2019/064942
SEQ ID NO:189 (CDR3) and heavy chain CDRs comprising the amino acid
sequences of SEQ ID NO:190 (CDRl), SEQ ID NO:191 (CDR2) and SEQ ID
NO:192 (CDR3) (antigen binding unit DLL3#16);
xvii) an n binding unit comprising light chain CDRs comprising the amino
acid sequences of SEQ ID NO:193 (CDRl), SEQ ID NO:194(CDR2) and SEQ
ID NO:l95 (CDR3) and heavy chain CDRs comprising the amino acid
sequences of SEQ ID NO:196 (CDRl), SEQ ID NO:197 (CDR2) and SEQ ID
NO:198 (CDR3) (antigen binding unit DLL3#17); and
xviii) an n binding unit comprising light chain CDRs comprising the amino
acid sequences of SEQ ID NO:199 (CDRI), SEQ ID NO:200 (CDR2) and
SEQ ID NO:201 (CDR3) and heavy chain CDRs comprising the amino acid
ces of SEQ ID NO:202 (CDRl), SEQ ID NO:203 (CDR2) and SEQ ID
NO:204 (CDR3) (antigen binding unit DLL3#18).
Preferably, the first antigen binding unit of the binding n of the invention is any one
of i) to iii) as defined by the CDR sequences above.
For the avoidance of doubt, each of the specific embodiments listed herein can also be
considered independent aspects of the invention.
In some embodiments of the binding protein of the invention, said second antigen binding
unit specifically binding to CD3 is selected from the group consisting of i) to iii):
i) an antigen binding unit comprising light chain CDRs comprising the amino acid
sequences of SEQ ID NO:55 (CDRl), SEQ ID NO:56 (CDR2) and SEQ ID
NO:57 (CDR3) and heavy chain CDRs comprising the amino acid sequences of
SEQ ID NO:58 (CDRl), SEQ ID NO:59 (CDR2) and SEQ ID NO:60 (CDR3)
(antigen binding unit CD3#1);
ii) an antigen binding unit comprising light chain CDRs comprising the amino acid
ces of SEQ ID NO:61 (CDRl), SEQ ID NO:62 (CDR2) and SEQ ID
NO:63 (CDR3) and heavy chain CDRs comprising the amino acid sequences of
SEQ ID NO:64 (CDRl), SEQ ID NO:65 (CDR2) and SEQ ID NO:66 (CDR3)
(antigen binding unit CD3#2); and
iii) an antigen binding unit comprising light chain CDRs sing the amino acid
sequences of SEQ ID NO:96 (CDRl), SEQ ID NO:97 (CDR2) and SEQ ID
_32_
N0298 (CDR3) and heavy chain CDRs comprising the amino acid sequences of
SEQ ID NO:99 (CDRl), SEQ ID NO:100 (CDR2) and SEQ ID NO:101 (CDR3)
(antigen binding unit CD3#3).
The first antigen binding units i) to xviii) as outlined above are termed DLL3#1, DLL3#2,
DLL3#3, DLL3#4, DLL3#5, DLL3#6, DLL3#7, DLL3#8, DLL3#9, DLL3#10, DLL3#11,
DLL3#12, DLL3#13, DLL3#14, DLL3#15, 6, DLL3#17 and DLL3#18,
respectively and the second antigen binding units i) to iii) as outlined above are termed
CD3#1, CD3#2 and CD3#3, respectively. Provided herein is a sequence table which
y allows identification of individual amino acid sequences to specific antigen binding
units and full length binding proteins of the present invention. A summary is ed in
Table l in Example 2.
The terms “first” and “second” with respect to antigen binding units in general, as used
herein, is solely intended to indicate that these units are two different units (as they bind to
different target antigens). Thus, these terms shall not be understood to refer to the exact
order or sequence of the units within the binding n of the invention.
In some embodiments, the binding protein of the invention comprises a first antigen
binding unit selected from the group consisting of DLL3#1, , DLL3#3, DLL3#4,
DLL3#5, DLL3#6, DLL3#7, DLL3#8, DLL3#9, DLL3#10, DLL3#11, DLL3#12,
DLL3#13, 4, DLL3#15, DLL3#16, DLL3#17 and DLL3#18 as defined by the
respective CDR sequences described above and a second antigen binding unit of CD3#1 as
defined by the respective CDR sequences described above. In preferred embodiments, the
binding protein of the ion comprises a first antigen binding unit selected from the
group consisting of DLL3#1, DLL3#2, and DLL3#3 as defined by the respective CDR
sequences described above and a second antigen binding unit of CD3#1 as defined by the
respective CDR sequences described above.
In some ments, the binding protein of the invention comprises a first antigen
binding unit selected from the group consisting of DLL3#1, DLL3#2, DLL3#3, DLL3#4,
DLL3#5, DLL3#6, DLL3#7, DLL3#8, DLL3#9, DLL3#10, 1, 2,
DLL3#l3, DLL3#14, DLL3#15, DLL3#l6, DLL3#l7 and DLL3#l8 as defined by the
respective CDR sequences described above and a second antigen binding unit of CD3#2 as
defined by the tive CDR sequences described above. In preferred embodiments, the
g n of the invention ses a first antigen binding unit selected from the
_33_
WO 34220
group consisting of DLL3#1, , and DLL3#3 as defined by the respective CDR
sequences described above and a second n g unit of CD3#2 as defined by the
respective CDR sequences described above.
In some embodiments, the binding protein of the invention comprises a first antigen
binding unit selected from the group ting of , DLL3#2, DLL3#3, DLL3#4,
DLL3#5, DLL3#6, DLL3#7, DLL3#8, DLL3#9, DLL3#10, DLL3#11, DLL3#12,
DLL3#l3, DLL3#14, DLL3#15, DLL3#l6, 7 and DLL3#l8 as defined by the
respective CDR sequences described above and a second antigen binding unit of CD3#3 as
defined by the respective CDR sequences described above. In preferred embodiments, the
binding n of the invention comprises a first n g unit selected from the
group consisting of DLL3#1, DLL3#2, and DLL3#3 as defined by the respective CDR
sequences described above and a second n binding unit of CD3#3 as defined by the
respective CDR ces described above.
In one preferred embodiment, the binding protein of the invention comprises a first antigen
binding unit specifically binding to DLL3, comprising light chain CDRs comprising the
amino acid sequences of SEQ ID N021 (CDRl), SEQ ID N022 (CDR2) and SEQ ID N023
(CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID N024
(CDRl), SEQ ID N025 (CDR2) and SEQ ID N026 (CDR3) and a second antigen binding
unit specifically binding to CD3, comprising light chain CDRs comprising the amino acid
sequences of SEQ ID NO:55 (CDRl), SEQ ID NO:56 (CDR2) and SEQ ID NO:57
(CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID N0258
(CDRl), SEQ ID NO:59 (CDR2) and SEQ ID N0260 (CDR3).
In one preferred embodiment, the binding protein of the invention comprises a first antigen
binding unit specifically binding to DLL3, comprising light chain CDRs comprising the
amino acid sequences of SEQ ID N027 (CDRl), SEQ ID N028 (CDR2) and SEQ ID NO:9
(CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID N0210
(CDRl), SEQ ID N0: 11 (CDR2) and SEQ ID N0:12 (CDR3) and a second antigen
binding unit specifically binding to CD3, comprising light chain CDRs comprising the
amino acid sequences of SEQ ID NO:55 (CDRl), SEQ ID NO:56 (CDR2) and SEQ ID
N0257 (CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID
NO:58 (CDRl), SEQ ID NO:59 (CDR2) and SEQ ID N0260 (CDR3).
_34_
In one red embodiment, the binding protein of the invention comprises a first antigen
binding unit specifically binding to DLL3, comprising light chain CDRs comprising the
amino acid ces of SEQ ID NO: 13 (CDRl), SEQ ID NO:14 (CDR2) and SEQ ID
NO:15 (CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID
NO:16 (CDRl), SEQ ID NO: 17 (CDR2) and SEQ ID NO:18 (CDR3) and a second antigen
binding unit specifically binding to CD3, comprising light chain CDRs comprising the
amino acid sequences of SEQ ID N0255 (CDRl), SEQ ID NO:56 (CDR2) and SEQ ID
N0:57 (CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID
N0258 (CDRl), SEQ ID N0259 (CDR2) and SEQ ID NO:60 (CDR3).
In one red embodiment, the binding protein of the invention comprises a first antigen
binding unit specifically binding to DLL3, comprising light chain CDRs comprising the
amino acid sequences of SEQ ID N0:l (CDRl), SEQ ID N022 (CDR2) and SEQ ID N023
(CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID NO:4
(CDRl), SEQ ID N025 (CDR2) and SEQ ID NO:6 (CDR3) and a second antigen binding
unit specifically binding to CD3 comprising light chain CDRs comprising the amino acid
sequences of SEQ ID NO:61 (CDRl), SEQ ID NO:62 (CDR2) and SEQ ID NO:63
(CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID NO:64
, SEQ ID NO:65 (CDR2) and SEQ ID NO:66 .
In one preferred embodiment, the binding protein of the invention ses a first antigen
g unit specifically binding to DLL3, comprising light chain CDRs comprising the
amino acid sequences of SEQ ID NO:7 (CDRl), SEQ ID NO:8 (CDR2) and SEQ ID NO:9
(CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID NO:10
(CDRl), SEQ ID NO:11 (CDR2) and SEQ ID NO:12 (CDR3) and a second antigen
binding unit specifically g to CD3, comprising light chain CDRs comprising the
amino acid sequences of SEQ ID N0261 (CDRl), SEQ ID NO:62 (CDR2) and SEQ ID
NO:63 (CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID
NO:64 (CDRl), SEQ ID NO:65 (CDR2) and SEQ ID NO:66 (CDR3).
In one preferred embodiment, the binding protein of the invention comprises a first antigen
g unit specifically binding to DLL3, comprising light chain CDRs comprising the
amino acid sequences of SEQ ID NO: 13 (CDRl), SEQ ID NO:14 (CDR2) and SEQ ID
NO:15 (CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID
NO:16 (CDRl), SEQ ID NO: 17 (CDR2) and SEQ ID NO:18 (CDR3) and a second antigen
_35_
binding unit cally binding to CD3, comprising light chain CDRs comprising the
amino acid sequences of SEQ ID NO:61 (CDRl), SEQ ID NO:62 (CDR2) and SEQ ID
NO:63 (CDR3) and heavy chain CDRs sing the amino acid sequences of SEQ ID
NO:64 (CDRl), SEQ ID NO:65 (CDR2) and SEQ ID NO:66 (CDR3).
In addition to the CDR sequences as set out herein, the antigen binding units of the binding
proteins of the invention include immunoglobulin framework region (FR) sequences.
These ces are preferably not immunogenic in humans, and are therefore preferably
human or humanized FR sequences. Suitable human or humanized FR sequences are
known in the art. Specifically preferred FR sequences can be taken from the embodiments
shown herein, disclosing the te n binding units and thereby CDR sequences
as well as FR sequences.
In red embodiments of the binding proteins of the invention, the first and the second
binding unit each comprise a light chain variable domain and a heavy chain variable
domain derived from an dy le, said light/heavy chain variable domains
defined by the CDR sequences of any one of DLL3#1, DLL3#2, DLL3#3, DLL3#4,
DLL3#5, , DLL3#7, DLL3#8, DLL3#9, DLL3#10, DLL3#11, DLL3#12,
DLL3#13, DLL3#14, DLL3#15, DLL3#16, DLL3#17 or 8 for the first antigen
binding unit and said light/heavy chain variable s defined by the CDR sequences of
any one of CD3#1, CD3#2 or CD3#3 for the second antigen binding unit. In some
embodiments of the binding protein of the invention, the VH and/or VL domain of the
antigen binding units of any one or more of DLL3#1, DLL3#2, DLL3#3, DLL3#4,
DLL3#5, DLL3#6, DLL3#7, DLL3#8, DLL3#9, DLL3#10, DLL3#11, DLL3#12,
DLL3#13, DLL3#14, DLL3#15, DLL3#16, DLL3#17, DLL3#18, CD3#1, CD3#2 or
CD3#3 is a human or humanized VH and/or VL domain.
In preferred embodiments of the invention, the light/heavy chain le domains of the
first antigen binding unit are further defined as follows
i) a light chain variable domain comprising the amino acid sequences of SEQ ID
N037 and heavy chain variable domain comprising the amino acid sequences of
SEQ ID NO:38 (antigen g unit DLL3#1); or
ii) a light chain variable domain comprising the amino acid sequences of SEQ ID
N039 and heavy chain variable domain comprising the amino acid sequences of
SEQ ID NO:40 (antigen g unit DLL3#2); or
_36_
iii) a light chain variable domain comprising the amino acid sequences of SEQ ID
NO:41 and heavy chain variable domain comprising the amino acid ces of
SEQ ID NO:42 (antigen binding unit DLL3#3); or
iv) a light chain le domain comprising the amino acid sequences of SEQ ID
NO:43 and heavy chain variable domain comprising the amino acid sequences of
SEQ ID NO:44 (antigen binding unit DLL3#4); or
a light chain variable domain comprising the amino acid sequences of SEQ ID
NO:45 and heavy chain variable domain comprising the amino acid sequences of
SEQ ID NO:46 (antigen binding unit DLL3#5); or
vi) a light chain variable domain comprising the amino acid sequences of SEQ ID
NO:47 and heavy chain variable domain comprising the amino acid sequences of
SEQ ID NO:48 (antigen binding unit DLL3#6); or
vii) a light chain variable domain comprising the amino acid sequence of SEQ ID
NO:205 and heavy chain variable domain comprising the amino acid ce of
SEQ ID NO:206 (antigen g unit DLL3#7); or
viii) a light chain variable domain comprising the amino acid sequence of SEQ ID
NO:207 and heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:208 (antigen binding unit DLL3#8); or
ix) a light chain le domain comprising the amino acid sequence of SEQ ID
NO:209 and heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:210 (antigen binding unit DLL3#9); or
a light chain variable domain comprising the amino acid sequence of SEQ ID
N02 11 and heavy chain variable domain comprising the amino acid sequence of
SEQ ID N022 12 (antigen binding unit DLL3#10); or
Xi) a light chain le domain comprising the amino acid sequence of SEQ ID
NO:213 and heavy chain variable domain comprising the amino acid ce of
SEQ ID N02 14 (antigen binding unit DLL3#l l); or
xii) a light chain variable domain comprising the amino acid sequence of SEQ ID
N022 15 and heavy chain variable domain comprising the amino acid sequence of
SEQ ID N02 16 (antigen binding unit DLL3#l2); or
xiii) a light chain variable domain comprising the amino acid sequence of SEQ ID
N02 17 and heavy chain variable domain sing the amino acid sequence of
SEQ ID NO:218 (antigen g unit DLL3#l3); or
_37_
xiv) a light chain variable domain comprising the amino acid sequence of SEQ ID
NO:219 and heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:220 (antigen binding unit DLL3#14); or
xv) a light chain variable domain sing the amino acid sequence of SEQ ID
NO:221 and heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:222 (antigen binding unit DLL3#15); or
xvi) a light chain variable domain comprising the amino acid sequence of SEQ ID
NO:223 and heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:224 (antigen binding unit DLL3#16); or
xvii) a light chain variable domain sing the amino acid sequence of SEQ ID
NO:225 and heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:226 en binding unit DLL3#l7); or
xviii) sing a light chain variable domain comprising the amino acid ce of
SEQ ID NO:227 and heavy chain variable domain comprising the amino acid
sequence of SEQ ID NO:228 (antigen binding unit DLL3#18).
Preferably, the first antigen binding unit of the binding protein of the invention is any one
of i) to iii) as defined by the VL and VH sequences above.
In preferred embodiments of the invention, the light/heavy chain variable domains of the
second antigen binding unit are further defined as follows
i) a light chain variable domain comprising the amino acid sequence of SEQ ID
NO:67 and a heavy chain le domain sing the amino acid sequence of
SEQ ID NO:68 (antigen binding unit CD3#l); or
ii) a light chain variable domain comprising the amino acid sequence of SEQ ID
NO:69 and a heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:70 (antigen binding unit CD3#2); or
iii) a light chain variable domain sing the amino acid sequence of SEQ ID
NO:102 and a heavy chain variable domain comprising the amino acid sequence
of SEQ ID NO:103 (antigen binding unit CD3#3).
In some embodiments, the binding n of the ion comprises a combination of a
first and a second antigen binding unit selected from the group consisting of
DLL3#l/CD3#1, DLL3#2/CD3#1, DLL3#3/CD3#1, DLL3#4/CD3#1, DLL3#5/CD3#1,
DLL3#6/CD3#1, /CD3#1, DLL3#8/CD3#1, DLL3#9/CD3#1, DLL3#10/CD3#1,
_38_
DLL3#11/CD3#1, DLL3#12/CD3#1, DLL3#13/CD3#1, DLL3#14/CD3#1,
DLL3#15/CD3#1, DLL3#16/CD3#1, DLL3#l7/CD3#1, DLL3#18/CD3#1,
DLL3#1/CD3#2, /CD3#2, DLL3#3/CD3#2, DLL3#4/CD3#2, DLL3#5/CD3#2,
DLL3#6/CD3#2, /CD3#2, DLL3#8/CD3#2, DLL3#9/CD3#2, DLL3#lO/CD3#2,
1/CD3#2, DLL3#l2/CD3#2, DLL3#13/CD3#2, DLL3#14/CD3#2,
DLL3#15/CD3#2, DLL3#16/CD3#2, DLL3#l7/CD3#2,
DLL3#18/CD3#2,DLL3#l/CD3#3, DLL3#2/CD3#3, DLL3#3/CD3#3, DLL3#4/CD3#3,
DLL3#5/CD3#3, /CD3#3, DLL3#7/CD3#3, DLL3#8/CD3#3, DLL3#9/CD3#3,
DLL3#10/CD3#3, DLL3#1 l/CD3#3, DLL3#12/CD3#3, DLL3#l3/CD3#3,
DLL3#l4/CD3#3, 5/CD3#3, DLL3#l6/CD3#3, DLL3#l7/CD3#3,
DLL3#l 8/CD3#3, the first and second antigen binding unit being defined by the CDR
and/or VH and VL sequences of the antigen binding units as described above. In preferred
embodiments, the binding protein of the invention comprises a combination of a first and a
second antigen binding unit selected from the group consisting of DLL3#l/CD3#1,
DLL3#2/CD3#1, DLL3#3/CD3#1, DLL3#1/CD3#2, /CD3#2, DLL3#3/CD3#2,
DLL3#l/CD3#3, DLL3#2/CD3#3, and DLL3#3/CD3#3, the first and second antigen
binding unit being defined by the CDR and/or VH and VL sequences of the antigen
binding units as described above.
In one red ment, the binding protein of the invention comprises (i) a first
n binding unit specifically binding to DLL3 comprising a light chain variable domain
comprising the amino acid sequences of SEQ ID NO:37 and a heavy chain variable domain
comprising the amino acid sequences of SEQ ID NO:38 and (ii) a second antigen g
unit specifically binding to CD3 comprising a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:67 and a heavy chain variable domain comprising the
amino acid sequence of SEQ ID NO:68.
In one preferred embodiment, the binding protein of the invention comprises (i) a first
antigen binding unit specifically binding to DLL3 comprising a light chain le domain
sing the amino acid sequences of SEQ ID N039 and a heavy chain variable domain
comprising the amino acid sequences of SEQ ID NO:40 and (ii) a second antigen binding
unit specifically binding to CD3 comprising a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:67 and a heavy chain variable domain comprising the
amino acid sequence of SEQ ID NO:68.
_39_
In one preferred embodiment, the binding protein of the invention comprises (i) a first
antigen binding unit cally binding to DLL3 comprising a light chain variable domain
comprising the amino acid sequences of SEQ ID NO:41 and heavy chain le domain
comprising the amino acid sequences of SEQ ID NO:42 and (ii) a second antigen binding
unit specifically binding to CD3 comprising a light chain le domain sing the
amino acid sequence of SEQ ID NO:67 and a heavy chain le domain comprising the
amino acid sequence of SEQ ID NO:68.
In one red embodiment, the binding protein of the invention comprises (i) a first
n binding unit specifically g to DLL3 comprising a light chain variable domain
sing the amino acid sequences of SEQ ID NO:37 and heavy chain variable domain
comprising the amino acid sequences of SEQ ID NO:38 and (ii) a second n binding
unit specifically binding to CD3 comprising a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:69 and a heavy chain variable domain comprising the
amino acid sequence of SEQ ID NO:70.
In one preferred embodiment, the binding protein of the invention ses (i) a first
antigen g unit specifically binding to DLL3 comprising a light chain variable domain
comprising the amino acid sequences of SEQ ID NO:39 and heavy chain variable domain
comprising the amino acid sequences of SEQ ID NO:40 and (ii) a second antigen binding
unit specifically g to CD3 comprising a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:69 and a heavy chain variable domain comprising the
amino acid sequence of SEQ ID NO:70.
In one preferred embodiment, the binding protein of the invention comprises (i) a first
antigen binding unit specifically binding to DLL3 comprising a light chain variable domain
comprising the amino acid sequences of SEQ ID NO:4l and heavy chain variable domain
comprising the amino acid sequences of SEQ ID NO:42 and a second antigen binding unit
specifically binding to CD3 comprising a light chain variable domain comprising the
amino acid sequence of SEQ ID NO:69 and a heavy chain variable domain comprising the
amino acid sequence of SEQ ID NO:70.
In some embodiments, the binding protein of the invention comprises i) a first antigen
binding unit specifically binding to DLL3 (e.g. any one of DLL3#1, DLL3#2, DLL3#3,
DLL3#4, DLL3#5, DLL3#6, DLL3#7, DLL3#8, DLL3#9, DLL3#10, DLL3#ll,
2, DLL3#13, DLL3#14, DLL3#15, DLL3#16, DLL3#17 or DLL3#18 as defined
_40_
by the respective CDR or VH/VL sequences above) which comprises a first light chain
le domain ntly linked, either directly or indirectly, to a first heavy chain
variable domain with a first peptide linker and/or ii) a second antigen binding unit
specifically g to CD3 (e.g. any one of CD3#1, CD3#2, or CD3#3 as defined by the
respective CDR or VH/VL sequences above) which comprises a second light chain
variable domain covalently linked, either directly or indirectly, to a second heavy chain
variable domain with a second peptide linker.
In some embodiments of the binding proteins of the invention, the first and/or the second
antigen binding unit further comprises a CL and a CH1 domain like in a light/heavy Fab
domain of a conventional antibody molecule, thus said first g unit comprises a) a VL
domain (e.g., defined by the light chain CDR (LCCDR) or VL sequences of any one of
DLL3#l, DLL3#2, , DLL3#4, DLL3#5, DLL3#6, DLL3#7, DLL3#8, DLL3#9,
DLL3#10, DLL3#11, DLL3#12, DLL3#13, DLL3#14, DLL3#15, DLL3#16, DLL3#17 or
8) covalently linked (directly or indirectly bound) to a first CL domain and b) a
VH domain (e. g., defined by the heavy chain CDR (HCCDR) or VH sequences of any one
of DLL3#1, DLL3#2, DLL3#3, DLL3#4, DLL3#5, DLL3#6 DLL3#7, DLL3#8, DLL3#9,
DLL3#10, DLL3#11, DLL3#12, DLL3#13, DLL3#14, DLL3#15, DLL3#16, DLL3#17 or
DLL3#18) covalently linked (directly or ctly bound) to a first CH1 domain and/or
said second antigen binding unit comprises a) a VL domain (e. g., defined by the LCCDR
or VL sequences of any one of CD3#1, CD3#2 or CD3#3) covalently linked (directly or
indirectly bound) to a second CL domain and b) a VH domain (e.g., defined by HCCDR or
VH sequences of any one of CD3#1, CD3#2 or CD3#3) covalently linked (directly or
indirectly bound) to a second CHl domain.
In the context of the present invention, a CL domain is the constant domain of an antibody
light chain, for example a kappa (K) or a lambda (9») light chain. An example of a constant
region of a kappa light chain is shown in SEQ ID NO:87. An e of a constant region
of a lambda light chain is shown in SEQ ID NO:88. In some embodiments, the first and the
second CL domain are the same, e.g. the first and the second CL domain are both a kappa
light chain nt domain or the first and the second CL domain are both a lambda light
chain constant domain. In some embodiments, the first and the second CL domain are
different, e.g., the first CL domain is a constant kappa domain and the second CL domain
is a constant lambda domain or vice versa.
_41_
WO 34220
In the t of the present invention, a CH1 domain is the first constant domain of an
antibody heavy chain. An e of a constant CH1 domain is shown in SEQ ID
NO:253.
In preferred embodiments of the binding proteins of the ion, the first antigen binding
unit (e. g., any one of DLL3#1, DLL3#2, DLL3#3, DLL3#4, DLL3#5, DLL3#6, DLL3#7,
DLL3#8, DLL3#9, DLL3#10, DLL3#11, DLL3#12, DLL3#13, DLL3#14, DLL3#15,
DLL3#16, 7 or DLL3#18 defined by the CDR and/or VH/VL sequences as
outlined above) of the binding proteins of the ion comprises from N— to C-terminus:
a first light chain variable domain, a first CL domain, a first linker peptide, a first VH
domain and a first CH1 domain, and/or the second binding unit (e.g., any one of CD3#1,
CD3#2 or CD3#3 defined by the CDR and/or VH/VL sequences as outlined above) of the
binding proteins of the invention comprises from N— to inus: a second light chain
variable domain, a second CL domain, a second linker peptide, a second VH domain and a
second CH1 domain. In this embodiment, the first and/or the second binding unit have the
structure of a single chain Fab. For both, the first and/or the second antigen binding unit,
when forming a single chain Fab, the order can be ed such that from N- to C-
terminus the antigen binding unit comprises: VH-CHl -[linker peptide]—VL-CL. In some
embodiments of the protein of the ion when the first and/or second antigen binding
unit comprise a Fab or a single chain Fab, the constant domains can be of the same type
(e.g. both CL domains are kappa or lambda light chain nt domains) or of different
types (the first CL domain is a kappa and the second CL domain is a lambda light chain
constant domain or vice versa).
In one aspect, a linker used in a binding protein of the present invention comprises 26 to 42
amino acids, for example 30 to 40 amino acids. In a further aspect, a linker used in a
protein of the present ion comprises 34 to 40 amino acids, for example 36 to 39
amino acids, for example 38 amino acids. In some embodiments, the linker comprises a
sequence of any one of SEQ ID N05: 89, 90, 91, 92, 93, 94, or 95, preferably SEQ ID NO:
The linker sequence may be a naturally occurring sequence or a non—naturally occurring
sequence. If used for therapeutic purposes, the linker is preferably non—immunogenic in the
subject to which the binding protein of the ion is administered.
_42_
One useful group of linker sequences are linkers derived from the hinge region of heavy
chain dies as described in WOl996/34103 and WOl994/04678. Other examples are
poly-alanine linker sequences such as Ala-Ala-Ala.
Further preferred examples of linker sequences are Gly/Ser linkers of different length such
as (glyxsery)z linkers, including e.g. er)3, (gly4ser)5, (gly4ser)7, (gly3ser)3,
(gly3ser)5, (gly3ser)7, (gly3ser2)3, (gly3ser2)5, and (gly3ser2)7 or a linker of any one of
SEQ ID Nos: 89 to 95 .
In some embodiments of the g proteins of the invention, the VL domain of the first
n binding unit (e.g., defined by the light chain CDR (LCCDR) or VL sequences of
DLL3#1, DLL3#2, DLL3#3, DLL3#4, DLL3#5, DLL3#6, DLL3#7, DLL3#8, DLL3#9,
DLL3#10, DLL3#11, DLL3#12, DLL3#13, DLL3#14, DLL3#15, DLL3#16, DLL3#17 or
DLL3#18) is ntly linked (e.g., directly bound) via a first Gly/Ser linker (e.g.,
Gly/Ser linker of any one of 26 to 42 amino acids, 30 to 40 amino acids, 34 to 40 amino
acids, or 36 to 39 amino acids, preferably 38 amino acids) to the VH domain of the first
n g unit (e.g., defined by the heavy chain CDR ) or VH sequences of
DLL3#1, DLL3#2, DLL3#3, DLL3#4, DLL3#5, DLL3#6, DLL3#7, DLL3#8, DLL3#9,
DLL3#10, DLL3#11, DLL3#12, DLL3#13, 4, DLL3#15, DLL3#16, DLL3#17 or
DLL3#18); and the VL domain of the second antigen binding unit (e.g., defined by the
light chain CDR (LCCDR) or VL sequences of CD3#1, CD3#2 or CD3#3) is ntly
linked (e. g. directly bound) via a second Gly/Ser linker (e.g., Gly/Ser linker of any one of
26 to 42 amino acids, 30 to 40 amino acids, 34 to 40 amino acids, or 36 to 39 amino acids,
preferably 38 amino acids) to the VH domain of the second antigen binding unit (e.g.,
defined by the heavy chain CDR (HCCDR) or VH sequences of CD3#1, CD3#2 or
CD3#3). More preferably, the first and the second linker are the same. Even more
preferably, the first and the second linker each comprise the amino acid sequence of SEQ
ID NO:89.
In some embodiments, the binding protein of the ion comprises a first single chain
Fab forming a first antigen binding unit specific for DLL3 and comprising the sequence
selected from the group consisting of SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:51,
SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:229, SEQ ID NO:230, SEQ
ID NO:231, SEQ ID NO:232, SEQ ID NO:233, SEQ ID , SEQ ID NO:235, SEQ
ID NO:236, SEQ ID NO:237, SEQ ID NO:238, SEQ ID NO:239, and SEQ ID NO:240 and
_43_
2019/064942
a second single chain Fab of SEQ ID NO:71 forming a second antigen binding unit
specific for CD3. In a preferred embodiment, the binding protein of the invention
comprises a first single chain Fab forming a first antigen binding unit comprising the
sequence of SEQ ID NO:49 and a second single chain Fab comprising the sequence of
SEQ ID NO:71 forming a second antigen binding unit. In a preferred embodiment, the
binding protein of the invention comprises a first single chain Fab forming a first antigen
binding unit comprising the sequence of SEQ ID NO:50 and a second single chain Fab
comprising the sequence of SEQ ID NO:71 forming a second antigen g unit. In a
preferred embodiment, the binding protein of the invention comprises a first single chain
Fab forming a first antigen binding unit comprising the sequence of SEQ ID NO:51 and a
second single chain Fab comprising the sequence of SEQ ID NO:71 forming a second
antigen g unit.
In some ments, the binding n of the invention comprises a first single chain
Fab forming a first antigen binding unit specific for DLL3 and comprising the sequence
selected from the group consisting of SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:51,
SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54 SEQ ID , SEQ ID NO:230, SEQ
ID NO:231, SEQ ID NO:232, SEQ ID NO:233, SEQ ID NO:234, SEQ ID NO:235, SEQ
ID NO:236, SEQ ID NO:237, SEQ ID NO:238, SEQ ID NO:239, and SEQ ID NO:240 and
a second single chain Fab of SEQ ID NO:72 forming a second antigen binding unit
specific for CD3. In a preferred ment, the binding protein of the invention
comprises a first single chain Fab forming a first antigen binding unit comprising the
sequence of SEQ ID NO:49 and a second single chain Fab comprising the sequence of
SEQ ID NO:72 forming a second antigen binding unit. In a preferred embodiment, the
binding n of the invention comprises a first single chain Fab forming a first antigen
binding unit comprising the sequence of SEQ ID NO:50 and a second single chain Fab
comprising the sequence of SEQ ID NO:72 forming a second antigen binding unit. In a
preferred embodiment, the binding protein of the invention comprises a first single chain
Fab forming a first antigen binding unit comprising the sequence of SEQ ID NO:51 and a
second single chain Fab comprising the ce of SEQ ID NO:72 forming a second
antigen binding unit.
In some ments, the binding n of the invention ses a first single chain
Fab forming a first antigen binding unit specific for DLL3 and sing the ce
selected from the group consisting of SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:51,
_44_
SEQ ID N0252, SEQ ID N0253, SEQ ID NO:54 SEQ ID N02229, SEQ ID NO:230, SEQ
ID NO:231, SEQ ID NO:232, SEQ ID NO:233, SEQ ID NO:234, SEQ ID NO:235, SEQ
ID NO:236, SEQ ID NO:237, SEQ ID NO:23 8, SEQ ID NO:239, and SEQ ID NO:240 and
a second single chain Fab of SEQ ID NO: 104 forming a second n binding unit
specific for CD3. In a red embodiment, the binding protein of the invention
comprises a first single chain Fab forming a first antigen binding unit comprising the
sequence of SEQ ID NO:49 and a second single chain Fab comprising the sequence of
SEQ ID NO:104 forming a second antigen binding unit. In a preferred embodiment, the
binding n of the invention comprises a first single chain Fab forming a first antigen
g unit comprising the sequence of SEQ ID NO:50 and a second single chain Fab
comprising the sequence of SEQ ID NO:104 forming a second antigen binding unit. In a
preferred embodiment, the binding protein of the invention comprises a first single chain
Fab g a first n binding unit comprising the sequence of SEQ ID NO:51 and a
second single chain Fab comprising the sequence of SEQ ID NO:104 forming a second
antigen binding unit.
In some embodiments, the first antigen binding unit (e.g., DLL3#1, DLL3#2, DLL3#3,
DLL3#4, DLL3#5, DLL3#6, DLL3#7, DLL3#8, DLL3#9, DLL3#10, DLL3#11,
DLL3#12, DLL3#13, DLL3#14, DLL3#15, DLL3#16, DLL3#17 or DLL3#18 as defined
by the CDR and/or VH/VL sequences outlined above) and/or the second antigen binding
unit (e.g. CD3#1, CD3#2 or CD3#3) comprises a VL domain covalently linked (e. g.
directly bound) to a CL domain and a VH domain linked to a CH1 domain (i.e. er
forming a Fab fragment derived from an antibody), and said CH1 domain is further
covalently linked (e. g. directly bound) to an EC domain thereby forming an arm of a
conventional Y shaped antibody molecule with one light and one heavy chain. In some
ments, the first and the second antigen binding unit each form a Fab nt, i.e. a
first and a second Fab fragment, which is covalently linked (e.g. directly bound) to a first
and a second Fc domain, respectively, thereby forming a conventional heterotetrameric
ific and bivalent antibody molecule.
In preferred embodiments, the first antigen binding unit (e.g., any one of DLL3#1,
DLL3#2, DLL3#3, DLL3#4, DLL3#5, DLL3#6, DLL3#7, DLL3#8, DLL3#9, 0,
DLL3#l l, DLL3#12, 3, DLL3#l4, DLL3#15, DLL3#l6, 7 or DLL3#18
as defined by the CDR and/or VH/VL sequences ed above) and/or the second antigen
binding unit (e. g. any one of CD3#1, CD3#2 or CD3#3) comprise a single chain Fab, i.e.
_45_
an antibody light chain (VL—CL) covalently linked to the VH—CHl domain of a heavy
chain via a peptide linker (e. g., Gly/Ser linker of any one of 26 to 42 amino acids, 30 to 40
amino acids, 34 to 40 amino acids, or 36 to 39 amino acids, preferably 38 amino acids,
even more preferably a linker of SEQ ID NO:89). In preferred embodiments, the binding
protein of the invention comprises a first polypeptide chain comprising a first single chain
Fab specifically binding to DLL3 (e. g., any one of DLL3#l, DLL3#2, DLL3#3, DLL3#4,
DLL3#5, DLL3#6, , DLL3#8, , DLL3#10, DLL3#11, DLL3#12,
DLL3#13, 4, DLL3#15, DLL3#16, DLL3#17 or DLL3#18 as defined by the
respective CDR or VH/VL sequences above, preferably the first antigen binding unit is
DLL3#1, DLL3#2, DLL3#3) and a first PC domain (this polypeptide chain herein referred
to also as “DLL3 chain”) and a second polypeptide chain comprising a second single chain
Fab specifically binding to CD3 (e.g. any one of CD3#1 CD3#2 or CD3#3 as defined by
the respective CDR or VH/VL sequences above) and a second Fc domain (this polypeptide
chain herein referred to herein also as “CD3 chain”). In some embodiments, the first and
the second Fc domain are the same. In red ments, the first and the second Fc
domains are different. The resulting g proteins of the invention bear a full PC and
have two independent binding sites, a first binding unit for DLL3 and a second binding
unit for CD3. In some embodiments, the first n binding unit consists of a single
polypeptide chain (a DLL3 chain). In some embodiments, the second antigen binding unit
ts of a single ptide chain (a CD3 chain). In some embodiments, both the first
and the second antigen binding unit consist of a single polypeptide chain, respectively.
In some embodiments, the first antigen binding unit of the n of the invention is
formed by a first polypeptide chain (a DLL3 chain) and the second antigen binding unit is
formed by a second polypeptide chain (a CD3 chain). Thus, in some embodiments, the
binding n of the ion comprises two different polypeptide chains, each
comprising an antigen binding unit with different specificity, the ptide chains
covalently linked to each other, either via disulfide bonds or potentially via a peptide
linker. In some embodiments, the binding protein of the invention is a bispecific, bivalent
heterodimeric n comprising two ptide chains, one polypeptide chain (a first
polypeptide chain or DLL3 chain) comprising an antigen binding unit specifically binding
to DLL3 (e. g. any one of DLL3#1, DLL3#2, DLL3#3, DLL3#4, DLL3#5, DLL3#6,
DLL3#7, DLL3#8, DLL3#9, DLL3#10, DLL3#1 l, DLL3#12, DLL3#13, DLL3#14,
DLL3#15, DLL3#16, DLL3#17 or DLL3#18 defined by the respective CDR and/or
—46-
VH/VL ces) and another polypeptide chain (a second polypeptide chain or CD3
chain) comprising an antigen binding unit cally binding to CD3 (e. g. any one of
CD3#1, CD3#2 or CD3#3).
In the context of the present invention, an Fc domain is for example derived from the
heavy chain of an IgG, for e an IgG1,IgG2 or IgG4_ For example, an Fc domain of
the present invention is a Fc domain of a heavy chain of an IgG1 or IgG4 and comprises a
hinge region and two constant domains (CH2 and CH3). Examples of Fc domains (including
a hinge region) are shown in SEQ ID NOsz81 and 84.
The numbering of the amino acids in the amino acid chains of a protein of the present
invention is herein according to the EU numbering system (Edelman, Cunningham et a1.
1969), unless ise specified. This means that the amino acid numbers indicated
herein correspond to the ons in a heavy chain of the ponding pe (e.g.
IgG1 or IgG4), according to the EU numbering system, unless otherwise specified.
In some embodiments, the first Fc domain and the second Fc domain in a protein of the
present invention each comprises one or more amino acid changes which reduce the
formation of homodimers of the first or second polypeptide chains instead of heterodimers
of a first and a second polypeptide chain. Through these changes, a "protrusion" is
generated in one of the Fc domains by replacing one or more, small amino acid side chains
from the ace of one of the heavy chains with larger side chains (e. g. tyrosine or
tryptophan). Compensatory "cavities" of identical or similar size are created on the
interface of the other PC domain by replacing large amino acid side chains with smaller
ones (e. g. alanine or ine). This provides a mechanism for increasing the yield of the
heterodimer over other unwanted end-products such as mers, in particular
homodimers of the Fc domain with the “protrusion” (see for example Ridgway et a1.
Protein Eng, 1996. 9(7): p. 617—21; Atwell et a1, JMB, 1997, 270, 26-35). In some
ments, such amino acid changes are a tyrosine (Y) at position 366 [T366Y] of the
first PC domain and a threonine (T) at position 407 [Y407T] of the second Fc . In
some embodiments, the first PC domain comprises a serine (S) at position 366 [T3668] and
the second Fc domain comprises a tryptophan (W) at position 366 [T366W], an alanine (A)
at position 368 [L368A] and a valine (V) at position 407 [Y407V]. In preferred
embodiments, the first PC domain comprises a tryptophan (W) at position 366 [T3 66W]
and the second Fc domain comprises a serine (S) at position 366 [T3668], an alanine (A) at
_47_
position 368 ] and a valine (V) at position 407 [Y407V]. For example, position 366
of the Fc domain ing to EU numbering, corresponding to the amino acid position
146 in the human IgG1 Fc sequence of SEQ ID NO:81, is changed from T at position 146
in SEQ ID NO:81 to W at position 146 in SEQ ID NO:82; and ons 366, 368 and 407
according to EU numbering, corresponding to the amino acid positions 146, 148 and 187,
respectively, in SEQ ID NO:81, are changed from T, L and Y at these positions in SEQ ID
NO:81 to S, A and V at these positions in SEQ ID NO:83. In any of these embodiments,
the amino acid changes described for the first PC domain may be located in the second Fc
domain and the respective amino acid changes for the second Fc domain may be located in
the first PC domain. In other words, the term “first” and “second” can be exchanged in
these embodiments. In some embodiments, such a PC domain is an Fc domain derived from
the heavy chain of an IgG1 or IgG4.
In some embodiments, the first PC domain comprises a cysteine (C) at position 354
[S354C] in addition to the tryptOphan (W) at position 366 [T3 66W] and the second Fc
domain comprises a ne (C) at position 349 [Y349C] in addition to the serine (S) at
position 366 [T366S], the alanine (A) at position 368 [L368A] and the valine (V) at
position 407 [Y407V]. In one aspect, such Fc domain is an EC domain derived from the
heavy chain of an IgG4.
In some ments, the first PC domain or the second Fc domain in a binding protein of
the present invention r comprises one or more amino acid changes which reduce the
binding of the Fc domain to protein A. In some embodiments, such amino acid changes are
an arginine at position 435 [H43 SR] and a phenylalanine at position 436 [Y43 6F] of one of
the Fc domains. Both changes are derived from the sequence of human IgG3 (IgG3 does
not bind to protein A). These two mutations are located in the CH3 domain and are
orated in one of the Fc domains to reduce binding to Protein A (see for example
erg et al. J l Methods, 1997. : p. 25—34). These two changes facilitate
the removal of homodimers of heavy chains comprising these changes during n
purification.
In some embodiments, in a binding protein of the present invention, the Fc domain, which
comprises a threonine (T) at position 407 [Y407T], further comprises an arginine at
position 435 [H435R] and a phenylalanine at position 436 [Y436F]. In this case, the other
heavy chain comprises a tyrosine (Y) at on 366 [T366Y], but does not include the
—48-
two changes at positions 435 and 436. Alternatively, in some ments, in a protein of
the present invention, the Fc domain, which comprises a serine (S) at position 366
[T3 66S], an alanine (A) at position 368 [L368A] and a valine (V) at position 407 [Y407V],
further comprises an arginine at position 435 [H435R] and a phenylalanine at position 436
[Y43 6F]. In this case, the other PC domain comprises a phan (W) at position 366
[T3 66W], but does not include the two changes at ons 435 and 436. Thus, the Fc
domain comprising the amino acid change resulting in a y” as described above also
comprises the amino acid changes, which reduce binding to Protein A. Homodimers
comprising this PC domain are removed through reduced binding to Protein A. The
production of mers of the other PC domain, which comprises the “protrusion”, is
reduced by the presence of the “protrusion”.
In some embodiments, the Fc domain of a protein of the present ion may or may not
further comprises YTE mutations (M252Y/S254T/T256E, EU numbering (Dall'Acqua,
Kiener et al. 2006)). These mutations have been shown to improve the pharmacokinetic
properties of Fc s through preferential enhancement of binding affinity for neonatal
FcRn receptor at pH 6.0.
In some embodiments, the first and/or the second Fc domain of the present invention
derived from an IgGl also includes the “KO” mutations (L234A, L235A). In a further
aspect, the first and/or the second Fc domain of the present invention derived from an IgG4
also includes the Pro hinge mutation (S228P).
In preferred embodiments of the invention, the binding n comprises i) a first
polypeptide chain comprising the amino acid sequence of SEQ ID NO:73 and a second
polypeptide chain comprising the amino acid sequence of SEQ ID NO:79
(DLL3#l/CD3#1), or ii) a first polypeptide chain comprising the amino acid sequence of
SEQ ID NO:74 and a second polypeptide chain comprising the amino acid sequence of
SEQ ID NO:79 (DLL3#2/CD3#1), or iii) a first polypeptide chain comprising the amino
acid ce of SEQ ID NO:75 and a second polypeptide chain comprising the amino
acid sequence of SEQ ID NO:79 (DLL3#3/CD3#1), or iv) a first polypeptide chain
comprising the amino acid ce of SEQ ID NO:76 and a second polypeptide chain
comprising the amino acid sequence of SEQ ID NO:79 (DLL3#4/CD3#1), or v) a first
polypeptide chain comprising the amino acid ce of SEQ ID NO:77 and a second
polypeptide chain comprising the amino acid sequence of SEQ ID NO:79
_49_
(DLL3#5/CD3#1), or vi) a first polypeptide chain comprising the amino acid sequence of
SEQ ID NO:78 and a second polypeptide chain comprising the amino acid sequence of
SEQ ID NO:79 (DLL3#6/CD3#1); or Vii) a first ptide chain comprising the amino
acid sequence of SEQ ID NO:241 and a second polypeptide chain sing the amino
acid sequence of SEQ ID NO:79 (DLL3#7/CD3#1); or viii) a first polypeptide chain
comprising the amino acid sequence of SEQ ID NO:242 and a second polypeptide chain
comprising the amino acid sequence of SEQ ID NO:79 (DLL3#8/CD3#1); or ix) a first
polypeptide chain comprising the amino acid sequence of SEQ ID NO:243 and a second
polypeptide chain comprising the amino acid sequence of SEQ ID NO:79
w (DLL3#9/CD3#1); or x) a first polypeptide chain sing the amino acid sequence of
SEQ ID NO:244 and a second polypeptide chain comprising the amino acid sequence of
SEQ ID NO:79 (DLL3#10/CD3#1); or xi) a first polypeptide chain comprising the amino
acid sequence of SEQ ID NO:245 and a second polypeptide chain comprising the amino
acid sequence of SEQ ID NO:79 11/CD3#1); or xii) a first polypeptide chain
H sing the amino acid sequence of SEQ ID NO:246 and a second polypeptide chain
sing the amino acid sequence of SEQ ID NO:79 (DLL3#12/CD3#1); or xiii) a first
polypeptide chain comprising the amino acid sequence of SEQ ID NO:247 and a second
polypeptide chain comprising the amino acid sequence of SEQ ID NO:79
(DLL3#l3/CD3#1); or xiv) a first polypeptide chain comprising the amino acid sequence
of SEQ ID NO:248 and a second polypeptide chain comprising the amino acid sequence of
SEQ ID NO:79 (DLL3#l4/CD3#1); or xv) a first polypeptide chain comprising the amino
acid sequence of SEQ ID NO:249 and a second polypeptide chain comprising the amino
acid sequence of SEQ ID NO:79 (DLL3#15/CD3#1), or xvi) a first polypeptide chain
comprising the amino acid sequence of SEQ ID NO:250 and a second polypeptide chain
comprising the amino acid sequence of SEQ ID NO:79 (DLL3#l6/CD3#1); or xvii) a first
polypeptide chain comprising the amino acid sequence of SEQ ID N025] and a second
polypeptide chain comprising the amino acid ce of SEQ ID NO:79
l7/CD3#1); or xviii) a first polypeptide chain comprising the amino acid sequence
of SEQ ID NO:252 and a second polypeptide chain comprising the amino acid sequence of
SEQ ID NO:79 18/CD3#1). Preferably, the first and second polypeptide chain are
linked via one or more disulfide bonds and form an antibody like structure (Figure 1)
r to a conventional Y—shaped antibody molecule.
_50_
In another preferred embodiment, the binding protein comprises a first polypeptide chain
specific for DLL3 comprising an amino acid sequence ed from the group ting
of SEQ ID NO:73, SEQ ID NO:74, and SEQ ID NO:75, and a second polypeptide chain
specific for CD3 comprising the amino acid sequence of SEQ ID NO:79.
In one preferred embodiment, the binding protein comprises a first polypeptide chain
specific for DLL3 comprising an amino acid sequence of SEQ ID NO:73 and a second
polypeptide chain specific for CD3 comprising the amino acid sequence of SEQ ID NO:79.
In one preferred embodiment, the binding protein comprises a first polypeptide chain
specific for DLL3 sing an amino acid sequence of SEQ ID NO:74 and a second
polypeptide chain specific for CD3 comprising the amino acid sequence of SEQ ID NO:79.
In one preferred ment, the binding protein comprises a first polypeptide chain
specific for DLL3 comprising an amino acid sequence of SEQ ID NO:75 and a second
polypeptide chain specific for CD3 comprising the amino acid sequence of SEQ ID NO:79.
In preferred embodiments of the invention, the binding protein comprises i) a first
ptide chain comprising the amino acid sequence of SEQ ID NO:73 and a second
polypeptide chain comprising the amino acid sequence of SEQ ID NO:80
(DLL3#1/CD3#2), or ii) a first polypeptide chain comprising the amino acid sequence of
SEQ ID NO:74 and a second polypeptide chain comprising the amino acid sequence of
SEQ ID NO:80 (DLL3#2/CD3#2), or iii) a first polypeptide chain comprising the amino
acid ce of SEQ ID NO:75 and a second polypeptide chain comprising the amino
acid ce of SEQ ID NO:80 (DLL3#3/CD3#2), or iv) a first polypeptide chain
comprising the amino acid sequence of SEQ ID NO:76 and a second polypeptide chain
comprising the amino acid sequence of SEQ ID NO:80 (DLL3#4/CD3#2), or V) a first
polypeptide chain comprising the amino acid sequence of SEQ ID NO:77 and a second
ptide chain comprising the amino acid sequence of SEQ ID NO:80
/CD3#2), or vi) a first polypeptide chain comprising the amino acid sequence of
SEQ ID NO:78 and a second polypeptide chain comprising the amino acid sequence of
SEQ ID NO:80 6/CD3#2); or vii) a first ptide chain comprising the amino
acid sequence of SEQ ID NO:241 and a second polypeptide chain comprising the amino
acid sequence of SEQ ID NO:80 (DLL3#7/CD3#2); or viii) a first polypeptide chain
comprising the amino acid sequence of SEQ ID NO:242 and a second polypeptide chain
comprising the amino acid sequence of SEQ ID NO:80 (DLL3#8/CD3#2); or ix) a first
_51_
polypeptide chain comprising the amino acid ce of SEQ ID NO:243 and a second
polypeptide chain comprising the amino acid sequence of SEQ ID NO:80
(DLL3#9/CD3#2); or x) a first polypeptide chain comprising the amino acid sequence of
SEQ ID NO:244 and a second polypeptide chain sing the amino acid sequence of
SEQ ID NO:80 (DLL3#10/CD3#2); or xi) a first polypeptide chain comprising the amino
acid sequence of SEQ ID NO:245 and a second ptide chain comprising the amino
acid sequence of SEQ ID NO:80 (DLL3#11/CD3#2); or xii) a first ptide chain
sing the amino acid sequence of SEQ ID NO:246 and a second polypeptide chain
comprising the amino acid ce of SEQ ID NO:80 (DLL3#l2/CD3#2); or xiii) a first
polypeptide chain comprising the amino acid sequence of SEQ ID NO:247 and a second
polypeptide chain comprising the amino acid sequence of SEQ ID NO:80
(DLL3#l3/CD3#2); or xiv) a first polypeptide chain sing the amino acid ce
of SEQ ID NO:248 and a second ptide chain comprising the amino acid sequence of
SEQ ID NO:80 (DLL3#14/CD3#2); or xv) a first polypeptide chain comprising the amino
acid sequence of SEQ ID NO:249 and a second polypeptide chain comprising the amino
acid sequence of SEQ ID NO:80 (DLL3#15/CD3#2), or xvi) a first polypeptide chain
comprising the amino acid sequence of SEQ ID NO:250 and a second polypeptide chain
comprising the amino acid sequence of SEQ ID NO:80 (DLL3#16/CD3#2); or xvii) a first
polypeptide chain comprising the amino acid sequence of SEQ ID NO:251 and a second
polypeptide chain comprising the amino acid sequence of SEQ ID NO:80
(DLL3#l7/CD3#2); or xviii) a first polypeptide chain comprising the amino acid sequence
of SEQ ID NO:252 and a second polypeptide chain comprising the amino acid sequence of
SEQ ID NO:80 (DLL3#l8/CD3#2). Preferably, the first and second polypeptide chain are
linked via one or more disulfide bonds and form an antibody like structure (Figure 1)
similar to a conventional Y—shaped antibody le.
In another preferred embodiment, the binding protein comprises a first polypeptide chain
specific for DLL3 comprising an amino acid sequence selected from the group consisting
of SEQ ID NO:73, SEQ ID NO:74, and SEQ ID NO:75, and a second polypeptide chain
Specific for CD3 comprising the amino acid sequence of SEQ ID NO:80.
In one preferred embodiment, the binding protein comprises a first ptide chain
specific for DLL3 comprising an amino acid sequence of SEQ ID NO:73 and a second
polypeptide chain specific for CD3 comprising the amino acid sequence of SEQ ID NO:80.
_52_
In one red embodiment, the binding protein comprises a first polypeptide chain
specific for DLL3 comprising an amino acid sequence of SEQ ID NO:74 and a second
polypeptide chain Specific for CD3 comprising the amino acid sequence of SEQ ID NO:80.
In one preferred embodiment, the binding protein comprises a first ptide chain
specific for DLL3 comprising an amino acid sequence of SEQ ID NO:75 and a second
polypeptide chain specific for CD3 comprising the amino acid sequence of SEQ ID NO:80.
In preferred embodiments of the invention, the binding protein comprises i) a first
polypeptide chain comprising the amino acid sequence of SEQ ID NO:73 and a second
polypeptide chain comprising the amino acid sequence of SEQ ID NO:105
(DLL3#1/CD3#3), or ii) a first polypeptide chain comprising the amino acid sequence of
SEQ ID NO:74 and a second polypeptide chain comprising the amino acid sequence of
SEQ ID NO:105 (DLL3#2/CD3#3), or iii) a first polypeptide chain comprising the amino
acid sequence of SEQ ID NO:75 and a second polypeptide chain comprising the amino
acid sequence of SEQ ID NO:105 (DLL3#3/CD3#3), or iv) a first polypeptide chain
comprising the amino acid sequence of SEQ ID NO:76 and a second polypeptide chain
comprising the amino acid sequence of SEQ ID NO:105 4/CD3#3), or V) a first
polypeptide chain comprising the amino acid ce of SEQ ID NO:77 and a second
polypeptide chain comprising the amino acid sequence of SEQ ID NO:105
(DLL3#5/CD3#3), or Vi) a first polypeptide chain comprising the amino acid sequence of
SEQ ID NO:78 and a second polypeptide chain comprising the amino acid sequence of
SEQ ID NO:105 (DLL3#6/CD3#3); or Vii) a first polypeptide chain sing the amino
acid sequence of SEQ ID NO:241 and a second polypeptide chain comprising the amino
acid sequence of SEQ ID NO:105 (DLL3#7/CD3#3); or Viii) a first polypeptide chain
comprising the amino acid ce of SEQ ID NO:242 and a second ptide chain
comprising the amino acid sequence of SEQ ID NO:105 (DLL3#8/CD3#3); or ix) a first
polypeptide chain comprising the amino acid sequence of SEQ ID NO:243 and a second
polypeptide chain comprising the amino acid sequence of SEQ ID NO:105
(DLL3#9/CD3#3); or x) a first polypeptide chain comprising the amino acid sequence of
SEQ ID NO:244 and a second polypeptide chain sing the amino acid sequence of
SEQ ID NO: 105 (DLL3#10/CD3#3); or xi) a first polypeptide chain comprising the amino
acid sequence of SEQ ID NO:245 and a second polypeptide chain sing the amino
acid sequence of SEQ ID NO:105 11/CD3#3); or xii) a first ptide chain
comprising the amino acid sequence of SEQ ID NO:246 and a second polypeptide chain
_53_
comprising the amino acid sequence of SEQ ID NO:105 (DLL3#12/CD3#3); or xiii) a first
polypeptide chain comprising the amino acid sequence of SEQ ID NO:247 and a second
polypeptide chain comprising the amino acid sequence of SEQ ID NO:105
(DLL3#l3/CD3#3); or xiv) a first polypeptide chain sing the amino acid sequence
of SEQ ID NO:248 and a second polypeptide chain comprising the amino acid sequence of
SEQ ID NO:105 (DLL3#l4/CD3#3); or xv) a first polypeptide chain comprising the amino
acid sequence of SEQ ID NO:249 and a second polypeptide chain comprising the amino
acid sequence of SEQ ID NO:105 15/CD3#3), or xvi) a first polypeptide chain
comprising the amino acid ce of SEQ ID NO:250 and a second polypeptide chain
comprising the amino acid ce of SEQ ID NO:105 l6/CD3#3); or xvii) a
first polypeptide chain comprising the amino acid sequence of SEQ ID NO:251 and a
second polypeptide chain comprising the amino acid sequence of SEQ ID NO:105
(DLL3#l7/CD3#3); or xviii) a first ptide chain comprising the amino acid sequence
of SEQ ID NO:252 and a second polypeptide chain comprising the amino acid sequence of
SEQ ID NO:105 (DLL3#l8/CD3#3). Preferably, the first and second polypeptide chain
are linked via one or more disulfide bonds and form an antibody like structure (Figure 1)
similar to a conventional Y-shaped antibody molecule.
In another preferred embodiment, the binding protein comprises a first polypeptide chain
c for DLL3 comprising an amino acid sequence selected from the group consisting
of SEQ ID NO:73, SEQ ID NO:74, and SEQ ID NO:75, and a second polypeptide chain
specific for CD3 comprising the amino acid sequence of SEQ ID NO:105.
In one preferred embodiment, the binding protein comprises a first polypeptide chain
specific for DLL3 comprising an amino acid sequence of SEQ ID NO:73 and a second
polypeptide chain specific for CD3 comprising the amino acid sequence of SEQ ID
NO:105.
In one red embodiment, the binding protein comprises a first polypeptide chain
specific for DLL3 sing an amino acid sequence of SEQ ID NO:74 and a second
polypeptide chain specific for CD3 comprising the amino acid sequence of SEQ ID
NO:105.
In one preferred ment, the binding protein ses a first polypeptide chain
specific for DLL3 comprising an amino acid sequence of SEQ ID NO:75 and a second
_54_
polypeptide chain specific for CD3 comprising the amino acid sequence of SEQ ID
NO:105.
For all of the above ments it shall be understood that, by using the term
"comprising", it is intended to also include an ment in which the respective domain
or molecule "consists of’ the amino acid sequence as indicated.
In a further aspect, the present invention provides a protein comprising a first polypeptide
chain specifically binding to DLL3 and a second ptide chain specifically binding to
CD3, wherein the first chain comprises a first light chain covalently linked (e. g. ly
bound) to a first linker, which is itself covalently linked (e. g. directly bound) to a first
heavy chain, and wherein the second chain Specifically binding to CD3 ses a second
light chain covalently linked (e.g. directly bound) to a second linker, which is itself
covalently linked (e.g. directly bound) to a second heavy chain.
In some embodiments, starting from its N—terminus, the first polypeptide chain ses a
first light chain variable region cally g to DLL3, a first light chain constant
region, a first linker, a first heavy chain variable region specific for DLL3 and a first heavy
chain constant region. In some embodiments, ng from its N—terminus, the second
polypeptide chain comprises a second light chain variable region specifically binding to
CD3, a second light chain constant region, a second linker, a second heavy chain variable
region Specific for CD3 and a second heavy chain constant region.
The resulting proteins bear a full PC, which is marginally larger than an IgG and has two
independent binding sites (e.g., each binding site being monovalent for the respective
antigen), a first binding site for DLL3 and a second binding site for CD3. Preferably, the
first and second polypeptide chain are linked via one or more disulfide bonds. As such, the
ns of the invention are antibody-like structures, having the Y shaped structure of a
conventional full length antibody (see Figure 1). This bispecific format greatly reduces
heterogeneity after expression and purification (e.g. by avoiding mispairing of light and
heavy variable domains with different g specificities), while maintaining the
functional properties of the binding moieties within a structure less likely to generate
unwanted immunogenic reactions. This also enables good expression of heterodimeric
proteins, e.g. in mammalian cells.
In some ments of the protein of the invention, the first polypeptide chain
specifically binding to DLL3 comprises a first light chain variable domain and a first heavy
_55_
chain variable domain, which comprise CDR sequences selected from the group consisting
ofi) to xviii):
i) light chain CDRs comprising the amino acid sequences of SEQ ID NO:1 (CDRI),
SEQ ID NO:2 (CDR2) and SEQ ID NO:3 (CDR3) and a heavy chain CDRs com-
prising the amino acid sequences of SEQ ID NO:4 (CDRl), SEQ ID NO:5
(CDR2) and SEQ ID NO:6 ;
ii) light chain CDRs comprising the amino acid sequences of SEQ ID NO:7 (CDRl),
SEQ ID N028 (CDR2) and SEQ ID NO:9 (CDR3) and heavy chain CDRs
comprising the amino acid sequences of SEQ ID NO: 10 (CDRl), SEQ ID NO: 11
(CDR2) and SEQ ID NO:12 (CDR3);
iii) light chain CDRs comprising the amino acid sequences of SEQ ID NO:l3
(CDRI), SEQ ID NO: 14 (CDR2) and SEQ ID NO:15 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO: 16 (CDRl), SEQ ID
NO:l7 (CDR2) and SEQ ID NO:18 (CDR3);
iv) light chain CDRs comprising the amino acid sequences of SEQ ID NO:l9
(CDRl), SEQ ID NO:20 (CDR2) and SEQ ID NO:21 (CDR3) and heavy chain
CDRs comprising the amino acid ces of SEQ ID NO:22 (CDRl), SEQ ID
NO:23 (CDR2) and SEQ ID NO:24 (CDR3);
v) light chain CDRs comprising the amino acid sequences of SEQ ID NO:25
(CDRl), SEQ ID NO:26 (CDR2) and SEQ ID NO:27 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO:28 (CDRl), SEQ ID
NO:29 (CDR2) and SEQ ID NO:30 (CDR3); and
vi) light chain CDRs comprising the amino acid sequences of SEQ ID NO:31
(CDRI), SEQ ID NO:32 (CDR2) and SEQ ID NO:33 (CDR3) and heavy chain
CDRs ising the amino acid ces of SEQ ID NO:34 (CDRl), SEQ ID
NO:35 (CDR2) and SEQ ID NO:36 (CDR3);
vii) light chain CDRs comprising the amino acid sequences of SEQ ID NO: 133
(CDRl), SEQ ID NO:134 (CDR2) and SEQ ID NO:135 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO:l36 (CDRl), SEQ ID
NO:137 (CDR2) and SEQ ID NO: 138 (CDR3);
—56—
viii) light chain CDRs comprising the amino acid sequences of SEQ ID NO: 139
(CDRl), SEQ ID NO: 140 (CDR2) and SEQ ID NO: 141 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO:142 (CDRl), SEQ ID
NO:143 (CDR2) and SEQ ID NO: 144 (CDR3);
ix) light chain CDRs sing the amino acid sequences of SEQ ID NO: 145
(CDRl), SEQ ID NO: 146 (CDR2) and SEQ ID NO: 147 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO: 148 (CDRl), SEQ ID
NO:149 (CDR2) and SEQ ID NO:150 (CDR3);
light chain CDRs comprising the amino acid sequences of SEQ ID NO: 151
, SEQ ID NO: 152 (CDR2) and SEQ ID NO: 153 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO: 154 (CDRl), SEQ ID
NO:155 (CDR2) and SEQ ID NO: 156 (CDR3);
Xi) light chain CDRs comprising the amino acid sequences of SEQ ID NO: 157
(CDRl), SEQ ID NO: 158 (CDR2) and SEQ ID NO: 159 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO: 160 (CDRl), SEQ ID
NO:161 (CDR2) and SEQ ID NO: 162 (CDR3);
xii) light chain CDRs comprising the amino acid sequences of SEQ ID NO: 163
(CDRl), SEQ ID NO: 164 (CDR2) and SEQ ID NO: 165 (CDR3) and heavy chain
CDRs comprising the amino acid ces of SEQ ID NO:166 (CDRl), SEQ ID
NO:167 (CDR2) and SEQ ID NO:168 (CDR3);
xiii) light chain CDRs comprising the amino acid sequences of SEQ ID NO: 169
(CDRl), SEQ ID NO:170 (CDR2) and SEQ ID NO: 171 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO: 172 , SEQ ID
NO:173 (CDR2) and SEQ ID NO: 174 (CDR3);
xiv) comprising light chain CDRs comprising the amino acid sequences of SEQ ID
NO:175 (CDRl), SEQ ID NO: 176 (CDR2) and SEQ ID NO: 177 (CDR3) and
heavy chain CDRs comprising the amino acid sequences of SEQ ID NO: 178
(CDRl), SEQ ID NO: 179 (CDR2) and SEQ ID NO: 180 (CDR3);
xv) light chain CDRs comprising the amino acid sequences of SEQ ID NO: 181
(CDRl), SEQ ID NO:182 (CDR2) and SEQ ID NO: 183 (CDR3) and heavy chain
_57_
WO 34220
CDRs comprising the amino acid sequences of SEQ ID NO:184 (CDRl), SEQ ID
NO:185 (CDR2) and SEQ ID NO:186 (CDR3);
xvi) light chain CDRs comprising the amino acid ces of SEQ ID NO: 187
(CDRl), SEQ ID NO:188 (CDR2) and SEQ ID NO: 189 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO: 190 (CDRl), SEQ ID
NO:191 (CDR2) and SEQ ID NO:192 (CDR3);
xvii) light chain CDRs comprising the amino acid sequences of SEQ ID NO: 193
(CDRl), SEQ ID NO:194(CDR2) and SEQ ID NO:195 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO: 196 (CDRl), SEQ ID
NO:197 (CDR2) and SEQ ID NO: 198 (CDR3); and
xviii) light chain CDRs comprising the amino acid sequences of SEQ ID NO: 199
(CDRl), SEQ ID NO:200 (CDR2) and SEQ ID NO:201 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO:202 (CDRl), SEQ ID
NO:203 (CDR2) and SEQ ID NO:204 (CDR3).
The respective light/heavy chain variable domains defined by these CDR sequences are
termed DLL3#1, DLL3#2, DLL3#3, DLL3#4, DLL3#5, DLL3#6, , DLL3#8,
DLL3#9, 0, DLL3#11, DLL3#12, 3, DLL3#14, DLL3#15, DLL3#16,
DLL3#17, and DLL3#18, respectively. Preferably, the CDR sequences are selected from
the group consisting of i) to iii) (DLL3#1, DLL3#2, DLL3#3) as defined above.
In preferred embodiments of the binding protein of the invention, said second polypeptide
chain specifically binding to CD3 comprises a second light chain variable domain and
second heavy chain variable domain, which ses CDR sequences selected from the
group ting of:
i) light chain CDRs comprising the amino acid sequences of SEQ ID NO:55
(CDRl), SEQ ID NO:56 (CDR2) and SEQ ID NO:57 (CDR3) and heavy chain
CDRs com-prising the amino acid sequences of SEQ ID NO:58 (CDRl), SEQ ID
NO:59 (CDR2) and SEQ ID NO:60 (CDR3);
ii) light chain CDRs comprising the amino acid sequences of SEQ ID NO:61
(CDRl), SEQ ID NO:62 (CDR2) and SEQ ID NO:63 (CDR3) and heavy chain
CDRs ising the amino acid sequences of SEQ ID NO:64 (CDRl), SEQ ID
NO:65 (CDR2) and SEQ ID NO:66 (CDR3); and
—58—
WO 34220
iii) light chain CDRs comprising the amino acid sequences of SEQ ID NO:96
(CDRl), SEQ ID NO:97 (CDR2) and SEQ ID NO:98 (CDR3) and heavy chain
CDRS ising the amino acid sequences of SEQ ID NO:99 (CDRl), SEQ ID
N0:100 (CDR2) and SEQ ID N0:101 (CDR3).
The respective light/heavy chain variable domains defined by these CDR sequences are
termed CD3#l, CD3#2 and CD3#3, respectively.
In one preferred embodiment, the binding protein of the invention comprises (i) a first
polypeptide chain specifically binding to DLL3, comprising a first light chain variable
domain with light chain CDRs comprising the amino acid sequences of SEQ ID N021
(CDRl), SEQ ID N012 (CDR2) and SEQ ID N0:3 (CDR3) and a first heavy chain
variable domain with heavy chain CDRs comprising the amino acid sequences of SEQ ID
N024 (CDRl), SEQ ID N025 (CDR2) and SEQ ID NO:6 (CDR3); and (ii) a second
ptide chain specifically binding to CD3, comprising a second light chain variable
domain with light chain CDRs comprising the amino acid ces of SEQ ID N0:55
(CDRl), SEQ ID N0:56 (CDR2) and SEQ ID N0:57 (CDR3) and a second heavy chain
variable domain with heavy chain CDRS comprising the amino acid sequences of SEQ ID
NO:58 (CDRl), SEQ ID NO:59 (CDR2) and SEQ ID NO:60 (CDR3).
In one red embodiment, the binding protein of the ion comprises (i) a first
polypeptide chain specifically binding to DLL3, comprising a first light chain variable
domain with light chain CDRs sing the amino acid sequences of SEQ ID N027
(CDRl), SEQ ID N018 (CDR2) and SEQ ID N029 (CDR3) and a first heavy chain
variable domain with heavy chain CDRs comprising the amino acid ces of SEQ ID
NO: 10 (CDRl), SEQ ID N0: 11 (CDR2) and SEQ ID NO: 12 (CDR3); and (ii) a second
polypeptide chain specifically binding to CD3, comprising a second light chain variable
domain with light chain CDRs comprising the amino acid sequences of SEQ ID N0:55
(CDRl), SEQ ID N0:56 (CDR2) and SEQ ID N0:57 (CDR3) and a second heavy chain
variable domain with heavy chain CDRs com-prising the amino acid sequences of SEQ ID
N0258 (CDRl), SEQ ID N0:59 (CDR2) and SEQ ID NO:60 (CDR3).
In one preferred embodiment, the binding protein of the invention comprises (i) a first
polypeptide chain Specifically binding to DLL3, comprising a first light chain variable
domain with light chain CDRs comprising the amino acid sequences of SEQ ID N0:l3
(CDRl), SEQ ID NO: 14 (CDR2) and SEQ ID NO: 15 (CDR3) and a first heavy chain
_59_
variable domain with heavy chain CDRs comprising the amino acid sequences of SEQ ID
NO: 16 , SEQ ID NO: 17 (CDR2) and SEQ ID NO: 18 (CDR3); and (ii) a second
polypeptide chain specifically binding to CD3, comprising a second light chain variable
domain with light chain CDRs comprising the amino acid ces of SEQ ID NO:55
(CDRl), SEQ ID NO:56 (CDR2) and SEQ ID NO:57 (CDR3) and a second heavy chain
variable domain with heavy chain CDRs comprising the amino acid sequences of SEQ ID
NO:58 (CDRl), SEQ ID NO:59 (CDR2) and SEQ ID NO:60 (CDR3).
In one preferred embodiment, the g protein of the invention comprises (i) a first
ptide chain specifically g to DLL3, comprising a first light chain variable
domain with light chain CDRs comprising the amino acid sequences of SEQ ID NO:1
(CDRl), SEQ ID NO:2 (CDR2) and SEQ ID NO:3 (CDR3) and a first heavy chain
variable domain with heavy chain CDRs comprising the amino acid sequences of SEQ ID
NO:4 (CDRl), SEQ ID NO:5 (CDR2) and SEQ ID NO:6 (CDR3); and (ii) a second
polypeptide chain specifically binding to CD3, comprising a second light chain variable
domain with light chain CDRs comprising the amino acid ces of SEQ ID NO:61
(CDRl), SEQ ID NO:62 (CDR2) and SEQ ID NO:63 (CDR3) and a second heavy chain
variable domain with heavy chain CDRs comprising the amino acid sequences of SEQ ID
NO:64 (CDRl), SEQ ID NO:65 (CDR2) and SEQ ID NO:66 (CDR3).
In one preferred ment, the binding protein of the invention comprises (i) a first
polypeptide chain specifically binding to DLL3, comprising a first light chain variable
domain with light chain CDRs comprising the amino acid sequences of SEQ ID N027
(CDRl), SEQ ID NO:8 (CDR2) and SEQ ID NO:9 (CDR3) and a first heavy chain
variable domain with heavy chain CDRs comprising the amino acid sequences of SEQ ID
NO: 10 (CDRl), SEQ ID NO: 11 (CDR2) and SEQ ID NO:12 (CDR3); and (ii) a second
polypeptide chain specifically g to CD3, comprising a second light chain variable
domain with light chain CDRs comprising the amino acid sequences of SEQ ID NO:61
(CDRl), SEQ ID NO:62 (CDR2) and SEQ ID NO:63 (CDR3) and a second heavy chain
variable domain with heavy chain CDRs com-prising the amino acid sequences of SEQ ID
NO:64 (CDRl), SEQ ID NO:65 (CDR2) and SEQ ID NO:66 .
In one preferred embodiment, the binding protein of the invention comprises (i) a first
polypeptide chain specifically binding to DLL3, comprising a first light chain variable
domain with light chain CDRs comprising the amino acid sequences of SEQ ID NO:13
—60-
(CDRl), SEQ ID NO: 14 (CDR2) and SEQ ID NO: 15 (CDR3) and a first heavy chain
variable domain with heavy chain CDRs comprising the amino acid ces of SEQ ID
NO: 16 , SEQ ID NO: 17 (CDRZ) and SEQ ID NO:18 (CDR3); and (ii) a second
polypeptide chain specifically binding to CD3, comprising a second light chain variable
domain with light chain CDRs comprising the amino acid sequences of SEQ ID NO:61
(CDRl), SEQ ID NO:62 (CDR2) and SEQ ID NO:63 (CDR3) and a second heavy chain
variable domain with heavy chain CDRs com-prising the amino acid ces of SEQ ID
NO:64 (CDRl), SEQ ID NO:65 (CDR2) and SEQ ID NO:66 (CDR3).
In preferred embodiments of the protein of the invention, said first polypeptide chain
specifically g to DLL3 ses a light chain variable domain (a first light chain
variable domain) and a heavy chain variable domain (a first heavy chain variable domain)
selected from the group consisting of i) to xviii):
i) a light chain variable domain comprising the amino acid sequences of SEQ ID
NO:37 and heavy chain variable domain comprising the amino acid sequences of
SEQ ID NO:38 (DLL3#l);
ii) a light chain le domain comprising the amino acid sequences of SEQ ID
NO:39 and heavy chain le domain comprising the amino acid ces of
SEQ ID NO:40 (DLL3#2);
iii) a light chain variable domain comprising the amino acid sequences of SEQ ID
NO:41 and heavy chain variable domain comprising the amino acid sequences of
SEQ ID NO:42 (DLL3#3);
iv) a light chain variable domain comprising the amino acid sequences of SEQ ID
NO:43 and heavy chain variable domain comprising the amino acid sequences of
SEQ ID NO:44 (DLL3#4);
v) a light chain variable domain comprising the amino acid sequences of SEQ ID
NO:45 and heavy chain variable domain comprising the amino acid sequences of
SEQ ID NO:46 (DLL3#5);
vi) a light chain variable domain comprising the amino acid sequences of SEQ ID
NO:47 and heavy chain variable domain comprising the amino acid sequences of
SEQ ID NO:48 (DLL3#6);
—61-
2019/064942
Vii) a light chain variable domain sing the amino acid sequence of SEQ ID
NO:205 and heavy chain variable domain comprising the amino acid ce of
SEQ ID NO:206 (DLL3#7);
viii) a light chain variable domain comprising the amino acid sequence of SEQ ID
NO:207 and heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:208 (DLL3#8);
ix) a light chain variable domain comprising the amino acid ce of SEQ ID
NO:209 and heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:210 (DLL3#9);
a light chain variable domain comprising the amino acid sequence of SEQ ID
NO:211 and heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:212 (DLL3#10);
xi) a light chain variable domain comprising the amino acid sequence of SEQ ID
NO:213 and heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:214(DLL3#11);
xii) a light chain variable domain comprising the amino acid ce of SEQ ID
NO:215 and heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:216 (DLL3#12);
xiii) a light chain variable domain comprising the amino acid sequence of SEQ ID
NO:217 and heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:218 (DLL3#13);
xiv) a light chain le domain comprising the amino acid sequence of SEQ ID
NO:219 and heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:220 14);
xv) a light chain variable domain comprising the amino acid sequence of SEQ ID
NO:221 and heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:222 (DLL3#15);
xvi) a light chain variable domain comprising the amino acid sequence of SEQ ID
NO:223 and heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:224 (DLL3#16);
—62-
2019/064942
xvii) a light chain variable domain sing the amino acid sequence of SEQ ID
NO:225 and heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:226 (DLL3#17); and
xviii) a light chain variable domain sing the amino acid sequence of SEQ ID
NO:227 and heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:228 (DLL3#18).
Preferably, the light chain variable and heavy chain variable domain sequences are ed
from the group consisting of i) to iii) (DLL3#1, DLL3#2, DLL3#3) as defined above.
In preferred embodiments of the protein of the ion, said second polypeptide chain
specifically binding to CD3 comprises a light chain variable domain (a second light chain
variable domain) and a heavy chain variable domain (a second heavy chain variable
domain) selected from the group consisting of:
i) a light chain variable domain comprising the amino acid sequence of SEQ ID
NO:67 and a heavy chain variable domain comprising the amino acid sequence of
SEQ ID NOZ68 (CD3#1);
ii) a light chain variable domain comprising the amino acid sequence of SEQ ID
NO:69 and a heavy chain variable domain comprising the amino acid ce of
SEQ ID NO:70 (CD3#2); and
iii) a light chain variable domain comprising the amino acid sequence of SEQ ID
NO:102 and a heavy chain variable domain sing the amino acid sequence
of SEQ ID NO: 103 (CD3#3).
In some embodiments, the g protein of the invention comprises a first and a second
polypeptide chain comprising CDR and/or VH and VL sequences of the light/heavy chain
variable domains selected from the list consisting of DLL3#l/CD3#1, DLL3#2/CD3#1,
DLL3#3/CD3#1, DLL3#4/CD3#1, DLL3#5/CD3#1, DLL3#6/CD3#1, DLL3#7/CD3#1,
DLL3#8/CD3#1, DLL3#9/CD3#1, DLL3#10/CD3#1, DLL3#1l/CD3#1,
DLL3#12/CD3#1, DLL3#13/CD3#1, 4/CD3#1, DLL3#15/CD3#1,
DLL3#16/CD3#1, DLL3#l7/CD3#1, DLL3#18/CD3#1, DLL3#1/CD3#2,
DLL3#2/CD3#2, DLL3#3/CD3#2, DLL3#4/CD3#2, DLL3#5/CD3#2, DLL3#6/CD3#2,
DLL3#7/CD3#2, DLL3#8/CD3#2, DLL3#9/CD3#2, DLL3#lO/CD3#2, DLL3#1l/CD3#2,
DLL3#12/CD3#2, DLL3#13/CD3#2, DLL3#14/CD3#2, DLL3#15/CD3#2,
DLL3#16/CD3#2, DLL3#l7/CD3#2, 8/CD3#2, DLL3#1/CD3#3,
_63_
DLL3#2/CD3#3, DLL3#3/CD3#3, DLL3#4/CD3#3, DLL3#5/CD3#3 and
DLL3#6/CD3#3, DLL3#7/CD3#3, DLL3#8/CD3#3, DLL3#9/CD3#3, DLL3#10/CD3#3,
DLL3#1l/CD3#3, DLL3#12/CD3#3, DLL3#13/CD3#3, DLL3#14/CD3#3,
/CD3#3, DLL3#16/CD3#3, DLL3#l7/CD3#3, DLL3#18/CD3#3. In preferred
embodiments, the g protein of the ion comprises a first and a second
polypeptide chain comprising CDR and/or VH and VL sequences of the light/heavy chain
variable domains selected from the list consisting of DLL3#l/CD3#1, DLL3#2/CD3#1,
DLL3#3/CD3#1, DLL3#l/CD3#2, DLL3#2/CD3#2, DLL3#3/CD3#2, DLL3#l/CD3#3,
DLL3#2/CD3#3, and DLL3#3/CD3#3.
In one preferred embodiment, the binding protein of the invention comprises (i) a first
polypeptide chain specifically binding to DLL3, comprising a light chain variable domain
of SEQ ID NO:37 and heavy chain variable domain of SEQ ID NO:38; and (ii) a second
polypeptide chain specifically binding to CD3, comprising a light chain variable domain of
SEQ ID NO:67 and a heavy chain variable domain of SEQ ID NO:68.
In one preferred embodiment, the binding protein of the invention comprises (i) a first
polypeptide chain specifically binding to DLL3, comprising a light chain variable domain
of SEQ ID NO:39 and heavy chain variable domain of SEQ ID NO:40; and (ii) a second
polypeptide chain specifically binding to CD3, comprising a light chain variable domain of
SEQ ID NO:67 and a heavy chain variable domain of SEQ ID NO:68.
In one preferred embodiment, the binding protein of the invention comprises (i) a first
polypeptide chain specifically binding to DLL3, comprising a light chain variable domain
of SEQ ID NO:41 and heavy chain variable domain of SEQ ID NO:42; and (ii) a second
polypeptide chain specifically binding to CD3, comprising a light chain variable domain of
SEQ ID NO:67 and a heavy chain variable domain of SEQ ID NO:68.
In one preferred embodiment, the g protein of the ion ses (i) a first
polypeptide chain specifically binding to DLL3, sing a light chain variable domain
of SEQ ID N037 and heavy chain variable domain of SEQ ID NO:3 8; and (ii) a second
ptide chain specifically binding to CD3, comprising a light chain le domain of
SEQ ID NO:69 and a heavy chain le domain of SEQ ID NO:70.
In one preferred embodiment, the binding protein of the invention comprises (i) a first
polypeptide chain specifically binding to DLL3, comprising a light chain variable domain
of SEQ ID N039 and heavy chain variable domain of SEQ ID NO:40; and (ii) a second
—64-
polypeptide chain specifically binding to CD3, comprising a light chain variable domain of
SEQ ID NO:69 and a heavy chain variable domain of SEQ ID NO:70.
In one red embodiment, the g n of the invention comprises (i) a first
polypeptide chain specifically binding to DLL3, comprising a light chain variable domain
of SEQ ID NO:41 and heavy chain le domain of SEQ ID NO:42; and (ii) a second
polypeptide chain specifically binding to CD3, comprising a light chain variable domain of
SEQ ID NO:69 and a heavy chain variable domain of SEQ ID NO:70.
In some embodiments of the invention, the first and/or the second linker peptide comprise
a linker as described above, e. g. a linker derived from a hinge region, a poly-alanine linker
or a Gly/Ser linker, wherein the linker comprises 26 to 42 amino acids, for example any
one of 30 to 40 amino acids, 34 to 40 amino acids, or 36 to 39 amino acids, preferably 38
amino acids.
In preferred embodiments, the first polypeptide chain specific for DLL3 comprises the
amino acid sequence of any one of SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:51, SEQ
ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:229, SEQ ID , SEQ ID
NO:231, SEQ ID NO:232, SEQ ID NO:233, SEQ ID NO:234, SEQ ID NO:235, SEQ ID
NO:236, SEQ ID NO:237, SEQ ID NO:238, SEQ ID NO:239, or SEQ ID NO:240 and the
second polypeptide chain specific for CD3 comprises the amino acid sequence of SEQ ID
NO:7l.
In some embodiments, the first ptide chain specific for DLL3 comprises the amino
acid sequence of any one of SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:51, SEQ ID
NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:229, SEQ ID NO:230, SEQ ID
NO:231, SEQ ID NO:232, SEQ ID NO:233, SEQ ID NO:234, SEQ ID , SEQ ID
NO:236, SEQ ID NO:237, SEQ ID , SEQ ID NO:239, or SEQ ID NO:240 and the
second polypeptide chain specific for CD3 comprises the amino acid sequence of SEQ ID
NO:72.
In some embodiments, the first polypeptide chain specific for DLL3 comprises the amino
acid ce of any one of SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:51, SEQ ID
NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:229, SEQ ID NO:230, SEQ ID
NO:231, SEQ ID NO:232, SEQ ID NO:233, SEQ ID NO:234, SEQ ID NO:235, SEQ ID
NO:236, SEQ ID NO:237, SEQ ID NO:23 8, SEQ ID NO:239, or SEQ ID NO:240 and the
—65—
second ptide chain specific for CD3 comprises the amino acid sequence of SEQ ID
NO:104.
In one preferred embodiment, the first polypeptide chain specific for DLL3 comprises the
amino acid sequence of SEQ ID NO:49 and the second polypeptide chain specific for CD3
comprises the amino acid sequence of SEQ ID NO:71.
In one preferred embodiment, the first polypeptide chain specific for DLL3 comprises the
amino acid sequence of SEQ ID NO:50 and the second polypeptide chain specific for CD3
comprises the amino acid sequence of SEQ ID NO:71.
In one preferred ment, the first ptide chain specific for DLL3 comprises the
amino acid ce of SEQ ID NO:51 and the second polypeptide chain specific for CD3
comprises the amino acid sequence of SEQ ID NO:71.
In one preferred embodiment, the first polypeptide chain specific for DLL3 comprises the
amino acid sequence of SEQ ID NO:49 and the second polypeptide chain specific for CD3
comprises the amino acid sequence of SEQ ID NO:72.
In one preferred embodiment, the first polypeptide chain specific for DLL3 comprises the
amino acid sequence of SEQ ID NO:50 and the second polypeptide chain specific for CD3
comprises the amino acid sequence of SEQ ID NO:72.
In one preferred embodiment, the first polypeptide chain specific for DLL3 comprises the
amino acid sequence of SEQ ID NO:51 and the second polypeptide chain specific for CD3
comprises the amino acid sequence of SEQ ID NO:72.
In some embodiments of binding protein of the invention, the first and second polypeptide
chain comprises an EC domain derived from the heavy chain of an IgG, for example an
IgGl, IgG2 or IgG4. For example, an EC domain of the t invention is a PC domain of
a heavy chain of an IgGl or IgG4 and comprises a hinge region and two constant domains
(CH2 and CH3). Examples of Fc domains ofhuman IgGs are shown in SEQ ID NO:81 and
In some embodiments of the binding protein of the invention, the heavy chain comprises
one or more amino acid changes. For example, such amino acid changes are a ne (Y)
at position 366 ] of the first heavy chain and a threonine (T) at position 407
[Y407T] of the second heavy chain. In some ments, the first heavy chain comprises
a serine (S) at on 366 [T3 66S] and the second heavy chain comprises a tryptophan
—66-
(W) at position 366 [T366W], an alanine (A) at position 368 [L368A] and a valine (V) at
position 407 [Y407V]. In preferred embodiments, the first heavy chain comprises a
tryptophan (W) at position 366 [T366W] and the second heavy chain comprises a serine
(S) at position 366 [T366S], an alanine (A) at on 368 [L368A] and a valine (V) at
position 407 [Y407V]. For example, position 366 of the Fc domain according to EU
numbering, corresponding to the amino acid position 146 in the human IgG1 Fc sequence
of SEQ ID NO:81, is changed from T at position 146 in SEQ ID NO:81 to W at position
146 in SEQ ID NO:82; and positions 366, 368 and 407 according to EU numbering,
ponding to the amino acid positions 146, 148 and 187, respectively, in SEQ ID
NO:81, are changed from T, L and Y at these positions in SEQ ID NO:81 to S, A and V at
these positions in SEQ ID NO:83. In any of these embodiments, the amino acid changes
described for the first heavy chain may be located in the second heavy chain and the
respective amino acid changes for the second heavy chain may be located in the first heavy
chain. In other words, the term “first” and “second” can be ged in these
embodiments. In some embodiments, the heavy chain is derived from the heavy chain of
an IgG1 or IgG4.
In some embodiments, the first heavy chain or the second heavy chain in a protein of the
present invention further comprises one or more amino acid changes which reduce the
binding of the heavy chain to protein A. In some embodiments, such amino acid changes
are an arginine at position 435 [H435R] and a phenylalanine at position 436 [Y436F] of
one of the heavy chains.
In some embodiments, in a protein of the present invention, the heavy chain, which
comprises a threonine (T) at position 407 [Y407T], further ses an ne at
on 435 [H43 SR] and a phenylalanine at position 436 [Y43 6F]. In this case, the other
heavy chain comprises a ne (Y) at position 366 [T366Y], but does not include the
two changes at positions 435 and 43 6. atively, in some embodiments, in a protein of
the present invention, the heavy chain, which comprises a serine (S) at position 366
[T3 66S], an alanine (A) at position 368 [L368A] and a valine (V) at position 407 [Y407V],
further comprises an arginine at position 435 [H435R] and a phenylalanine at position 436
[Y436F]. In this case, the other heavy chain comprises a tryptophan (W) at position 366
[T3 66W], but does not include the two changes at ons 435 and 436. Thus, the heavy
chain sing the amino acid change resulting in a “cavity” as bed above also
comprises the amino acid changes, which reduce binding to n A. Homodimers
—67—
comprising these heavy chains are removed through reduced binding to Protein A. The
production of homodimers of the other heavy chain, which ses the “protrusion”, is
reduced by the presence of the “protrusion”.
In some embodiments, the heavy chain of a protein of the present invention may or may
not further comprise YTE mutations (M252Y/SZS4T/T25 6E, EU numbering (Dall'Acqua,
Kiener et a1. 2006)). These mutations have been shown to improve the pharmacokinetic
properties of heavy chain through ential enhancement of g affinity for neonatal
FcRn receptor at pH 6.0.
In some embodiments, the first and/or the second heavy chain of the present invention
derived from an IgGl also includes the “KO” mutations (L234A, L235A). In a further
aspect, the first and/or the second heavy chain of the present invention derived from an
IgG4 also includes the Pro hinge mutation (SZ28P).
In a further aspect, the proteins of the invention comprise a first antigen binding unit or
polypeptide chain c for DLL3 with an affinity of preferably 3 lOnM, more
preferably S_lnM, even more preferable S 0.1nM, even more preferably £0.01 nM to
human and cynomolgus monkey DLL3. The affinity can be measured in a SPR (BIAcore)
assay using recombinant DLL3 -protein, as described, e. g. in the examples or other methods
that are well known for the skilled person. The proteins comprise a second antigen binding
unit or polypeptide chain with an y of ably 5500 nM, more preferably 5 100
nM, even more preferably 3 10 nM to human and cynomolgus monkey CD3EV complex.
In a r aspect, the DLL3/CD3 binding proteins of the invention do not bind to DLL3-
negative cells and do not cross-react with the human and DLL3 paralogues DLLl and
DLL4, as shown in Example 5.
In a further aspect, the DLL3/CD3 binding proteins of the present invention comprise a
first antigen binding unit or a first ptide chain cally binding to the membrane
al peptide of the DLL3 protein. In a further aspect, the proteins of the invention
display weak binding to DLL3 protein expressing cells, e. g. no saturation of protein
binding to the cell surface is achieved up to a concentration of 100 nM (see e. g. Figure 6).
In a r aspect, the DLL3/CD3 binding proteins of the present invention are capable of
ing cytotoxicity against tumor cells by providing optimal steric conditions for the
formation of a tic synapse n a tumor cell expressing DLL3 and a T cell, in
—68-
order to redirect the T cell activity selectively to the targeted tumor cells, leading to tumor
cell lysis.
Various methods can be used to measure the cytotoxicity mediated by the DLL3/CD3
binding proteins of the present invention. For example, xicity can be measured using
the method described in example 10. Effector cells can be e.g. stimulated or unstimulated
(human or cynomolgus monkey) T cells or their subsets (e. g. CD4, CD8) or unstimulated
(human or cynomolgus monkey) peripheral blood clear cells ). The target
cells should express at least the extracellular domain of (human or cynomolgus monkey)
DLL3 and can be cells with endogenous (natural) DLL3 sion, such as human small
cell lung carcinoma cell lines SHP77, NCI-H82, alternatively also recombinant cells that
s either the full-length DLL3 or the ellular domain of DLL3. The effector to
target cell ratio (ET) is usually about 10:1 but can vary. Cytotoxic activity of DLL3/CD3
binding molecules can be determined e. g. in a LDH—release assay after 48 or 72 hours of
incubation. Modifications in incubation time and read-out used for determination of
cytotoxicity are possible and known to the skilled person. Read—out systems for
cytotoxicity can comprise MTT/MTS assays, ATP-based , FACS-based assays, 51-
um release assays, sulforhodamine B (SRB) assays, colorimetric (WST) assays,
clonogenic assays, ECIS technology and bioluminescent assays.
The cytotoxic activity mediated by D3 binding proteins of the t invention is
preferably measured in a cell—based cytotoxicity assay. The cytotoxicity is represented by
the EC90 values measured in the cytotoxicity assay. The skilled person is aware that an
EC90 can be expected to be lower when purified T cells are used as effector cells,
compared with PBMCs, the skilled person is also aware that the EC90 can be even lower
when stimulated T cells are used. It can rmore expected that the EC90 values are
lower when the target cells express a high number of DLL3 on the cell surface compared to
cell expressing a low number of DLL3 molecules on the cell surface. The EC90 of the
DLL3/CD3 binding protein is preferably 5 10 nM, more preferably 5 5 nM and even more
preferablyg 1 nM.
Preferably, the multi-specific binding proteins of the invention do not induce/mediate lysis
ofDLL3 negative cells. The term “do not induce/mediate lysis” of egative cells
means that an DLL3/CD3 binding molecule does not induce or mediate lysis of more than
%, ably not more than 20%, more preferably not more than 10% and particular not
—69-
more than 5% or DLL3-negative cells, s lysis of the DLL3 -positive lung carcinoma
cell line is set to be 100%. This usually applies for concentrations of the binding protein of
up to 1000 nM.
Preferably, the DLL3/CD3 binding proteins of the invention are not alized by the
targeted cells. The rate of internalization can be assayed e. g. as described in Example 11.
Preferably, the internalization rate (e.g. measured as a decrease in cytotoxicity) is S 50%
after a 4 hour pre-incubation of the DLL3/CD3 binding proteins with the target cells, more
ably 5 40% and even more preferably 33 0%.
Furthermore, the DLL3/CD3 binding proteins of the invention are shown to be stable with
a monomer content above 95% (e.g., at least 98%, see example 14), have favorable
pharmacokinetic properties and good downstream manufacturability and are further
ed to have good bio—distribution (see e.g., example 12). The proteins of the present
invention furthermore have a favorable immunogenicity profile (see example 16) and have
good stability in—vitro and o (see e.g., examples 12 and 15). Furthermore, the
DLL3/CD3 binding proteins of the invention (e.g., /CD3#1, DLL3#3/CD3#2)
show ble efficacy in a humanized in viva xenograft mouse model. DLL3/CD3
binding proteins induced strong tumor regression starting already after the first dose of
DLL3/CD3 binding proteins. Furthermore the DLL3/CD3 binding ns of the invention
induce tumor regression at very low doses of 0.25 mg/kg administered once weekly (q7d),
r supporting their eutic applicability. In particular, the DLL3/CD3 binding
proteins of the ion induce selective T cell proliferation, T cell tion, T cell
degranulation and cytokine secretion (see example 18) only in the presence of DLL3-
positive target cells and not in the presence of DLL3-negative target cells, and r
significantly increase T cell infiltration into tumor tissue (see example 20). Furthermore
example 19 demonstrates that DLL3/CD3 binding ns mediate CD4+ as well as CD8+
T cell redirected lysis. In particular, na'ive T cells as well as CD4+ effector memory, CD4+
central memory, CD8+CD45RA+ effector and CD8+ memory cells contribute to the T cell
redirected lysis of DLL3 —expression tumor cells.
A further aspect of the present invention provides isolated nucleic acid molecules encoding
the first and/or the second n binding unit of a multi-specific binding protein of the
invention. In some embodiments, the nucleic acid molecules further encode a first and/or a
second Fc domain as described herein, the first and/or second Fc domain linked to the 3’
_70_
end of the nucleic acid le encoding the first and/or second antigen binding unit,
tively. In some embodiments, the nucleic acid molecule encodes i) a first
polypeptide chain comprising a first single chain Fab specific for DLL3 (e.g. any one of
DLL3#1, DLL3#2, DLL3#3, DLL3#4, DLL3#5, DLL3 #6, DLL3#7, DLL3#8, DLL3#9,
0, DLL3#11, DLL3#12, DLL3#13, DLL3#14, DLL3#15, DLL3#16, DLL3#17
and DLL3#18), and optionally a first PC domain and/or ii) a second polypeptide chain
comprising a second single chain Fab specific for CD3 (e. g., any one of CD3#1, CD3#2
and CD3#3) and optionally a second Fc domain.
Preferably the nucleic acid molecule comprises a nucleotide ce encoding a first
single chain Fab of any one of SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:51, SEQ ID
NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:229, SEQ ID NO:230, SEQ ID
NO:231, SEQ ID NO:232, SEQ ID NO:233, SEQ ID NO:234, SEQ ID NO:235, SEQ ID
NO:236, SEQ ID NO:237, SEQ ID NO:238, SEQ ID NO:239, or SEQ ID NO:240 and/or
a second single chain Fab of SEQ ID NO:71, SEQ ID NO:72 or SEQ ID NO: 104. In some
embodiments, the nucleic acid molecule ses a nucleotide sequence encoding a first
polypeptide chain of any one of SEQ ID NO:73, SEQ ID NO:74, SEQ ID NO:75, SEQ ID
NO:76, SEQ ID NO:77, SEQ ID NO:78, SEQ ID NO:241, SEQ ID NO; 242, SEQ ID
NO:243, SEQ ID NO:244, SEQ ID NO: 245, SEQ ID NO: 246, SEQ ID NO: 247, SEQ ID
NO: 248, SEQ ID NO: 249, SEQ ID NO: 250, SEQ ID NO: 251, or SEQ ID NO: 252
and/or a second polypeptide chain specific for CD3 comprising the amino acid sequence of
SEQ ID NO:79, SEQ ID NO:80 or SEQ ID NO: 105.
A further aspect of the invention es an expression vector containing a DNA
molecule comprising the nucleotide sequence encoding the first and/or second antigen
binding domain (e.g. a first and/or second single chain Fab of the ion). Preferably
the expression vector ses, in addition, a nucleic acid molecule, preferably a DNA
molecule, encoding a first and/or second Fc domain, linked to the nucleic acid molecule,
preferably the DNA le, encoding the first and/or second antigen binding domain
(e.g. first and/or second single chain Fab, respectively). As such, the expression vector
comprises a nucleotide ce encoding a polypeptide chain comprising a first single
chain Fab linked to a first Fc domain and/or a nucleotide sequence encoding a polypeptide
chain comprising a second single chain Fab linked to a second Fc domain.
_71_
In a red embodiment, the expression vector contains a DNA molecule comprising the
nucleotide ce ng the first and/or the second polypeptide chain of the
invention. In a preferred embodiment, the expression vector comprises the nucleotide
sequence encoding a first polypeptide chain of in any one of SEQ ID NO:73, SEQ ID
NO:74, SEQ ID NO:75, SEQ ID NO:76, SEQ ID NO:77, SEQ ID NO:78, SEQ ID
NO:241, SEQ ID NO; 242, SEQ ID NO:243, SEQ ID NO:244, SEQ ID NO: 245, SEQ ID
NO: 246, SEQ ID NO: 247, SEQ ID NO: 248, SEQ ID NO: 249, SEQ ID NO: 250, SEQ
ID NO: 251, or SEQ ID NO: 252 and/or a second polypeptide chain comprising SEQ ID
NO:79.
In further preferred embodiments, the expression vector comprises the nucleotide sequence
encoding a first polypeptide chain of any one of SEQ ID NO:73, SEQ ID NO:74, SEQ ID
NO:75, SEQ ID NO:76, SEQ ID NO:77, SEQ ID NO:78, SEQ ID NO:241, SEQ ID NO;
242, SEQ ID NO:243, SEQ ID NO:244, SEQ ID NO: 245, SEQ ID NO: 246, SEQ ID NO:
247, SEQ ID NO: 248, SEQ ID NO: 249, SEQ ID NO: 250, SEQ ID NO: 251, or SEQ ID
NO: 252 and/or a second polypeptide chain sing SEQ ID NO:80.
In further red embodiments, the expression vector comprises the nucleotide sequence
encoding a first polypeptide chain of any one of SEQ ID NO:73, SEQ ID NO:74, SEQ ID
NO:75, SEQ ID NO:76, SEQ ID NO:77, SEQ ID NO:78, SEQ ID NO:241, SEQ ID NO;
242, SEQ ID NO:243, SEQ ID NO:244, SEQ ID NO: 245, SEQ ID NO: 246, SEQ ID NO:
247, SEQ ID NO: 248, SEQ ID NO: 249, SEQ ID NO: 250, SEQ ID NO: 251, or SEQ ID
NO: 252 and/or a second polypeptide chain comprising SEQ ID NO:105.
In a cally preferred embodiment, two expression vectors may be used, one of them
for expression of the first polypeptide chain specific for DLL3, the other one for
expression of the second polypeptide chain specific for CD3, which two expression vectors
may then both be transfected into a host cell for recombinant protein expression.
Preferably, the expression vector will be a vector comprising said nucleic acid molecule or
molecules, operably linked to at least one regulatory sequence, wherein such regulatory
sequence may be a promoter, enhancer, or terminator sequence, and most preferably a
heterologous promotor, enhancer, or terminator ce.
In another aspect, the invention relates to a host cell having an expression vector ng
a first polypeptide chain c for DLL3 of the invention and an expression vector
encoding a second polypeptide chain specific for CD3 of the invention.
_72_
ing to a particularly preferred embodiment, said host cells are otic cells such
as mammalian cells. In another embodiment, such host cells are bacterial cells. Other
useful cells are yeast cells or other fungal cells.
Suitable mammalian cells include for e CHO cells, BHK cells, HeLa cells, COS
cells, and the like. However, amphibian cells, insect cells, plant cells, and any other cells
used in the art for the expression of heterologous proteins can be used as well.
ANTI—DLL3 ANTIBODIES
DLL3 is normally expressed on intracellular membranes, including those of the Golgi
w apparatus in foetal brain, and plays a key role in somitogenesis in the paraxial mesoderm
(Geffers et al., J Cell Biol. 2007;178:465; n et al., Hum. Mol. Genet. 2011;20:905—
916). Marked induction of DLL3 expression in some tumor types including SCLC,
LCNEC and glioblastoma results in localization to the cell surface: this together with the
absence of detectable cell surface DLL3 in non-malignant cells opens a new window of
H opportunity for tumour-cell specific therapy and for the use of anti-DLL3 antibodies as
diagnostic and stic tools.
Several anti-DLL3 antibodies (such as LS—cl67440, an; AP21739PU—N, Acris; LS-
C148700, LSBio) are commercially available. r, these antibodies do not perform
well in immunohistochemistry (IHC), FACS and ELISA assays and fail to specifically
bind to DLL3 protein expressed on cells, particularly tumor cells. Anti-DLL3 antibodies
have also been reported, e.g., in 111733 and suggested for diagnostic use in
glioma patients, but no data of IHC assays are shown. Thus, the use of anti-DLL3
antibodies as reliable diagnostic tools to accurately measure DLL3 expression in patients,
e.g. in tumor cells/tissues and/or to assess the efficacy of DLL3 targeted therapies remains
challenging.
Thus, there is a need to identify alternative anti-DLL3 antibodies, which can be used for
accurate and specific detection of DLL3 protein expression in various assays such as
FACS, ELISA, precipitation, Western blotting, ELISA, radioimmunoassay, flow
cytometry, IHC and immunometric assays in any kind of biological sample and can be
used as reliable diagnostic reagents.
_73_
Therefore, a further aspect of the ion provides anti-DLL3 antibody molecules
comprising
i) light chain CDRs comprising the amino acid sequences of SEQ ID NO:1 (CDRl),
SEQ ID NO:2 (CDR2) and SEQ ID NO:3 (CDR3) and heavy chain CDRs
comprising the amino acid sequences of SEQ ID NO:4 (CDRl), SEQ ID NO:5
(CDR2) and SEQ ID NO:6 (CDR3); or
ii) light chain CDRs comprising the amino acid sequences of SEQ ID NO:7 (CDRl),
SEQ ID NO:8 (CDR2) and SEQ ID N029 (CDR3) and heavy chain CDRs
comprising the amino acid ces of SEQ ID NO: 10 (CDRl), SEQ ID NO:ll
(CDR2) and SEQ ID NO:12 (CDR3); or
iii) light chain CDRs comprising the amino acid sequences of SEQ ID NO:13
(CDRl), SEQ ID NO:14 (CDR2) and SEQ ID NO:15 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO:16 , SEQ ID
NO:17 (CDR2) and SEQ ID NO: 18 (CDR3); or
iv) light chain CDRs sing the amino acid sequences of SEQ ID NO:19
(CDRl), SEQ ID NO:20 (CDR2) and SEQ ID NO:21 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID N0222 (CDRl), SEQ ID
NO:23 (CDR2) and SEQ ID NO:24 (CDR3); or
light chain CDRs comprising the amino acid sequences of SEQ ID NO:25
(CDRl), SEQ ID NO:26 (CDR2) and SEQ ID NO:27 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID N028 (CDRl), SEQ ID
NO:29 (CDR2) and SEQ ID NO:30 (CDR3); or
vi) light chain CDRs comprising the amino acid sequences of SEQ ID NO:31
(CDRl), SEQ ID NO:32 (CDR2) and SEQ ID NO:33 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO:34 (CDRl), SEQ ID
NO:35 (CDR2) and SEQ ID NO:36 (CDR3); or
vii) light chain CDRs comprising the amino acid sequences of SEQ ID NO: 133
(CDRl), SEQ ID NO: 134 (CDR2) and SEQ ID NO: 135 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO: 136 , SEQ ID
NO:137 (CDR2) and SEQ ID NO:138 (CDR3); or
_74_
viii) light chain CDRs sing the amino acid sequences of SEQ ID NO: 139
(CDRl), SEQ ID NO: 140 (CDR2) and SEQ ID NO: 141 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO: 142 (CDRl), SEQ ID
NO:143 (CDR2) and SEQ ID NO: 144 (CDR3); or
ix) light chain CDRs comprising the amino acid sequences of SEQ ID NO: 145
, SEQ ID NO: 146 (CDR2) and SEQ ID NO: 147 (CDR3) and heavy chain
CDRs sing the amino acid sequences of SEQ ID NO: 148 (CDRl), SEQ ID
NO:149 (CDR2) and SEQ ID NO:150 (CDR3); or
light chain CDRs comprising the amino acid sequences of SEQ ID NO: 151
(CDRl), SEQ ID NO: 152 (CDR2) and SEQ ID NO: 153 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO: 154 (CDRl), SEQ ID
NO:155 (CDR2) and SEQ ID NO:156 (CDR3); or
xi) light chain CDRs comprising the amino acid sequences of SEQ ID NO: 157
(CDRl), SEQ ID NO: 158 (CDR2) and SEQ ID NO: 159 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO: 160 (CDRl), SEQ ID
NO:161 (CDR2) and SEQ ID NO:162 (CDR3); or
xii) light chain CDRs comprising the amino acid sequences of SEQ ID NO: 163
(CDRl), SEQ ID NO: 164 (CDR2) and SEQ ID NO: 165 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO: 166 (CDRl), SEQ ID
NO:167 (CDR2) and SEQ ID NO:168 (CDR3); or
xiii) light chain CDRs comprising the amino acid sequences of SEQ ID NO: 169
(CDRl), SEQ ID NO: 170 (CDR2) and SEQ ID NO: 171 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO: 172 (CDRl), SEQ ID
NO:173 (CDR2) and SEQ ID NO:174 (CDR3); or
xiv) comprising light chain CDRs comprising the amino acid sequences of SEQ ID
NO:175 (CDRl), SEQ ID NO: 176 (CDR2) and SEQ ID NO: 177 (CDR3) and
heavy chain CDRs comprising the amino acid sequences of SEQ ID NO: 178
(CDRl), SEQ ID NO: 179 (CDR2) and SEQ ID NO:180 (CDR3); or
xv) light chain CDRs comprising the amino acid sequences of SEQ ID NO:181
(CDRl), SEQ ID NO: 182 (CDR2) and SEQ ID NO: 183 (CDR3) and heavy chain
CDRs comprising the amino acid ces of SEQ ID NO:184 (CDRI), SEQ ID
NO:185 (CDR2) and SEQ ID NO:186 (CDR3); or
_75_
xvi) light chain CDRs comprising the amino acid ces of SEQ ID NO:187
(CDRl), SEQ ID NO: 188 (CDR2) and SEQ ID NO: 189 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO: 190 , SEQ ID
NO:191 (CDR2) and SEQ ID NO:192 (CDR3); or
xvii) light chain CDRs comprising the amino acid ces of SEQ ID NO: 193
(CDRl), SEQ ID NO:194(CDR2) and SEQ ID NO:195 (CDR3) and heavy chain
CDRs comprising the amino acid ces of SEQ ID NO: 196 (CDRl), SEQ ID
NO:197 (CDR2) and SEQ ID NO:198 (CDR3); or
xviii) light chain CDRs sing the amino acid sequences of SEQ ID NO: 199
w (CDRl), SEQ ID NO:200 (CDR2) and SEQ ID NO:201 (CDR3) and heavy chain
CDRs comprising the amino acid sequences of SEQ ID NO:202 (CDRl), SEQ ID
NO:203 (CDR2) and SEQ ID NO:204 (CDR3).
The antibodies i) to xviii) as outlined above are termed DLL3#1, DLL3#2, DLL3#3,
DLL3#4, DLL3#5, DLL3#6, DLL3#7, DLL3#8, DLL3#9, DLL3#10, DLL3#11,
E DLL3#12, DLL3#13, DLL3#14, DLL3#15, DLL3#16, DLL3#17 or DLL3#18
respectively. Provided herein is a sequence table which readily allows identification of
individual amino acid sequences to specific antibodies of the present invention.
In preferred embodiments of the invention, the antibody molecule ses CDR
sequences as defined in i) or v) above corresponding to DLL3#1 or DLL3#5.
In some embodiments, the anti-DLL3 dy of the invention is a chimeric, a humanized
or a human antibody molecule. In some embodiments, the antibody molecule is a
monoclonal antibody Fab, F(ab)2, Fv or scFv. . In some embodiments, the anti-DLL3
antibody molecule of the invention comprises a heavy chain constant region selected from
the group consisting of IgG1, IgG2, IgG3, IgG4, IgM, IgA and IgE constant regions. In
some embodiments, the light chain nt region of the anti-DLL3 antibody molecule of
the invention is kappa or lambda.
In some ments, the anti-DLL3 antibody of the invention has a heavy chain variable
domain sing an amino acid sequence at least 85% identical to any one of SEQ ID
NOs:38, 40, 42, 44, 46, 48, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, and 228.
Preferably, the antibody molecule has a heavy chain variable domain comprising an amino
acid sequence of SEQ ID NOs:38, 40, 42, 44, 46, 48, 206, 208, 210, 212, 214, 216, 218,
220, 222, 224, 226, or 228.
_76_
In some embodiments, the anti-DLL3 antibody molecule has a light chain variable domain
comprising an amino acid sequence at least 85% identical to any one of SEQ ID NOs:37,
39, 41, 43, 45, 47, 205, 207,209, 211, 213, 215, 217, 219, 221, 223, 225, and 227.
Preferably, the antibody molecule has a light chain variable domain sing an amino
acid sequence of SEQ ID NOsz37, 39, 41, 43, 45, 47, 205, 207, 209, 211, 213, 215, 217,
219, 221, 223, 225, or 227.
Methods of calculating amino acid ce identities are well known in the art and further
discussed herein in the Definitions section of the specification.
In some embodiments, the LL3 antibody molecule has i) a heavy chain variable
domain comprising the amino acid sequence of SEQ ID NO:38 and alight chain variable
domain comprising the amino acid sequence of SEQ ID NO:37 (DLL3#1), or ii) a heavy
chain variable domain sing the amino acid sequence of SEQ ID NO: 40 and a light
chain variable domain comprising the amino acid sequence of SEQ ID NO: 39 (DLL3#2);
or iii) a heavy chain variable domain comprising the amino acid sequence of SEQ ID
NO:42 and a light chain variable domain comprising the amino acid sequence of SEQ ID
NO:41 (DLL3#3), or iv) a heavy chain variable domain comprising the amino acid
sequence of SEQ ID NO:44 and a light chain variable domain comprising the amino acid
sequence of SEQ ID NO:43 (DLL3#4); or v) a heavy chain le domain comprising
the amino acid sequence of SEQ ID NO:46 and a light chain variable domain comprising
the amino acid ce of SEQ ID NO:45 (DLL3#5); or vi) a heavy chain variable
domain comprising the amino acid sequence of SEQ ID NO:48 and a light chain variable
domain comprising the amino acid ce of SEQ ID NO:47 (DLL3#6); or vii) a light
chain variable domain comprising the amino acid sequence of SEQ ID NO:205 and heavy
chain variable domain sing the amino acid sequence of SEQ ID NO:206 (DLL3#7);
or viii) a light chain variable domain comprising the amino acid sequence of SEQ ID
NO:207 and heavy chain variable domain comprising the amino acid sequence of SEQ ID
NO:208 (DLL3#8); or ix) a light chain variable domain comprising the amino acid
sequence of SEQ ID NO:209 and heavy chain variable domain comprising the amino acid
sequence of SEQ ID NO:210 (DLL3#9); or x) a light chain variable domain sing the
amino acid sequence of SEQ ID NO:211 and heavy chain variable domain comprising the
amino acid sequence of SEQ ID NO:212 (DLL3#10); or xi)a light chain le domain
comprising the amino acid sequence of SEQ ID NO:213 and heavy chain variable domain
comprising the amino acid sequence of SEQ ID NO:214 (DLL3#11); or xii) a light chain
_77_
variable domain comprising the amino acid sequence of SEQ ID NO:215 and heavy chain
variable domain comprising the amino acid sequence of SEQ ID NO:216 12); or
xiii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:217
and heavy chain variable domain sing the amino acid sequence of SEQ ID NO:218
(DLL3#13); or xiv) a light chain le domain comprising the amino acid sequence of
SEQ ID NO:219 and heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:220 (DLL3#14); or xv) a light chain variable domain comprising the amino
acid sequence of SEQ ID NO:221 and heavy chain variable domain comprising the amino
acid sequence of SEQ ID NO:222 (DLL3#15); or xvi) a light chain variable domain
comprising the amino acid sequence of SEQ ID NO:223 and heavy chain variable domain
sing the amino acid sequence of SEQ ID NO:224 (DLL3#16); or xvii) a light chain
variable domain comprising the amino acid sequence of SEQ ID NO:225 and heavy chain
variable domain comprising the amino acid sequence of SEQ ID NO:226 (DLL3#17); or
xviii) a light chain variable domain comprising the amino acid sequence of SEQ ID
NO:227 and heavy chain variable domain comprising the amino acid ce of SEQ ID
NO:228 (DLL3#18).
In some embodiments, the anti-DLL3 antibody of the invention is a mouse monoclonal
antibody. In the context of this ion a mouse monoclonal antibody includes an
antibody where the VH and VL are obtained from immunization of mice with human
DLL3 protein, subsequent selection of le VH and VL sequences binding with certain
affinity to human DLL3, and then further joining such VH and VL sequences to constant
domains which are derived from mouse (e.g. from mouse IgG2a) by recombinant
techniques; and which are produced by recombinant expression in host cells. Further
encompassed by the invention are chimeric antibodies, e.g., comprising variable and
constant regions from different species. In some embodiments, the antibody molecule of
the invention is a ic antibody comprising VH and VL domains derived from mouse
as bed above and further comprising constant domains derived from another species
such as human, , rat, goat, donkey. In some ments, the chimeric antibody
ses VH and VL domains derived from mouse and r humanized or sequence
optimized as defined above and further comprises constant domains derived from another
species. In some embodiments, the chimeric antibody comprises VH and VL domains
derived from a transgenic animal (e. g. a mouse) comprising human IgG sequences, thus
comprises human VH and VL sequences, and further comprises constant domains derived
—78—
from another species. In any of the embodiments of chimeric antibodies as outlined above,
the heavy chain constant region is a mouse, human, rabbit, rat, goat or donkey heavy chain
region.
In some embodiments, the anti-DLL3 antibody molecule of the invention has a constant
domain selected from the group consisting of IgG1, IgG2, IgG3, IgG4, IgM, IgA and IgE
constant s. In a preferred embodiment, the anti-DLL3 antibody has a constant
domain of IgG2a, preferably comprising the sequence of SEQ ID NO:254. In some
embodiments, the anti-DLL3 antibody molecule has a light chain constant domain which is
kappa or lambda, preferably the light chain nt domain is a kappa light chain constant
w domain, preferably comprising the sequence of SEQ ID NO:255.
In some embodiments, the anti-DLL3 antibody molecule is capable of binding to human
and cynomolgus monkey DLL3 with a iation constant (KD) of preferably 5 10nM,
more preferably S_lnM, even more preferable S 0.1nM, even more preferably £0.01 nM.
The affinity (KD value) can be measured in a SPR (BIAcore) assay using recombinant
E DLL3 —protein, as described, e. g. in the examples or other methods that are well known for
the skilled person.
In some embodiments, the anti—DLL3 antibody molecule does not bind to mouse DLL3.
In some embodiments, the anti-DLL3 antibody le is capable of detecting DLL3
expression (e. g. asmic and surface protein expression) on tissue samples (e.g.,
paraffin embedded/formalin-fixed tissue samples) such as tumor tissue s, or
ed cell lines. Optionally, the paraffin ed/formalin fixed cell culture or tissue
samples are further treated with an epitope retriever such as Proteinase K.
In some embodiments, the anti-DLL3 antibody molecule of the invention binds to the same
e as any one of the DLL3#1, DLL2#2, DLL3#3, DLL3#4, DLL3#5, DLL3#6,
DLL3#7, DLL3#8, DLL3#9, DLL3#10, DLL3#11, DLL3#12, DLL3#13, DLL3#14,
DLL3#15, DLL3#16, DLL3#17, or DLL3#18 antibody. In some embodiments, the anti-
DLL3 dy molecule of the invention competes for binding to human DLL3 with
any one of the DLL3#1, DLL2#2, DLL3#3, DLL3#4, DLL3#5, DLL3#6, DLL3#7,
DLL3#8, DLL3#9, 0, DLL3#11, DLL3#12, DLL3#13, DLL3#14, DLL3#15,
DLL3#16, DLL3#17, or DLL3#18 antibody molecules.
_79_
Another aspect of the present invention provides ed nucleic acid molecules ng
the heavy chain variable domain and/or the light chain variable domain of an anti-DLL3
antibody molecule of the invention.
Preferably the c acid molecule comprises a nucleotide sequence ng the heavy
chain variable domain of any one of SEQ ID NOsz38, 40, 42, 44, 46, 48, 206, 208, 210,
212, 214, 216, 218, 220, 222, 224, 226, or 228. Preferably the nucleic acid molecule
comprises a tide sequence ng the light chain variable domain of any one of
SEQ ID NOs: 37, 39, 41, 43, 45, 47, 205, 207, 209, 211, 213, 215, 217, 219, 221, 223, 225,
or 227.
A further aspect of the invention provides an expression vector containing a DNA
molecule comprising the nucleotide sequence encoding the heavy chain variable domain
and/or the light chain variable domain of an anti-DLL3 antibody molecule of the invention.
Preferably the expression vector comprises, in addition, a nucleic acid molecule, preferably
a DNA molecule, ng the constant domains of a heavy chain and/or the constant
domain of a light chain, respectively, linked to the nucleic acid molecule, preferably the
DNA molecule, encoding the heavy chain variable domain and/or the light chain variable
domain, respectively.
In a specifically preferred embodiment, two expression vectors may be used, one of them
for expression of the heavy chain, the other one for sion of the light chain, which
two expression vectors may then both be transfected into a host cell for recombinant
protein expression.
Preferably, the expression vector will be a vector comprising said nucleic acid molecule or
molecules, operably linked to at least one regulatory sequence, wherein such tory
sequence may be a promoter, enhancer, or ator sequence, and most preferably a
heterologous promotor, enhancer, or terminator sequence.
In another aspect, the invention relates to a host cell having an sion vector encoding
a heavy chain of an anti-DLL3 antibody molecule of the invention and an expression
vector encoding a light chain of an LL3 antibody le of the invention.
According to a particularly preferred embodiment, said host cells are eukaryotic cells such
as mammalian cells. In another embodiment, such host cells are bacterial cells. Other
useful cells are yeast cells or other fungal cells.
—80-
Suitable mammalian cells include for example CHO cells, BHK cells, HeLa cells, COS
cells, and the like. However, amphibian cells, insect cells, plant cells, and any other cells
used in the art for the expression of heterologous proteins can be used as well.
METHODS OF MANUFACTURE AND PURIFICATION
The invention further provides methods of manufacturing a multi-speciflc binding protein
of the invention, such methods generally comprising the steps of:
— culturing host cells comprising an expression vector comprising a nucleic acid encoding
a binding protein of the invention under conditions that allow formation of the binding
protein of the invention; and,
— recovering the binding n expressed by the host cells from the culture; and
- optionally further purifying and/or modifying and/or formulating the g protein of
the invention.
The invention further provides methods of cturing an anti-DLL3 antibody of the
ion, such methods generally comprising the steps of:
- culturing host cells comprising an expression vector sing a nucleic acid encoding
an antibody molecule of the invention under ions that allow formation of the
antibody molecule; and,
— recovering the antibody molecule expressed by the host cells from the culture; and
- optionally further ing and/or modifying and/or formulating the antibody molecule
of the invention.
A nucleic acid of the ion can e. g. be a DNA molecule sing coding sequences
as well as regulatory sequences and optionally natural or artificial introns, or can be a
cDNA molecule. It may have its original codons or may have an optimized codon usage
that has been specifically adapted for expression in the intended host cell or host organism.
According to one embodiment of the invention, the c acid of the invention is in
ially isolated form, as defined above.
The nucleic acids of the ion may be prepared or obtained in a manner known per se
(e.g. by automated DNA synthesis and/or recombinant DNA technology), based on the
ation on the amino acid sequences for the proteins of the invention given herein.
—81-
The nucleic acid of the invention will typically be incorporated into an sion ,
i.e. a vector that can provide for expression of the protein when transfected into a suitable
host cell or other expression system.
For manufacturing the binding proteins or antibodies of the invention, the d artisan
may choose from a great variety of expression systems well known in the art, e. g. those
reviewed by Kipriyanow and Le Gall, 2004.
Expression s include plasmids, retroviruses, cosmids, EBV derived episomes, and
the like. The expression vector and expression control sequences are selected to be
compatible with the host cell. The nucleotide sequence encoding the first antigen binding
unit (e. g. the DLL3 specific single chain Fab or the full length DLL3 chain of the binding
protein of the ion) and the nucleotide sequence encoding the second antigen binding
unit (e. g. CD3 specific single chain Fab or the full length CD3 chain of the binding protein
of the invention) of the DLL3/CD3 binding protein can be ed into separate vectors. In
certain embodiments, both DNA sequences are inserted into the same expression vector.
The nucleotide sequence encoding the light chain of a DLL3 antibody and the nucleotide
sequence encoding the heavy chain of a DLL3 antibody can be inserted into separate
vectors. In certain embodiments, both DNA sequences are inserted into the same
expression vector.
Convenient vectors are those that encode a functionally complete human CH (constant
heavy) immunoglobulin sequence, with riate restriction sites engineered so that any
antigen binding unit such as a single chain Fab sequence or any heavy/light chain variable
domain can be easily ed and expressed, as described above. For the antibody heavy
chain, it can be, without limitation, any IgG e (IgGl, IgG2, IgG3, IgG4) or other
globulins, ing allelic variants.
The recombinant expression vector may also encode a signal peptide that facilitates
ion of the full length CD3 or DLL3 chain from a host cell or of the light/heavy chain
of an anti-DLL3 antibody. The DNA encoding the protein chain may be cloned into the
vector such that the signal peptide is linked in—frame to the amino terminus of the mature
full length chain DNA. The signal peptide may be an immunoglobulin signal peptide or a
heterologous peptide from a non-immunoglobulin protein. Alternatively, the DNA
sequence ng the full length chains of the protein of the ion may already
contain a signal peptide sequence.
—82-
In addition to the D3 chain encoding DNA sequences or the heavy/light chain of a
DLL3 antibody encoding DNA ces, the recombinant expression vectors typically
carries regulatory sequences, optionally heterologous tory sequences, including
promoters, enhancers, ation and polyadenylation signals and other expression
control ts that control the expression of the protein chains in a host cell. Examples
for er sequences lified for expression in mammalian cells) are promoters
and/or enhancers derived from CMV (such as the CMV Simian Virus 40 (SV40)
promoter/enhancer), adenovirus, (e. g., the adenovirus major late promoter (AdMLP)),
polyoma and strong mammalian promoters such as native immunoglobulin and actin
promoters. Examples for polyadenylation signals are BGH polyA, SV40 late or early
polyA; alternatively, 3 ’UTRs of immunoglobulin genes etc. can be used.
The inant expression vectors may also carry ces that te replication of
the vector in host cells (e. g. origins of replication) and selectable marker genes. Nucleic
acid molecules encoding the full length chain with the first antigen g unit (single
chain Fab and Fe domain) or an antigen-binding n thereof and/or the full length chain
with the second antigen binding unit (single chain Fab and Fe domain) or an antigen-
binding portion thereof, and vectors comprising these DNA molecules can be introduced
into host cells, e.g. bacterial cells or higher eukaryotic cells, e.g. mammalian cells,
according to transfection methods well known in the art, including liposome—mediated
transfection, polycation-mediated transfection, protoplast fusion, microinj ections, calcium
phosphate precipitation, electroporation or transfer by viral vectors.
Preferably, the DNA molecules encoding the DLL3 and CD3 chain of the protein of the
invention are present on two expression vectors which are co—transfected into the host cell,
preferably a mammalian cell.
Mammalian cell lines available as hosts for expression are well known in the art and
include, inter alia, Chinese hamster ovary (CHO) cells, NSO, SP2/0 cells, HeLa cells, baby
hamster kidney (BHK) cells, monkey kidney cells (COS), human carcinoma cells (e. g.,
Hep G2 and A—549 cells), 3T3 cells or the derivatives/progenies of any such cell line.
Other mammalian cells, including but not limited to human, mice, rat, monkey and rodent
cells lines, or other eukaryotic cells, including but not limited to yeast, insect and plant
cells, or prokaryotic cells such as bacteria may be used.
—83-
The proteins of the invention are produced by culturing the host cells for a period of time
sufficient to allow for sion of the protein in the host cells. Protein les are
ably recovered from the e medium as a secreted polypeptide or it can be
recovered from host cell lysates if for example expressed without a secretory signal. It is
necessary to purify the protein molecules using standard protein purification methods used
for recombinant proteins and host cell proteins in a way that ntially homogenous
preparations of the protein are obtained. By way of example, state—of—the art purification
methods useful for obtaining n molecules of the invention include, as a first step,
removal of cells and/or particulate cell debris from the culture medium or lysate. The
protein is then purified from contaminant soluble proteins, polypeptides and nucleic acids,
for example, by fractionation on immunoaffinity or ion-exchange s, ethanol
precipitation, reverse phase HPLC, ex chromatography, chromatography on silica
or on a cation exchange resin. As a final step in the process for obtaining a protein
molecule preparation, the purified protein molecule may be dried, e.g. lyophilized, as
described below for therapeutic applications.
The present invention relates to binding proteins that have binding specificities for at least
two different targets. In relation to the present invention, the binding molecules are
d from antibodies. Techniques for making binding molecules include, but are not
d to, inant co-expression of two immunoglobulin chains having different
specificities (see Milstein and Cuello, Nature 305: 537 (1983)), WO 93/08829, and
Traunecker et al., EMBO J. 10: 3655 (1991)), and "knob—in—hole" engineering (see, e.g.,
US. Patent No. 5,731, 168; Atwell et a1, JMB, 1997, 270, 26—35). g proteins of the
invention may also be made by engineering electrostatic steering effects for making
antibody Fc—heterodimeric molecules (A1); cross— g two or more
antibodies or nts (see, e.g., US Patent No. 4,676,980, and Brennan et al., e,
229: 81 (1985)); using leucine zippers to produce cific proteins (see, e.g., Kostelny et
al., Immunol., 148(5): 1547—1553 (1992)); using "diabody" technology for making
bispecific antibody fragments (see, e. g., Hollinger et al., Proc. Natl. Acad. Sci. USA,
90:6444- 6448 (1993)); and using single-chain Fv (sFV) dimers (see, e.g. Gruber et al., /.
Immunol., 152:5368 (1994)); and preparing trispecific antibodies as described, e. g., in Tutt
et a1. /. Immunol. 147: 60 (1991).
The compositions (e.g., multi-specific binding proteins and anti-DLL3 antibodies) and
methods disclosed herein encompass polypeptides and c acids having the sequences
—84-
specified, or sequences substantially identical or similar thereto, e. g., ces at least
85%, 90%, 95% identical or higher to the sequence specified. In the t of an amino
acid ce, the term "substantially identical" is used herein to refer to a first amino acid
sequence that contains a sufficient or minimum number of amino acid residues that are i)
identical to, or ii) conservative substitutions of aligned amino acid residues in a second
amino acid sequence such that the first and second amino acid sequences can have a
common structural domain and/or common functional activity. For example, amino acid
sequences that contain a common structural domain have at least about 85%, 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to a reference sequence, e.g., a
sequence provided . In the context of tide sequence, the term "substantially
identical" is used herein to refer to a first nucleic acid ce that contains a sufficient or
minimum number of nucleotides that are identical to aligned nucleotides in a second
nucleic acid sequence such that the first and second nucleotide sequences encode a
polypeptide having common functional activity, or encode a common structural
polypeptide domain or a common functional ptide activity, for example, nucleotide
sequences having at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%
or 99% ty to a reference sequence.
The nucleic acid molecules of the invention include, but are not limited to, the DNA
molecules ng the polypeptide sequences shown in the ce listing. Also, the
present invention also relates to nucleic acid molecules that hybridize to the DNA
molecules encoding the polypeptide sequences shown in the sequence listing under high
ency binding and washing conditions, as defined in . Preferred
molecules (from an mRNA perspective) are those that have at least 75% or 80%
(preferably at least 85%, more preferably at least 90% and most preferably at least 95%)
homology or sequence identity with one of the DNA molecules described herein. By way
of example, in view of expressing the dies in eukaryotic cells, the DNA sequences
shown in the sequence listing have been designed to match codon usage in eukaryotic
cells. If it is desired to express the antibodies in E. coli, these sequences can be changed to
match E. coli codon usage. Variants of DNA molecules of the invention can be constructed
in l different ways, as described e. g. in .
The proteins of the invention may have a modified N—terminal sequence, e.g. a deletion of
one or more of the N-terminal amino acids, or an exchange of e. g. the first, N-terminal
amino acid (e. g. glutamate to alanine), to optimize the molecule for being expressed by
—85-
using certain expression s (such as specific vectors or host cells), or for being
expressed as inclusion bodies or in soluble form, or for being secreted into the medium or
the periplasmic space or for being contained Within the cell, or for ng a more
homogenous product. The polypeptides of the ion may have a modified C-terminal
sequence, such as an additional alanine, and/or further amino acid ges in the C-
terminal part or at other defined positions within any of the framework regions, as
explained e.g. in WO2012/l7574l, WO201 1/075861, or WO2013/024059, in order to e.g.
further enhance stability or reduce immunogenicity of such ptides.
For the avoidance of doubt, all of the embodiments relating to pharmaceutical
compositions, kits, treatment methods, medical uses, combinations, methods of
administration and dosages as described herein are contemplated for any of the multi-
specific binding ns bed herein, either alone or in combination with further
therapeutic agents (as specified in more detail .
PHARMACEUTICAL COMPOSITIONS; METHODS OF ADMINISTRATION;
DOSAGES
The invention further relates to pharmaceutical compositions for the treatment of a disease
(as specified in more detail below), wherein such compositions comprise at least one multi—
specific binding protein of the invention. The invention further encompasses methods of
treating a disease (as ed in more detail below) using at least one multi—specific
protein of the invention or pharmaceutical composition as set out below, and further
encompasses the preparation of a medicament for the ent of such disease by using
such binding protein of the invention or pharmaceutical composition.
The binding proteins of the invention (e.g., any one of DLL3#l/CD3#1, DLL3#2/CD3#1,
DLL3#3/CD3#1, DLL3#4/CD3#1, DLL3#5/CD3#1, DLL3#6/CD3#1, DLL3#7/CD3#1,
DLL3#8/CD3#1, DLL3#9/CD3#1, DLL3#10/CD3#1, DLL3#1 l/CD3#1,
DLL3#l2/CD3#1, DLL3#l3/CD3#1, DLL3#l4/CD3#1, DLL3#15/CD3#1,
DLL3#l6/CD3#1, DLL3#17/CD3#1, DLL3#18/CD3#1, DLL3#l/CD3#2,
/CD3#2, DLL3#3/CD3#2, DLL3#4/CD3#2, DLL3#5/CD3#2, DLL3#6/CD3#2,
DLL3#7/CD3#2, /CD3#2, DLL3#9/CD3#2, DLL3#10/CD3#2, DLL3#1 l/CD3#2,
DLL3#l2/CD3#2, DLL3#l3/CD3#2, DLL3#l4/CD3#2, DLL3#15/CD3#2,
DLL3#l6/CD3#2, DLL3#17/CD3#2, DLL3#18/CD3#2, DLL3#l/CD3#3,
—86-
DLL3#2/CD3#3, DLL3#3/CD3#3, DLL3#4/CD3#3, DLL3#5/CD3#3 and
DLL3#6/CD3#3, DLL3#7/CD3#3, DLL3#8/CD3#3, DLL3#9/CD3#3, DLL3#10/CD3#3,
DLL3#1 l/CD3#3, DLL3#12/CD3#3, DLL3#13/CD3#3, DLL3#14/CD3#3,
DLL3#15/CD3#3, DLL3#16/CD3#3, DLL3#l7/CD3#3, DLL3#1 3, preferably any
one of DLL3#1/CD3#1, DLL3#1/CD3#2, DLL3#1/CD3#3, DLL3#2/CD3#1,
DLL3#2/CD3#2, DLL3#2/CD3#3, DLL3#3/CD3#1, DLL3#3/CD3#2, DLL3#3/CD3#3 )
and/or the compositions comprising the same can be administered to a patient in need
thereof in any suitable manner, depending on the c pharmaceutical formulation or
composition to be used. Thus, the binding proteins of the ion and/or the
compositions comprising the same can for e be administered intravenously (iv),
subcutaneously (s.c.), intramuscularly , intraperitoneally (i.p.), transdermally, orally,
sublingually (e. g. in the form of a sublingual , spray or drop placed under the tongue
and adsorbed through the mucus membranes into the capillary network under the tongue),
(intra-)nasally (e. g. in the form of a nasal spray and/or as an aerosol), topically, by means
of a suppository, by inhalation, or any other suitable manner in an effective amount or
dose. The binding protein can be administered by infusion, bolus or injection. In preferred
embodiments, the administration is by intravenous on or subcutaneous injection.
The binding proteins of the ion and/or the compositions comprising the same are
administered according to a regimen of treatment that is suitable for treating and/or
alleviating the disease, disorder or condition to be treated or alleviated. The clinician will
generally be able to determine a suitable treatment regimen, depending on factors such as
the e, disorder or ion to be treated or alleviated, the severity of the disease, the
severity of the symptoms thereof, the specific g protein of the invention to be used,
the specific route of administration and pharmaceutical formulation or composition to be
used, the age, , weight, diet, general condition of the patient, and similar factors well
known to the clinician. Generally, the treatment regimen will comprise the administration
of one or more binding proteins of the ion, or of one or more compositions
comprising the same, in therapeutically effective amounts or doses.
lly, for the ent and/or alleviation of the diseases, disorders and conditions
mentioned herein and depending on the specific e, disorder or condition to be
treated, the potency of the specific binding protein of the invention to be used, the specific
route of administration and the specific pharmaceutical formulation or ition used,
the binding ns of the invention will generally be administered in an amount between
—87—
0.005 and 20.0 mg per am ofbody weight and dose, preferably between 0.05 and
.0 mg/kg/dose, either continuously (e. g. by infusion) or more preferably as single doses
(such as e.g. twice a week, , or monthly doses; cf. below), but can significantly
vary, especially, depending on the before-mentioned parameters. Thus, in some cases it
may be sufficient to use less than the m dose given above, whereas in other cases
the upper limit may have to be exceeded. When administering large amounts it may be
advisable to divide them up into a number of smaller doses spread over the day.
Depending on the specific binding protein of the invention and its specific pharmacokinetic
and other properties, it may be administered daily, every second, third, fourth, fifth or sixth
day, weekly, monthly, and the like. An administration regimen could include long-term,
weekly treatment. By "long-term" is meant at least two weeks and ably months, or
years of duration.
The efficacy of the multi-specific n of the invention, and of compositions comprising
the same, can be tested using any suitable in vitro assay, cell-based assay, in vivo assay
and/or animal model known per se, or any ation thereof, ing on the specific
disease involved. Suitable assays and animal models will be clear to the skilled person, and
for example include the assays and animal models used in the Examples below.
FORMULATIONS
For pharmaceutical use, the binding proteins of the invention may be formulated as a
pharmaceutical preparation sing (i) at least one binding protein of the invention
(e.g., any one of DLL3#l/CD3#1, DLL3#2/CD3#1, DLL3#3/CD3#1, DLL3#4/CD3#1,
DLL3#5/CD3#1, /CD3#1, DLL3#7/CD3#1, DLL3#8/CD3#1, DLL3#9/CD3#1,
DLL3#10/CD3#1, DLL3#1 l/CD3#1, DLL3#12/CD3#1, DLL3#l3/CD3#1,
DLL3#l4/CD3#1, DLL3#15/CD3#1, DLL3#l6/CD3#1, DLL3#l7/CD3#1,
DLL3#l8/CD3#1, DLL3#1/CD3#2, DLL3#2/CD3#2, DLL3#3/CD3#2, DLL3#4/CD3#2,
DLL3#5/CD3#2, DLL3#6/CD3#2, DLL3#7/CD3#2, DLL3#8/CD3#2, DLL3#9/CD3#2,
DLL3#10/CD3#2, DLL3#1 l/CD3#2, DLL3#12/CD3#2, DLL3#l3/CD3#2,
DLL3#l4/CD3#2, 5/CD3#2, DLL3#l6/CD3#2, DLL3#l7/CD3#2,
DLL3#l8/CD3#2, DLL3#1/CD3#3, /CD3#3, DLL3#3/CD3#3, /CD3#3,
DLL3#5/CD3#3 and DLL3#6/CD3#3, DLL3#7/CD3#3, DLL3#8/CD3#3,
DLL3#9/CD3#3, DLL3#10/CD3#3, DLL3#1 l/CD3#3, DLL3#12/CD3#3,
—88-
DLL3#l3/CD3#3, DLL3#14/CD3#3, DLL3#15/CD3#3, DLL3#16/CD3#3,
DLL3#l7/CD3#3, DLL3#l8/CD3#3, preferably any one of DLL3#1/CD3#1,
DLL3#1/CD3#2, DLL3#l/CD3#3, DLL3#2/CD3#1, /CD3#2, DLL3#2/CD3#3,
DLL3#3/CD3#1, DLL3#3/CD3#2, DLL3#3/CD3#3) and (ii) at least one pharmaceutically
acceptable carrier, diluent, excipient, adjuvant, and/or stabilizer, and (iii) ally one or
more further pharmacologically active polypeptides and/or compounds. By
"pharmaceutically acceptable" is meant that the respective material does not show any
biological or otherwise undesirable effects when administered to an dual and does
not interact in a deleterious manner with any of the other components of the
pharmaceutical ition (such as e.g. the pharmaceutically active ingredient) in which
it is contained. c examples can be found in rd handbooks, such as e. g.
Remington's Pharmaceutical Sciences, 18th Ed., Mack Publishing Company, USA (1990).
For example, the binding proteins of the invention may be formulated and administered in
any manner known per se for conventional antibodies and antibody fragments and other
pharmaceutically active proteins. Thus, according to a further embodiment, the invention
relates to a pharmaceutical composition or preparation that contains at least one binding
protein of the invention and at least one pharmaceutically acceptable carrier, diluent,
excipient, adjuvant and/or stabilizer, and optionally one or more further cologically
active substances, in the form of lyophilized or otherwise dried formulations or aqueous or
non-aqueous solutions or suspensions.
Pharmaceutical preparations for parenteral administration, such as intravenous,
uscular, subcutaneous injection or intravenous on may for example be sterile
solutions, suspensions, dispersions, emulsions, or s which comprise the active
ingredient and which are suitable, optionally after a further dissolution or dilution step, for
infusion or injection. Suitable carriers or diluents for such preparations for example
e, without limitation, sterile water and pharmaceutically acceptable aqueous buffers
and solutions such as physiological phosphate—buffered , 's solutions, dextrose
solution, and Hank's solution; water oils; ol; ethanol; glycols such as propylene
glycol, as well as mineral oils, animal oils and vegetable oils, for example peanut oil,
n oil, as well as suitable mixtures thereof.
Solutions of the binding proteins of the invention may also contain a preservative to
prevent the growth of microorganisms, such as antibacterial and ngal agents, for
example, p-hydroxybenzoates, parabens, chlorobutanol, phenol, sorbic acid, thiomersal,
—89—
(alkali metal salts of) ethylenediamine tetraacetic acid, and the like. In many cases, it will
be preferable to include isotonic agents, for example, , buffers or sodium chloride.
Optionally, emulsifiers and/or dispersants may be used. The proper fluidity can be
maintained, for example, by the ion of liposomes, by the maintenance of the
required particle size in the case of dispersions or by the use of surfactants. Other agents
delaying absorption, for example, aluminum earate and gelatin, may also be added.
The ons may be filled into ion vials, ampoules, on bottles, and the like.
In all cases, the ultimate dosage form must be sterile, fluid and stable under the conditions
of manufacture and storage. Sterile inj ectable solutions are prepared by incorporating the
active compound in the required amount in the appropriate solvent with various of the
other ingredients enumerated above, as required, followed by filter sterilization. In the case
of sterile powders for the preparation of sterile injectable solutions, the preferred methods
ofpreparation are vacuum drying and the freeze drying techniques, which yield a powder
of the active ingredient plus any additional desired ingredient present in the previously
sterile—filtered solutions.
Usually, aqueous solutions or suspensions will be preferred. Generally, suitable
formulations for therapeutic proteins such as the binding proteins of the invention are
ed protein solutions, such as solutions including the protein in a le
concentration (such as from 0.001 to 400 mg/ml, preferably from 0.005 to 200 mg/ml,
more preferably 0.01 to 200 mg/ml, more preferably 1.0 - 100 mg/ml, such as 1.0 mg/ml
(i.v. administration) or 100 mg/ml (s.c. administration) and an aqueous buffer such as:
- phosphate buffered saline, pH 7.4,
- other ate buffers, pH 6.2 to 8.2,
- acetate s, pH 3.2 to 7.5, preferably pH 4.8 to 5.5
- ine buffers, pH 5.5 to 7.0,
— succinate buffers, pH 3.2 to 6.6, and
- citrate s, pH 2.1 to 6.2,
and, optionally, salts (e.g. NaCl) and/or sugars (such as e. g. sucrose and trehalose) and/or
other polyalcohols (such as e. g. ol and glycerol) for providing isotonicity of the
solution.
In addition, other agents such as a detergent, e.g. 0.02 % Tween—20 or Tween-80, may be
included in such solutions. Formulations for subcutaneous application may include
significantly higher concentrations of the antibody of the invention, such as up to
_90_
100 mg/ml or even above 100 mg/ml. r, it will be clear to the person skilled in the
art that the ingredients and the amounts f as given above do only represent one,
red option. Alternatives and variations thereof will be immediately apparent to the
skilled person, or can easily be conceived starting from the above disclosure. The above
described formulations can optionally be provided as lyophilized formulation that is to be
reconstituted in a solution, e.g. in water for injection (WFI).
ing to a further aspect of the invention, a binding protein of the invention may be
used in combination with a device useful for the administration of protein, such as a
syringe, injector pen, micropump, or other device.
METHOD OF TREATMENT
A further aspect of the invention provides a method of treating cancer comprising
administering to a patient in need thereof a therapeutically effective amount of the g
protein of the invention.
A further aspect of the invention provides a binding n of the invention for use in a
method of treating cancer.
A further aspect of the ion is the use of the binding protein of the invention for
preparing a pharmaceutical composition for treating cancer.
For the avoidance of doubt, the medical use aspects of the invention may comprise any of
the specific binding proteins of the invention as described above (e.g., any one of
DLL3#1/CD3#1, DLL3#2/CD3#1, DLL3#3/CD3#1, DLL3#4/CD3#1, DLL3#5/CD3#1,
/CD3#1, DLL3#7/CD3#1, DLL3#8/CD3#1, DLL3#9/CD3#1, DLL3#10/CD3#1,
DLL3#11/CD3#1, DLL3#12/CD3#1, DLL3#13/CD3#1, DLL3#l4/CD3#1,
DLL3#15/CD3#1, DLL3#l6/CD3#1, DLL3#17/CD3#1, DLL3#18/CD3#1,
DLL3#1/CD3#2, DLL3#2/CD3#2, /CD3#2, DLL3#4/CD3#2, DLL3#5/CD3#2,
DLL3#6/CD3#2, DLL3#7/CD3#2, DLL3#8/CD3#2, DLL3#9/CD3#2, DLL3#10/CD3#2,
DLL3#11/CD3#2, DLL3#12/CD3#2, DLL3#13/CD3#2, 4/CD3#2,
DLL3#15/CD3#2, 6/CD3#2, DLL3#17/CD3#2, DLL3#18/CD3#2,
DLL3#l/CD3#3, DLL3#2/CD3#3, /CD3#3, DLL3#4/CD3#3, DLL3#5/CD3#3
and DLL3#6/CD3#3, DLL3#7/CD3#3, DLL3#8/CD3#3, DLL3#9/CD3#3,
DLL3#10/CD3#3, DLL3#11/CD3#3, DLL3#12/CD3#3, DLL3#l3/CD3#3,
DLL3#14/CD3#3, DLL3#15/CD3#3, DLL3#l6/CD3#3, DLL3#l7/CD3#3,
_91_
DLL3#1 8/CD3#3, preferably any one of DLL3#l/CD3#1, DLL3#l/CD3#2,
DLL3#l/CD3#3, DLL3#2/CD3#1, DLL3#2/CD3#2, DLL3#2/CD3#3, DLL3#3/CD3#1,
DLL3#3/CD3#2, DLL3#3/CD3#3 ).
As used herein, the term "cancer" is meant to include all types of cancerous growths or
oncogenic processes, metastatic tissues or malignantly transformed cells, tissues, or organs,
irrespective of histopathologic type or stage of invasiveness.
ary cancers whose growth can be inhibited using the multi-specific binding
proteins described herein are any DLL3 sing tumors, preferably SCLC, LCNEC,
glioma, astoma, melanoma, or other DLL3 expressing neuroendocrine tumors (e.g.,
neuroendocrine prostate cancer or neuroendocrine pancreatic , small cell bladder
cancer).
Neuroendocrine tumors (NETs) arise from the dispersed endocrine system and can occur in
many different areas of the body. Traditionally, NETs have been classified by their
anatomic site of origin and are typically highly aggressive. They are most often located in
the gastrointestinal tract, pancreas or the lungs (small cell lung carcinoma and large cell
neuroendocrine carcinoma) as well as in s, or in the genitourinary tract (bladder,
prostate, ovary, cervix, and endometrium). NETs e certain tumors of the
gastrointestinal tract and of the pancreatic islet cells, certain thymus and lung tumors, and
medullary carcinoma of the llicular cells of the thyroid.
Additional cancers whose growth can be inhibited using the multi-specific binding proteins
described herein are pseudo neuroendocrine tumors (pNETs) that share certain pic,
phenotypic or mical characteristics with ionally defined neuroendocrine
tumors .
In some embodiments, the following cancers, tumors, and other proliferative diseases may
be treated with specific binding proteins of the invention: lung cancer; preferably
SCLC, NSCLC or LCNEC; breast; cervical; colon; colorectal; endometrial; head and neck;
liver (hepatoblastoma or hepatocellular carcinoma); ovarian; pancreatic; prostate; skin;
gastric; testis; thyroid; adrenal; renal; bladder; uterine; esophageal; urothelial cancer; brain
tumor; lymphoma; Ewing sarcoma; and other neuroendocrine and small blue round cell
tumors.
In a preferred embodiment of the invention the cancer is small cell lung cancer (SCLC) or
glioblastoma.
_92_
All cancers, , neoplasms, etc., mentioned above which are characterized by their
specific location/origin in the body are meant to include both the primary tumors and the
metastatic tumors derived therefrom.
It is possible that a patient is more likely to d to treatment with a binding protein of
the invention (as described herein) if that patient has a cancer which is characterized by
having a high expression of DLL3. Thus, in some embodiments, the cancer to be treated
with the binding ns of the invention is a cancer with high expression of DLL3, e. g.,
DLL3 expression is higher than the average expression in cancer cells of a population of
patients suffering from the same type of a DLL3 expressing cancer.
The binding proteins of the invention may be used in therapeutic regimens in the context of
first line, second line, or any further line treatments and maintenance treatment.
The binding proteins of the invention may be used for the prevention, short—term or long-
term treatment of the above—mentioned diseases, optionally also in combination with
radiotherapy, one or more additional therapeutic agents and/or surgery.
In preferred embodiments, the protein of the invention is used for the treatment of cancer
in combination with a PD-l antagonist, such as an anti-PD-l antibody or an anti-PDL-l
antibody. Preferably said anti-PD-l antibody is selected from the group consisting of
pembrolizumab, nivolumab, zumab, PDl-l, PD1-2, PD1-3, PDl-4, and PD1-5 as
described herein (as defined by the sequences in Table A below) and in W02017/198741
(incorporated herein by reference). ably said anti-PDL-l dy is selected from
the group consisting of atezolizumab, ab and durvalumab. In particular red
embodiments, the binding protein of the ion (preferably any one of DLL3#1/CD3#1,
DLL3#1/CD3#2, DLL3#1/CD3#3, DLL3#2/CD3#1, DLL3#2/CD3#2, DLL3#2/CD3#3,
DLL3#3/CD3#1, DLL3#3/CD3#2, or DLL3#3/CD3#3) is used for the treatment of cancer
in combination with PDl-l. In ular preferred ments, the binding protein of the
invention (preferably any one of DLL3#l/CD3#1, DLL3#l/CD3#2, DLL3#l/CD3#3,
DLL3#2/CD3#1, DLL3#2/CD3#2, DLL3#2/CD3#3, /CD3#1, DLL3#3/CD3#2, or
DLL3#3/CD3#3) is used for the treatment of cancer in combination with PDl—2. In
particular preferred embodiments, the binding protein of the invention (preferably any one
of DLL3#1/CD3#1, /CD3#2, DLL3#1/CD3#3, DLL3#2/CD3#1, DLL3#2/CD3#2,
DLL3#2/CD3#3, DLL3#3/CD3#1, DLL3#3/CD3#2, DLL3#3/CD3#3) is used for the
treatment of cancer in combination with PDl-3. In ular preferred embodiments, the
_93_
binding protein of the invention (preferably any one of DLL3#1/CD3#1, /CD3#2,
DLL3#l/CD3#3, DLL3#2/CD3#1, DLL3#2/CD3#2, DLL3#2/CD3#3, DLL3#3/CD3#1,
DLL3#3/CD3#2, DLL3#3/CD3#3) is used for the treatment of cancer in combination with
PDl-4. In particular preferred embodiments, the binding protein of the ion
(preferably any one of DLL3#1/CD3#1, DLL3#1/CD3#2, /CD3#3,
DLL3#2/CD3#1, DLL3#2/CD3#2, DLL3#2/CD3#3, DLL3#3/CD3#1, /CD3#2,
DLL3#3/CD3#3) is used for the treatment of cancer in combination with PD1-5.
Table A: Amino acid sequences and SEQ ID NOs of heavy chain and light chain
sequences of anti—PDl antibodies PD 1 —1, PD 1 —2, PD 1 —3, PD1—4, PD1—5.
SEQ ID Brief Sequence
NUInbeTi description
of sequence
SEQ ID PDl-l HC EVMLVESGGGLVQPGGSLRLSCTASGFTFSASAMSWV
N02256 RQAPGKGLEWVAYISGGGGDTYYSSSVKGRFTISRDN
AKNSLYLQMNSLRAEDTAVYYCARHSNVNYYAMDY
WGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGC
LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL
PSSSLGTKTYTCNVDHKPSNTKVDKRVESKYG
PPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV
VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTIS
KAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPS
DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVD
KSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
SEQ ID PDl-l LC EIVLTQSPATLSLSPGERATMSCRASENIDTSGISFMNW
N01257 YQQKPGQAPKLLIYVASNQGSGIPARFSGSGSGTDFTLT
ISRLEPEDFAVYYCQQSKEVPWTFGQGTKLEIKRTVAA
PPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK
HKVYACEVTHQGLSSPVTKSFNRGEC
SEQ ID PD 1 —2 HC EVMLVESGGGLVQPGGSLRLSCTASGFTFSASAMSWV
_94_
SEQ ID Brief Sequence
Number: description
of sequence
NO:258 RQAPGKGLEWVAYISGGGGDTYYSSSVKGRFTISRDN
AKNSLYLQMNSLRAEDTAVYYCARHSNPNYYAMDY
WGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGC
LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL
SSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYG
PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV
VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTIS
KAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPS
DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVD
KSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
SEQ ID PD1—2 LC SPATLSLSPGERATMSCRASENIDTSGISFMNW
NO:259 YQQKPGQAPKLLIYVASNQGSGIPARFSGSGSGTDFTLT
ISRLEPEDFAVYYCQQSKEVPWTFGQGTKLEIKRTVAA
PSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK
HKVYACEVTHQGLSSPVTKSFNRGEC
SEQ ID PD1—3 HC EVMLVESGGGLVQPGGSLRLSCTASGFTFSKSAMSWV
NO:260 RQAPGKGLEWVAYISGGGGDTYYSSSVKGRFTISRDN
LQMNSLRAEDTAVYYCARHSNVNYYAMDY
WGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGC
LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL
SSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYG
PPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV
VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTIS
KAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPS
DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVD
KSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
_95_
SEQ ID Brief Sequence
Number: description
of sequence
SEQ ID PD1—3 LC EIVLTQSPATLSLSPGERATMSCRASENIDVSGISFMNW
NO:261 YQQKPGQAPKLLIYVASNQGSGIPARFSGSGSGTDFTLT
ISRLEPEDFAVYYCQQSKEVPWTFGQGTKLEIKRTVAA
PSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK
HKVYACEVTHQGLSSPVTKSFNRGEC
SEQ ID PD1-4 HC EVMLVESGGGLVQPGGSLRLSCTASGFTFSKSAMSWV
NO:262 RQAPGKGLEWVAYISGGGGDTYYSSSVKGRFTISRDN
AKNSLYLQMNSLRAEDTAVYYCARHSNVNYYAMDY
WGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGC
LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL
SSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYG
PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV
VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTIS
KAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPS
DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVD
GNVFSCSVMHEALHNHYTQKSLSLSLG
SEQ ID PD1—4 LC EIVLTQSPATLSLSPGERATMSCRASENIDVSGISFMNW
NO:263 QAPKLLIYVASNQGSGIPARFSGSGSGTDFTLT
ISRLEPEDFAVYYCQQSKEVPWTFGQGTKLEIKRTVAA
PSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK
HKVYACEVTHQGLSSPVTKSFNRGEC
SEQ ID PDl-S HC EVMLVESGGGLVQPGGSLRLSCTASGFTFSKSAMSWV
NO:264 RQAPGKGLEWVAYISGGGGDTYYSSSVKGRFTISRDN
AKNSLYLQMNSLRAEDTAVYYCARHSNVNYYAMDY
WGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGC
LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL
_96_
SEQ ID Brief Sequence
Number: ption
of sequence
SSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYG
PPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV
VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTIS
KAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPS
DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVD
KSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
SEQ ID PD1-5 LC EIVLTQSPATLSLSPGERATMSCRASENIDVSGISFMNW
N02265 QAPKLLIYVASNQGSGIPARFSGSGSGTDFTLT
ISRLEPEDFAVYYCQQSKEVPWTFGQGTKLEIKRTVAA
PPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK
HKVYACEVTHQGLSSPVTKSFNRGEC
According to these preferred embodiments and any other of the aspects of the present
invention, antibodies PDl—l, PDl—2, PDl—3, PDl—4 and PDl-5 are antibody molecules as
disclosed in /198741, and are defined by the sequences as shown in Table A
above.
Accordingly, PDl—l has a heavy chain comprising the amino acid sequence of SEQ ID
NO:256 and a light chain comprising the amino acid sequence of SEQ ID NO:257;
PDl-2 has a heavy chain comprising the amino acid sequence of SEQ ID NO:258 and a
light chain comprising the amino acid sequence of SEQ ID NO:259;
PDl-3 has a heavy chain sing the amino acid sequence of SEQ ID NO:260 and a
light chain comprising the amino acid sequence of SEQ ID NO:261;
PDl-4 has a heavy chain comprising the amino acid sequence of SEQ ID NO:262 and a
light chain comprising the amino acid sequence of SEQ ID NO:263; and
PDl-5 has a heavy chain comprising the amino acid sequence of SEQ ID NO:264 and a
light chain comprising the amino acid sequence of SEQ ID NO:265.
_97_
The above also includes the use of the binding proteins of the invention in various methods
of treating the above es by administering a therapeutically effective dose to a patient
in need thereof, as well as the use of these binding proteins for the manufacture of
medicaments for the treatment of such es, as well as pharmaceutical compositions
including such binding proteins of the invention, as well as the preparation and/or
manufacture of medicaments including such binding proteins of the invention, and the like.
COMBINATIONS WITH OTHER ACTIVE SUBSTANCES OR TREATMENTS
A binding n of the invention may be used on its own or in combination with one or
more onal therapeutic agents, in particular in combination with a chemotherapeutic
agent like DNA damaging agents, a eutically active compound that inhibits
angiogenesis, a signal uction pathway inhibitor, an EGFR inhibitor, an immune
modulator, an immune checkpoint inhibitor, a c checkpoint inhibitor or a al
therapy agent.
The additional eutic agent may be administered simultaneously with, optionally as a
component of the same pharmaceutical preparation, or before or after administration of the
DLL3/CD3 binding protein.
Cytostatic and/or cytotoxic active substances which may be administered in combination
with binding molecules of the invention include, without being restricted thereto,
hormones, hormone analogues and antihormones, aromatase inhibitors, LHRH agonists
and antagonists, tors of growth factors (growth factors such as for example et
derived growth factor (PDGF), fibroblast growth factor (FGF), vascular endothelial growth
factor (VEGF), epidermal growth factor (EGF), ne-like growth factors (IGF), human
epidermal growth factor (HER, e.g. HER2, HER3, HER4) and hepatocyte growth factor
(HGF)), inhibitors are for e )growth factor antibodies, (anti-)growth factor
receptor antibodies and tyrosine kinase inhibitors, such as for example cetuximab,
gefitinib, ib, nintedanib, imatinib, lapatinib, bosutinib and trastuzumab;
antimetabolites (e.g. antifolates such as methotrexate, raltitrexed, pyrimidine analogues
such as 5—fluorouracil (5 —FU), gemcitabine, irinotecan, doxorubicin, TAS-102,
capecitabine and gemcitabine, purine and adenosine analogues such as mercaptopurine,
thioguanine, cladribine and pentostatin, bine (ara C), fludarabine); antitumor
antibiotics (e. g. anthracyclins); platinum derivatives (e. g. cisplatin, oxaliplatin,
—98-
carboplatin); tion agents (e. g. estramustin, meclorethamine, melphalan,
chlorambucil, busulphan, dacarbazin, cyclophosphamide, ifosfamide, temozolomide,
nitrosoureas such as for example carrnustin and lomustin, thiotepa); antimitotic agents (e. g.
Vinca alkaloids such as for example Vinblastine, Vindesin, Vinorelbin and Vincristine; and
taxanes such as paclitaxel, docetaxel); angiogenesis inhibitors, including bevacizumab,
ramucirumab and aflibercept, tubuline inhibitors; DNA synthesis inhibitors, PARP
inhibitors, omerase tors (e.g. epipodophyllotoxins such as for example
ide and hos, teniposide, amsacrin, topotecan, ecan, mitoxantrone),
serine/threonine kinase inhibitors (e. g. PDKl inhibitors, Raf inhibitors, A-Raf inhibitors,
B-Raf inhibitors, C—Raf inhibitors, mTOR inhibitors, mTORCl/2 inhibitors, PI3K
tors, PI3K0L inhibitors, dual mTOlUPI3K inhibitors, STK33 inhibitors, AKT
inhibitors, PLKl inhibitors (such as volasertib), tors of CDKs, including CDK9
inhibitors, Aurora kinase inhibitors), tyrosine kinase inhibitors (e.g. PTKZ/FAK inhibitors),
protein protein interaction inhibitors, MEK inhibitors, ERK inhibitors, FLT3 inhibitors,
BRD4 inhibitors, IGF-lR inhibitors, Bcl-xL inhibitors, Bcl—2 inhibitors, Bcl—2/Bcl-xL
inhibitors, ErbB or inhibitors, BCR-ABL inhibitors, ABL inhibitors, Src inhibitors,
rapamycin analogs (e. g. everolimus, temsirolimus, ridaforolimus, sirolimus), en
synthesis inhibitors, androgen receptor inhibitors, DNMT tors, HDAC inhibitors,
ANGl/2 tors, CYPl7 inhibitors, radiopharmaceuticals, therapeutic agents
such as immune checkpoint inhibitors (e. g. CTLA4, PDl, PD-Ll, LAG3, and TIM3
binding molecules / immunoglobulins, such as ipilimumab, nivolumab, pembrolizumab)
and various chemotherapeutic agents such as amifostin, anagrelid, clodronat, filgrastin,
interferon, interferon alpha, leucovorin, rituximab, procarbazine, levamisole, mesna,
ne, pamidronate and porflmer; proteasome inhibitors (such as Bortezomib); Smac
and BH3 mimetics; agents restoring p53 functionality including mdm2-p53 antagonist;
inhibitors of the Wnt/beta—catenin signaling y; and/or cyclin—dependent kinase 9
inhibitors.
Particularly preferred are treatments with the binding molecules of the invention in
combination with one or more immunotherapeutic , including anti-PD-l and anti-
PD—Ll agents and anti LAG3 agents: Exemplary anti-PDl agents include but are not
limited to anti-PD-l antibody PDR-OOl, pembrolizumab, nivolumab, pidilizumab and
PDl-l, PDl-2, PDl-3, PD1-4 and PDl-5 as sed herein (Table A) and in
WO2017/198741. Exemplary anti— PDL-l agents include but are not limited to
_99_
atezolizumab, avelumab and durvalumab. In preferred embodiments, the binding molecule
of the invention (preferably any one of DLL3#1/CD3#1, DLL3#l/CD3#2,
DLL3#1/CD3#3, /CD3#1, DLL3#2/CD3#2, DLL3#2/CD3#3, /CD3#1,
DLL3#3/CD3#2, DLL3#3/CD3#3) is combined with PDl—l. In preferred embodiments,
the binding molecule of the invention (preferably any one of DLL3#1/CD3#1,
/CD3#2, DLL3#1/CD3#3, DLL3#2/CD3#1, DLL3#2/CD3#2, DLL3#2/CD3#3,
DLL3#3/CD3#1, DLL3#3/CD3#2, DLL3#3/CD3#3) is combined with PD1—2. In preferred
embodiments, the binding molecule of the invention (preferably any one of
DLL3#1/CD3#1, DLL3#1/CD3#2, DLL3#l/CD3#3, DLL3#2/CD3#1, DLL3#2/CD3#2,
DLL3#2/CD3#3, DLL3#3/CD3#1, DLL3#3/CD3#2, DLL3#3/CD3#3) is combined with
PDl -3. In preferred embodiments, the binding molecule of the invention (preferably any
one ofDLL3#1/CD3#1, DLL3#1/CD3#2, DLL3#1/CD3#3, DLL3#2/CD3#1,
DLL3#2/CD3#2, DLL3#2/CD3#3, DLL3#3/CD3#1, DLL3#3/CD3#2, DLL3#3/CD3#3) is
combined with PD1—4. In preferred embodiments, the binding molecule of the invention
(preferably any one of DLL3#1/CD3#1, DLL3#l/CD3#2, DLL3#1/CD3#3,
DLL3#2/CD3#1, DLL3#2/CD3#2, DLL3#2/CD3#3, DLL3#3/CD3#1, DLL3#3/CD3#2,
DLL3#3/CD3#3) is ed with PD1—5.
In n embodiments, the additional eutic agent may be a further
therapeutic agent, such as modulators of: TIM-1, TIM-3, TIM-4, PD-L2, LAG3,
CTLA—4, Galectin 9, Galectin—1, CD69, CD113, GPR56, CD48, GARP, CAECAM—l,
BTLA, TIGIT, CD160, LAIRl, 2B4, CEACAM, CD39, TGFB, IL—10, Fas ligand, ICOS,
B7 family (B7—1, B7—2, B7-H1 ), B7—DC (PD—L2), B7—H2 (ICOS—L), B7—H3, B7—
H4, B7—H5 ), or .
In some embodiments, the onal immunotherapeutic agent is a member of the TNF
family of molecules that bind to cognate TNF receptor family members, which include
CD40 and CD40L, OX—40, OX—40L, CD70, CD27L, CD30, CD30L, 4—1BBL, CD137,
GITR, TRAIL/ApoZ-L, TRAILRl/DR4, TRAILR2/DR5, TRAILR3, TRAILR4, OPG,
RANK, RANKL, TWEAKIVFn14, TWEAK, BAFFR, EDAR, XEDAR, TACI, APRIL,
BCMA, LIGHT, DcR3, HVEM, VEGI/TLIA, DR3, EDAR, EDAl, XEDAR,
EDA2, TNFRl, Lymphotoxin (x/TNFB, TNFR2, TNFOt, LTBR, Lymphotoxin (x152, FAS,
FASL, RELT, DR6, TROY, NGFR.
In some embodiments, the additional therapeutic agent is a SMAC mimetic. SMAC
—100—
mimetics are compounds which bind to Inhibitor of sis Proteins (IAPs) and have
immune tory function and mediate the induction of systemic cytokines (e. g. IL—6,
TNFO. etc.) and ines (e.g. MCP-l) when administered to animals or humans. In
some embodiments, the SMAC mimetic is (i) LCL161, i.e. compound A in example 1 of
(page 28/29; [122]), or a pharmaceutically acceptable salt thereof; (ii)
the SMAC mimetic known as Debio-l 143, or a ceutically acceptable salt f;
(iii) the SMAC mimetic known as pant, or a pharmaceutically acceptable salt thereof;
(iv) the SMAC mimetic known as ASTX-660, or a ceutically acceptable salt
thereof; or (V) the SMAC mimetic known as CUDC-427, or a pharmaceutically acceptable
salt thereof.
In some embodiments, the additional immunotherapeutic agent is selected from (i)
antagonists of cytokines that inhibit T cell activation (e.g., IL-6, IL-10, TGF-B, VEGF;
"immunosuppressive cytokines") and/or (ii) agonists of cytokines that stimulate T cell
activation and/or cytokines such as IL2, for stimulating an immune response, e.g., for
treating proliferative diseases, such as cancer.
In some embodiments, the additional immunotherapeutic agent is an agonist of a protein
that ates T cell activation, such as CD28, GITRL, OX40L, CD27, and CD28H.
In some ments, the additional eutic agent is an oncolytic virus including but
not limited to an oncolytic virus derived from vaccinia Virus, adenovirus, (AdV), herpes
simplex virus (HSVl or HSV2), reovirus, myxoma virus (MYXV), poliovirus, vesicular
stomatitis Virus (VSV), Maraba Virus, varicella Virus, measles Virus (MV), or Newcastle
disease virus (NDV).
DLAGNOSTIC USES
The anti-DLL3 antibody molecules of the invention are useful in diagnostic and prognostic
methods and can be employed for labelling, localizing, or fying cells or tissues
expressing DLL3 (e.g. in ELISA assays, FACS analysis, immunohistology or the like) by
attaching a dye, a drug or another molecule with binding specificity for a ent antigen.
For example, a detectable label can be conjugated to the anti-DLL3 antibody molecule of
the invention or a secondary reagent binding ically to the antibody molecule of the
invention and being ated with a detectable label (e.g. a secondary antibody) can be
used in such diagnostic methods. In some embodiments, DLL3 specific antibodies
—lOl—
specifically bind to DLL3 expressed in cells, either in the cytoplasm and/or at the cell
surface, and are used for localizing and/or identifying such cells. In some embodiments,
the DLL3 c antibodies provided herein are used for identifying cells or tissues
expressing DLL3 (e. g. tumor cells).
Antibodies of the invention are selected such that they have a high level of epitope binding
city and high binding affinity to the DLL3 polypeptide. In l, the higher the
binding y of an antibody, the more stringent wash ions can be performed in an
immunoassay to remove nonspecifically bound material without removing the target
polypeptide.
Thus, further ed herein are methods of detecting DLL3 in a biological sample.
Specifically, in one aspect the ion provides a method of detecting DLL3 in a sample
(e.g. a tissue sample, a tumor tissue sample) comprising
(a) contacting the sample with an antibody of the invention; and
(b) detecting anti—DLL3 antibody bound to DLL3.
A biological sample can be obtained/isolated from any tissue (including biopsies), cell or
body fluid of a t. In a preferred embodiment, the sample is a tissue sample,
preferably a tumor tissue sample. In a specific embodiment, the sample is a fixed (tumor)
tissue sample, preferably a formalin-fixed, paraffin—embedded (FFPE) tissue sample, more
ably a formalin—fixed, paraffin—embedded (FFPE) tumor tissue sample.
The samples are typically divided into several portions and affixed to a medium for
microscopic analysis, such as a microscope slide. Where the sample is a tissue sample, the
l portions may be tissue sections. In some embodiments, serial sections are taken
from FFPE tissue samples. In some ments, serial sections are taken from a plurality
of different sites of a FFPE block, which can be done to capture both intra—section
heterogeneity and intra-block heterogeneity. In some embodiments, serial sections are
taken from a plurality of different biopsy samples taken from different locations in the
same tumor, which can be done to capture both section heterogeneity and intra—tumor
heterogeneity. Typically, tissue samples first undergo deparaffinization, antigen retrieval
(e.g. with Proteinase K) before antigen ion. The tissue sample can be
obtained/isolated from a variety of tissues (e. g. from a bi0psy), specifically tissues
obtained from tumors including but not limit to SCLC, LCNEC, glioma, glioblastoma,
—102—
melanoma, or other neuroendocrine tumors (e.g., neuroendocrine prostate cancer or
neuroendocrine pancreatic cancer, small cell bladder cancer).
Further exemplary tumors from which a e) sample can be obtained/isolated include
lung cancer; preferably SCLC, NSCLC or LCNEC; ; cervical; colon; colorectal;
endometrial; head and neck; liver (hepatoblastoma or hepatocellular oma); ovarian;
pancreatic; prostate; skin; gastric; testis; thyroid; adrenal; renal; bladder; uterine;
esophageal; urothelial cancer; brain tumor; lymphoma; Ewing sarcoma; and other
neuroendocrine (including pseudo—endocrine tumors) and small blue round cell tumors.
Exemplary methods of DLL3 detection in a sample are immunocytochemistry (ICC),
immunohistochemistry (IHC), Western Blotting, Flow cytometry and/or ELISA.
In a preferred embodiment, DLL3 is detected using IHC.
In a c aspect of the ion, the method of detecting DLL3 in a tissue sample
comprises
a) contacting a tissue sample (e. g. a tumor tissue such as SCLC, astoma or
ndocrine tumors), preferably said tissue sample is a fixed tissue sample (e. g.,
formalin-fixed and paraffin embedded), with an antibody of the invention (e. g.
DLL3#1 or DLL3#5)
b) permitting formation of antibody-antigen complexes in the sample, and
c) detecting the anti-DLL3 antibody bound to DLL3.
In some embodiments of the methods of the invention, the anti-DLL3 antibody is detected
by a able signal, preferably, the detectable signal is generated by a detectable label.
In a red embodiment of the method of the invention, the detectable signal is detected
in an IHC assay. In some embodiments, the detectable signal is detected in an ELISA
assay, by flow cytometry or by Western blot. In some embodiments, the methods described
herein can be used to detect DLL3 present on the cell surface of a cell (e. g. a tumor cell),
for example using flow cytometry. In some embodiments, the methods described herein
can be used to detect the presence of DLL3 in a tissue sample (e. g. tumor tissue sample)
using ELISA, Western blot or IHC.
In some embodiments, the able label is directly conjugated to the anti—DLL3
antibody and thus is deposited on the sample upon binding of the anti-DLL3 antibody to
DLL3, this is generally referred to as a direct labeling method). Direct ng methods
—103—
are often more directly quantifiable, but often suffer from a lack of sensitivity. In other
embodiments, tion of the detectable label is effected by the use of a secondary
detection reagent binding specifically to the antibody molecule of the invention and being
conjugated with a detectable label (e. g. a secondary antibody), this is generally referred to
as an indirect labeling method. In some embodiments, the specific secondary detection
reagent may be a species—specific secondary antibody, an apten antibody g to a
hapten—conjugated anti-DLL3 antibody, or a biotin—binding protein bound to a biotinylated
anti-DLL3 antibody).
Particular examples of detectable labels that can be conjugated either to the anti-DLL3
antibody of the invention or to a secondary detection reagent, include chromogenic,
fluorescent, orescent, luminescent and radioactive molecules and materials,
catalysts (such as enzymes) that convert one substance into another substance to provide a
detectable difference (such as by converting a colorless substance into a colored substance
or vice versa, or by producing a precipitate or increasing sample turbidity), haptens that
can be detected through antibody-hapten binding interactions using additional detectably
labeled dy conjugates, and paramagnetic and magnetic molecules or materials.
For example, the detectable label can be an enzyme such as adish peroxidase (HRP),
alkaline atase (AP), acid phosphatase, glucose oxidase, B—galactosidase, B—
glucuronidase, and B—lactamase; a fluorphore such as ceins, phores,
ins, BODIPY dyes, resorufins, and rhodamines; nanoparticles such as quantum
dots (US. Pat. Nos. 6,815,064, 6,682,596 and 6,649,138); metal chelates such as DOTA
and DPTA chelates of radioactive or paramagnetic metal ions like Gd <3 +>; and
liposomes, for example, liposomes containing trapped fluorescent molecules.
Where the detectable label includes an enzyme, a detectable substrate such as a
chromogen, a enic compound, or a luminogenic compound can be used in
combination with the enzyme to generate a detectable signal. Particular examples of
genic compounds include diaminobenzidine (DAB), 4-nitrophenylphospate
, fast red, bromochloroindolyl ate (BCIP), nitro blue tetrazolium (NBT),
BCIP/NBT, fast red, AP Orange, AP blue, tetramethylbenzidine (TMB), 2,2'— azino—di-[3-
ethylbenzothiazoline sulphonate] (ABTS), o-dianisidine, 4- chloronaphthol (4-CN),
nitrophenyl- -D-galactopyranoside (ONPG), o- phenylenediamine (OPD), 5—bromo—4-
indoly - -galactopyranoside ), umbelliferyl- —D-galactopyranoside
(MU-Gal), p-nitrophenyl- a-D-galactopyranoside (PNP), 5—bromo-4—chloro—3-indolyl- —D-
— l 04—
WO 34220
glucuronide (X—Gluc), 3-aminoethyl ol (AEC), fuchsin, trotetrazolium
(INT), tetrazolium blue and tetrazolium violet.
In some examples, the detectable moiety is a hore, which belongs to several
common chemical classes including coumarins, fluoresceins (or fluorescein derivatives and
analogs), rhodamines, resorufins, luminophores and cyanines.
In other ments, the detectable moiety is a molecule detectable via brightfleld
microscopy, such as dyes including diaminobenzidine (DAB), 4-(dimethylamino)
azobenzene—4'- sulfonamide (DABSYL), tetramethylrhodamine (DISCOVERY Purple),
N,N'—biscarboxypentyl—5,5'—disulfonato—indo— dicarbocyanine (Cy5), and Rhodamine 110
(Rhodamine).
Haptens are small molecules that are specifically bound by antibodies, although by
themselves they will not elicit an immune response in an animal and must first be attached
to a larger carrier molecule such as a protein to generate an immune response. Examples of
s include di—nitrophenyl, biotin, digoxigenin, and fluorescein.
Further ed herein in one aspect are methods of diagnosing or fying a tumor as
DLL3 expressing tumor (expressing DLL3 in the cytoplasm and/or the cell surface),
comprising detecting DLL3 in a sample (e.g. a tumor tissue sample) of the subject using
the anti-DLL3 antibodies (e. g. DLL3#1 or DLL3#5) of the invention (e.g. using IHC on a
tumor tissue sample). In a further aspect, provided herein are methods of selecting a DLL3
targeted therapy for a subject, comprising detecting DLL3 in a sample (e.g. a tumor tissue
sample) of the t using the anti-DLL3 dies (e.g. DLL3#1 or DLL3#5) of the
invention (e.g. using IHC on a tumor tissue sample). In a r aspect, provided herein
are methods of monitoring the therapeutic effect (e.g. of a DLL3 ted therapy) in a
subject, comprising ing DLL3 in a sample (e.g. a tumor tissue sample) of the subject
using the anti-DLL3 antibodies (e.g. DLL3#1 or DLL3#5) of the invention (e.g. using IHC
on a tumor tissue sample).
The anti-DLL3 antibody molecules of the invention can also be used for targeting cells. In
some embodiments, the DLL3 specific antibodies provided herein are used for delivering a
drug or cytotoxic agent to a target cell (e.g. a tumor cell expressing DLL3) by attaching
such drug or cytotoxic agent to said DLL3 antibody, thereby, for example, killing said
target cell.
—105—
KITS
The ion also encompasses kits comprising at least a multi-specific binding protein of
the invention (e.g., any one of DLL3#l/CD3#1, DLL3#2/CD3#1, DLL3#3/CD3#1,
/CD3#1, DLL3#5/CD3#1, DLL3#6/CD3#1, DLL3#7/CD3#1, DLL3#8/CD3#1,
DLL3#9/CD3#1, DLL3#10/CD3#1, DLL3#11/CD3#1, DLL3#12/CD3#1,
DLL3#13/CD3#1, DLL3#14/CD3#1, DLL3#15/CD3#1, 6/CD3#1,
DLL3#17/CD3#1, DLL3#18/CD3#1, DLL3#1/CD3#2, DLL3#2/CD3#2, DLL3#3/CD3#2,
DLL3#4/CD3#2, DLL3#5/CD3#2, DLL3#6/CD3#2, DLL3#7/CD3#2, DLL3#8/CD3#2,
DLL3#9/CD3#2, DLL3#10/CD3#2, DLL3#11/CD3#2, DLL3#12/CD3#2,
DLL3#13/CD3#2, DLL3#14/CD3#2, DLL3#15/CD3#2, DLL3#16/CD3#2,
DLL3#17/CD3#2, DLL3#18/CD3#2, /CD3#3, /CD3#3, DLL3#3/CD3#3,
DLL3#4/CD3#3, DLL3#5/CD3#3 and DLL3#6/CD3#3, DLL3#7/CD3#3,
DLL3#8/CD3#3, DLL3#9/CD3#3, DLL3#10/CD3#3, DLL3#11/CD3#3,
2/CD3#3, DLL3#l3/CD3#3, 4/CD3#3, DLL3#15/CD3#3,
DLL3#16/CD3#3, DLL3#17/CD3#3, 8/CD3#3, preferably any one of
DLL3#1/CD3#1, DLL3#1/CD3#2, DLL3#1/CD3#3, /CD3#1, DLL3#2/CD3#2,
DLL3#2/CD3#3, DLL3#3/CD3#1, DLL3#3/CD3#2, DLL3#3/CD3#3) and optionally one
or more other components selected from the group consisting of other drugs used for the
treatment of the diseases and disorders as described above.
In one embodiment, the kit es a composition containing an effective amount of a
binding protein of the invention in unit dosage form.
The invention also encompasses kits comprising at least a multi-specific binding protein of
the invention, and one or more other components ed from the group consisting of
other drugs used for the treatment of the diseases and disorders as described above.
In one embodiment, the kit includes a composition containing an effective amount of a
multi-specific binding protein of the invention in unit dosage form (preferably any one of
DLL3#l/CD3#1, DLL3#1/CD3#2, DLL3#l/CD3#3, DLL3#2/CD3#1, DLL3#2/CD3#2,
DLL3#2/CD3#3, DLL3#3/CD3#1, DLL3#3/CD3#2, DLL3#3/CD3#3). In a further
embodiment the kit includes both a composition containing an effective amount of a multi-
c binding protein of the invention in unit dosage form (preferably any one of
DLL3#l/CD3#1, DLL3#l/CD3#2, DLL3#1/CD3#3, /CD3#1, DLL3#2/CD3#2,
DLL3#2/CD3#3, DLL3#3/CD3#1, DLL3#3/CD3#2, DLL3#3/CD3#3) and a composition
—106—
containing an effective amount of a PD-l antagonist in unit dosage form, such as an anti
PD-l antibody, most preferably PDl-l and PDl-5 as described
, PD1-2, PD1-3, PDl-4,
herein (e.g. Table A) and in W02017/l9874l.
In some embodiments, the kit comprises a sterile container which contains such a
composition; such containers can be boxes, es, bottles, vials, tubes, bags, pouches,
blister-packs, or other le container forms known in the art. Such containers can be
made of plastic, glass, laminated paper, metal foil, or other materials suitable for holding
medicaments. Further, the kit may comprise the pharmaceutical composition in a first
container with the binding protein of the invention in lyophilized form and a second
ner with a pharmaceutically able diluent (e.g., sterile water) for injection. The
pharmaceutically able diluent can be used for reconstitution or dilution of the
binding protein.
If desired, a specific binding n of the invention, is provided together with
instructions for administering the multi-specific binding proteins to a subject having
cancer. The instructions will generally e information about the use of the
composition for the treatment or prevention of a . In other embodiments, the
instructions include at least one of the following: description of the therapeutic agent;
dosage schedule and stration for treatment or prevention of cancer or symptoms
thereof; precautions; warnings; indications; counter—indications; overdosage information;
adverse reactions; animal cology; clinical studies; and/or references. The
instructions may be printed directly on the container (when present), or as a label d
to the container, or as a separate sheet, pamphlet, card, or folder supplied in or with the
container.
As set forth , the present disclosure further provides diagnostic methods for
determining the expression of DLL3 in a biological sample. In one aspect, the present
disclosure provides kits for performing these methods as well as instructions for carrying
out the s of the present disclosure such as collecting tissue and/or performing the
detection assay, and/or analyzing the results.
The kit comprises, or atively consists essentially of, or yet further consists of, a
DLL3 antibody composition of the invention (e. g., monoclonal antibodies) and instructions
for use. The kits are useful for detecting the presence of DLL3 polypeptides in a biological
sample e. g., any body fluid or biopsy samples of body tissue. In some embodiments, the kit
—107—
can comprise: one or more DLL3 antibodies e of binding a DLL3 polypeptide in a
sample (e.g., anti-DLL3 dy DLL3#l or DLL3#5); means for ing the DLL3
polypeptide in the sample; and optionally means for ing the signal/amount of the
DLL3 ptide in the sample with a control. One or more of the anti-DLL3 antibodies
of the invention may be labeled. The kit components, (e. g., reagents) can be packaged in a
suitable container. The kit can further se instructions for using the kit to detect the
DLL3 polypeptides. In certain embodiments, the kit comprises an anti-DLL3 antibody of
the invention (a first antibody) and a second, different antibody which binds to either the
DLL3 polypeptide or the first antibody and is conjugated to a detectable label.
The kit can also comprise, e.g., a buffering agent, a preservative or a protein—stabilizing
agent. The kit can further comprise components necessary for detecting the detectable—
label, e.g., an enzyme or a substrate. The kit can also contain a control sample or a series of
control samples, which can be assayed and compared to the test sample. Each component
of the kit can be enclosed within an dual container and all of the various containers
can be within a single package, along with instructions for reting the results of the
assays performed using the kit. The kits of the present disclosure may contain a written
product on or in the kit container. The written product describes how to use the ts
contained in the kit.
As amenable, these suggested kit ents may be packaged in a manner customary for
use by those of skill in the art. For example, these suggested kit components may be
provided in solution or as a liquid dispersion or the like.
EXAMPLES
The following examples rate the invention. These examples should not be construed
as to limit the scope of this invention.
Example 1: Design and construction of CD3/DLL3 binding proteins
The present inventors have developed multi—specif1c binding proteins that bind DLL3 and
CD3 and that induce T-cell activation leading to lysis of DLL3 -expressing tumor cells. The
molecular design used has an IgG dy scaffold and an IgG-like structure. It features
knob-in-hole technology in the Fe for hetero-dimerization of the Knob (anti-DLL3) and
—108—
Hole (anti—CD3) arms. In addition, the binding n has flexible peptide sequences
between the light and the corresponding heavy chain in each arm. Thus, the binding protein
comprises two arms, one binding to CD3, the other one binding to DLL3, each arm
comprising a single chain Fab and an Fc region.
Preferably the binding molecule is bispecific and bivalent (monovalent for each of the two
targets).
Preparation of binding domains that recognize DLL3 and CD3 using high throughput
V gene ry from hybridomas and cultured single B cells.
To obtain anti-DLL3 binders, hybridomas or single B cells derived from DLL3 immunized
wild-type and AlivaMab humanized mice (Ablexis, San Francisco, CA, USA: ab
transgenic mouse rm with human immunoglobulin loci) were cultured in Vitro.
Supernatants were screened for reactivity t recombinant human DLL3, by
AlphaLISA (PerkinElmer, Waltham, MA, USA), and against SHP77 cells (ATCC®, CRL—
2195TM) expressing human DLL3, by Flow Cytometry.
Immunoglobulin (Ig) VH and VL genes were then amplified from fied positive
. To isolate RNA from hybridomas, about 2x106 cells from single clones were
pelleted and used as source al. For single B cells, 100 to 500 cells expanded from
singularly ed B cells were used as source material. RNA was isolated using RNeasy
Plus (Qiagen, Hilden, Germany). cDNA was then sized using Smarter cDNA
synthesis kit (Clontech, Mountain View, CA) according to manufacturer’s instructions. To
facilitate cDNA synthesis, oligodT was used to prime reverse transcription of all
messenger RNAs ed by “5’ capping” with a Smarter IIA oligonucleotide.
Subsequent amplification of the VH and VL fragments was performed using a 2-step PCR
amplification using 5’ primers targeting the Smarter IIA cap and 3 ’ primers targeting
consensus regions in CHl. Briefly, each Soul PCR reaction consists of 20uM of forward
and reverse primer mixes, 25 ul of PrimeStar Max DNA polymerase premix (Clontech), 2ul
rified cDNA, and 21 ul of double-distilled H20. The cycling program starts at 94
0C for 3 min, followed by 35 cycles (94°C for 30 Sec, 50°C for l min, 68 °C for l min),
and ends at 72 °C for 7 min. The second round PCR was performed with VL and VH 2nd
round primers containing 15bp complementary extensions that “overlap” respective
regions in their respective pTT5 mother vector (VH and VL). Second round PCR was
—109—
performed with the following program: 94 0C for 3 min; 35 cycles (94 °C for 30 Sec, 50°C
for l min, 68 0C for l min), and ends at 72 °C for 7 min.
In—Fusion® HD Cloning Kit (Clontech, USA.) was used for directional cloning of VL
gene into a pTTS hngK vector and VH gene into a pTTS hngGlKO vector. To facilitate
In—Fusion® HD Cloning, PCR products were purified and treated with g Enhancer
before In—Fusion HD Cloning. Cloning and transformation were performed according to
manufacturer’s protocol (Clontech, U.S.A.). Mini—prep DNAs were subjected to Sanger
sequencing to confirm that te V-gene fragments were obtained.
Using this methodology, pairs of Ig VH and VL genes encoding binding s with
specificity for DLL3 were prepared. inant antibodies were produced by transient
transfection of CHO-E37 cells with the corresponding heavy and light chain-encoding
Confirmatory screening of recombinant antibodies
Supernatants containing expressed recombinant antibodies were assayed by flow
cytometry for binding to cell lines sing human or cyno DLL3. Briefly, cells were
incubated with recombinant supernatants, washed, and bound mAbs from the supernatants
were detected with anti—human—IgG—APC (Jackson ImmunoResearch 109—136—098).
Signal-to-background ratios (S/B) were calculated by dividing the median fluorescence
intensity (MFI) of the sample by that of e control (variable regions against an
unrelated protein and different constant region backbones).
e Plasmon Resonance (SPR) on Biacore 400 was performed on recombinant
supernatants. Briefly, the non-optimized IgGs in the HTP supernatants were captured via
Protein A/G onto the sensor surface for 60 sec at 10 ul/min. Binding of 100 nM human
DLL3 to the captured IgGs was monitored for 180 sec of association at 30 ul/min, ed
by 120 sec of dissociation in the HBS-EP buffer. Regeneration of the Protein A/G surface
was performed with Glycine pH 2.1 in between each binding cycle. The following
materials were used in this assay: Protein t: recombinantly expressed human DLL3.
System running buffer: HBS-EP (10 mM HEPES pH 7.4, 150 mM NaCl, 3 mM EDTA,
and 0.005% V/V rbate P20). ing reagent: Protein A/G G (ThermoFisher
Scientific, Waltham, MA, USA), with specificity towards all human IgG isotypes.
—llO—
Clones of interest (with Kd<300pM) were selected for pecific ting.
Multispecific binding proteins were generated and further evaluated in mechanistic and
functional screening (such as cell binding, cytotoxicity and T cell activation as described
below).
Humanization of DLL3 and CD3 s
Sequences of DLL3 binders as described above as well as CD3 binders described in the
ture (Pessano et al., EMBO J. 1985 Feb; 4(2): 337-44; Salmerén A et al., J l.
1991 Nov 1;147(9):3047—52) were humanized and/or optimized. Sequence
optimization/humanization of antibodies is a methodology to engineer antibodies raised in
non-human species (against a specific antigen/ epitope) for use as therapeutics that
resemble antibodies produced in humans and thereby eliminating potential adverse effects
such as genicity while retaining the specificity. The sequence
zation/humanization approach utilized here was as described by Singh et a1, 2015
(Singh S et al., mAbs 2015: 7(4):778-91). In brief, closely matching human germlines were
fied in silica, and optimization/humanization variants were evaluated using a phage
screening method. Final lead candidate sequences were selected based on g, percent
human score and Epivax (in silico predictive tool for potential genicity) score.
Construction of bispecific proteins binding DLL3 and CD3
The variable regions of the DLL3 and CD3 s were cloned into the expression vector
pTT5 (National Research Council, Canada), using common molecular biology techniques
to form bispecific binding proteins with one DLL3 specific binding unit comprising a
single chain Fab binding to DLL3 and an Fc region (such binding unit also referred to
herein as “DLL3 arm” or “DLL3 chain”) and a CD3 specific binding unit comprising a
single chain Fab binding to CD3 and an Fc region (such binding unit also referred to herein
as “CD3 arm” or “CD3 chain. The Fc regions of the DLL3 and CD3 arms include either
“Knob” or “Hole” mutations (Atwell et a1, JMB, 1997, 270, 26—35) and the respective
chains are referred to as Knob or Hole chains. For fragment DNA ly, a
Gibson—assembly and NEBuilder HiFi DNA assembly approaches were used, following
manufacturer’s protocols (New England Biolabs, Ipswich, MA, USA). DNA mini-preps
were sequenced.
—lll—
Each expression vector contains eukaryotic promoter elements for the chain—encoding gene
(DLL3 or CD3 arm/chain), i.e., the gene encoding the signal sequence and the light and
heavy chain, an expression cassette for a prokaryotic selection marker gene such as
ampicillin, and an origin of replication. These DNA plasmids were propagated in
ampicillin resistant E. coli colonies and cultures and were purified.
Example 2: Expression and purification of bispecific, bivalent binding proteins
binding DLL3 and CD3
Bispecific molecules binding DLL3 and CD3 were produced by transient transfection of
CHO—E cells with the pTTS vectors carrying the DLL3/CD3—chain—encoding genes.
Briefly, transfected CHO—E cells g in suspension in serum—free media were
cultivated in shake flasks under agitation at 140 rpm, 37°C and 5% C02 and kept at
ions of exponential growth. On the day of transfection, cells were chemically
transfected with Knob-chain plasmid and Hole-chain plasmid in 1:3 mass ratio. They were
then seeded at l to 2x10A6 cells/ml in l L of Gibco® FreeStyleTM CHO expression
medium echnologies, NY, US). Cells were then incubated under orbital shaking for
days with one-time feeding of 200 ml commercial feed solution to allow expression of
the proteins. Antibody titers in the cell culture supernatants were determined using an
Octet® instrument (Pall ForteBio, CA, US) and protA biosensor tips according to
manufacturer’s ctions.
Recombinant DLL3/CD3 g proteins were purified from culture supernatant in a two-
step process: first by n A affinity chromatography using MabSelectTM column (GE
Healthcare); second, by Cation exchange chromatography using a Poros 50 HS column
(Applied tems, Carlsbad, CA, USA). The two—step purified material was stored in
final buffer of 50mM Sodium Acetate and IOOmM NaCl, pH 5.0 Purity and degree of
heterogeneity of the s were assessed by analytical size-exclusion chromatography,
mass spectrometry and analytical ultracentrifugation. Samples that were advanced for
functional testing comprised two-step purified material, with about 99% monomer t.
Table 1: Amino acid ces and SEQ ID NOs of CDRs, VH, VL, scFabs, DLL3—arm
and m sequences of the ns/antibody constructs described herein:
—112—
2019/064942
SEQ ID Brief ce
Number description
ofsequence
SEQID DLLfifl RASQSVSSNFLV
h021 LCCDR1
SEQID DLLfifl GASTRAS
BOQ LCCDRZ
SEQ ID DLL3#1 QQYGDSPYT
ROS LCCDR3
SEQ ID DLL3#1 GNTFTNYYMH
BOA HCCDR1
SEQID DLLfifl HDPSVGSKSYAQKFLG
h05 HCCDRZ
SEQID DLLfifl AGKRFGESYFDY
hOfi HCCDR3
SEQ ID DLL3#2 RASQGISNYLA
hOfl LCCDR1
SEQ ID DLL3#2 AASSLQS
BO£ LCCDRZ
SEQ ID DLL3#2 LQHNSSPYT
h09 LCCDR3
SEQ ID DLL3#2 GYTFTSYYMH
ROAO HCCDR1
SEQID DLLfifl HNPSGGSTSYAQKFQG
ROfll HCCDRZ
SEQ ID DLL3#2 GEAVGGNYYYYGMDV
ROAZ HCCDR3
SEQ ID DLL3#3 RASQGISNYLV
R0fl3 LCCDR1
SEQID DLLfiB AVSSLYS
R0fl4 LCCDR2
SEQID DLLfiB LQHDSYPYT
ROAS LCCDR3
SEQID DLLfiB GYTFTSYYVH
R0fl6 HCCDR1
SEQID DLLEB HNPGGGTTSYAQKFLG
—113—
SEQ ID Brief Sequence
Number description
of sequence
N0:17 HCCDR2
SEQ ID DLL3#3 NYFYYGMDV
N0:18 HCCDR3
SEQ ID DLL3#4 RASKSVSSFGYSFMH
N0:19 LCCDRl
SEQ ID DLL3#4 LASNLES
N020 LCCDR2
SEQ ID DLL3#4 QHSRELPWT
N021 LCCDR3
SEQ ID DLL3#4 VYTFTSYFMY
N022 HCCDRl
SEQ ID DLL3#4 EISPTNGNSNLNERFKN
N023 HCCDR2
SEQ ID DLL3#4 GGDGYLDY
N024 HCCDR3
SEQ ID DLL3#5 QASQDISNYLN
N025 LCCDRl
SEQ ID DLL3#5 DASNLET
N026 LCCDR2
SEQ ID DLL3#5 QQYDNLPTWT
N027 LCCDR3
SEQ ID DLL3#5 YYIH
N028 HCCDRl
SEQ ID DLL3#5 WINPNSGGTNYAQKFQG
N029 HCCDR2
SEQ ID DLL3#5 GWDY
N0230 HCCDR3
SEQ ID DLL3#6 RASQDISNYFA
N0231 LCCDRI
SEQ ID DLL3#6 AASTLQS
N0232 LCCDR2
SEQ ID DLL3#6 QQLNSYPYT
N0233 LCCDR3
—114—
SEQ ID Brief Sequence
Number ption
ofsequence
SEQ ID DLL3#6 GGSISSYFWS
NO:34 HCCDR1
SEQ ID DLL3#6 STNYNPSLNS
NO:35 HCCDRZ
SEQ ID DLL3#6 RGDWGGFDI
NO:36 HCCDR3
SEQ ID DLL3#1 EIVLTQSPGTLSLSPGERATLSCRASQSVSSNFLVWYQQKPG
NO:37 VL QAPRPLIYGASTRASGIPDRFSGSGSGADFTLTISRLEPEDFAL
YYCQQYGDSPYTFGQGTTLEIK
SEQ ID DLL3#1 QVQLVQSGAEVKKPGASVKVSCKASGNTFTNYYMHWVRQ
N0238 VH APGPGLEWMGIIDPSVGSKSYAQKFLGRVTIARDTSTSTVFL
DLYSLRSEDTAVYFCARAGKRFGESYFDYWGQGTLVTVSS
SEQ ID DLL3#2 DIQMTQSPSAMSASVGDRVTITCRASQGISNYLAWFQQKPG
NO:39 VL KVPEPLIYAASSLQSGVPSRFSGSGSVTEFTLTISSLQPEDFAT
NSSPYTFGQGTKLEIK
SEQ ID DLL3#2 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQ
NO:40 VH APGQGLEWMGIINPSGGSTSYAQKFQGRVTMTRDTSTSTW
MELSSLRSEDTAVYYCARGEAVGGNYYYYGMDVWGQGTT
VTVSS
SEQ ID DLL3#3 DIQMTQSPSAMSASVGDRVTITCRASQGISNYLVWFQQKPG
NO:41 VL KAPKRLIYAVSSLYSGVPSRFSGSGSGTEFTLTISSLQPEDFAT
YYCLQHDSYPYTFGQGTKLEIK
SEQ ID DLL3#3 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYVHWVRQ
NO:42 VH APGQGLEWMVIINPGGGTTSYAQKFLGRVTMTRDTSTNTVY
MELKSLRSEDTAVYYCARGEAVTGNYFYYGMDVWGQGTT
VTVSS
SEQ ID DLL3#4 DIVLTQSPASLAVSLGQRATISCRASKSVSSFGYSFMHWYQQ
NO:43 VL KPGQPPKLLIYLASNLESGVPARFSGSGSGTDFTLNIHPVEEE
DAATYYCQHSRELPWTFGGGTKLEIK
SEQ ID DLL3#4 QVQLQQSGTELVKPGASVKLSCKASVYTFTSYFMYWVKQR
NO:44 VH PGHGLEWIGEISPTNGNSNLNERFKNKATLTVDKSSSTAYM
QLSSLTSEDSAVYYCTRGGDGYLDYWGQGTTLTVSS
SEQ ID DLL3#5 DIQMTQSPSSLSASVGDRVTVTCQASQDISNYLNWYQQKPG
—115—
SEQ ID Brief Sequence
Number description
of sequence
NO:45 VL KAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIAT
YYCQQYDNLPTWTFGQGTKVEIK
SEQ ID DLL3#5 QVQLVQSGAEVKKPGASVKVSCKASGFTFTGYYIHWVRQA
NO:46 VH PGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDSSINTAF
MELSRLTSDDTAVYYCAAGWDYWGQGTLVTVSS
SEQ ID DLL3#6 DIQLTQSPSFLSTSVGDRVTITCRASQDISNYFAWYQQKPGK
NO:47 VL YAASTLQSGVPSRFSGGGSGTEFTLTISSLQPEDFAT
YYCQQLNSYPYTFGQGTKLEIK
SEQ ID DLL3#6 QVQLQESGPGLVKPSETLSLTCTVSGGSISSYFWSWIRQPAG
NO:48 VH KGLEWIGRIYTSGSTNYNPSLNSRLTMSVDTSKNQFSLKLSS
VTAADTAV Y Y CARRGDWGGFDIWGQGTVVTVSS
SEQ ID DLL3#1 EIVLTQSPGTLSLSPGERATLSCRASQSVSSNFLVWYQQKPG
NO:49 scFab QAPRPLIYGASTRASGIPDRFSGSGSGADFTLTISRLEPEDFAL
GDSPYTFGQGTTLEIKRTVAAPSVFIFPPSDEQLKS
GTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD
SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF
NRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGG
QSGAEVKKPGASVKVSCKASGNTFTNYYMHWVR
QAPGPGLEWMGIIDPSVGSKSYAQKFLGRVTIARDTSTSTVF
LDLYSLRSEDTAVYFCARAGKRFGESYFDYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN
SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV
NHKPSNTKVDKRVEPKSC
SEQ ID DLL3#2 DIQMTQSPSAMSASVGDRVTITCRASQGISNYLAWFQQKPG
NO:50 scFab KVPEPLIYAASSLQSGVPSRFSGSGSVTEFTLTISSLQPEDFAT
YYCLQHNSSPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSG
TASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS
KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF
NRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGG
SQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVR
QAPGQGLEWMGIINPSGGSTSYAQKFQGRVTMTRDTSTSTV
YMELSSLRSEDTAVYYCARGEAVGGNYYYYGMDVWGQGT
TVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP
—116—
2019/064942
SEQ ID Brief Sequence
Number description
of sequence
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKRVEPKSC
SEQ ID DLL3#3 SPSAMSASVGDRVTITCRASQGISNYLVWFQQKPG
N025 1 scFab KAPKRLIYAVSSLYSGVPSRFSGSGSGTEFTLTISSLQPEDFAT
YYCLQHDSYPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKS
GTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD
SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF
GGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGG
SQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYVHWVRQ
APGQGLEWMVIINPGGGTTSYAQKFLGRVTMTRDTSTNTVY
MELKSLRSEDTAVYYCARGEAVTGNYFYYGMDVWGQGTT
VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSWTVPSSSLGTQ
TYICNVNHKPSNTKVDKRVEPKSC
SEQ ID DLL3#4 DIVLTQSPASLAVSLGQRATISCRASKSVSSFGYSFMHWYQQ
NO:52 scFab KPGQPPKLLIYLASNLESGVPARFSGSGSGTDFTLNIHPVEEE
DAATYYCQHSRELPWTFGGGTKLEIKRTVAAPSVFIFPPSDE
QLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESV
TEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
VTKSFNRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKS
TGGGGSQVQLQQSGTELVKPGASVKLSCKASVYTFTSYFMY
WVKQRPGHGLEWIGEISPTNGNSNLNERFKNKATLTVDKSS
STAYMQLSSLTSEDSAVYYCTRGGDGYLDYWGQGTTLTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN
VNHKPSNTKVDKRVEPKSC
SEQ ID DLL3#5 DIQMTQSPSSLSASVGDRVTVTCQASQDISNYLNWYQQKPG
NO:53 scFab KAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIAT
YYCQQYDNLPTWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLK
SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQ
DSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTK
SFNRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGG
GGSQVQLVQSGAEVKKPGASVKVSCKASGFTFTGYYIHWV
—117—
W0 20191234220
SEQ ID Brief Sequence
Number ption
ofsequence
RQAPGQGLEWWKHVDWNSGGTNYAQKFQGRVTMTRDS$N
TAFMELSRLTSDDTAVYYCAAGWDYWGQGTLVTVSSASTK
GPSVFPLAPSSKSTSGGTAALGCLVKIBTTEPVTVSVWNSGAL
TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVTHHK
PSNTKVDKRVEPKSC
SEQ ID DLL3#6 DIQLTQSPSFLSTSVGDRVTITCRASQDISNYFAWYQQKPGK
N054 scFab APKLLIYAASTLQSGVPSRFSGGGSGTEFTLTISSLQPEDFAT
YYCQQLNSYPYTFGQGTKLEHKRTVAAPSVFHTPSDEQLKS
GTASVVCLLNNFYPREAKNTBNKVDNALQSGNSQESVTEQD
SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF
NRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGG
SQVQLQESGPGLVKP$HISLTCTVSGGSSSYFWSWHRQPA
GKGLEWIGRIYTSGSTNYNPSLNSRLTMSVDTSKNQFSLKLS
SVTAADTAVYYCARRLHNNGGFDDNGQGTVVTVSSASTKGP
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS
GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYHHVVNHKPS
RVEPKSC
SEQID CD3#1 RSSTGAVTTSNYAN
N055 LCCDRI
SEQID CD3#1 GTNKRAP
N056 LCCDR2
SEQ ID CD3#1 ALWYSNLWV
N057 LCCDR3
SEQID CD3#1 GFTFNTYALHQ
N058 HCCDRI
SEQID CD3#1 IURSKXTDWLATYYADSVKD
N059 HCCDR2
SEQID CD3#1 HGNFGNSYVSWWAY
N050 HCCDR3
SEQID CD3#2 RSSTGAVTTSNYVUQ
N051 LCCDRI
SEQID CD3#2 GTNKRAP
N052 LCCDR2
—118—
SEQ ID Brief Sequence
Number description
of sequence
SEQ ID CD3#2 ALWYSNLWV
I\O:63 LCCDR3
SEQ ID CD3#2 GFTFNTYAMN
I\O:64 HCCDR1
SEQ ID CD3#2 RIRSKYINYATYYADSVKD
I\O:65 HCCDRZ
SEQ ID CD3#2 SYVSWFAY
I\O:66 HCCDR3
SEQ ID CD3#1 EAVVTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWVQEK
I\O:67 VL PGQLPRGLIGGTNKRAPWVPARFSGSLLGGKAALTLSGAQP
EDEAEYFCALWYSNLWVFGGGTKLTVL
SEQ ID CD3#1 SGGGLVQPGGSLKLSCAASGFTFNTYAMNWVRQA
N0268 VH PGKGLEWVARIRSKYNNYATYYADSVKDRFTISRDDSKNTA
LKTEDTAVYYCVRHGNFGNSYVSWFAYWGQGTL
VTVSA
SEQ ID CD3#2 EAVVTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWVQEK
NO:69 VL PGQLPRGLIGGTNKRAPWVPARFSGSLLGGKAALTLSGAQP
EDEAEYFCALWYSNLWVFGGGTKLTVL
SEQ ID CD3#2 EVQLVESGGGLVQPGGSLKLSCAASGFTFNTYAMNWVRQA
NO:7O VH PGKGLEWVARIRSKYINYATYYADSVKDRFTISRDDSKNTA
YLQMNNLKTEDTAVYYCVRHGNFGNSYVSWFAYWGQGTL
VTVSA
SEQ ID CD3#1 EAVVTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWVQEK
NO:71 scFab PGQLPRGLIGGTNKRAPWVPARFSGSLLGGKAALTLSGAQP
EDEAEYFCALWYSNLWVFGGGTKLTVLGQPKAAPSVTLFPP
SSEELQANKATLVCLISDFYPGAVKVAWKADGSPVNTGVET
TTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTV
EKTVAPAECSGGGGSEGKSSGSGSESKSTEGKSSGSGSESKS
TGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNTYAM
NWVRQAPGKGLEWVARIRSKYNNYATYYADSVKDRFTISR
DDSKNTAYLQMNNLKTEDTAVYYCVRHGNFGNSYVSWFA
YWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT
—119—
SEQ ID Brief Sequence
Number ption
of sequence
VPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
SEQ ID CD3#2 EAVVTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWVQEK
NO:72 scFab PGQLPRGLIGGTNKRAPWVPARFSGSLLGGKAALTLSGAQP
EDEAEYFCALWYSNLWVFGGGTKLTVLGQPKAAPSVTLFPP
SSEELQANKATLVCLISDFYPGAVKVAWKADGSPVNTGVET
TTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTV
EKTVAPAECSGGGGSEGKSSGSGSESKSTEGKSSGSGSESKS
TGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNTYAM
NWVRQAPGKGLEWVARIRSKYINYATYYADSVKDRFTISRD
DSKNTAYLQMNNLKTEDTAVYYCVRHGNFGNSYVSWFAY
WGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP
SSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
SEQ ID DLL3#1 EIVLTQSPGTLSLSPGERATLSCRASQSVSSNFLVWYQQKPG
NO:73 chain QAPRPLIYGASTRASGIPDRFSGSGSGADFTLTISRLEPEDFAL
YYCQQYGDSPYTFGQGTTLEIKRTVAAPSVFIFPPSDEQLKS
GTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD
SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF
NRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGG
SQVQLVQSGAEVKKPGASVKVSCKASGNTFTNYYMHWVR
QAPGPGLEWMGIIDPSVGSKSYAQKFLGRVTIARDTSTSTVF
RSEDTAVYFCARAGKRFGESYFDYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN
SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV
TKVDKRVEPKSCDKTHTCPPCPAPEAAGGPSVFLFP
PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEV
HNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLW
CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS
KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SEQ ID DLL3#2 DIQMTQSPSAMSASVGDRVTITCRASQGISNYLAWFQQKPG
NO:74 chain KVPEPLIYAASSLQSGVPSRFSGSGSVTEFTLTISSLQPEDFAT
YYCLQHNSSPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSG
—120—
SEQ ID Brief Sequence
Number description
of sequence
TASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS
KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF
NRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGG
SQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVR
QAPGQGLEWMGIINPSGGSTSYAQKFQGRVTMTRDTSTSTV
YMELSSLRSEDTAVYYCARGEAVGGNYYYYGMDVWGQGT
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEAAG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY
VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK
EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT
KNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS
LSLSPG
SEQ ID DLL3#3 SPSAMSASVGDRVTITCRASQGISNYLVWFQQKPG
NO:75 chain IYAVSSLYSGVPSRFSGSGSGTEFTLTISSLQPEDFAT
YYCLQHDSYPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKS
GTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD
SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF
NRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGG
SQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYVHWVRQ
APGQGLEWMVIINPGGGTTSYAQKFLGRVTMTRDTSTNTVY
MELKSLRSEDTAVYYCARGEAVTGNYFYYGMDVWGQGTT
VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
TYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEAAGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV
DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKE
YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTK
NQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL
SLSPG
—121—
SEQ ID Brief Sequence
Number description
of sequence
SEQ ID DLL3#4 DIVLTQSPASLAVSLGQRATISCRASKSVSSFGYSFMHWYQQ
NO:76 chain KPGQPPKLLIYLASNLESGVPARFSGSGSGTDFTLNIHPVEEE
DAATYYCQHSRELPWTFGGGTKLEIKRTVAAPSVFIFPPSDE
QLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESV
TEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
VTKSFNRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKS
TGGGGSQVQLQQSGTELVKPGASVKLSCKASVYTFTSYFMY
WVKQRPGHGLEWIGEISPTNGNSNLNERFKNKATLTVDKSS
STAYMQLSSLTSEDSAVYYCTRGGDGYLDYWGQGTTLTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN
VNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEAAGGPSVFL
DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE
VHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK
VSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS
LWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP
SEQ ID DLL3#5 DIQMTQSPSSLSASVGDRVTVTCQASQDISNYLNWYQQKPG
NO:77 chain KAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIAT
YYCQQYDNLPTWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLK
SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQ
DSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTK
SFNRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGG
LVQSGAEVKKPGASVKVSCKASGFTFTGYYIHWV
RQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDSSIN
TAFMELSRLTSDDTAVYYCAAGWDYWGQGTLVTVSSASTK
GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL
TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHK
PSNTKVDKRVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKP
KDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNA
KTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA
LPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLV
—122—
SEQ ID Brief Sequence
Number description
of sequence
KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT
QQGNVFSCSVMHEALHNHYTQKSLSLSPG
SEQ ID DLL3#6 DIQLTQSPSFLSTSVGDRVTITCRASQDISNYFAWYQQKPGK
NO:78 chain APKLLIYAASTLQSGVPSRFSGGGSGTEFTLTISSLQPEDFAT
YYCQQLNSYPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKS
GTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD
SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF
NRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGG
SQVQLQESGPGLVKPSETLSLTCTVSGGSISSYFWSWIRQPA
GKGLEWIGRIYTSGSTNYNPSLNSRLTMSVDTSKNQFSLKLS
SVTAADTAVYYCARRGDWGGFDIWGQGTVVTVSSASTKGP
SVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS
AVLQSSGLYSLSSWTVPSSSLGTQTYICNVNHKPS
NTKVDKRVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKD
TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKT
KPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKG
AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD
KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SEQ ID CD3#1 EAVVTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWVQEK
NO:79 chain PGQLPRGLIGGTNKRAPWVPARFSGSLLGGKAALTLSGAQP
EDEAEYFCALWYSNLWVFGGGTKLTVLGQPKAAPSVTLFPP
SSEELQANKATLVCLISDFYPGAVKVAWKADGSPVNTGVET
TTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTV
EKTVAPAECSGGGGSEGKSSGSGSESKSTEGKSSGSGSESKS
TGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNTYAM
NWVRQAPGKGLEWVARIRSKYNNYATYYADSVKDRFTISR
DDSKNTAYLQMNNLKTEDTAVYYCVRHGNFGNSYVSWFA
YWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT
VPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPC
PAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP
EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ
—123—
SEQ ID Brief Sequence
Number description
of sequence
DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP
PSREEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKT
TPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHN
LSLSPG
SEQ ID CD3#2 EAVVTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWVQEK
NO:80 chain PGQLPRGLIGGTNKRAPWVPARFSGSLLGGKAALTLSGAQP
EDEAEYFCALWYSNLWVFGGGTKLTVLGQPKAAPSVTLFPP
SSEELQANKATLVCLISDFYPGAVKVAWKADGSPVNTGVET
TTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTV
EKTVAPAECSGGGGSEGKSSGSGSESKSTEGKSSGSGSESKS
TGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNTYAM
NWVRQAPGKGLEWVARIRSKYINYATYYADSVKDRFTISRD
DSKNTAYLQMNNLKTEDTAVYYCVRHGNFGNSYVSWFAY
WGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP
QTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPA
PEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV
KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD
WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
REEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTP
PVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNRF
TQKSLSLSPG
SEQ ID Fc domain* DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV
NO:81 (IgGl) DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV
VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP
REPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESN
GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC
SVMHEALHNHYTQKSLSLSPG
SEQ ID Fc W domain DKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCV
NO:82 (IgG 1 , VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR
LALA) VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ
PREPQVYTLPPSREEMTKNQVSLWCLVKGFYPSDIAVEWES
NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
—124—
SEQ ID Brief Sequence
Number description
ence
CSVMHEALHNHYTQKSLSLSPG
SEQ ID Fc SAV DKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCV
NO:83 domain VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR
(IgG 1 , VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ
RF/LALA) PREPQVYTLPPSREEMTKNQVSLSCAVKGFYPSDIAVEWESN
GQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSC
SVMHEALHNRFTQKSLSLSPG
SEQ ID Fc domain ESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTC
NO:84 (IgG4Pro) VVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYR
VVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQ
PREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESN
GQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSC
SVMHEALHNHYTQKSLSLSLG
SEQ ID Fc W domain ESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTC
NO:85 (IgG4Pro) EDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYR
VVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQ
PREPQVYTLPPSQEEMTKNQVSLWCLVKGFYPSDIAVEWES
NGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFS
ALHNHYTQKSLSLSLG
SEQ ID Fc SAV ESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTC
NO:86 domain WVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYR
(IgG4Pro, VVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQ
RF) YTLPPSQEEMTKNQVSLSCAVKGFYPSDIAVEWES
NGQPENNYKTTPPVLDSDGSFFLVSRLTVDKSRWQEGNVFS
CSVMHEALHNRFTQKSLSLSLG
SEQ ID constant RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQW
NO:87 region of a KVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH
kappa light KVYACEVTHQGLSSPVTKSFNRGEC
chain
SEQ ID constant GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVKVA
NO:88 region of a WKADGSPVNTGVETTTPSKQSNNKYAASSYLSLTPEQWKS
lambda light HRSYSCQVTHEGSTVEKTVAPAECS
chain
—l25—
SEQ ID Brief Sequence
Number ption
ofsequence
SEQ ID Linker GGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGGS
1\O:89
SEQ ID Linker GGGGSGGGGSGGSGGSGGGGGS
1\O:90
SEQ ID Linker GGGGSGGGGSGGGGSGGGGSGGGGGS
R0291
SEQ ID Linker GGGGSGGGGGGSGGGGGGSGGGGSGGGGGS
R0192
SEQ ID Linker GGGGSGGGGSGGGSGGGSGGGGSGGGGSGGGGGS
1\O:93
SEQ ID Linker GGGGSGGGGSGGGSGGGSGGGSGGGGSGGGGSGGGGGS
R0194
SEQ ID Linker GGGGSGGGGSGGGSGGGSGGGSGGGGSGGGGGSGGGSGG
R0195 GGS
SEQ ID CD3#3 RSSTGAVTTSNYAN
R0196 LCCDR1
SEQ ID CD3#3 GTNKRAP
R0197 LCCDRZ
SEQ ID CD3#3 ALWYSNLWV
R0298 LCCDR3
SEQ ID CD3#3 GFTFNTYAMN
R0299 HCCDR1
SEQ ID CD3#3 RIRSKYANYATYYADSVKD
RO:100 HCCDRZ
SEQ ID CD3#3 HGNFGNSYVSWFAY
RO:101 HCCDR3
SEQ ID CD3#3 EAVVTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWVQEK
R0: 1 02 VL PGQLPRGLIGGTNKRAPWVPARFSGSLLGGKAALTLSGAQP
EDEAEYFCALWYSNLWVFGGGTKLTVL
SEQ ID CD3#3 SGGGLVQPGGSLKLSCAASGFTFNTYAMNWVRQA
NO: 1 03 HL PGKGLEWVARIRSKYANYATYYADSVKDRFTISRDDSKNTA
YLQMNNLKTEDTAVYYCVRHGNFGNSYVSWFAYWGQGTL
VTVSA
—126—
SEQ ID Brief Sequence
Number description
of sequence
SEQ ID CD3#3 EAVVTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWVQEK
NO: 1 04 scFab PGQLPRGLIGGTNKRAPWVPARFSGSLLGGKAALTLSGAQP
EDEAEYFCALWYSNLWVFGGGTKLTVLGQPKAAPSVTLFPP
SSEELQANKATLVCLISDFYPGAVKVAWKADGSPVNTGVET
TTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTV
EKTVAPAECSGGGGSEGKSSGSGSESKSTEGKSSGSGSESKS
TGGGGSEVQLVESGGGLVQPGGSLKLSCAASGFTFNTYAM
NWVRQAPGKGLEWVARIRSKYANYATYYADSVKDRFTISR
DDSKNTAYLQMNNLKTEDTAVYYCVRHGNFGNSYVSWFA
YWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT
VPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
SEQ ID CD3#3 EAVVTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWVQEK
N0:105 chain PGQLPRGLIGGTNKRAPWVPARFSGSLLGGKAALTLSGAQP
EDEAEYFCALWYSNLWVFGGGTKLTVLGQPKAAPSVTLFPP
SSEELQANKATLVCLISDFYPGAVKVAWKADGSPVNTGVET
TTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTV
EKTVAPAECSGGGGSEGKSSGSGSESKSTEGKSSGSGSESKS
EVQLVESGGGLVQPGGSLKLSCAASGFTFNTYAM
NWVRQAPGKGLEWVARIRSKYANYATYYADSVKDRFTISR
DDSKNTAYLQMNNLKTEDTAVYYCVRHGNFGNSYVSWFA
YWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT
VPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPC
PAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP
EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ
EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP
TKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKT
TPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHN
RFTQKSLSLSPG
SEQ ID DLL3#7 RASQSVNSNFLA
N0:133 LCCDRI
SEQ ID DLL3#7 GTSSRAT
—127—
SEQ ID Brief Sequence
Number description
ofsequence
NO:134 LCCDR2
SEQ ID DLL3#7 QQYGSSPWT
NO:135 LCCDR3
SEQ ID DLL3#7 YGMF
NO:136 HCCDR1
SEQ ID DLL3#7 VIWLDGDDEDYVDSVKG
NO:137 HCCDR2
SEQ ID DLL3#7 VLDY
NO:138 HCCDR3
SEQ ID DLL3#8 KSSQSVLDTSNNKNYLV
NO:139 LCCDR1
SEQ ID DLL3#8 WASTRES
NO: 140 LCCDR2
SEQ ID DLL3#8 QHYYNSPYT
NO: 141 LCCDR3
SEQ ID DLL3#8 GYTFTDYYMH
NO: 142 HCCDR1
SEQ ID DLL3#8 WINPNSGGTNYEQKFQG
NO: 143 HCCDR2
SEQ ID DLL3#8 DAWIPMDY
NO: 144 HCCDR3
SEQ ID DLL3#9 RASQSISRSYLA
NO: 145 LCCDR1
SEQ ID DLL3#9 GASSRAT
NO: 146 LCCDR2
SEQ ID DLL3#9 QQYGTSPIT
NO: 147 LCCDR3
SEQ ID DLL3#9 GGSISSYYWS
NO: 148 HCCDRI
SEQ ID DLL3#9 NTNYNPSLKS
NO: 149 HCCDR2
SEQ ID DLL3#9 IGVAGFYFDY
N02150 HCCDR3
—128—
SEQ ID Brief Sequence
Number description
ence
SEQ ID DLL3#10 RASQSLNSIFLA
BOJSI LCCDR1
SEQID DLLfiflO GASSRAT
BOASZ LCCDRZ
SEQ ID DLL3#1O QQYGGSMNT
hOfl53 LCCDR3
SEQ ID DLL3#10 GYTFTGYYMH
hOfl54 HCCDR1
SEQ ID 0 WINPNSGGTIFAQRFQG
BOASS HCCDRZ
SEQID DLLfiflO DFGDTVGNAFDI
hOfl56 HCCDR3
SEQID , SASSSVTYHI
h0fl57 LCCDR1
SEQID DLLyfll RTSYLAS
h0fl58 LCCDRZ
SEQID DLLfifll QQRSSYPRT
h0fl59 LCCDR3
SEQID DLLfifll GYAFSDYWHT
.\O:160 HCCDR1
SEQID DLL3#H. IHYPGSGSTKSSEKFKN
R0fl61 HCCDRZ
SEQID DLLfifll LYYYGSHYLDT
X0fl62 HCCDR3
SEQID DLLfiflZ SASSSVTYHI
R0fl63 LCCDR1
SEQID DLLfiflZ RTSYLAS
R0fl64 LCCDR2
SEQID DLLfifl2 QQRSSYPRT
R0fl65 LCCDR3
SEQID DLLfifl2 GYAFSDYWHT
.\O:166 HCCDR1
SEQID DLLfifl2 IMYPGSGSTKSSEKFKN
—129—
SEQ ID Brief Sequence
Number description
ofsequence
NOfl67 HCCDR2
SEQID DLLfiflZ LYYYGSYYLDT
NOfl68 HCCDR3
SEQ ID DLL3#13 RSSQSIVHSNGNTYLE
NOfl69 LCCDRl
SEQID DLLfifl3 KVSNRFS
NOfl70 LCCDR2
SEQID DLLyfl3 FQGSHVPYT
NOfl71 LCCDR3
SEQID DLLyfl3 GYTFTNYGVT
N0fl72 HCCDRl
SEQID DLLyfl3 “HNTYSGAPTYADDFNG
N0fl73 HCCDR2
SEQID DLLyfl3 LDDYDLYYFDY
NOfl74 HCCDR3
SEQID DLLyfl4 KASQSVDYDGDSYNDJ
NOfl75 LCCDRl
SEQID DLLyfl4 AASTLES
NOfl76 LCCDR2
SEQ ID DLL3#14 PWT
NOfl77 LCCDR3
SEQID DLL3fl4 GYTFTDYWTH
N0fl78 HCCDRl
SEQID DLL3fl4 XHYPGNSYTAYNQKFKD
NOfl79 HCCDR2
SEQ ID DLL3#14 DY
NOfl80 HCCDR3
SEQID DLLyfl5 KASQSVDYDGDSYLN
NOfl81 LCCDRI
SEQID DLLyfl5 AASNLES
NOfl82 LCCDR2
SEQ ID DLL3#15 QQSSEDPRT
NOfl83 LCCDR3
—130—
2019/064942
SEQ ID Brief Sequence
Number description
ofsequence
SEQID DLLfiflS GYTFTNYGLHQ
I\O:184 HCCDR1
SEQID DLLfiflS “HNTYTGEPTYADDFKG
BOASS HCCDRZ
SEQ ID DLL3#15 FHFSSNGDAMDN
I\O:186 HCCDR3
SEQ ID DLL3#16 RASQSVSDWLA
h0fl87 LCCDR1
SEQID DLLfifl6 RASSLES
h0fl88 LCCDRZ
SEQ ID 6 QLYNSYSPT
h0fl89 LCCDR3
SEQ ID DLL3#16 GFTFSSYWMT
I\O:190 HCCDR1
SEQID DLLyfl6 PHKEDGSEKYYVDSVKG
h0fl91 HCCDRZ
SEQ ID DLL3#16 DWGYFDY
h0fl92 HCCDR3
SEQ ID DLL3#17 RASENIYYSLA
R0fl93 LCCDR1
SEQ ID DLL3#17 NTNSLED
R0fl94 LCCDR2
SEQID DLLfifl7 KQAYDFPLT
R0fl95 LCCDR3
SEQ ID DLL3#17 YYIH
.\O:196 HCCDR1
SEQID DLLfifl7 “HYPGDGSTNNNEKFKG
.\O:197 HCCDRZ
SEQ ID DLL3#17 GEGNAMDD
R0fl98 HCCDR3
SEQ ID DLL3#18 RASENIYYSLA
R0fl99 LCCDR1
SEQID DLLfifl8 'NANSLED
—131—
SEQ ID Brief Sequence
Number description
ofsequence
NO:200 LCCDR2
SEQ ID 8 KQAYDVPLT
NO:201 LCCDR3
SEQ ID DLL3#18 GYTFTAYFIH
NO:202 HCCDRI
SEQ ID DLL3#18 YIDPFNDDTNYNVKFKG
NO:203 HCCDR2
SEQ ID DLL3#18 GTSATLDY
NO:204 HCCDR3
SEQ ID DLL3#7 EIVLTQSPDTLSLSPGERATLSCRASQSVNSNFLAWYQQKPG
NO:205 VL QTPRLLIFGTSSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAV
YYCQQYGSSPWTFGQGTKVEIR
SEQ ID DLL3#7 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMFWVRQA
NO:206 VH WVAVIWLDGDDEDYVDSVKGRFTISRDDSKNTLY
LQMNSLRVDDTAIYYCARVLDYWGQGTLVTVSS
SEQ ID DLL3#8 DIVMAQSPDSLAVSLGERATINCKSSQSVLDTSNNKNYLVW
NO2207 VL YQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSL
QAEDVAVYYCQHYYNSPYTFGQGTKLEIK
SEQ ID DLL3#8 QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMHWVRQ
NO:208 VH APGQGLEWMGWINPNSGGTNYEQKFQGRVTMTRDTSISTA
YMELNRLRSDDTAVYYCTRDAVVIPMDYWGQGTLVTVSS
SEQ ID DLL3#9 EIVLTQSPGTLSLSPGERATLSCRASQSISRSYLAWYQQKPGQ
NO:209 VL APRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVY
YCQQYGTSPITFGQGTRLEIK
SEQ ID DLL3#9 QVHLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQTPG
NO:21 0 VH KGLDWIGYRYYSGNTNYNPSLKSRVTISLDMSNNQFSLKLS
SVTAADTAIYYCASIGVAGFYFDYWGQGTLVTVSS
SEQ ID DLL3#10 EIVLTQSPGTLSLSPGERATLSCRASQSLNSIFLAWYQQKPGQ
NO:21 1 VL APWLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAV
YFCQQYGGSMNTFGQGTKLEIK
SEQ ID 0 QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRL
NO:212 VH APGQGLEWMGWINPNSGGTIFAQRFQGRVTMTRDTSISTVY
MDLNRLRSDDTAVYYCARDFGDTVGNAFDIWGQGTMVTV
—132—
SEQ ID Brief Sequence
Number description
ofsequence
SEQ ID DLL3#11 QIVLTQSPAIMSASPGEKVTITCSASSSVTYIHWFQQNPGTSP
NO:21 3 VL KLWIYRTSYLASGVPARFSGSGSGTSYSLTISRMEAEDAATY
YCQQRSSYPRTFGGGTKLEIK
SEQ ID DLL3#11 QVQLQQPGAELVQPGSSVKMSCKASGYAFSDYWITWVKQR
NO:214 VH PGQGLEWIGDIYPGSGSTKSSEKFKNKATLTADTSSSKAYIQ
FSSLTPEDSAVYYCVSLYYYGSHYLDTWGQGTTLTVSS
SEQ ID DLL3#12 QVVLTQSPAIMSASPGEKVTITCSASSSVTYIHWFQQNPGTSP
NO:21 5 VL KLWIYRTSYLASGVPARFSGSGSGTSYSLTISRMEAEDAATY
YCQQRSSYPRTFGGGTKLEIK
SEQ ID DLL3#12 QVQLQQPGAEFVQPGSSVKMSCKASGYAFSDYWITWVKQR
NO:21 6 VH PGQGLEWIGDIYPGSGSTKSSEKFKNRATLTADTSSSTAYIQF
SSLTPEDSAVYYCVSLYYYGSYYLDTWGQGTTLTVSS
SEQ ID DLL3#13 DVLMTQTPLSLPVSLGDQAAISCRSSQSIVHSNGNTYLEWYL
NO:21 7 VL QKPGQSPKVLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVE
AEDLGVYYCFQGSHVPYTFGGGTKLEIK
SEQ ID DLL3#13 QIQLVQSGPELKKPGETVKISCKASGYTFTNYGVTWVKQAP
NO:21 8 VH GKGLKWMGWINTYSGAPTYADDFNGRFALSLETSASTAYL
QINNLKNEDTATYFCARLDDYDLYYFDYWGQGTALTVSS
SEQ ID DLL3#14 DIVLTQSPASLSVSLGQRATISCKASQSVDYDGDSYMNWYQ
NO:21 9 VL QKPGQPPKLLIYAASTLESGIPARFSGSGSGTDFTLNIHPVEEE
DAATYYCQQSDEDPWTFGGGTKLEIK
SEQ ID DLL3#14 QIQLQQSGPELVKPGVKISCKASGYTFTDYYIHWMKQRPGQ
NO:220 VH GLEWIGYIYPGNSYTAYNQKFKDKATLTADNPSSTAYMQLS
SLTSEDSAVYFCARSGGSAMDYWGQGTSVTVSS
SEQ ID DLL3#15 DIVLTQSPASLAVSLGQRATISCKASQSVDYDGDSYLNWYQ
NO:221 VL PKLLIYAASNLESGIPARFSGSGSGTDFTLNIHPVEE
YCQQSSEDPRTFGGGTKLEIK
SEQ ID DLL3#15 QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAP
NO:222 VH GKGLKWMGWINTYTGEPTYADDFKGRFAFSLETSASTAYL
NEDMATYFCTKFHFSSNGDAMDNWGQGTSVTVSS
SEQ ID DLL3#16 DIQMTQSPSTLSASVGDRVTITCRASQSVSDWLAWYQQKPG
NO2223 VL KAPKFLIYRASSLESGVPSRFSGSGSGTEFTLTISSLQPADFAT
—133—
SEQ ID Brief ce
Number description
of sequence
YYCQLYNSYSPTFGQGTKVEIK
SEQ ID DLL3#16 EVHLVESGGGLVQPGGSLRLSCAASGFTFSSYWMTWVRQA
NO:224 VH PGKGLEWVANIKEDGSEKYYVDSVKGRFTISRDNAKNSLYL
QMNSLRAEDTALYYCARDWGYFDYWGQGTLVTVSS
SEQ ID DLL3#17 DIQMTQSPASLAASVGETVTITCRASENIYYSLAWYQQKQG
NO:225 VL KSPQLLIYNTNSLEDGVPSRFSGSGSGTQYSMKINSMQPEDT
ATYFCKQAYDFPLTFGAGTKLELK
SEQ ID DLL3#17 QIQLQQSGPEVVKPGASVKISCKASGYTFISYYIHWVKQRPG
NO:226 VH QGLEWIGWIYPGDGSTNNNEKFKGKTTLTADKSSSTAYMLL
SSLTSEDSAVYFCARGEGNAMDDWGQGTSVTVSS
SEQ ID 8 DIQMTQSPASLAASVGETVTITCRASENIYYSLAWYQQKQG
NO:227 VL KSPQLLIYNANSLEDGVPSRFSGSGSGTQYSMKINNMQPEDT
ATYFCKQAYDVPLTFGAGTKLELK
SEQ ID DLL3#18 QVQLQQSGPDLVKPGASVKMSCEASGYTFTAYFIHWVKQK
N02228 VH PGQGLEWIGYIDPFNDDTNYNVKFKGKATLTSDTSSSIAYME
LSSLTSEDSSFYYCARGTSATLDYWGHGTTLTVSS
SEQ ID DLL3#7 EIVLTQSPDTLSLSPGERATLSCRASQSVNSNFLAWYQQKPG
NO:229 scFab QTPRLLIFGTSSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAV
YYCQQYGSSPWTFGQGTKVEIRRTVAAPSVFIFPPSDEQLKS
GTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD
SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF
NRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGG
SQVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMFWVRQ
APGKGLEWVAVIWLDGDDEDYVDSVKGRFTISRDDSKNTL
YLQMNSLRVDDTAIYYCARVLDYWGQGTLVTVSSASTKGP
SVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS
GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPS
NTKVDKRVEPKSC
SEQ ID DLL3#8 DIVMAQSPDSLAVSLGERATINCKSSQSVLDTSNNKNYLVW
NO:230 scFab YQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSL
QAEDVAVYYCQHYYNSPYTFGQGTKLEIKRTVAAPSVFIFPP
SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL
—134—
SEQ ID Brief Sequence
Number description
of sequence
SSPVTKSFNRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSES
KSTGGGGSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDY
YMHWVRQAPGQGLEWMGWINPNSGGTNYEQKFQGRVTM
STAYMELNRLRSDDTAVYYCTRDAVVIPMDYWGQ
GTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP
EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYICNVNHKPSNTKVDKRVEPKSC
SEQ ID DLL3#9 EIVLTQSPGTLSLSPGERATLSCRASQSISRSYLAWYQQKPGQ
NO:231 scFab APRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVY
YCQQYGTSPITFGQGTRLEIKRTVAAPSVFIFPPSDEQLKSGT
ASWCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSK
DSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR
GECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGGSQ
VHLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQTPGK
GLDWIGYRYYSGNTNYNPSLKSRVTISLDMSNNQFSLKLSS
VTAADTAIYYCASIGVAGFYFDYWGQGTLVTVSSASTKGPS
VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSN
VEPKSC
SEQ ID DLL3#10 EIVLTQSPGTLSLSPGERATLSCRASQSLNSIFLAWYQQKPGQ
NO:232 scFab APWLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAV
YFCQQYGGSMNTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKS
GTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD
SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF
NRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGG
SQVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVR
LAPGQGLEWMGWINPNSGGTIFAQRFQGRVTMTRDTSISTV
YMDLNRLRSDDTAVYYCARDFGDTVGNAFDIWGQGTMVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTV
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY
ICNVNHKPSNTKVDKRVEPKSC
SEQ ID DLL3#1 1 QIVLTQSPAIMSASPGEKVTITCSASSSVTYIHWFQQNPGTSP
N02233 scFab KLWIYRTSYLASGVPARFSGSGSGTSYSLTISRMEAEDAATY
—135—
SEQ ID Brief Sequence
Number description
of sequence
YCQQRSSYPRTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGT
ASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSK
DSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR
GECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGGSQ
VQLQQPGAELVQPGSSVKMSCKASGYAFSDYWITWVKQRP
IGDIYPGSGSTKSSEKFKNKATLTADTSSSKAYIQF
SSLTPEDSAVYYCVSLYYYGSHYLDTWGQGTTLTVSSASTK
LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL
TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHK
PSNTKVDKRVEPKSC
SEQ ID 2 QVVLTQSPAIMSASPGEKVTITCSASSSVTYIHWFQQNPGTSP
N0:234 scFab KLWIYRTSYLASGVPARFSGSGSGTSYSLTISRMEAEDAATY
YCQQRSSYPRTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGT
ASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSK
DSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR
GECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGGSQ
VQLQQPGAEFVQPGSSVKMSCKASGYAFSDYWITWVKQRP
GQGLEWIGDIYPGSGSTKSSEKFKNRATLTADTSSSTAYIQFS
SLTPEDSAVYYCVSLYYYGSYYLDTWGQGTTLTVSSASTKG
PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALT
SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKP
SNTKVDKRVEPKSC
SEQ ID DLL3#13 DVLMTQTPLSLPVSLGDQAAISCRSSQSIVHSNGNTYLEWYL
NO:235 scFab QKPGQSPKVLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVE
AEDLGVYYCFQGSHVPYTFGGGTKLEIKRTVAAPSVFIFPPS
GTASVVCLLNNFYPREAKVQWKVDNALQSGNSQE
SVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLS
SPVTKSFNRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSES
KSTGGGGSQIQLVQSGPELKKPGETVKISCKASGYTFTNYGV
TWVKQAPGKGLKWMGWINTYSGAPTYADDFNGRFALSLE
TSASTAYLQINNLKNEDTATYFCARLDDYDLYYFDYWGQG
TALTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE
PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG
—136—
SEQ ID Brief ce
Number description
of sequence
TQTYICNVNHKPSNTKVDKRVEPKSC
SEQ ID DLL3#14 DIVLTQSPASLSVSLGQRATISCKASQSVDYDGDSYMNWYQ
NO:236 scFab QKPGQPPKLLIYAASTLESGIPARFSGSGSGTDFTLNIHPVEEE
DAATYYCQQSDEDPWTFGGGTKLEIKRTVAAPSVFIFPPSDE
QLKSGTASWCLLNNFYPREAKVQWKVDNALQSGNSQESV
TEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
VTKSFNRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKS
TGGGGSQIQLQQSGPELVKPGVKISCKASGYTFTDYYIHWM
KQRPGQGLEWIGYIYPGNSYTAYNQKFKDKATLTADNPSST
AYMQLSSLTSEDSAVYFCARSGGSAMDYWGQGTSVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV
NHKPSNTKVDKRVEPKSC
SEQ ID DLL3#15 DIVLTQSPASLAVSLGQRATISCKASQSVDYDGDSYLNWYQ
NO:237 scFab QKPGQPPKLLIYAASNLESGIPARFSGSGSGTDFTLNIHPVEE
EDAATYYCQQSSEDPRTFGGGTKLEIKRTVAAPSVFIFPPSDE
QLKSGTASWCLLNNFYPREAKVQWKVDNALQSGNSQESV
DSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
VTKSFNRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKS
TGGGGSQIQLVQSGPELKKPGETVKISCKASGYTFTNYGMN
WVKQAPGKGLKWMGWINTYTGEPTYADDFKGRFAFSLETS
QINNLKNEDMATYFCTKFHFSSNGDAMDNWGQGT
SVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKRVEPKSC
SEQ ID DLL3#16 SPSTLSASVGDRVTITCRASQSVSDWLAWYQQKPG
NO:23 8 scFab KAPKFLIYRASSLESGVPSRFSGSGSGTEFTLTISSLQPADFAT
YYCQLYNSYSPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKS
GTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD
SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF
NRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGG
SEVHLVESGGGLVQPGGSLRLSCAASGFTFSSYWMTWVRQ
APGKGLEWVANIKEDGSEKYYVDSVKGRFTISRDNAKNSLY
—137—
SEQ ID Brief Sequence
Number description
of sequence
LQMNSLRAEDTALYYCARDWGYFDYWGQGTLVTVSSAST
KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG
ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKRVEPKSC
SEQ ID DLL3#17 DIQMTQSPASLAASVGETVTITCRASENIYYSLAWYQQKQG
NO:239 scFab KSPQLLIYNTNSLEDGVPSRFSGSGSGTQYSMKINSMQPEDT
ATYFCKQAYDFPLTFGAGTKLELKRTVAAPSVFIFPPSDEQL
KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE
TYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT
KSFNRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTG
GGGSQIQLQQSGPEVVKPGASVKISCKASGYTFISYYIHWVK
QRPGQGLEWIGWIYPGDGSTNNNEKFKGKTTLTADKSSSTA
YMLLSSLTSEDSAVYFCARGEGNAMDDWGQGTSVTVSSAS
FPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG
HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKRVEPKSC
SEQ ID 8 DIQMTQSPASLAASVGETVTITCRASENIYYSLAWYQQKQG
NO:240 scFab KSPQLLIYNANSLEDGVPSRFSGSGSGTQYSMKINNMQPEDT
ATYFCKQAYDVPLTFGAGTKLELKRTVAAPSVFIFPPSDEQL
KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE
QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT
KSFNRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTG
GGGSQVQLQQSGPDLVKPGASVKMSCEASGYTFTAYFIHW
VKQKPGQGLEWIGYIDPFNDDTNYNVKFKGKATLTSDTSSSI
AYMELSSLTSEDSSFYYCARGTSATLDYWGHGTTLTVSSAS
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG
ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKRVEPKSC
SEQ ID DLL3#7 EIVLTQSPDTLSLSPGERATLSCRASQSVNSNFLAWYQQKPG
NO:24 1 chain QTPRLLIFGTSSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAV
YYCQQYGSSPWTFGQGTKVEIRRTVAAPSVFIFPPSDEQLKS
GTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD
SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF
—138—
SEQ ID Brief Sequence
Number description
of sequence
NRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGG
SQVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMFWVRQ
APGKGLEWVAVIWLDGDDEDYVDSVKGRFTISRDDSKNTL
YLQMNSLRVDDTAIYYCARVLDYWGQGTLVTVSSASTKGP
SVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS
GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPS
NTKVDKRVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKD
TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKT
KPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
ISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKG
FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD
KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SEQ ID DLL3#8 DIVMAQSPDSLAVSLGERATINCKSSQSVLDTSNNKNYLVW
NO:242 chain YQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSL
QAEDVAVYYCQHYYNSPYTFGQGTKLEIKRTVAAPSVFIFPP
SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL
SSPVTKSFNRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSES
KSTGGGGSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDY
YMHWVRQAPGQGLEWMGWINPNSGGTNYEQKFQGRVTM
TRDTSISTAYMELNRLRSDDTAVYYCTRDAVVIPMDYWGQ
GTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP
EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEA
AGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFN
WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN
KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE
MTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPV
LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT
QKSLSLSPG
SEQ ID DLL3#9 EIVLTQSPGTLSLSPGERATLSCRASQSISRSYLAWYQQKPGQ
NO:243 chain APRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVY
YCQQYGTSPITFGQGTRLEIKRTVAAPSVFIFPPSDEQLKSGT
—139—
SEQ ID Brief Sequence
Number description
of sequence
LNNFYPREAKVQWKVDNALQSGNSQESVTEQDSK
DSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR
GECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGGSQ
VHLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQTPGK
GLDWIGYRYYSGNTNYNPSLKSRVTISLDMSNNQFSLKLSS
VTAADTAIYYCASIGVAGFYFDYWGQGTLVTVSSASTKGPS
VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSN
TKVDKRVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDT
LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK
PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA
PIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKGF
VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK
SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SEQ ID 0 EIVLTQSPGTLSLSPGERATLSCRASQSLNSIFLAWYQQKPGQ
NO:244 chain APWLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAV
YFCQQYGGSMNTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKS
GTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD
SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF
NRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGG
SQVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVR
LAPGQGLEWMGWINPNSGGTIFAQRFQGRVTMTRDTSISTV
YMDLNRLRSDDTAVYYCARDFGDTVGNAFDIWGQGTMVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTV
SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY
ICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEAAGGPS
VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD
GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY
KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKN
QVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG
SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
SEQ ID DLL3#1 1 QIVLTQSPAIMSASPGEKVTITCSASSSVTYIHWFQQNPGTSP
—140—
SEQ ID Brief Sequence
Number description
of sequence
NO:245 chain TSYLASGVPARFSGSGSGTSYSLTISRMEAEDAATY
YCQQRSSYPRTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGT
ASWCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSK
DSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR
GECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGGSQ
VQLQQPGAELVQPGSSVKMSCKASGYAFSDYWITWVKQRP
GQGLEWIGDIYPGSGSTKSSEKFKNKATLTADTSSSKAYIQF
SSLTPEDSAVYYCVSLYYYGSHYLDTWGQGTTLTVSSASTK
GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL
TSGVHTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICNVNHK
PSNTKVDKRVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKP
KDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNA
KTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA
LPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLV
KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT
VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SEQ ID DLL3#12 QVVLTQSPAIMSASPGEKVTITCSASSSVTYIHWFQQNPGTSP
NO:246 chain KLWIYRTSYLASGVPARFSGSGSGTSYSLTISRMEAEDAATY
YCQQRSSYPRTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGT
ASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSK
DSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR
GECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGGSQ
VQLQQPGAEFVQPGSSVKMSCKASGYAFSDYWITWVKQRP
GQGLEWIGDIYPGSGSTKSSEKFKNRATLTADTSSSTAYIQFS
SLTPEDSAVYYCVSLYYYGSYYLDTWGQGTTLTVSSASTKG
PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALT
SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKP
KRVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPK
DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK
TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKAL
PAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVK
GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV
DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
—141—
SEQ ID Brief Sequence
Number description
of sequence
SEQ ID DLL3#13 DVLMTQTPLSLPVSLGDQAAISCRSSQSIVHSNGNTYLEWYL
NO:247 chain QKPGQSPKVLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVE
AEDLGVYYCFQGSHVPYTFGGGTKLEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQE
SVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLS
SPVTKSFNRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSES
KSTGGGGSQIQLVQSGPELKKPGETVKISCKASGYTFTNYGV
TWVKQAPGKGLKWMGWINTYSGAPTYADDFNGRFALSLE
TSASTAYLQINNLKNEDTATYFCARLDDYDLYYFDYWGQG
TALTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE
PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG
TQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEAA
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW
YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEM
TKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD
SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK
SLSLSPG
SEQ ID DLL3#14 DIVLTQSPASLSVSLGQRATISCKASQSVDYDGDSYMNWYQ
NO:248 chain PKLLIYAASTLESGIPARFSGSGSGTDFTLNIHPVEEE
DAATYYCQQSDEDPWTFGGGTKLEIKRTVAAPSVFIFPPSDE
QLKSGTASWCLLNNFYPREAKVQWKVDNALQSGNSQESV
TEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
VTKSFNRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKS
TGGGGSQIQLQQSGPELVKPGVKISCKASGYTFTDYYIHWM
GLEWIGYIYPGNSYTAYNQKFKDKATLTADNPSST
AYMQLSSLTSEDSAVYFCARSGGSAMDYWGQGTSVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV
NHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEAAGGPSVFLFP
LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEV
PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLW
—142—
SEQ ID Brief Sequence
Number description
of sequence
CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS
KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SEQ ID DLL3#15 DIVLTQSPASLAVSLGQRATISCKASQSVDYDGDSYLNWYQ
NO:249 chain QKPGQPPKLLIYAASNLESGIPARFSGSGSGTDFTLNIHPVEE
EDAATYYCQQSSEDPRTFGGGTKLEIKRTVAAPSVFIFPPSDE
QLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESV
TEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
VTKSFNRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKS
TGGGGSQIQLVQSGPELKKPGETVKISCKASGYTFTNYGMN
WVKQAPGKGLKWMGWTNTYTGEPTYADDFKGRFAFSLETS
ASTAYLQINNLKNEDMATYFCTKFHFSSNGDAMDNWGQGT
SVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEAAG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY
HNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK
EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT
KNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS
LSLSPG
SEQ ID DLL3#16 DIQMTQSPSTLSASVGDRVTITCRASQSVSDWLAWYQQKPG
NO:250 chain KAPKFLIYRASSLESGVPSRFSGSGSGTEFTLTISSLQPADFAT
YYCQLYNSYSPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKS
GTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD
SLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF
NRGECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTGGGG
SEVHLVESGGGLVQPGGSLRLSCAASGFTFSSYWMTWVRQ
APGKGLEWVANIKEDGSEKYYVDSVKGRFTISRDNAKNSLY
LQMNSLRAEDTALYYCARDWGYFDYWGQGTLVTVSSAST
KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG
ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
KVDKRVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPP
KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH
—143—
SEQ ID Brief Sequence
Number description
of sequence
NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN
KALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWC
PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SEQ ID DLL3#17 DIQMTQSPASLAASVGETVTITCRASENIYYSLAWYQQKQG
N0:251 chain KSPQLLIYNTNSLEDGVPSRFSGSGSGTQYSMKJNSMQPEDT
ATYFCKQAYDFPLTFGAGTKLELKRTVAAPSVFIFPPSDEQL
KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE
QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT
ECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTG
GGGSQIQLQQSGPEVVKPGASVKISCKASGYTFISYYIHWVK
QRPGQGLEWIGWIYPGDGSTNNNEKFKGKTTLTADKSSSTA
YMLLSSLTSEDSAVYFCARGEGNAMDDWGQGTSVTVSSAS
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG
ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKRVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPP
KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH
NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN
KALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SEQ ID DLL3#18 DIQMTQSPASLAASVGETVTITCRASENIYYSLAWYQQKQG
N0:252 chain KSPQLLIYNANSLEDGVPSRFSGSGSGTQYSMKINNMQPEDT
ATYFCKQAYDVPLTFGAGTKLELKRTVAAPSVFIFPPSDEQL
KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE
QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT
ECGGGGSEGKSSGSGSESKSTEGKSSGSGSESKSTG
GGGSQVQLQQSGPDLVKPGASVKMSCEASGYTFTAYFIHW
VKQKPGQGLEWIGYIDPFNDDTNYNVKFKGKATLTSDTSSSI
AYMELSSLTSEDSSFYYCARGTSATLDYWGHGTTLTVSSAS
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG
ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKRVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPP
—144—
SEQ ID Brief Sequence
Number description
of sequence
KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH
NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN
KALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SEQ ID Constant ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN
NO:253 region of SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV
heavy chain NHKPSNTKVDKRVEPKSC
CH 1
SEQ ID Mouse AKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTW
NO:254 IgGZa HC NSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNV
AHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPP
KIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTA
QTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKD
LPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMV
DIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSK
NWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
SEQ ID Mouse RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWK
NO:255 Kappa LC IDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHN
SYTCEATHKTSTSPIVKSFNRNEC
*Underlined sequence indicates hinge region
Example 3: Production of recombinant proteins
' Human DLL3-His
A cell line to e Human DLL3 -His was generated using HEK—293 cells (Thermo
Fisher), the Lenti-X Lentiviral System (Clontech), and plasmid encoding Human DLL3-
His (human DLL3 Accession No. Q9NYJ7 huDLL3—His: SEQ ID NO:106). For
expression, cells were cultured and ed at 37C, 5% C02, and shaking at 140 rpm. On
Day 0 of expression, cell were pelleted and re—suspended in Expi 293 media. On day 3 of
sion the conditioned culture supernatant was ted by pelleting the cells for 40
s at 4700 rpm. Protease inhibitors were added to the biomass before purification.
Expression was confirmed by western blot. The conditioned culture supernatant was
—145—
ed with 0.5 mM TCEP, 0.02% CHAPS, 10 mM ole. Purification was carried
out on a HisTrap Ni excel column and Buffer A: 50 mM MES, 50 mM NaCl, 0.5 mM
TCEP, 0.02% CHAPS, pH 6.5. The protein of interest was eluted in Buffer A
supplemented with 0.5M Imidazole, pH 8.5, using an elution gradient from 20 mM
imidazole to 500 mM imidazole. The pooled fractions were dialyzed in buffer250 mM
MES, 50 mM NaCl, 1 mM TCEP, 0.02% CHAPS, 0.2M Arginine, 3% glycerol, pH 6.5.
The purified material was qualified by mass spectrometry and analytical ultra-
fugation.
° Cyno DLL3-His
A cell line to produce Cyno DLL3 -His was generated using HEK-293 cells (Thermo
Fisher), the Lenti-X Lentiviral System (Clontech), and plasmid encoding Cyno DLL3 -His
(Cyno DLL3 Accession No: XM_0055 89196.1 (RefSeq); Cyno DLL3 —His: SEQ ID
NO:107). For expression, cells were cultured and expanded at 37°C, 5% CO2, and shaking
at 140 rpm. On Day 0 of expression, cells were pelleted and re-suspended in Expi 293
media. On day 3 of expression the conditioned culture supernatant was harvested by
ing the cells for 40 minutes at 4700 rpm. Protease inhibitors were added to the
biomass before ation. Expression was confirmed by western blot. The conditioned
culture supernatant was ed with 0.5 mM TCEP, 0.02% CHAPS, 10 mM imidazole.
ation was carried out on a HisTrap Ni excel column and Buffer A: 50 mM MES, 50
mM NaCl, 0.5 mM TCEP, 0.02% CHAPS, pH 6.5. The protein of interest was eluted in
Buffer A supplemented with 0.5M Imidazole, pH 8.5, using an elution gradient from 20
mM imidazole to 500 mM imidazole. The pooled fractions were dialyzed in buffer: 50 mM
MES, 50 mM NaCl, 1 mM TCEP, 0.02% CHAPS, 0.2M Arginine, 3% glycerol, pH 6.5.
The purified material was qualified by mass spectrometry and analytical ultra-
fugation.
0 Human CD3 E+G Hch-6xHis (E+G indicates sy subunits)
A cell line to e Human CD3 E+G Hch—6xHis was generated using HEK—293 cells
(Thermo Fisher), the Lenti—X Lentiviral System (Clontech), and plasmid encoding Human
CD3 E+G Hch—6xHis (human CD3E Accession No: P07766; human CD3E+G-Hch—His:
SEQ ID NO: 108). For sion, cells were cultured and expanded in Freestyle 293
media, at 37C, humidified 8% CO2 environment, and shaking at 135 rpm. The conditioned
culture supernatant was harvested at Day 6 by centrifugation for 30 minutes at 9300xg.
sion was monitored by SDS—PAGE and Western Blotting. The conditioned culture
— 1 46—
WO 34220
supernatant was adjusted with 0.2M Sucrose, 5% ol, 0.01% CHAPS, and 10mM
Imidazole. The pH was then adjusted to 7.2. Purification was carried out in a two—step
process: affinity purification using Ni/NTA resin (overnight incubation at 4C, and elution
with 250mM Imidazole); followed by size—exclusion chromatography on a Superdex 200
column in destination buffer PBS with 0.2M Sucrose, 5% glycerol, 0.01% CHAPS, lmM
TCEP, pH7.2. The pooled al was concentrated using a 10K MWCO PES ne
viva cell 100 centrifugation device prior to final analysis and storage. The purified
material was qualified by mass spectrometry and analytical ultra-centrifugation.
° Cyno CD3 E+G His (E+G indicates S’Y subunits)
A cell line to produce Cyno CD3 E+G Hch—6xHis was generated using HEK—293 cells
(Thermo Fisher), the Lenti—X Lentiviral System (Clontech), and plasmid encoding Cyno
CD3 E+G Hch—6xHis (Cynomolgus CD3E Accession No: Q95L15 <, cyno CD3 E+G
hch—His: SEQ ID NO:109). For expression, cells were cultured and expanded in Freestyle
293 media, at 37C, humidified 8% C02 environment, and shaking at 135 rpm. The
conditioned culture supernatant was harvested at Day 6 by centrifugation for 30 minutes at
9300xg. Expression was monitored by SDS-PAGE and Western Blotting. The conditioned
culture supernatant was ed with 0.2M e, 5% glycerol, 0.01% CHAPS, and
10mM Imidazole. The pH was then ed to 7.2. Purification was carried out in a two—
step s: y purification using Ni/NTA resin (overnight incubation at 4C, and
elution with 250mM Imidazole); ed by size-exclusion chromatography on a
Superdex 200 column in destination buffer PBS with 0.2M Sucrose, 5% ol, 0.01%
CHAPS, lmM TCEP, pH7.2. The pooled material was concentrated using a 10K MWCO
PES membrane viva cell 100 centrifugation device prior to final analysis and storage. The
purified material was qualified by mass spectrometry and analytical ultra-centrifugation.
Example 4A: SPR based determination of affinities to recombinant DLL3 and CD3
S’Y subunits and interspecies cross-reactivity
The g affinity of purified DLL3/CD3 bispecific constructs for recombinant human
and cyno DLL3—ECD and Fc—fusion proteins of human and cyno CD3 8y subunits was
determined by Surface Plasmon nce (SPR), using a ProteOn XPR36 instrument
(Bio-Rad).The running buffer and all dilutions (except where stated) were done in PBS—T—
EDTA. The GLM sensor chip (Bio—Rad) was normalized and pre-conditioned as per the
manufacturer’s recommendations. The sensor chip was activated with equal mixture of
EDC/s-NHS in the horizontal direction for 300 sec at a flow rate of 30 ul/min and
—147—
immobilized with protein A/G (20 ug/ml in 10 mM acetate pH 4.5) in the horizontal
direction for 300 sec at a flowrate of 30 ul/min resulting in ~ 5000 RU of protein A/G on
the surface. The sensor chip was vated with 1M ethanolamine HCl in the horizontal
direction for 300 sec at a flowrate of 30 . The sensor chip was stabilized with 18 sec
of 0.85% phosphoric acid at a flowrate of 100 til/min 3 times horizontally and 3 times
vertically.
For binding kinetic determination to DLL3, bispecific molecules were captured
individually on the protein A/G surface vertically for 250 sec at a flowrate of 25 ul/min.
The baseline was stabilized by injecting EDTA for 60 sec at a flowrate of 40
ul/min horizontally. The analyte (hu DLL3 or cy DLL3) was injected horizontally over the
captured antibody for 600 sec at a flowrate of 40 ul/min and a dissociation for 2700 sec.
The concentrations of the analyte were 20 nM, 10 nM, 5 nM, 2.5 nM, and 1.25 nM. The
surface was regenerated by injecting 0.85% phosphoric acid solution for 18 sec at a
flowrate of 100 ul/min one time horizontally and one time vertically.
For binding kinetic determination to CD3, hu CD387 —Fc and cy CD387 —Fc (dissolved in
pH 4.5 acetate) was immobilized directly onto the sensor surface h amine coupling
for 140 sec at a e of 30 ul/min vertically. The baseline was stabilized by injecting
PBS-T-EDTA for 60 sec at a flowrate of 40 ul/min ntally. The analyte (the
bispecific molecule) was injected horizontally over the captured CD3 87—Fc construct for
600 sec at a flowrate of 40 pl/l’l’lll’l and a dissociation for 600 sec. The concentrations of the
analyte were 250 nM, 125 nM, 62.5 nM, 31.3 nM, and 15.6 nM or 2 uM, 1 “M, 0.5 “M,
0.25 uM, and 0.125 nM. The surface was regenerated by injecting 0.85% phosphoric acid
solution for 18 sec at a flowrate of 100 ul/min one time horizontally and one time
vertically.
The inter spot (interactions with sensor e) and blank (PBS-T—EDTA) were subtracted
from the raw data. Sensorgrams were then fit to 1:1 kinetic model to provide rate
constants (ka, kd) as well as ty (KD) value for hu DLL3 and cy DLL3, and fit
globally to equilibrium to provide affinity (KD) value for hu CD387 and cy CD387.
DLL3/CD3 binding proteins bed herein showed affinities to DLL3 in the pM range.
ies to the CD3 87 subunit were in the low nM range. The interspecies gap between
human and cyno is balanced. Affinities of three exemplary D3 g proteins
(DLL3/CD3 binding proteins comprising a DLL3 chain of SEQ ID NO:75 and a CD3
—148—
chain of SEQ ID NO:79, SEQ ID NO:80 or SEQ ID NO:105, respectively) are shown in
Table 2A.
Table 2A: ies (KD) of DLL3/CD3 binding proteins to human and cynomolgus
monkey DLL3 and CD3 8}! subunit as determined by SPR analysis, and interspecies gaps
binding
protein
Example 48: SPR based determination of affinities to recombinant DLL3 and CD3 87
The g affinity of purified DLL3/CD3 bispecific constructs for recombinant human
DLL3 —ECD and Fc—fusion n of human CD3 8y subunits was determined by Surface
Plasmon Resonance (SPR), using a ProteOn XPR36 instrument (Bio—Rad). The method
was similar as in Example 4A, with a few differences as outlined below.
For binding kinetic determination to DLL3, anti—DLL3/CD3 les were captured
individually on the protein A/G e vertically for 200 sec at a flowrate of 30 ill/min.
The baseline was stabilized by injecting PBS-T-EDTA for 60 sec at a flowrate of 30
ill/min horizontally. The analyte (hu DLL3) was injected horizontally over the captured
antibody for 300 sec at a flowrate of 30 ill/min and a dissociation for 1800 sec. The
concentrations of the analyte were 20 nM, 10 nM, 5 nM, 2.5 nM, and 1.25 nM. The surface
was regenerated by injecting 0.85% phosphoric acid solution for 18 sec at a flowrate of
100 ul/min one time horizontally and one time vertically.
For binding kinetic determination to CD3, HuCD3E_HuCD3 G—Fc (dissolved in pH 4.5
e) was immobilized directly onto the sensor surface through amine coupling for 360
sec at a flowrate of 30 ul/min vertically. The baseline was stabilized by injecting PBS-T-
EDTA for 60 sec at a e of 30 ill/min horizontally. The analytes (all anti-DLL3/CD3
molecules) were injected horizontally over the captured dy for 600 sec at a flowrate
of 30 ul/min and a dissociation for 1800 see. The concentrations of the e were 250
nM, 83.3 11M, 27.8 nM, 9.3 nM, and 3.1 nM. The surface was rated by injecting
—149—
0.85% phosphoric acid solution for 18 sec at a flowrate of 100 ul/min one time
horizontally and one time vertically.
Affinities of exemplary DLL3/CD3 binding proteins (DLL3/CD3 binding ns
comprising a DLL3 chain of SEQ ID NO:73, SEQ ID NO:74, SEQ ID NO:75, SEQ ID
NO:76, SEQ ID NO:77, SEQ ID NO:78, SEQ ID NO:241, SEQ ID NO:242, SEQ ID
NO:243, SEQ ID , SEQ ID NO:245, SEQ ID NO:246, SEQ ID NO:247, SEQ ID
NO:248, SEQ ID NO:249, SEQ ID NO:250, SEQ ID , or SEQ ID NO:252 and a
CD3 chain of SEQ ID NO:79, a DLL3 binding protein comprising a DLL3 chain of SEQ
ID NO:75 and a CD3 chain of SEQ ID NO:80, and a DLL3 binding protein comprising a
DLL3 chain of SEQ ID NO:75 and a CD3 chain of SEQ ID NO: 105) are shown in 2B.
Table 2B: Affinities (KD) of DLL3/CD3 binding proteins to human DLL3 and CD3 8y
subunit as determined by SPR analysis
DLL3/CD3 Recomb.
binding
protein
DLL3#1/ 52 pM I
CD3#1
DLL3#2/ 91 pM
CD3#1
DLL3#3/ 75 pM
CD3#1
DLL3#3/ 120 pM
CD3#2
DLL3#3/ 116 pM
CD3#3
/ < 20 pM
CD3#1
DLL3#5/ < 20 pM
CD3#1
DLL3#6/ 152 pM
CD3#1
DLL3#7/ 637 pM
CD3#1
DLL3#8/ 40 pM
CD3#1
DLL3#9/ 46 pM
CD3#1
DLL3#10/ 141 pM I
CD3#1
DLL3#1 1/ 37 pM
CD3#1
DLL3#12/ < 20 pM
CD3#1
DLL3#13/ 23 pM
CD3#1
—150—
DLL3/CD3 Recomb.
binding
protein
CD3#l
CD3#1
CD3#l
CD3#l
CD3#1
Example 5: Generation of HEK293 cells expressing the ellular domain and its
subdomains on the cell surface
For generation of stable HEK293 cells expressing full-length human DLL3 (Uniprot:
Q9NYJ7), cynomolgus DLL3 (UPIOOO3AB95BD), human DLLl (Q00548) and human
DLL4 (Q9NR61), respectively, the respective coding sequence was cloned into pcDNA3.l
(Thermo Fisher ific) and a FLAG-tag was inserted n the signal sequence and
the extracellular . The expression on the cell surface was verified by using an anti-
FLAG antibody (clone M2, Sigma) ed by a monoclonal anti mouse lgGl (Acris).
The extracellular domain of DLL3 consists of different subdomains:
- Hu DLL3 Signal peptide: aa 1-26
° Hu DLL3 N—terminal ECD domain: aa 27-175
- Hu DLL3 DSL: aa 176—215
0 Hu DLL3 EGFl: aa 216—249
0 Hu DLL3 EGF2: aa 274—3 10
- Hu DLL3 EGF3: aa 1
0 Hu DLL3 EGF4: aa 353—3 89
- Hu DLL3 EGFS: aa 391—427
° Hu DLL3 EGF6: aa 429—465
- Membrane proximal peptide: aa 466—492
The following subdomains of DLL3 were expressed on the cell surface of HEK293 cells:
- Hu DLL3 : Uniprot: Q9NYJ7 aa 216-310
° Hu DLL3 EGF 2+3: Uniprot: Q9NYJ7 aa 274—351
- Hu DLL3 EGF3+4: Uniprot: Q9NYJ7 aa 312-389
° Hu DLL3 EGF4+5: Uniprot: Q9NYJ7 aa 353—427
- Hu DLL3 EGF5+6: Uniprot: Q9NYJ7 aa 391-465
—151—
- Hu DLL3 EGF6+membrane proximal peptide: Uniprot: Q9NYJ7 aa 429-492
For the generation of HEK293 cells expressing 6-His-myc tagged subdomains of human
DLL3, the respective coding sequences were cloned into pcDNA 3.1 (Thermo Fisher
Scientific). Constructs contain an N—terminal mouse IgG Vk g sequence, followed by
a idin-myc tag and the respective human DLL3 . To ensure cell surface
localization of the human DLL3 domains, all constructs were followed by a Ser/Gly—
Linker, the transmembrane domain (aa266-288) and the intracellular domain (aa 289—3 14)
ofhuman EpCAM (P16422). The expression of the subdomains was verified using mouse
monoclonal IgG2a antibodies against s domains as described in WO 2013126746.
Bound monoclonal antibody was detected with an goat anti—mouse IgG (F(ab’)2)—RPE
(Jackson Immuno Research). The samples were ed by flow cytometry. The
sion of human DLLl and DLL4 was confirmed by FACS analysis using anti-DLLl
(R&D s, MAB1818) and anti—DLL4 R&D Systems, MAB1506) antibodies
followed by PE-labeled anti-mouse or anti-rat secondary antibodies (see Figure 5, right
panel).
Table 3: Sequences of various DLL3 ains expressed on HEK293 cells
ID Construct Sequence
SEQ ID FLAG- MVSPRMSGLLSQTVILALIFLPQTRPDYKDDDDKAGVFELQIHSF
N021 10 tagged GPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAAL
human SARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWRE
DLL3 full ELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRF
length SYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAP
LVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRG
PSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGL
VTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCE
KRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDD
CAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARP
CAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAP
PGLRPGDPQRYLLPPALGLLVAAGVAGAALLLVHVRRRGHSQD
AGSRLLAGTPEPSV
DVDPQGIYVISAPSIYAREVATPLFPPLHTGRAGQRQHLLFPYPSSI
LSVK
—152—
WO 34220 2019/064942
ID uct Sequence
SEQ ID FLAG- MVSPRMSRLLSQTVILALIFIPQARPDYKDDDDKAGVFELQIHSFG
NO:111 tagged cyno PGPGPGAPRSPCSARGPCRLFFRVCLKPGLSEEAAESPCALGAALS
DLL3 full ARGPVYTEQPEAPAPDLPLPNGLLQVPFRDAWPGTFSLIIETWREE
length LGDQIGGPAWSLLARVTRRRRLAAGGPWARDIQRAGAWELRFS
YRARCELPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPP
VCRAGCSLEHGFCEQPGECRCLEGWTGPLCMVPVSTSSCLGLRG
PSSTTTGCLVPGPGPCDGNPCANGGSCSETPGSFECTCPRGFYGLR
CEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEK
RVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDC
AGRACANGGTCVEGGGAHRCSCALGFGGRNCRERADPCAARPC
AHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGVSALPAAPP
GLRPGDPQRYLLPPALGLLVAAGVAGAALLLVHVRRRGHAQDA
GSRLLAGTPEPSV
VDSRGIYVISAPSIYAREVAMPLFPPLHTGRAGQRQNLLFPFPSSlL
SEQ ID FLAG- MGSRCALALAVLSALLCDYKDDDDKQVWSSGVFELKLQEFVNK
NO:112 tagged KGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQASVSPEPPCTY
human GSAVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTFSLIIEA
DLLl full LHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDL
length KYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPG
WKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIR
YPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKNG
ATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDL
ENSYSCTCPPGFYGKICELSAMTCADGPCFNGGRCSDSPDGGYSC
RCPVGYSGFNCEKKIDYCSSSPCSNGAKCVDLGDAYLCRCQAGF
SGRHCDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCS
EHAPCHNGATCHERGHRYVCECARGYGGPNCQFLLPEL
PPGPAVVDLTEKLEGQGGPFPWVAVCAGVILVLMLLLGCAAVV
VCVRLRLQKHRPPADPCRGETETMNNLANCQREKDISVSIIGATQ
IKNTNKKADFHGDHSADKNGFKARYPAVDYNLVQDLKGDDTAV
RDAHSKRDTKCQPQGSSGEEKGTPTTLRGGEASERKRPDSGCSTS
KDTKYQSVYVISEEKDECVIATEV
SEQ ID FLAG- MAAASRSASGWALLLLVALWQQRAAGDYKDDDDKSGVFQLQL
NO:113 tagged QEFINERGVLASGRPCEPGCRTFFRVCLKHFQAVVSPGPCTFGTV
human STPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIEAWHAP
DLL4 full GDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSY
length RVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTG
EYCQQPICLSGCHEQNGYCSKPAECLCRPGWQGRLCNECIPHNG
CRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATCS
NSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDG
PGYYGLHCEHSTLSCADSPCFNGGSCRERNQGANYACE
CPPNFTGSNCEKKVDRCTSNPCANGGQCLNRGPSRMCRCRPGFT
GTYCELHVSDCARNPCAHGGTCHDLENGLMCTCPAGFSGRRCE
VRTSIDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPV
GLPPSFPWVAVSLGVGLAVLLVLLGMVAVAVRQLRLRRPDDGS
REAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGLDKSNCGK
QQNHTLDYNLAPGPLGRGTMPGKFPHSDKSLGEKAPLRLHSEKP
ECRISAICSPRDSMYQSVCLISEERNECVIATEV
—153—
ID Construct Sequence
SEQ ID FLAG tag DYKDDDDK
I\O:114
SEQ ID Vk leader METDTLLLWVLLLWVPGSTGD
I\O:115
SEQ ID yc EQKLISEEDL
1\O:1 16 tag
SEQ ID Ser/Gly SGGGGS
I\O:1 17 linker
SEQ ID EpCAM IVVVVIAVVAGIVVLVI
I\O:1 18 transmemb
rane
domain
SEQ ID EpCAM SRKKRMAKYEKAEIKEMGEMHRELNA
N021 19 intracellula
r domain
SEQ ID EGFl APLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCT
NO: 120
SEQ ID Hu DLL3 APLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSP
NO:121 EGF 1+2 RGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFY
GLRCE
SEQ ID EGF2 GPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCE
NO: 122
SEQ ID Hu DLL3 GPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCAD
NO:123 EGF 2+3 GPCFNGGLCVGGADPDSAYICHCPPGFQGSNCE
SEQ ID EGF3 SGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCE
V0: 124
SEQ ID Hu DLL3 SGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVD
V0: 125 EGF 3+4 RCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCE
SEQ ID EGF4 RVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCE
V0: 126
SEQ ID Hu DLL3 RVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDC
V0: 127 EGF 4+5 AGRACANGGTCVEGGGAHRCSCALGFGGRDCR
SEQ ID EGFS DLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCR
V0: 128
SEQ ID Hu DLL3 DDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAA
NO:129 EGF 5+6 RPCAHGGRCYAHFSGLVCACAPGYMGARCE
—154—
ID Construct Sequence
SEQ ID EGF6 RADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCE
NO: 1 30
SEQ ID Hu DLL3 RADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPD
NO:131 EGF6- GASALPAAPPGLRPGDPQRYL
membrane
proximal
peptide
SEQ ID Membrane FPVHPDGASALPAAPPGLRPGDPQRYL
NOzl32 proximal
peptide
Example 6: e domain mapping of DLL3/CD3 binding proteins
Epitope domains were ined by binding of D3 binding ns to
recombinant cell lines expressing subdomains of DLL3 (see Figure 2). Generation of these
cell lines is described under Example 5.
DLL3/CD3 binding proteins were produced by transient transfection of CHO-E cells with
the pTT5 vectors carrying the chain—encoding genes, as described in Example 2.
Cells expressing ains of DLL3 were stained with ep purified DLL3/CD3
binding proteins at 1.6 nM in FACS buffer (PBS/0.5%BSA/0.05% sodium azide). Bound
molecules were detected with PE—conjugated anti—human secondary antibody (Sigma—
Aldrich, #P8047). As negative control, cells were incubated with ary antibody only.
The samples were measured by flow—cytometry. Figure 3A—C show exemplary binders
(DLL3/CD3 binding ns comprising a DLL3 chain of SEQ ID NO:73, SEQ ID
NO:74, SEQ ID NO:75, SEQ ID NO:76, SEQ ID NO:77, SEQ ID NO:78, SEQ ID
NO:241, SEQ ID NO:242, SEQ ID NO:243, SEQ ID NO:244, SEQ ID , SEQ ID
NO:246, SEQ ID NO:247, SEQ ID NO:248, SEQ ID NO:249, SEQ ID NO:250, SEQ ID
NO:251 or SEQ ID NO:252 and a CD3 chain of SEQ ID NO:79, and a DLL3 binding
protein comprising a DLL3 chain of SEQ ID NO:75 and a CD3 chain of SEQ ID NO:80)
binding to different regions of DLL3. The sequences of the epitope domains are listed in
Example 5, Table 3.
—155—
WO 34220
Example 7: Interspecies cross-reactivity
Interspecies cross—reactivity was determined by binding of DLL3/CD3 binding proteins to
NCI—H82 (HTB—l75TM) and SHP77 (ATCC®, CRL—2195TM) cells, two SCLC cell lines, as
well as to a recombinant cell line expressing cynomolgus DLL3 (generation of cell line
described in Example 5).
DLL3/CD3 g proteins were produced by transient ection of CHO—E cells with
the pTTS vectors carrying the chain-encoding genes, as described in Example 2. Cells
sing human or cynomolgus DLL3 were stained with 1.6 nM of two-step purified
DLL3/CD3 binding proteins with increasing concentrations in FACS buffer
(PBS/0.5%BSA/0.05% sodium azide). Bound molecules were detected with PE—conjugated
anti-human secondary antibody (Sigma—Aldrich, #P8047). As negative control, cells were
incubated with secondary antibody only. The samples were measured by flow-cytometry.
Figure 4 shows g to human and cyno DLL3-expressing cells of seven exemplary
DLL3/CD3 binding proteins (DLL3/CD3 binding proteins comprising a DLL3 chain of
SEQ ID NO:73 and a CD3 chain of SEQ ID NO:79, a DLL3 chain of SEQ ID NO:74 and a
CD3 chain of SEQ ID NO:79, a DLL3 chain of SEQ ID NO:75 and a CD3 chain of SEQ
ID NO:79, a DLL3 chain of SEQ ID NO:75 and a CD3 chain of SEQ ID NO:80, a DLL3
chain of SEQ ID NO:76 and a CD3 chain of SEQ ID NO:79, a DLL3 chain of SEQ ID
NO:77 and a CD3 chain of SEQ ID NO:79 or a DLL3 chain of SEQ ID NO:78 and a CD3
chain of SEQ ID NO:79).
Example 8: Confirmation of the absence of binding to human DLLl and DLL4
Absence of cross-reactivity to human DLLl and DLL4 was determined by binding of
DLL3/CD3 binding ns to recombinant cells expressing human DLLl or DLL4
(generation of cell lines described in Example 5).
DLL3/CD3 binding proteins were produced by transient ection of CHO-E cells with
the pTTS vectors carrying the encoding genes, as described in Example 2.
Cells expressing DLLl and DLL4 were stained with 1.6 nM of two-step purified
DLL3/CD3 binding ns with increasing concentrations in FACS buffer
.5%BSA/0.05% sodium . Bound molecules were detected with PE—conjugated
anti-human secondary antibody (Sigma—Aldrich, #P8047). As negative control, cells were
—156—
ted with secondary antibody only. The samples were measured by flow—cytometry.
Expression of human DLLl and DLL4 was confirmed by FACS analysis using anti-DLLl
(R&D s, MAB1818) and LL4 R&D Systems, MAB1506) antibodies
followed by PE-labeled anti—mouse or anti—rat secondary antibodies. Figure 5 shows
binding of seven exemplary DLL3/CD3 binding proteins (DLL3/CD3 binding proteins
comprising a DLL3 chain of SEQ ID NO:73 and a CD3 chain of SEQ ID NO:79, a DLL3
chain of SEQ ID NO:74 and a CD3 chain of SEQ ID NO:79, a DLL3 chain of SEQ ID
NO:75 and a CD3 chain of SEQ ID NO:79, a DLL3 chain of SEQ ID NO:75 and a CD3
chain of SEQ ID NO:80, a DLL3 chain of SEQ ID NO:76 and a CD3 chain of SEQ ID
NO:79, a DLL3 chain of SEQ ID NO:77 and a CD3 chain of SEQ ID NO:79 or a DLL3
chain of SEQ ID NO:78 and a CD3 chain of SEQ ID NO:79) to human DLLl and DLL4-
expressing cells.
Example 9: Binding of DLL3/CD3 binding proteins to SCLC cell lines and T cells
Binding of DLL3/CD3 binding proteins to human SCLC cell lines was tested by flow
cytometry ofNCI—H82 (HTB—175TM) and SHP77 (ATCC®, CRL—2195TM). DLL3/CD3
binding proteins were produced, as described in Example 2.
Human peripheral blood mononuclear cells (PBMCs) were prepared by Ficoll density
nt centrifugation from enriched lymphocyte preparations (buffy coats), a side
product ofblood banks collecting blood for transfusions. All buffy coats were obtained
after informed t in accordance with the Declaration of Helsinki and with approval of
the cantonal ethical tee in Austria and PBMCs were prepared the same day of
tion. Therefore, mononuclear cells were isolated by Ficoll y gradient
centrifugation (35 min without brake at 1400 rpm) and extensive washes with PBS.
Remaining erythrocytes were removed by incubating for 3 minutes in ACK lysis buffer
(Thermo Fisher Scientific, A1049201), followed by washing in PBS, before suspension in
assay medium ning RPMI 1640 GlutaMAX (Gibco #61870—010), 5% human AB
serum AB (Gemini, GemCell cat # 100—5 12 LOT#H565001) + 1% MEM—NEAA (Gibco
#11140-035), 10mM HEPES (Affymetrix #7365 9), 10 uM beta—Mercaptoethanol
(Gibco #21985—023) and sodium pyruvat (Gibco #11360—039).
T—cells were ed by ve selection using the Pan T Cell Isolation Kit II (Miltenyi
Biotec #130—091—156). In brief, cells were resuspend in 40 ul buffer PBS/0,5% BSA
—157—
(Gibco ref#04l-94553 M)/2mM EDTA (Invitrogen ref# 15575-03 8)per 10 Mio cells and
incubated with 10 ul of -Antibody il per 10 Mio cells for 5 min at 4 °C.
Subsequently, 30 pl buffer and 20 pl anti-biotin MicroBeds/ 10 million cells were added
and incubated for 10 min at 4°C. Subsequently the mixture was placed in a pre-rinsed
25LS column (Miltenyi Biotec #130401) in the ic field of suitable MACS
separator (Miltenyi Biotec). Flow—through was collected and washed in assay medium.
Cells (T cells or human SCLC cells) were stained with increasing concentrations of two-
step purified DLL3/CD3 binding proteins with increasing concentrations in FACS buffer
(PBS/0.5%BSA/0.05% sodium azide). Bound molecules were detected with PE—conjugated
anti—human secondary antibody (Sigma-Aldrich, ). DLL3/CD3 binding proteins
targeting DSL (DLL3#6), EGFl (DLL3#5) or EGF4 (DLL#4) domains show stronger
binding to SCLC cell lines sing DLL3, compared to DLL3/CD3 binding ns
which target the membrane proximal peptide (DLL3#1, DLL3#2, DLL3#3). Binding to
SHP77, NCI-H82 cells and T cells of ary DLL3/CD3 binding proteins (DLL3/CD3
binding proteins comprising a DLL3 chain of SEQ ID NO:73, SEQ ID NO:74, SEQ ID
NO:75, SEQ ID NO:76, SEQ ID NO:77, SEQ ID NO:78, SEQ ID NO:241, SEQ ID
NO:242, SEQ ID NO:243, SEQ ID NO:244, SEQ ID NO:245, SEQ ID NO:246, SEQ ID
NO:247, SEQ ID NO:248, SEQ ID NO:249, SEQ ID NO:250, SEQ ID NO:251 or SEQ ID
NO:252 and a CD3 chain of SEQ ID NO:79, and a DLL3 g protein comprising a
DLL3 chain of SEQ ID NO:75 and a CD3 chain of SEQ ID NO:80) against ent
epitope domains is shown in Figure 6A—V.
Example 10A: Potency of redirecting imulated PBMCs against human SCLC
cell lines
Potency of non-stimulated PBMCs against SCLC cell lines was determined using lactate-
dehydrogenase (LDH) release as readout for cell lysis. In this assay, DLL3 -positive SCLC
cell lines, SHP77 and NCI—H82, were co—cultured with human PBMCs as or cells and
increasing concentrations of DLL3/CD3 binding proteins for 72 hours at an effector to
target cell ratio of 10:1. DLL3/CD3 binding proteins (DLL3/CD3 binding proteins
comprising a DLL3 chain of SEQ ID NO:73, SEQ ID NO:74, SEQ ID NO:75, SEQ ID
NO:76, SEQ ID NO:77, SEQ ID NO:78, and a CD3 chain of SEQ ID NO:79, and a DLL3
binding protein comprising a DLL3 chain of SEQ ID NO:75 and a CD3 chain of SEQ ID
—158—
NO:80) were produced by transient transfection of CHO—E cells with the pTT5 vectors
carrying the encoding genes, as described in Example 2.
Human eral blood mononuclear cells (PBMCs) were prepared by Ficoll density
gradient centrifugation from ed lymphocyte preparations (buffy coats), a side
product of blood banks collecting blood for transfusions. All buffy coats were obtained
after informed consent in accordance with the ation of Helsinki and with approval of
the cantonal ethical committee in a and PBMCs were prepared the same day of
collection. Therefore, mononuclear cells were isolated by Ficoll density gradient
centrifugation (35 min without brake at 1400 rpm) and extensive washes with PBS.
Remaining erythrocytes were removed by incubating for 3 minutes in ACK lysis buffer
(Thermo Fisher Scientific, A1049201), followed by washing in PBS, before sion in
assay medium containing RPMI 1640 GlutaMAX (Gibco #61870-010), 5% human AB
serum AB i, GemCell cat # 100-5 12 LOT#H565001) + 1% AA (Gibco
#11140-035), lOmM HEPES (Affymetrix #7365 9), 10 uM beta-Mercaptoethanol
(Gibco #21985—023) and sodium pyruvat (Gibco #11360—039).
Subsequently, target cells, SHP77 and NCI—H82, and PBMCs at a ratio of 1:10 were
incubated with DLL3/CD3 binding proteins at concentrations from 0.0001 nM to 100 nM
for 72 hours.
Cytotoxic activity was determined using the Cytotoxicity Detection KitPLUS (Roche),
following the manufacturer’s instructions. In brief, this method is based on the usage of the
e of LDH from dead or plasma —membrane damaged cells. Cell culture supernatant is
incubated with the reaction mixture from the kit for 30 minutes and the formation of
Formazan, as a result of LDH activity is measured in a spectrophotometer at 500nm as
surrogate for cell lysis. Percentage of cytotoxicity relative to the maximal lysis control
was calculated according to the ing formula:
measured value — ound
Cytotoxicity (relative to control) =
max1mal lySIS — mlnlmal lySIS_ _ _ . .
Background: Target cells + Effector cells
Maximal lysis: Target cells + 5% Triton X—100
Minimal lysis: Target cells
—159—
W0 2019l234220
Using GraphPad Prism 5 software, the percentage of cytotoxicity relative to the maximal
lysis control was plotted against the ponding DLL3/CD3 binding protein
concentrations. Dose response curves were analysed with the four-parameter logistic
equation model for evaluation of sigmoidal dose—response curve and EC90 values were
calculated (EC90 values are shown in Table 4A).
Figure 7A shows an example of potency in cell lysis of seven exemplary DLL3/CD3
binding proteins (DLL3/CD3 binding proteins comprising a DLL3 chain of SEQ ID
NO:73, SEQ ID NO:74, SEQ ID NO:75, SEQ ID NO:76, SEQ ID NO:77, or SEQ ID
NO:78, and a CD3 chain of SEQ ID NO:79, and a DLL3 binding protein comprising a
DLL3 chain of SEQ ID NO:75 and a CD3 chain of SEQ ID NO:80) binding to different
epitope domains.
Table 4A: EC90 values [nM] of DLL3/CD3 binding proteins as measured in a 72 hour
cytotoxicity assay with non—stimulated PBMCs as effector cells and SCLC cell lines, NCI—
H82 and SHP77 as target cells.
DLL3/CD3 binding
. NCI H82 SHP77
proteins
/CD3#1 1 .7 i—‘ J>
DLL3#2/CD3#1 2 .9
waits/com -_ HUJ - U'I-J>
/CD3#2 3 .9 16.5
no saturation at 100
DLL3#4/CD3#1 _
no saturation at 100 nM
no saturation at 100
DLL3#5/CD3#1 _
no saturation at 100 nM
no saturation at 100
DLL3#6/CD3#1 _
no saturation at 100 nM
e 10B: Potency of redirecting non-stimulated T cells against human SCLC cell
lines
T cells were isolated as described in Example 9. Subsequently purified T cells were used as
effector cells in a cytotoxicity assay with SHP77 and NCI-H82 cells as target cells as
described in e 10A. Dose response curves are shown in Figures 7B—H (SHP77
cells) and Figure 71-0 (NCI-H82 cells). ated EC90 values are shown in Table 4B.
Figure 7B—O show examples of potency in cell lysis of 19 ary DLL3/CD3 binding
proteins (DLL3/CD3 g proteins comprising a DLL3 chain of SEQ ID NO:73, SEQ
—160—
ID NO:74, SEQ ID NO:75, SEQ ID NO:76, SEQ ID NO:7?, SEQ ID No:78, SEQ ID
NO:241, SEQ ID NO:242, SEQ ID NO:243, SEQ ID NO:244, SEQ ID NO:245, SEQ ID
NO:246, SEQ ID No;247, SEQ ID No;248, SEQ ID No;249, SEQ ID NO:250, SEQ ID
NO:251, SEQ ID NO:252
Table 4B: ECgovalues [nM] of D3 binding proteins as measured in a 72 hour
cytotoxicity assay with purified T cells as effector cells and SCLC and NCI-H82 cell lines
as target cells.
D3 binding
NCI-H82 SHP77
proteins
/CD3#1 no activity no activity
DLL3#6/CD3#1 no activity no activity
DLL3#8/CD3#1 no activity no activity
DLL3#9/CD3#1 no activity no activity
DLL3#l6/CD3#1 no activity no activity
DLL3#l7/CD3#1 no activity no activity
Example 11: In vitro internalization assay
Changes in the potency of the DLL3/CD3 g proteins after pre—incubated with DLL3-
positive SHP77 cells as target cells were measured. If the D3 binding protein is
—l6l—
WO 34220
internalized, the effective concentration should decrease with this and thus the apparent
potency should decrease.
D3 g proteins were produced as described in Example 2. Human eral
blood mononuclear cells (PBMCs) were prepared as described in Example 10.
SHP77 target cells were plated and incubated with DLL3/CD3 binding proteins at
concentrations from 0.0001 to 100 nM for 2 and 4 hours before adding non-stimulated
PBMCs for 48 hours. The effector to target cell ratio was 10: l. Cytotoxic activity was
determined using the Cytotoxicity Detection KitPLUS (Roche) as described in Example 10.
Figure 8 shows no ence in potency and efficacy of lysing cells of two exemplary
DLL3/CD3 binding proteins CD3 binding protein comprising a DLL3 chain of
SEQ ID NO:75 and a CD3 chain of SEQ ID NO:79, and DLL3/CD3 binding protein
comprising a DLL3 chain of SEQ ID NO:75 and a CD3 chain of SEQ ID NO:80). Potency
and efficacy have been observed ed to non—pre—incubated samples (0h). Results
suggest that no significant internalization occurs with DLL3/CD3 binding proteins.
Example 12: Mouse PK study
The PK of DLL3/CD3 g proteins was evaluated in C57BL/6 mice ing a single
1 mg/kg iv. dose. Serum concentrations of DLL3/CD3 binding proteins were determined
using a DLL3 capture/CD3 detection assay.
In brief, male C57BL/6 mice received a single 1 mg/kg intravenous (IV) dose (n = 3 per
molecule). Blood samples were collected se and 0.15, 2, 8, 24, 72, 96, 168, 240 and
336 hours post—dose. Serum drug levels were measured with an MSD—based ligand binding
assay, using biotinylated DLL3 as the capture reagent and sulfo-tagged CD3 as the
detection reagent. Pharmacokinetic (PK) parameters were ated from serum
concentration time-profiles using non-compartmental analysis. The following PK
parameters were assessed: AUCtlast (area under the serum concentration-time curve from
time zero to the last quantifiable time-point), AUCinf (area under the serum concentration-
time curve extrapolated to y), CL (systemic clearance), Vss (steady—state volume of
bution) and t1/2 (terminal half-life).
Mean (SD) serum concentration time-profiles for exemplary DLL3/CD3 binding proteins
(DLL3/CD3 binding protein comprising a DLL3 chain of SEQ ID NO:75 and a CD3 chain
of SEQ ID NO:79, and DLL3/CD3 binding protein comprising a DLL3 chain of SEQ ID
—162—
NO:75 and a CD3 chain of SEQ ID NO:80) are ized in Figure 9. Mean (SD) PK
parameters for these exemplary D3 binding proteins are summarized in Table 5.
Table 5: Mean (SD) PK parameters of exemplary DLL3/CD3 g proteins in male
C57BL/6 mice following a single 1 mg/kg enous dose
DLL3 CD3 bmdm{wroteins' ' AUCO-Iast AUCu.inf CL Vss t 1/2
("W/ml) (“W/ml) (mL/kg) (days)
(mL/dav/kg)
178 10.6
DLL3#3/CD3#1 1180(127) 1760(179) 13.7(1.48)
(57-7) (467)
109 4.97
DLL3#3/CD3#2 70) 1440(154) 16.8(1.74)
(19.5) (0.78)
Example 13: In vivo xenograft y study
Efficacy s were performed using a human xenograft mouse model reconstituted with
human T cells. In detail, human SHP77 small cell lung cancer cells (2 x 107) were injected
subcutaneously (S. c.) into the right dorsal flank of sub-lethally irradiated (2 Gy, day -1)
female NOD.Cg—Prkdcscjd IZng‘ij“g/IicTac mice (Day 1). In el, human CD3 positive
T cells (isolated from healthy human blood donor) were expanded in vitro.
Human peripheral blood mononuclear cells (PBMCS) were prepared as described in
Example 10.
s were isolated by negative selection using the Pan T Cell Isolation Kit 11 (Miltenyi
Biotec #130-091—156). In brief, cells were resuspend in 40 ul buffer 5% BSA (gibco
ref#041—94553 M)/2mM EDTA (Invitrogen ref# 15575—03 8)per 10 Mio cells and
incubated with 10 ul of Biotin-Antibody cocktail per 10 Mio cells for 5 min at 4 °C.
Subsequently, 30 ul buffer and 20 ul anti—biotin MicroBeds/10 million cells were added
and incubated for 10 min at 4°C. Subsequently the mixture was placed in a pre-rinsed
25LS column (Miltenyi Biotec #130401) in the magnetic field of suitable MACS
separator (Miltenyi Biotec). Flow—through was collected and washed in assay medium.
Subsequently T cells were expanded using the T Cell Activation/Expansion Kit human
(Miltenyi Biotec Cat#l30-09l-441, Lot#5170720843) for 20 days. In brief, anti-Biotin
MACSiBeadTM Particles are loaded with CD2-, CD3-, CD28 Biotin and are transferred to
—l63—
the purified T cells in a ratio of 2 cells per particle and incubated in presence of 20 Units
recombinant IL—2 (R&D#202—IL—050/CF) at a y of 0.5—1 106 ml for 20 days.
Cells were supplemented with 20 Units fresh IL-2 every three days. Three days before
injection into the animals, T cells were were restimulated with anti-Biotin
MACSiBeadTM Particles are loaded with CD2-, CD3-, CD28 Biotin at a ratio of 1 bead
per 4 cells for additional three days. Finally, beads were removed with a MACSiMAG
Separator (Miltenyi Biotec) and T cells were washed in PBMCs.
On day 14, animals were randomized into treatment groups based on tumor volume and 2 x
107 human T cells were injected intra—peritoneally (i.p.). Treatment was started on day 17
and DLL3/CD3 binding protein(DLL3/CD3 binding protein comprising a DLL3 chain of
SEQ ID NO:75 and a CD3 chain of SEQ ID NO:79, and DLL3/CD3 binding protein
comprising a DLL3 chain of SEQ ID NO:75 and a CD3 chain of SEQ ID NO:80) or
Vehicle buffer (SOmM NaOAc, lOOmM NaCl, pH 5.0) was administered in a q7d dosing
regimen by intravenous (2'. v.) bolus injections into the lateral tail vein. Tumor growth was
monitored by external caliper measurements and tumor volumes were calculated using a
standard hemi-ellipsoid formula. Human T cell engraftment was assessed in the spleen by
immunohistochemistry (IHC) staining for human CD3 at the end of the study. Only those
animals g human T—cell engraftment at the end of the study were included in the
tical analysis. Animals reaching sacrifice criteria were euthanized early during the
s for ethical s. ent of tumor-bearing mice with DLL3/CD3 binding
proteins once weekly i.v. at 0.25 mg/kg induced icant tumor regression (Figure 10).
Example 14: Percent monomer content of DLL3/CD3 binding proteins
Percent monomer was determined for exemplary DLL3/CD3 binding ns (DLL3/CD3
binding ns comprising a DLL3 chain of SEQ ID NO:73, SEQ ID NO:74, SEQ ID
NO:75, SEQ ID NO:76, SEQ ID NO:77, SEQ ID NO:78, SEQ ID NO:241, SEQ ID
NO:242, SEQ ID NO:243, SEQ ID , SEQ ID NO:245, SEQ ID , SEQ ID
NO:247, SEQ ID NO:248, SEQ ID NO:249, SEQ ID NO:250, SEQ ID NO:251, or SEQ
ID NO:252 and a CD3 chain of SEQ ID NO:79, a DLL3 binding protein comprising a
DLL3 chain of SEQ ID NO:75 and a CD3 chain of SEQ ID NO:80, and a DLL3 binding
protein comprising a DLL3 chain of SEQ ID NO:75 and a CD3 chain of SEQ ID NO: 105)
by Analytical Size Exclusion Chromatography (aSEC) (shown in Table 6). aSEC was run
on a Waters (Milfrod, MA, USA) Acquity UPLC system using a Protein BEH SEC column
—164—
2019/064942
200A, 1.7pm, 4.6x150mm (Cat# 186005225). Running conditions were as follows: Mobile
phase: 50mM Sodium Phosphate, 200mM Arginine and 0.05% Sodium Azide; Flow rate:
0.5ml/min; Runtime: 5 minutes; Sample loading amount: 100g; Peak detection: ;
Automated processing method of chromatograms.
Table 6: Percent monomer after first and second purification step
DLL3/CD3 binding Percent monomer after Percent monomer after
proteins 1St step of purification 2nd step of ation
DLL3#1/CD3#1 76.4 99.4
DLL3#2/CD3#1 54.4 98.0
/CD3#1 69.5 99.8
DLL3#3/CD3#2 77.6 99.5
DLL3#3/CD3#3 70.8 98.3
DLL3#4/CD3#1 72.2 99.1
DLL3#5/CD3#1 70.5 99.1
DLL3#6/CD3#1 55.2 99.9
DLL3#7/CD3#1 78.1 99.0
DLL3#8/CD3#1 54.8 99.5
DLL3#9/CD3#1 72.0 99.0
DLL3#10/CD3#1 70.2 98.3
1/CD3#1 68.2 94.7
DLL3#12/CD3#1 66.2 98.7
DLL3#13/CD3#1 52.8 99.9
DLL3#14/CD3#1 52.6 87.0
DLL3#15/CD3#1 61.5 na
DLL3#16/CD3#1 71.8 99.5
DLL3#17/CD3#1 60.2 94.7
DLL3#18/CD3#1 61.5 98.2
Example 15A: Thermostability
Thermostability was determined by Differential Scanning Calorimetry (DSC) and results
of the first melting transitions (Tml) of D3 binding proteins are shown in Table 7.
DSC l melts e information regarding the thermal stability of a protein in
solution relative to a buffer control. Thermal unfolding and aggregation of a 1 mg/ml
solution of proteins in 20 mM Citrate, 115 mM NaCl, pH 6 was monitored from 20 °C to
110 °C at a scan rate of 60 °C/hr Via an automated capillary DSC.
—165—
Table 7A
DLL3/CD3 binding proteins Tml
DLL3#3/CD3#1 64
DLL3#3/CD3#2 60
DLL3#3/CD3#3 63
DLL3#4/CD3#1 63
Example 15B: Thermostability
Thermostability was determined by Thermal Shift Analysis (TSA) and results of the first
melting transitions (Tml) of D3 binding proteins (DLL3/CD3 binding proteins
comprising a DLL3 chain of SEQ ID NO:73, SEQ ID NO:74, SEQ ID NO:75, SEQ ID
NO:76, SEQ ID NO:77, SEQ ID NO:78, SEQ ID NO:241, SEQ ID , SEQ ID
NO:243, SEQ ID NO:244, SEQ ID NO:245, SEQ ID NO:246, SEQ ID NO:247, SEQ ID
NO:248, SEQ ID NO:249, SEQ ID NO:250, SEQ ID NO:251 or SEQ ID NO:252 and a
CD3 chain of SEQ ID NO:79, a DLL3 binding n sing a DLL3 chain of SEQ
ID NO:75 and a CD3 chain of SEQ ID NO:80, and a DLL3 binding protein comprising a
DLL3 chain of SEQ ID NO:75 and a CD3 chain of SEQ ID NO: 105) are shown in Table
7B. The fluorescence intensity profile as a on of temperature was acquired using a
QuantStudio 6 Flex real-time PCR system (Applied Biosystems, Waltham, MA) with
SYPRO Orange (Invitrogen, Carlsbad, CA) as the extrinsic fluorophore. Sample was
diluted to 0.4 mg/ml in 10 mM histidine, pH 6.0 with 40 mM sodium chloride and 0.02%
sodium azide. The melt curve was generated with a thermal ramp from 25°C to 95°C at a
rate of 2°C/min, with data collected imately every 0.4°C h the ‘ROX’ filter
set (Ex: 580 110 nm, Em: 623 il4 nm). Data were analyzed using Protein Thermal Shift
Software n 1.3 (ThermoFisher Scientific, Waltham, MA).
Table 7B
DLL3/CD3 binding proteins Tml (°C)
DLL3#1/CD3#1 65.6
DLL3#2/CD3#1 65.5
DLL3#3/CD3#1 65.6
DLL3#3/CD3#2 63.0
DLL3#3/CD3#3 65.5
—l66—
DLL3/CD3 binding proteins Tml (°C)
DLL3#4/CD3#1 65.8
/CD3#1 65.6
DLL3#6/CD3#1 65.8
DLL3#7/CD3#1 65.6
DLL3#8/CD3#1 65.8
DLL3#9/CD3#1 65.9
DLL3#10/CD3#1 64.6
DLL3#1 l/CD3#1 66.0
DLL3#12/CD3#1 65.9
DLL3#l3/CD3#1 65.8
DLL3#14/CD3#1 65.9
DLL3#l5/CD3#1 na
DLL3#l6/CD3#1 65.8
DLL3#l7/CD3#1 65.8
DLL3#l8/CD3#1 65.8
Example 16: Predicted Immunogenicity scores in silico by Epivax:
genicity of sequences was evaluated in silico with a mathematical algorithm.
Specifically, EpiMatrix Treg—adjusted Scores (Einax Inc., Providence RI)) as a measure
of immunogenicity scores, were ined for DLL3/CD3 binding proteins (DLL3/CD3
binding proteins comprising a DLL3 chain of SEQ ID NO:?3, SEQ ID NO:74, SEQ ID
NO:75, SEQ ID NO:76, SEQ ID NO:77, SEQ ID NO:78, SEQ ID , SEQ ID
N02242, SEQ ID N02243, SEQ ID NO:244, SEQ ID , SEQ ID NO:246, SEQ ID
NO:247, SEQ ID NO:248, SEQ ID NO:249, SEQ ID NO:250, SEQ ID NO:251 or SEQ ID
N02252 and a CD3 chain of SEQ ID NO:79, a DLL3 binding protein comprising a DLL3
chain of SEQ ID NO:75 and a CD3 chain of SEQ ID NO:80, and a DLL3 binding protein
comprising a DLL3 chain of SEQ ID NO:75 and a CD3 chain of SEQ ID NO: 105) and
compared to the scores of various Fc sequences. These scores are taking T—cell epitopes
and Treg es into consideration. The lower the immunogenicity score, the less likely a
sequence to be immunogenic. In general, a negative score is considered low risk of
immunogenicity, while a highly positive score is viewed as indication for potential
immunogenicity. As shown in the tables below, D3 binding proteins described
herein have very low immunogenicity scores, indicating that the risk of being
genic is low for these binding proteins.
—167—
Table 8: Adjusted Epivax scores of DLL3/CD3 binding proteins
DLL3/CD3 binding VH VL Full polypeptide
ns chain (VL-CL-linker-
VH-CH1-hinge-CH2-
CH3)
DLL3#1 DLL3 chain -36.88 -59.85 -43.31
DLL3#2 DLL3 chain -46.99 31.40 -33.53
DLL3#3 DLL3 chain -34.44 2.84 -35.50
DLL3#4 DLL3 chain 25.97 28.92 -21.93
DLL3#5 DLL3 chain -59.87 -46.45 -44.95
DLL3#6 DLL3 chain 29.70 -l4.55 -27.26
CD3#1 CD3 chain -9.68 -50.52 -35.25
CD3#2 CD3 chain -15,54 -50.52 -36.23
CD3#3 CD3 chain -13.49 -50.52 -35.88
DLL3#7 DLL3 chain -48.55 -34.92 -41.60
DLL3#8 DLL3 chain -54.39 -37.79 -42.89
DLL3#9 DLL3 chain 35.95 -60.37 -31.83
DLL3#10 DLL3 chain -33.82 -34.60 -40.73
1 DLL3 chain -24.00 26.66 -30.50
DLL3#12 DLL3 chain -30.43 25.68 -31.67
DLL3#13 DLL3 chain 8.64 18.63 -25.96
DLL3#14 DLL3 chain 1.58 -10.63 -31.72
DLL3#15 DLL3 chain 8.93 -8.31 -29.91
DLL3#16 DLL3 chain -55.14 13.98 -35.59
DLL3#17 DLL3 chain 11.89 12.55 -26.52
DLL3#18 DLL3 chain 5.82 15.85 -27.01
Table 9: Adjusted Epivax scores of Fc domains
Fc Protein Chain Adjusted Epivax score
Fc-IgGl -WT -25.64
Fc-IgGl -LALA -29.83
Fc-IgGl -LALA-KNOB -31.76
Fc-IgGl-LALA-HOLE -18.01
Example 17A: ecific binding to surfaces
The specificity of the DLL3/CD3 binding proteins of the invention was r tested in a
SPR—based assay using highly charged proteins. A non-specific binding assay was
—168—
2019/064942
developed using biosensor technology to determine if binding proteins have significant
binding to unrelated d ns. In this assay, DLL3/CD3 binding proteins were
passed over two SPR surfaces, one coated with a negatively d protein (Trypsin
Inhibitor) and one coated with a positively charged protein (Lysozyme). When a protein
displays significant non-specific binding to these surfaces, it is likely that the cause of
binding is the presence of positive or negative charged surface patches on the candidate.
Non-specific binding of proteins may translate to poor pharmacokinetics (PK) and
biodistribution and may also have downstream manufacturability s.
The experiment was performed on a Biacore T200. The dilution, surface preparation, and
binding experiments were performed at 25 0C in 1X HBS-EP buffer prepared from 10X
HBS-EP. The flow rate for both the immobilization protocol and binding ment was
at 5 uL/min.
To prepare the surface for the non-specific binding experiment, chicken egg white
lysozyme and trypsin inhibitor from glycine max n were coupled ly to a
series S CM5 chip with the surface density of 000 RU using the amine coupling kit
according to the cture instructions.
Samples were prepared at 1 uM in 1X HBS—EP buffer. The samples were injected over
activated surfaces with a 10 min association and 10 min dissociation. The data was
collected using Biacore T200 Control Software version 2.0.1 and analyzed using Biacore
T200 Evaluation Software version 3.0.
The DLL3/CD3 binding proteins did not bind to these highly charged surfaces. Table 10A
shows absence of binding to the two highly charged ns, Trypsin tor and
Lysozyme, with two exemplary DLL3/CD3 binding proteins.
Table 10A:
Non-specific g
DLL3/CD3 Binding Protein. _ _
Lysozyme (posntlve)_ _ Tryp. Inhlbltor (negative). _ _
DLL3#3/CD3#1
DLL3#3/CD3#2
Example 17B: Non-specific binding to surfaces
The specificity of the DLL3/CD3 binding ns (DLL3/CD3 binding proteins
comprising a DLL3 chain of SEQ ID NO:73, SEQ ID NO:74, SEQ ID NO:75, SEQ ID
—l69—
NO:76, SEQ ID NO:77, SEQ ID N0278, SEQ ID , SEQ ID NO:242, SEQ ID
, SEQ ID NO:244, SEQ ID NO:245, SEQ ID , SEQ ID NO:247, SEQ ID
N02248, SEQ ID N02249, SEQ ID NO:250, SEQ ID NO:251 or SEQ ID NO:252, and a
CD3 chain of SEQ ID NO:79, a DLL3 binding n comprising a DLL3 chain of SEQ
ID NO:75 and a CD3 chain of SEQ ID NO:80, and a DLL3 binding protein comprising a
DLL3 chain of SEQ ID NO:75 and a CD3 chain of SEQ ID NO: 105) was further tested in
an SPR—based assay using highly charged proteins, as described in Examplel7a, with a 10
min association and 15 min dissociation. The results are shown in Table 10B.
Table 10B: Low RU numbers indicate no significant binding to unrelated charged proteins
Non-specific binding (RU)
DLL3/CD3 Binding
Tryp. Inhibitor
Protein Lysozyme (positive)
(negative)
DLL3#1/CD3#1 4 1
DLL3#2/CD3#1 7 2
DLL3#3/CD3#1 54 85
DLL3#3/CD3#2 44 36
DLL3#3/CD3#3 17 28
/CD3#1 16 37
DLL3#5/CD3#1 4 0
DLL3#6/CD3#1 6 0
DLL3#7/CD3#1 9 3
DLL3#8/CD3#1 39 18
DLL3#9/CD3#1 15 27
DLL3#10/CD3#1 25 12
DLL3#ll/CD3#1 ll 13
DLL3#l2/CD3#1 8 9
DLL3#l3/CD3#1 ll 3
4/CD3#1 l8 6
DLL3#l5/CD3#1 na na
DLL3#16/CD3#1 6 0
DLL3#l7/CD3#1 l5 8
DLL3#l8/CD3#1 23 81
—l70—
e 18: Induction of lysis, T cell activation, T cell degranulation, T cell
proliferation and cytokine secretion in presence of DLL3-positive and DLL3-negative
tumor cells
PBMCs were purified as described in Example 9. To determine T cell tion, T cell
degranulation and cytokine secretion, a cytotoxicity assay with PBMCs and DLL3 -positive
SHP77 or egative RKO—E6 cells as target cells was setup as described in Example
10B. Potency of cell lysis by redirecting T cells towards human SHP77 or RKO—E6 cells
was determined as described in Example 10A. To determine T cell activation, and T cell
ulation cells were centrifuged and stained with antibodies against CD4 (BD
#550630), CD8 (BD #557834), CD25 (BD#340907), subsequently the cells were
permabilized using the Fixation/Permeabilization Solution (BD 4) and stained with
antibodies against Perforin (BioLegend #308120) and Granzyme B (BD #560221) and
measured by flow—cytometry. Cytokine levels in supematants were determined by U-
PLEX Biomarker Group 1 (hu) Assays (MSD, #K15067L-2, Kit).
To determine the proliferation of T cells, PBMCs were labeled with 5 uM Cell TraceTM
CFSE (Invitrogen, ) and T cell stained with an anti-CD3 antibody (BioLegend
cat#: 317336) . Subsequently the labeled PBMCs were incubated with SHP77 or RKO-E6
cells at a ratio of 10:1 and increasing concentrations of an D3 binding protein for 6
days.
Figures 11-15 show induction of T cell redirected lysis of SHP77 or RKO-E6 cells (Figure
11) and induction of dose-dependent T cell activation (Figure 12), T cell degranulation
(Figurel3), secretion of cytokines (Figure 14A: Interferon gamma; 14B: MCP-l), and
proliferation of T cells (Figure 15) in presence of SHP77 or RO-E6 cells and an
DLL3/CD3 binding protein.
Example 19: Redirection of T cell subsets to SHP77 cells
PBMCs were ed as bed in Example 10a. Subsequently T cell subsets were
isolated using the ing reagents and protocols:
Table 11: ts and protocols for ion of T cell subsets
T cell subset Used reagents and protocols
Native T cells Miltenyi Biotech; #130—097—095
CD4+ T cells Miltenyi Biotech; #130533
—171—
T cell subset Used reagents and protocols
CD4+ or Memory T cells Miltenyi Biotech; #130—094-125
CD4+ Central Memory T cells Miltenyi Biotech; #130302
CD8+ T cells Miltenyi Biotech; #130—096—495
CD8+CD45RA+ Effector T cells Miltenyi Biotech; #130-094—485
CD8+ Memory T cells Miltenyi Biotech; #130412
Figures 16—20 shows potency of redirecting of Pan T cells (Figure 16), naive T cells
(Figure 16), CD4+T cells (Figures 17, 18), CD4+ Effector Memory T cells (Figure 18),
CD4+ Central Memory T cells (Figure 17), CD8+T cells es 19, 20), CD8+CD45RA+
Effector T cells (Figure 19), CD8+ Memory T cells e 20) against human SHP77
cells of an DLL3/CD3 g protein.
Example 20: T cell infiltration in SHP77 xenograft tumor tissue with an exemplary
DLL3/CD3 binding protein.
Remaining tumor s from mice in the study described in Example 13 were prepared,
fixed in formalin and embedded in n. Subsequently tissue sections were prepared
and stained for CD3 sion on T cells (2GV6 Ventana). T cell infiltration in SHP77
xenograft tumor tissue with an ary DLL3/CD3 binding protein is shown in Figure
21. The scoring in Table 12 was used to quantify CD3 expression in xenograft tumor
tissues.
Table 12: Scoring for quantification of infiltrating CD3 -positive T cells
moderate cell numbers or clusters in stroma and margin; low numbers of intra-
epithelial cells
igh cell numbers or clusters in stroma and margin; low numbers of intraepithelial
cells
—l72—
Example 21: Production of LL3 antibodies
To obtain anti-DLL3 binders, hybridomas or single B cells derived from DLL3 immunized
wild-type and AlivaMab humanized mice (Ablexis, San Francisco, CA, USA: AlivaMab
transgenic mouse platform with human immunoglobulin loci) were ed in vitro.
Supernatants were screened for reactivity against recombinant human DLL3, by
AlphaLISA (PerkinElmer, Waltham, MA, USA), and against SHP-77 cells (ATCC®,
CRL-2195TM) expressing human DLL3, by Flow try.
Immunoglobulin (Ig) VH and VL genes were then amplified from identified positive
clones. To isolate RNA from hybridomas, about 2x106 cells from single clones were
pelleted and used as source material. For single B cells, 100 to 500 cells expanded from
singularly ed B cells were used as source material. RNA was isolated using RNeasy
Plus (Qiagen, Hilden, Germany). cDNA was then synthesized using Smarter cDNA
synthesis kit (Clontech, Mountain View, CA) according to manufacturer’s instructions. To
facilitate cDNA synthesis, oligodT was used to prime e transcription of all
messenger RNAs ed by “5’ capping” with a Smarter IIA oligonucleotide.
Subsequent amplification of the VH and VL fragments was performed using a 2-step PCR
amplification using 5’ primers ing the Smarter IIA cap and 3 ’ primers targeting
consensus s in CH1. Briefly, each 50ul PCR reaction consists of 20uM of forward
and reverse primer mixes, 25 ul of PrimeStar Max DNA polymerase premix (Clontech), 2 ul
of unpurified cDNA, and 21 ul of double-distilled H20. The cycling program starts at 94
°C for 3 min, followed by 35 cycles (94°C for 30 Sec, 50°C for l min, 68 °C for l min),
and ends at 72 °C for 7 min. The second round PCR was performed with VL and VH 2nd
round primers containing l5bp complementary extensions that “overlap” respective
regions in their tive pTT5 mother vector (VH and VL). Second round PCR was
performed with the following program: 94 °C for 3 min; 35 cycles (94 °C for 30 Sec, 50°C
for l min, 68 °C for l min), and ends at 72 °C for 7 min.
In—Fusion® HD Cloning Kit (Clontech, USA.) was used for directional cloning ofVL
gene into pTT5 hngK vector and VH gene into pTT5 hngGlKO vector. To tate In-
Fusion® HD Cloning, PCR ts were purified and treated with Cloning Enhancer
before In—Fusion HD g. Cloning and transformation were performed according to
manufacturer’s protocol (Clontech, U.S.A.). Mini—prep DNAs were subjected to Sanger
sequencing to confirm that complete V-gene fragments were obtained.
—l73—
Using this methodology, pairs of Ig VH and VL genes ng binding domains with
specificity for DLL3 were prepared. inant antibodies were produced by transient
transfection of CHO-E37 cells with the corresponding heavy and light chain-encoding
plasmids.
Confirmatory screening of recombinant antibodies
Supernatants containing expressed recombinant antibodies were assayed by flow
cytometry for g to cell lines expressing human DLL3. Briefly, cells were incubated
with recombinant atants, washed, and bound mAbs from the supernatants were
detected with anti-human-IgG-APC (Jackson Research 109—136—098). Signal—to—
background ratios (S/B) were calculated by dividing the median fluorescence intensity
(MFI) of the sample by that of isotype control.
Surface Plasmon nce (SPR) on Biacore 400 was performed on recombinant
supernatants. Briefly, the non-optimized IgGs in the HTP supernatants were captured Via
Protein A/G onto the sensor e for 60 sec at 10 . Binding of 100 11M human
DLL3 to the captured IgGs was monitored for 180 sec of association at 30 ul/min, followed
by 120 sec of dissociation in the HBS-EP buffer. Regeneration of the n A/G e
was performed with Glycine pH 2.1 in between each binding cycle. The following
materials were used in this assay: n reagent: recombinantly expressed human DLL3.
System running buffer: HBS-EP (10 mM HEPES pH 7.4, 150 mM NaCl, 3 mM EDTA,
and 0.005% V/V polysorbate P20). Capturing reagent: Protein A/G, with specificity
towards all human IgG isotypes.
Clones of interest (with Kd<3 OOpM) were selected and further evaluated in various
detection assays as described below.
Example 22: Binding of anti-DLL3 antibodies to recombinant human DLL3 protein
g of antibodies was performed in an ELISA. In brief, anti-DLL3 antibodies were
coated at a concentration of 2 itle at 4°C over night. After washing the plates were
blocked with ng buffer (Gibco, Gibco#043 —90309A) for one hour at room
temperature, followed by washing and incubation with recombinant DLL3 protein at
increasing concentrations. For detection the bound DLL3 protein was incubated with a
polyclonal anti-DLL3 antibody (R&D Systems, AB4315) followed by a SULFO—TAG
labelled anti-goat antibody (R32AG-1) for one hour. The bound antibody was quantified
—174—
by using a Read Buffer (MSD) in a Sector imager 6000 (MSD). Figure 22 shows binding
to three exemplary anti-DLL3 antibodies to recombinant protein. LL3 antibody
targeting the membrane proximal peptide domain (DLL3#3) shows stronger binding to
recombinant DLL3 protein, ed to anti-DLL3 antibodies which target the
EGF4(DLL3#4) or EGFl domain (DLL3#S).
Example 23: Binding of anti-DLL3 antibodies to SCLC cell lines
Cells (T cells or human SCLC cells) were stained with increasing concentrations of anti-
DLL3 antibody with increasing concentrations in FACS buffer (PBS/0.5%BSA/0.05%
sodium . Bound molecules were detected with PE—conjugated ouse secondary
antibody (Jackson Immuno Research, 115—116-072) by FACS analysis. Anti-DLL3
dies targeting DSL (DLL3#6), EGFl (DLL3#5) or EGF4 4) domains show
stronger binding to SCLC cell lines expressing DLL3, compared to anti-DLL3 antibodies
which target the C—terminal peptide (DLL3#1, , ) as shown in Figure 23.
Example 24: (IHC)
Anti-DLL3 antibodies were tested on a DLL3 mRNA positive SCLC sample at 20ug/ml
concentration using Ventana Discovery ultra (Ventana Medical Systems, Inc, Arizona)
following manufacturer’s instructions. In brief, IHC was performed on formalin fixed
paraffin embedded tissue and sections (4 um) where stained with anti-DLL3 dies.
IHC assay was performed on Ventana Discovery Ultra rm using RUO Discovery
Universal protocol. Anti—DLL3 dy staining was optimised using Proteinase K as
Epitope Retrieval for 12 minutes. Anti-DLL3 antibody was incubated for 60 minutes,
followed by anti—mouse HQ detection system and anti HQ HRP both for 12 minutes.
Negative controls (IgG antibody) were performed for each tissue section, treated
identically to the test slides.
The human SCLC cell line SHP77 were used as positive control. Digital images of whole-
tissue sections were ed using a Leica SCN400 histology r (Leica
Microsystems, Milton Keynes, UK).
Immunohistochemistry analysis of a human SCLC sample with exemplary anti-DLL3
antibodies is shown in Figure 24.
—l75—
Example 25: Determination of sion levels on SCLC cell lines
Cell surface expression of anti-DLL3 antibodies was quantified using the QIFIKIT
(K0078; Dako). In brief, SCLC cell lines , NCI-H82 and NCI-H2286) were labeled
with the anti-DLL3 antibody (DL309, ) or irrelevant antibody (isotype
control) at 5 ug/ml. In a te vial. Subsequently cells and beads provided in the kit
were labeled in el with fluorescein-conjugated anti—mouse ary antibodies.
Samples were measured in a BD CantoII Fluorocytometer and consequently, the
fluorescence is correlated with the number of bound anti—DLL3 antibodies on the cells and
on the beads. Table 12 shows DLL3 molecules expressed on the cell surface of three SCLC
cell lines.
Table 13: DLL3 molecules expressed on the cell surface of SCLC cell lines
Cell surface DLL3
SCLC CELL LINE molecules/cell
SHP77 (ATCC®, CRL-
CI—H2286 129
Example 26: Determination of sensitivity of IHC protocol on SCLC cell line blocks
To evaluate the sensitivity of the IHC protocol, SCLC cell lines (SI-11377, NCI—H82 and
NCI—H2286) were processed like tissues in hospitals and fixed in Formalin and
uently embedded in paraffin.
SCLC cell lines were cultured according to ATCC instructions. Cells were scraped from
the plate and fixed in Formalin and subsequently added to solubilized Histogel (Thermo
Fisher scientific, HG-4000—012) and incubated over night at 4°C, followed by a standard
paraffin ing ure performed in routine pathology laboratory. In brief, cell
block is incubated in l and Isopropanol before ing in Paraffin (roti-Plast,
#66425). Sections of the cell pellet blocks were performed and sections were stained with
the protocol as described in Example 24. The results shown in Figure 25 show that an IHC
protocol with anti-DLL3 antibody DLL3#5 is able to detect cells with very low DLL3
expression.
—l76—
WO 20191234220
Claims (1)
1. l. A protein comprising a first antigen binding unit Specifically binding to DLL3 and a second antigen binding unit specifically binding to CD3, wherein said first antigen binding unit specifically binding to DLL3 is selected from the group consisting of i) to xviii): i) an antigen binding unit comprising light chain CDRs comprising the amino acid ces of SEQ ID N0:l (CDRl), SEQ ID N0:2 (CDR2) and SEQ ID NO:3 (CDR3) and heavy chain CDRs comprising the amino acid sequences 10 of SEQ ID NO:4 (CDRl), SEQ ID N025 (CDR2) and SEQ ID N0:6 (CDR3); ii) an antigen binding unit comprising light chain CDRs sing the amino acid sequences of SEQ ID N017 (CDRl), SEQ ID N028 (CDR2) and SEQ ID N0:9 (CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID N0210 (CDRI), SEQ ID N0:ll (CDR2) and SEQ ID N0212 15 ; iii) an antigen binding unit comprising light chain CDRs comprising the amino acid ces of SEQ ID N0:l3 (CDRl), SEQ ID N0:14 (CDR2) and SEQ ID N0:15 (CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID N0:l6 (CDRl), SEQ ID N0:l7I (CDR2) and SEQ ID 20 N0:18 (CDR3); iv) an antigen binding unit comprising light chain CDRs comprising the amino acid sequences of SEQ ID N0:l9 , SEQ ID N0:20 (CDR2) and SEQ ID N0:21 (CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID N0:22 (CDRl), SEQ ID N0:23 (CDR2) and SEQ ID 25 N0:24 (CDR3); an antigen binding unit comprising light chain CDRs comprising the amino acid sequences of SEQ ID N0:25 (CDRl), SEQ ID N0:26 (CDR2) and SEQ ID N0:27 (CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID N0:28 , SEQ ID N0:29 (CDR2) and SEQ ID 30 NO:30 (CDR3); vi) an antigen binding unit comprising light chain CDRs comprising the amino acid ces of SEQ ID N0231 (CDRI), SEQ ID N0232 (CDR2) and SEQ —l77— WO 20191234220 ID NO:33 (CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID NO:34 , SEQ ID NO:35 (CDR2) and SEQ ID NO:36 (CDR3); vii) an antigen binding unit comprising light chain CDRs comprising the amino acid sequences of SEQ ID NO:133 (CDRl), SEQ ID NO:134 (CDR2) and SEQ ID NO:135 (CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID NO:136 (CDRl), SEQ ID NO:137 (CDR2) and SEQ ID NO:138 (CDR3); viii) an antigen binding unit comprising light chain CDRs comprising the amino 10 acid sequences of SEQ ID NO:139 (CDRl), SEQ ID NO:140 (CDR2) and SEQ ID NO:14l (CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID NO:142 (CDRI), SEQ ID NO:143 (CDR2) and SEQ ID NO:144 (CDR3); ix) an antigen binding unit comprising light chain CDRs comprising the amino 15 acid sequences of SEQ ID NO:145 (CDRl), SEQ ID NO:146 (CDR2) and SEQ ID NO:147 (CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID NO:148 (CDRI), SEQ ID NO:149 (CDR2) and SEQ ID NO:150 (CDR3); an antigen binding unit comprising light chain CDRs comprising the amino 20 acid ces of SEQ ID NO:151 (CDRl), SEQ ID NO:152 (CDR2) and SEQ ID NO:153 (CDR3) and heavy chain CDRs comprising the amino acid ces of SEQ ID NO:154 (CDRl), SEQ ID NO:155 (CDR2) and SEQ ID NO:156 (CDR3); xi) an antigen binding unit comprising light chain CDRs comprising the amino 25 acid ces of SEQ ID NO:157 (CDRl), SEQ ID NO:158 (CDR2) and SEQ ID NO:159 (CDR3) and heavy chain CDRs comprising the amino acid sequences of SEQ ID NO:16O (CDRl), SEQ ID NO:161 (CDR2) and SEQ ID NO:162 (CDR3); xii) an n binding unit sing light chain CDRs comprising the amino 30 acid sequences of SEQ ID NO:163 (CDRl), SEQ ID NO:164 (CDR2) and SEQ ID NO:165 (CDR3) and heavy chain CDRs comprising the amino acid —l78— WO 20191234220
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP18176888.8 | 2018-06-09 | ||
EP18176889.6 | 2018-06-09 | ||
EP19159321.9 | 2019-02-26 |
Publications (1)
Publication Number | Publication Date |
---|---|
NZ769422A true NZ769422A (en) |
Family
ID=
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20220251236A1 (en) | Multi-specific binding proteins for cancer treatment | |
US11732045B2 (en) | Multi-specific binding proteins for cancer treatment | |
US10604576B2 (en) | Antibodies and immunocytokines | |
JP7196076B2 (en) | Anti-TNF-related apoptosis-inducing ligand receptor 2 and anti-cadherin 17 binding bispecific molecules for the treatment of cancer | |
TWI564306B (en) | Bispecific antibody | |
KR20210076918A (en) | Antibody constructs binding to 4-1BB and tumor-associated antigens and uses thereof | |
CN115368458A (en) | anti-CD 73 antibodies and uses thereof | |
NZ769422A (en) | Dll3-cd3 bispecific antibodies | |
US20220411533A1 (en) | Novel Tri-specific Binding Molecules | |
US20240052065A1 (en) | Binding molecules for the treatment of cancer | |
WO2023086897A1 (en) | Siglec-6 antibodies, derivative compounds and related uses | |
JP2023536630A (en) | PD-L1 binding agents and uses thereof | |
TW202417501A (en) | Binding molecules for the treatment of cancer |