NZ768752A - Anti-human 4-1 bb antibodies and use thereof - Google Patents
Anti-human 4-1 bb antibodies and use thereofInfo
- Publication number
- NZ768752A NZ768752A NZNZ768752A NZ76875220A NZ768752A NZ 768752 A NZ768752 A NZ 768752A NZ NZ768752 A NZNZ768752 A NZ NZ768752A NZ 76875220 A NZ76875220 A NZ 76875220A NZ 768752 A NZ768752 A NZ 768752A
- Authority
- NZ
- New Zealand
- Prior art keywords
- antibody
- sequence
- seq
- human
- cancer
- Prior art date
Links
- 239000012634 fragment Substances 0.000 claims abstract description 213
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 169
- 210000001744 T-lymphocyte Anatomy 0.000 claims abstract description 148
- 238000000034 method Methods 0.000 claims abstract description 109
- 201000011510 cancer Diseases 0.000 claims abstract description 93
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 claims abstract description 66
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 claims abstract description 66
- 238000011282 treatment Methods 0.000 claims abstract description 64
- 230000028327 secretion Effects 0.000 claims abstract description 21
- 230000001939 inductive effect Effects 0.000 claims abstract description 16
- 238000000338 in vitro Methods 0.000 claims abstract description 12
- 230000027455 binding Effects 0.000 claims description 275
- 238000009739 binding Methods 0.000 claims description 271
- 239000000427 antigen Substances 0.000 claims description 218
- 108091007433 antigens Proteins 0.000 claims description 217
- 102000036639 antigens Human genes 0.000 claims description 217
- 210000004027 cell Anatomy 0.000 claims description 182
- 239000000203 mixture Substances 0.000 claims description 98
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 84
- 239000003795 chemical substances by application Substances 0.000 claims description 63
- 239000013598 vector Substances 0.000 claims description 60
- 150000007523 nucleic acids Chemical class 0.000 claims description 53
- 102000039446 nucleic acids Human genes 0.000 claims description 48
- 108020004707 nucleic acids Proteins 0.000 claims description 48
- 230000000694 effects Effects 0.000 claims description 46
- 230000014509 gene expression Effects 0.000 claims description 35
- 230000001965 increasing effect Effects 0.000 claims description 31
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 claims description 28
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 claims description 23
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 claims description 23
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 claims description 20
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 claims description 20
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 claims description 19
- 239000002246 antineoplastic agent Substances 0.000 claims description 18
- 230000035755 proliferation Effects 0.000 claims description 18
- 230000001093 anti-cancer Effects 0.000 claims description 17
- 239000003814 drug Substances 0.000 claims description 17
- 239000004474 valine Substances 0.000 claims description 16
- 238000002560 therapeutic procedure Methods 0.000 claims description 15
- 125000002987 valine group Chemical group [H]N([H])C([H])(C(*)=O)C([H])(C([H])([H])[H])C([H])([H])[H] 0.000 claims description 15
- 229940127089 cytotoxic agent Drugs 0.000 claims description 13
- 238000002955 isolation Methods 0.000 claims description 13
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 claims description 12
- 239000004473 Threonine Substances 0.000 claims description 12
- 238000004519 manufacturing process Methods 0.000 claims description 12
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 11
- 206010009944 Colon cancer Diseases 0.000 claims description 11
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 claims description 9
- 239000004472 Lysine Substances 0.000 claims description 9
- 208000029742 colonic neoplasm Diseases 0.000 claims description 9
- 230000011664 signaling Effects 0.000 claims description 9
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 claims description 8
- 239000002253 acid Substances 0.000 claims description 8
- 210000004748 cultured cell Anatomy 0.000 claims description 8
- 208000008443 pancreatic carcinoma Diseases 0.000 claims description 8
- 206010006187 Breast cancer Diseases 0.000 claims description 7
- 208000026310 Breast neoplasm Diseases 0.000 claims description 7
- 206010014733 Endometrial cancer Diseases 0.000 claims description 7
- 206010014759 Endometrial neoplasm Diseases 0.000 claims description 7
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims description 7
- 208000024770 Thyroid neoplasm Diseases 0.000 claims description 7
- 201000010536 head and neck cancer Diseases 0.000 claims description 7
- 208000014829 head and neck neoplasm Diseases 0.000 claims description 7
- 230000028993 immune response Effects 0.000 claims description 7
- 201000007270 liver cancer Diseases 0.000 claims description 7
- 208000014018 liver neoplasm Diseases 0.000 claims description 7
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims description 7
- 201000002528 pancreatic cancer Diseases 0.000 claims description 7
- 206010005003 Bladder cancer Diseases 0.000 claims description 6
- 108010074328 Interferon-gamma Proteins 0.000 claims description 6
- 206010039491 Sarcoma Diseases 0.000 claims description 6
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 claims description 6
- 230000001580 bacterial effect Effects 0.000 claims description 6
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 claims description 6
- 229960004316 cisplatin Drugs 0.000 claims description 6
- 229960004679 doxorubicin Drugs 0.000 claims description 6
- 210000004698 lymphocyte Anatomy 0.000 claims description 6
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 claims description 6
- 201000002510 thyroid cancer Diseases 0.000 claims description 6
- 201000005112 urinary bladder cancer Diseases 0.000 claims description 6
- 206010008342 Cervix carcinoma Diseases 0.000 claims description 5
- 208000000461 Esophageal Neoplasms Diseases 0.000 claims description 5
- 201000001342 Fallopian tube cancer Diseases 0.000 claims description 5
- 208000013452 Fallopian tube neoplasm Diseases 0.000 claims description 5
- 241000238631 Hexapoda Species 0.000 claims description 5
- 206010023825 Laryngeal cancer Diseases 0.000 claims description 5
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 5
- 206010030155 Oesophageal carcinoma Diseases 0.000 claims description 5
- 229930012538 Paclitaxel Natural products 0.000 claims description 5
- 206010060862 Prostate cancer Diseases 0.000 claims description 5
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 5
- 208000004337 Salivary Gland Neoplasms Diseases 0.000 claims description 5
- 206010061934 Salivary gland cancer Diseases 0.000 claims description 5
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 claims description 5
- 201000010881 cervical cancer Diseases 0.000 claims description 5
- 201000004101 esophageal cancer Diseases 0.000 claims description 5
- 230000002489 hematologic effect Effects 0.000 claims description 5
- 229960004768 irinotecan Drugs 0.000 claims description 5
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 claims description 5
- 206010023841 laryngeal neoplasm Diseases 0.000 claims description 5
- 201000005202 lung cancer Diseases 0.000 claims description 5
- 208000020816 lung neoplasm Diseases 0.000 claims description 5
- 229960001592 paclitaxel Drugs 0.000 claims description 5
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 claims description 5
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 claims description 4
- 102100037850 Interferon gamma Human genes 0.000 claims description 4
- 206010027406 Mesothelioma Diseases 0.000 claims description 4
- 102100040678 Programmed cell death protein 1 Human genes 0.000 claims description 4
- 240000004808 Saccharomyces cerevisiae Species 0.000 claims description 4
- 208000005718 Stomach Neoplasms Diseases 0.000 claims description 4
- 238000012258 culturing Methods 0.000 claims description 4
- 206010017758 gastric cancer Diseases 0.000 claims description 4
- 210000004962 mammalian cell Anatomy 0.000 claims description 4
- 201000011549 stomach cancer Diseases 0.000 claims description 4
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 claims description 3
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 claims description 3
- 208000026149 Primary peritoneal carcinoma Diseases 0.000 claims description 3
- 229960004397 cyclophosphamide Drugs 0.000 claims description 3
- 210000002865 immune cell Anatomy 0.000 claims description 3
- 229940124650 anti-cancer therapies Drugs 0.000 claims description 2
- 238000011319 anticancer therapy Methods 0.000 claims description 2
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 claims 5
- 101710089372 Programmed cell death protein 1 Proteins 0.000 claims 3
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 claims 2
- 108010002350 Interleukin-2 Proteins 0.000 claims 1
- 241000235058 Komagataella pastoris Species 0.000 claims 1
- 230000005865 ionizing radiation Effects 0.000 claims 1
- 230000002611 ovarian Effects 0.000 claims 1
- 229940035893 uracil Drugs 0.000 claims 1
- 230000035772 mutation Effects 0.000 abstract description 30
- 230000001225 therapeutic effect Effects 0.000 abstract description 19
- 238000001727 in vivo Methods 0.000 abstract description 7
- 230000002265 prevention Effects 0.000 abstract description 7
- 238000001514 detection method Methods 0.000 abstract description 6
- 230000006052 T cell proliferation Effects 0.000 abstract description 5
- 239000003153 chemical reaction reagent Substances 0.000 abstract description 4
- 241000282414 Homo sapiens Species 0.000 description 131
- 102000004196 processed proteins & peptides Human genes 0.000 description 78
- 229920001184 polypeptide Polymers 0.000 description 77
- 235000001014 amino acid Nutrition 0.000 description 71
- 229940024606 amino acid Drugs 0.000 description 64
- 150000001413 amino acids Chemical class 0.000 description 64
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 61
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 56
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 56
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 38
- 230000001976 improved effect Effects 0.000 description 31
- 229960002621 pembrolizumab Drugs 0.000 description 23
- 239000008194 pharmaceutical composition Substances 0.000 description 23
- 201000010099 disease Diseases 0.000 description 21
- 108090000623 proteins and genes Proteins 0.000 description 21
- 241000699666 Mus <mouse, genus> Species 0.000 description 20
- 230000004927 fusion Effects 0.000 description 19
- 238000002965 ELISA Methods 0.000 description 18
- -1 I 10 amino acids Chemical class 0.000 description 17
- 208000035475 disorder Diseases 0.000 description 17
- 239000000546 pharmaceutical excipient Substances 0.000 description 17
- 210000001519 tissue Anatomy 0.000 description 17
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 16
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 16
- 238000011577 humanized mouse model Methods 0.000 description 16
- 108020004414 DNA Proteins 0.000 description 15
- 241001465754 Metazoa Species 0.000 description 15
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 15
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 15
- 210000002966 serum Anatomy 0.000 description 15
- 239000000126 substance Substances 0.000 description 15
- 102000004127 Cytokines Human genes 0.000 description 14
- 108090000695 Cytokines Proteins 0.000 description 14
- 241000699670 Mus sp. Species 0.000 description 14
- 125000003275 alpha amino acid group Chemical group 0.000 description 14
- 210000004369 blood Anatomy 0.000 description 14
- 239000008280 blood Substances 0.000 description 14
- 150000002500 ions Chemical class 0.000 description 14
- 239000002609 medium Substances 0.000 description 14
- 239000000243 solution Substances 0.000 description 14
- 102000004169 proteins and genes Human genes 0.000 description 13
- 238000002648 combination therapy Methods 0.000 description 12
- 239000013604 expression vector Substances 0.000 description 12
- 230000004048 modification Effects 0.000 description 12
- 238000012986 modification Methods 0.000 description 12
- 238000006467 substitution reaction Methods 0.000 description 12
- 239000000556 agonist Substances 0.000 description 11
- 238000004458 analytical method Methods 0.000 description 11
- 241001529936 Murinae Species 0.000 description 10
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 9
- 108060003951 Immunoglobulin Proteins 0.000 description 9
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 9
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 9
- 125000000539 amino acid group Chemical group 0.000 description 9
- 238000003556 assay Methods 0.000 description 9
- 102000018358 immunoglobulin Human genes 0.000 description 9
- 239000007924 injection Substances 0.000 description 9
- 238000002347 injection Methods 0.000 description 9
- 235000018102 proteins Nutrition 0.000 description 9
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 8
- 230000000259 anti-tumor effect Effects 0.000 description 8
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 8
- 238000009472 formulation Methods 0.000 description 8
- 230000006870 function Effects 0.000 description 8
- 239000001963 growth medium Substances 0.000 description 8
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 8
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 7
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 7
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 7
- 108091028043 Nucleic acid sequence Proteins 0.000 description 7
- 229960001230 asparagine Drugs 0.000 description 7
- 235000009582 asparagine Nutrition 0.000 description 7
- 230000004663 cell proliferation Effects 0.000 description 7
- 238000006243 chemical reaction Methods 0.000 description 7
- 238000011284 combination treatment Methods 0.000 description 7
- 230000007423 decrease Effects 0.000 description 7
- 238000011161 development Methods 0.000 description 7
- 230000018109 developmental process Effects 0.000 description 7
- 239000012530 fluid Substances 0.000 description 7
- 239000003755 preservative agent Substances 0.000 description 7
- 230000009870 specific binding Effects 0.000 description 7
- 208000024891 symptom Diseases 0.000 description 7
- 229940124597 therapeutic agent Drugs 0.000 description 7
- 230000004614 tumor growth Effects 0.000 description 7
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 6
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 6
- 241000282412 Homo Species 0.000 description 6
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 6
- 230000006786 activation induced cell death Effects 0.000 description 6
- 239000004480 active ingredient Substances 0.000 description 6
- 239000011230 binding agent Substances 0.000 description 6
- 150000001720 carbohydrates Chemical class 0.000 description 6
- 238000005119 centrifugation Methods 0.000 description 6
- 230000000875 corresponding effect Effects 0.000 description 6
- 239000003085 diluting agent Substances 0.000 description 6
- 238000005259 measurement Methods 0.000 description 6
- 230000001404 mediated effect Effects 0.000 description 6
- 102000040430 polynucleotide Human genes 0.000 description 6
- 108091033319 polynucleotide Proteins 0.000 description 6
- 239000002157 polynucleotide Substances 0.000 description 6
- 238000000746 purification Methods 0.000 description 6
- 230000001177 retroviral effect Effects 0.000 description 6
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 6
- 210000004881 tumor cell Anatomy 0.000 description 6
- 241000588724 Escherichia coli Species 0.000 description 5
- 102000037982 Immune checkpoint proteins Human genes 0.000 description 5
- 108091008036 Immune checkpoint proteins Proteins 0.000 description 5
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 5
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 5
- 206010025323 Lymphomas Diseases 0.000 description 5
- 241000124008 Mammalia Species 0.000 description 5
- 241000288906 Primates Species 0.000 description 5
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 5
- 210000000601 blood cell Anatomy 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 235000014633 carbohydrates Nutrition 0.000 description 5
- 230000001413 cellular effect Effects 0.000 description 5
- 238000010494 dissociation reaction Methods 0.000 description 5
- 230000005593 dissociations Effects 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 5
- 230000002401 inhibitory effect Effects 0.000 description 5
- 230000005764 inhibitory process Effects 0.000 description 5
- 230000003211 malignant effect Effects 0.000 description 5
- 201000001441 melanoma Diseases 0.000 description 5
- 239000012528 membrane Substances 0.000 description 5
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 5
- 210000000056 organ Anatomy 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 239000000523 sample Substances 0.000 description 5
- 239000011780 sodium chloride Substances 0.000 description 5
- 241000894007 species Species 0.000 description 5
- 230000000638 stimulation Effects 0.000 description 5
- 239000006228 supernatant Substances 0.000 description 5
- 241001430294 unidentified retrovirus Species 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- 238000001262 western blot Methods 0.000 description 5
- 108020004705 Codon Proteins 0.000 description 4
- 238000008157 ELISA kit Methods 0.000 description 4
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 4
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 4
- 241000725303 Human immunodeficiency virus Species 0.000 description 4
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 4
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 4
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 4
- 206010033128 Ovarian cancer Diseases 0.000 description 4
- 206010061535 Ovarian neoplasm Diseases 0.000 description 4
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 4
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 4
- 239000013543 active substance Substances 0.000 description 4
- 230000001270 agonistic effect Effects 0.000 description 4
- 239000005557 antagonist Substances 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 230000022534 cell killing Effects 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 230000009977 dual effect Effects 0.000 description 4
- 239000012636 effector Substances 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 230000002708 enhancing effect Effects 0.000 description 4
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 4
- 229960002949 fluorouracil Drugs 0.000 description 4
- 230000013595 glycosylation Effects 0.000 description 4
- 238000006206 glycosylation reaction Methods 0.000 description 4
- 230000012010 growth Effects 0.000 description 4
- 230000006872 improvement Effects 0.000 description 4
- 238000001802 infusion Methods 0.000 description 4
- 239000003112 inhibitor Substances 0.000 description 4
- 239000003446 ligand Substances 0.000 description 4
- RLSSMJSEOOYNOY-UHFFFAOYSA-N m-cresol Chemical compound CC1=CC=CC(O)=C1 RLSSMJSEOOYNOY-UHFFFAOYSA-N 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 210000004379 membrane Anatomy 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 230000002335 preservative effect Effects 0.000 description 4
- 230000002062 proliferating effect Effects 0.000 description 4
- 102000005962 receptors Human genes 0.000 description 4
- 108020003175 receptors Proteins 0.000 description 4
- 230000002829 reductive effect Effects 0.000 description 4
- 150000003384 small molecules Chemical class 0.000 description 4
- 239000003981 vehicle Substances 0.000 description 4
- 239000013603 viral vector Substances 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 3
- 229940045513 CTLA4 antagonist Drugs 0.000 description 3
- 241000282465 Canis Species 0.000 description 3
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 3
- 241000196324 Embryophyta Species 0.000 description 3
- 229920001917 Ficoll Polymers 0.000 description 3
- 208000022072 Gallbladder Neoplasms Diseases 0.000 description 3
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 3
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 3
- 208000017604 Hodgkin disease Diseases 0.000 description 3
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 3
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 3
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 3
- 241000283973 Oryctolagus cuniculus Species 0.000 description 3
- 239000004698 Polyethylene Substances 0.000 description 3
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 3
- 230000006044 T cell activation Effects 0.000 description 3
- 235000004279 alanine Nutrition 0.000 description 3
- 229940049595 antibody-drug conjugate Drugs 0.000 description 3
- 230000006907 apoptotic process Effects 0.000 description 3
- 230000009286 beneficial effect Effects 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 239000012472 biological sample Substances 0.000 description 3
- 230000037396 body weight Effects 0.000 description 3
- 230000005907 cancer growth Effects 0.000 description 3
- 239000000969 carrier Substances 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 230000003013 cytotoxicity Effects 0.000 description 3
- 231100000135 cytotoxicity Toxicity 0.000 description 3
- 230000034994 death Effects 0.000 description 3
- 231100000517 death Toxicity 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 239000000539 dimer Substances 0.000 description 3
- 239000003995 emulsifying agent Substances 0.000 description 3
- 210000003743 erythrocyte Anatomy 0.000 description 3
- 239000000284 extract Substances 0.000 description 3
- 238000000684 flow cytometry Methods 0.000 description 3
- 201000010175 gallbladder cancer Diseases 0.000 description 3
- 235000013922 glutamic acid Nutrition 0.000 description 3
- 239000004220 glutamic acid Substances 0.000 description 3
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 3
- 208000032839 leukemia Diseases 0.000 description 3
- 239000008297 liquid dosage form Substances 0.000 description 3
- 238000002826 magnetic-activated cell sorting Methods 0.000 description 3
- 230000036210 malignancy Effects 0.000 description 3
- 238000013507 mapping Methods 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 125000003729 nucleotide group Chemical group 0.000 description 3
- 238000004091 panning Methods 0.000 description 3
- 230000001717 pathogenic effect Effects 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 210000003289 regulatory T cell Anatomy 0.000 description 3
- 230000001105 regulatory effect Effects 0.000 description 3
- 230000010076 replication Effects 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 238000012163 sequencing technique Methods 0.000 description 3
- 238000010561 standard procedure Methods 0.000 description 3
- 238000003860 storage Methods 0.000 description 3
- 239000007929 subcutaneous injection Substances 0.000 description 3
- 238000010254 subcutaneous injection Methods 0.000 description 3
- 238000011285 therapeutic regimen Methods 0.000 description 3
- 230000000699 topical effect Effects 0.000 description 3
- 230000009466 transformation Effects 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- BXTJCSYMGFJEID-XMTADJHZSA-N (2s)-2-[[(2r,3r)-3-[(2s)-1-[(3r,4s,5s)-4-[[(2s)-2-[[(2s)-2-[6-[3-[(2r)-2-amino-2-carboxyethyl]sulfanyl-2,5-dioxopyrrolidin-1-yl]hexanoyl-methylamino]-3-methylbutanoyl]amino]-3-methylbutanoyl]-methylamino]-3-methoxy-5-methylheptanoyl]pyrrolidin-2-yl]-3-met Chemical compound C([C@H](NC(=O)[C@H](C)[C@@H](OC)[C@@H]1CCCN1C(=O)C[C@H]([C@H]([C@@H](C)CC)N(C)C(=O)[C@@H](NC(=O)[C@H](C(C)C)N(C)C(=O)CCCCCN1C(C(SC[C@H](N)C(O)=O)CC1=O)=O)C(C)C)OC)C(O)=O)C1=CC=CC=C1 BXTJCSYMGFJEID-XMTADJHZSA-N 0.000 description 2
- CFKMVGJGLGKFKI-UHFFFAOYSA-N 4-chloro-m-cresol Chemical compound CC1=CC(O)=CC=C1Cl CFKMVGJGLGKFKI-UHFFFAOYSA-N 0.000 description 2
- YXHLJMWYDTXDHS-IRFLANFNSA-N 7-aminoactinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=C(N)C=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 YXHLJMWYDTXDHS-IRFLANFNSA-N 0.000 description 2
- 108700012813 7-aminoactinomycin D Proteins 0.000 description 2
- 241000251468 Actinopterygii Species 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 201000009030 Carcinoma Diseases 0.000 description 2
- 241000282693 Cercopithecidae Species 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 206010052360 Colorectal adenocarcinoma Diseases 0.000 description 2
- 108010062580 Concanavalin A Proteins 0.000 description 2
- 102000006395 Globulins Human genes 0.000 description 2
- 108010044091 Globulins Proteins 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 101710083479 Hepatitis A virus cellular receptor 2 homolog Proteins 0.000 description 2
- 101100005713 Homo sapiens CD4 gene Proteins 0.000 description 2
- 102000008100 Human Serum Albumin Human genes 0.000 description 2
- 108091006905 Human Serum Albumin Proteins 0.000 description 2
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 2
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- 102000008070 Interferon-gamma Human genes 0.000 description 2
- 208000005016 Intestinal Neoplasms Diseases 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- 229930126263 Maytansine Natural products 0.000 description 2
- 239000000020 Nitrocellulose Substances 0.000 description 2
- 241001494479 Pecora Species 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 241000283984 Rodentia Species 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- 239000004268 Sodium erythorbin Substances 0.000 description 2
- 229940126530 T cell activator Drugs 0.000 description 2
- 229940126547 T-cell immunoglobulin mucin-3 Drugs 0.000 description 2
- 108091023040 Transcription factor Proteins 0.000 description 2
- 102000040945 Transcription factor Human genes 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 239000012190 activator Substances 0.000 description 2
- 238000007792 addition Methods 0.000 description 2
- 230000002424 anti-apoptotic effect Effects 0.000 description 2
- 230000000840 anti-viral effect Effects 0.000 description 2
- 239000000611 antibody drug conjugate Substances 0.000 description 2
- 229960003852 atezolizumab Drugs 0.000 description 2
- 230000001363 autoimmune Effects 0.000 description 2
- 229950002916 avelumab Drugs 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 239000002585 base Substances 0.000 description 2
- 235000019445 benzyl alcohol Nutrition 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 239000006172 buffering agent Substances 0.000 description 2
- AIYUHDOJVYHVIT-UHFFFAOYSA-M caesium chloride Chemical compound [Cl-].[Cs+] AIYUHDOJVYHVIT-UHFFFAOYSA-M 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- VFLDPWHFBUODDF-FCXRPNKRSA-N curcumin Chemical compound C1=C(O)C(OC)=CC(\C=C\C(=O)CC(=O)\C=C\C=2C=C(OC)C(O)=CC=2)=C1 VFLDPWHFBUODDF-FCXRPNKRSA-N 0.000 description 2
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 2
- 230000001472 cytotoxic effect Effects 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 210000004443 dendritic cell Anatomy 0.000 description 2
- 239000010432 diamond Substances 0.000 description 2
- 238000002224 dissection Methods 0.000 description 2
- 229950009791 durvalumab Drugs 0.000 description 2
- 210000003162 effector t lymphocyte Anatomy 0.000 description 2
- 238000001378 electrochemiluminescence detection Methods 0.000 description 2
- 238000001962 electrophoresis Methods 0.000 description 2
- 229930013356 epothilone Natural products 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 230000002496 gastric effect Effects 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 150000004676 glycans Chemical class 0.000 description 2
- 238000003306 harvesting Methods 0.000 description 2
- 201000005787 hematologic cancer Diseases 0.000 description 2
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 230000036039 immunity Effects 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 239000003701 inert diluent Substances 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 229960003130 interferon gamma Drugs 0.000 description 2
- 201000002313 intestinal cancer Diseases 0.000 description 2
- 239000007928 intraperitoneal injection Substances 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- PGHMRUGBZOYCAA-UHFFFAOYSA-N ionomycin Natural products O1C(CC(O)C(C)C(O)C(C)C=CCC(C)CC(C)C(O)=CC(=O)C(C)CC(C)CC(CCC(O)=O)C)CCC1(C)C1OC(C)(C(C)O)CC1 PGHMRUGBZOYCAA-UHFFFAOYSA-N 0.000 description 2
- PGHMRUGBZOYCAA-ADZNBVRBSA-N ionomycin Chemical compound O1[C@H](C[C@H](O)[C@H](C)[C@H](O)[C@H](C)/C=C/C[C@@H](C)C[C@@H](C)C(/O)=C/C(=O)[C@@H](C)C[C@@H](C)C[C@@H](CCC(O)=O)C)CC[C@@]1(C)[C@@H]1O[C@](C)([C@@H](C)O)CC1 PGHMRUGBZOYCAA-ADZNBVRBSA-N 0.000 description 2
- 229910052742 iron Inorganic materials 0.000 description 2
- 238000001155 isoelectric focusing Methods 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 231100000053 low toxicity Toxicity 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 239000012139 lysis buffer Substances 0.000 description 2
- 239000006148 magnetic separator Substances 0.000 description 2
- 230000013011 mating Effects 0.000 description 2
- 230000035800 maturation Effects 0.000 description 2
- WKPWGQKGSOKKOO-RSFHAFMBSA-N maytansine Chemical compound CO[C@@H]([C@@]1(O)C[C@](OC(=O)N1)([C@H]([C@@H]1O[C@@]1(C)[C@@H](OC(=O)[C@H](C)N(C)C(C)=O)CC(=O)N1C)C)[H])\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 WKPWGQKGSOKKOO-RSFHAFMBSA-N 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- 150000002739 metals Chemical class 0.000 description 2
- 230000001394 metastastic effect Effects 0.000 description 2
- 206010061289 metastatic neoplasm Diseases 0.000 description 2
- 210000005087 mononuclear cell Anatomy 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- 210000000822 natural killer cell Anatomy 0.000 description 2
- 229920001220 nitrocellulos Polymers 0.000 description 2
- 229960003301 nivolumab Drugs 0.000 description 2
- QWVGKYWNOKOFNN-UHFFFAOYSA-N o-cresol Chemical compound CC1=CC=CC=C1O QWVGKYWNOKOFNN-UHFFFAOYSA-N 0.000 description 2
- 239000013618 particulate matter Substances 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 2
- PHEDXBVPIONUQT-RGYGYFBISA-N phorbol 13-acetate 12-myristate Chemical compound C([C@]1(O)C(=O)C(C)=C[C@H]1[C@@]1(O)[C@H](C)[C@H]2OC(=O)CCCCCCCCCCCCC)C(CO)=C[C@H]1[C@H]1[C@]2(OC(C)=O)C1(C)C PHEDXBVPIONUQT-RGYGYFBISA-N 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 238000003259 recombinant expression Methods 0.000 description 2
- 230000027223 regulation of cytokine secretion Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 230000004936 stimulating effect Effects 0.000 description 2
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 230000009261 transgenic effect Effects 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- MFZSNESUTRVBQX-XEURHVNRSA-N (2S)-2-amino-6-[4-[[3-[[(2S)-1-[[(1S,2R,3S,5S,6S,16E,18E,20R,21S)-11-chloro-21-hydroxy-12,20-dimethoxy-2,5,9,16-tetramethyl-8,23-dioxo-4,24-dioxa-9,22-diazatetracyclo[19.3.1.110,14.03,5]hexacosa-10,12,14(26),16,18-pentaen-6-yl]oxy]-1-oxopropan-2-yl]-methylamino]-3-oxopropyl]disulfanyl]pentanoylamino]hexanoic acid Chemical compound CO[C@@H]1\C=C\C=C(C)\Cc2cc(OC)c(Cl)c(c2)N(C)C(=O)C[C@H](OC(=O)[C@H](C)N(C)C(=O)CCSSC(C)CCC(=O)NCCCC[C@H](N)C(O)=O)[C@]2(C)O[C@H]2[C@H](C)[C@@H]2C[C@@]1(O)NC(=O)O2 MFZSNESUTRVBQX-XEURHVNRSA-N 0.000 description 1
- OOIBFPKQHULHSQ-UHFFFAOYSA-N (3-hydroxy-1-adamantyl) 2-methylprop-2-enoate Chemical compound C1C(C2)CC3CC2(O)CC1(OC(=O)C(=C)C)C3 OOIBFPKQHULHSQ-UHFFFAOYSA-N 0.000 description 1
- BQIMPGFMMOZASS-CLZZGJSISA-N (6r,7r)-7-amino-3-(hydroxymethyl)-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid Chemical compound S1CC(CO)=C(C(O)=O)N2C(=O)[C@@H](N)[C@H]21 BQIMPGFMMOZASS-CLZZGJSISA-N 0.000 description 1
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 1
- QCDWFXQBSFUVSP-UHFFFAOYSA-N 2-phenoxyethanol Chemical compound OCCOC1=CC=CC=C1 QCDWFXQBSFUVSP-UHFFFAOYSA-N 0.000 description 1
- NDMPLJNOPCLANR-UHFFFAOYSA-N 3,4-dihydroxy-15-(4-hydroxy-18-methoxycarbonyl-5,18-seco-ibogamin-18-yl)-16-methoxy-1-methyl-6,7-didehydro-aspidospermidine-3-carboxylic acid methyl ester Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 NDMPLJNOPCLANR-UHFFFAOYSA-N 0.000 description 1
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 1
- 102000002627 4-1BB Ligand Human genes 0.000 description 1
- 108010082808 4-1BB Ligand Proteins 0.000 description 1
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 description 1
- WYWHKKSPHMUBEB-UHFFFAOYSA-N 6-Mercaptoguanine Natural products N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 1
- 101150034533 ATIC gene Proteins 0.000 description 1
- 208000010507 Adenocarcinoma of Lung Diseases 0.000 description 1
- 206010052747 Adenocarcinoma pancreas Diseases 0.000 description 1
- 208000003200 Adenoma Diseases 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 241000271566 Aves Species 0.000 description 1
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 1
- 101000840545 Bacillus thuringiensis L-isoleucine-4-hydroxylase Proteins 0.000 description 1
- 102100024775 Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase Human genes 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 102100027138 Butyrophilin subfamily 3 member A1 Human genes 0.000 description 1
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 1
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 1
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 1
- 208000010667 Carcinoma of liver and intrahepatic biliary tract Diseases 0.000 description 1
- 241000251730 Chondrichthyes Species 0.000 description 1
- 108700010070 Codon Usage Proteins 0.000 description 1
- 102000029816 Collagenase Human genes 0.000 description 1
- 108060005980 Collagenase Proteins 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 102000000989 Complement System Proteins Human genes 0.000 description 1
- 108010069112 Complement System Proteins Proteins 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 241000938605 Crocodylia Species 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- 150000008574 D-amino acids Chemical class 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 108090000323 DNA Topoisomerases Proteins 0.000 description 1
- 102000003915 DNA Topoisomerases Human genes 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 208000031969 Eye Hemorrhage Diseases 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 210000000712 G cell Anatomy 0.000 description 1
- 108700023863 Gene Components Proteins 0.000 description 1
- 208000032612 Glial tumor Diseases 0.000 description 1
- 206010018338 Glioma Diseases 0.000 description 1
- 102000005720 Glutathione transferase Human genes 0.000 description 1
- 108010070675 Glutathione transferase Proteins 0.000 description 1
- 241000989913 Gunnera petaloidea Species 0.000 description 1
- 108010013476 HLA-A24 Antigen Proteins 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 206010073069 Hepatic cancer Diseases 0.000 description 1
- 108010007707 Hepatitis A Virus Cellular Receptor 2 Proteins 0.000 description 1
- 102000003964 Histone deacetylase Human genes 0.000 description 1
- 108090000353 Histone deacetylase Proteins 0.000 description 1
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 1
- 101000984934 Homo sapiens Butyrophilin subfamily 3 member A1 Proteins 0.000 description 1
- 101001037256 Homo sapiens Indoleamine 2,3-dioxygenase 1 Proteins 0.000 description 1
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 1
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 1
- 101000831007 Homo sapiens T-cell immunoreceptor with Ig and ITIM domains Proteins 0.000 description 1
- 101500025614 Homo sapiens Transforming growth factor beta-1 Proteins 0.000 description 1
- 101000635938 Homo sapiens Transforming growth factor beta-1 proprotein Proteins 0.000 description 1
- 101000666896 Homo sapiens V-type immunoglobulin domain-containing suppressor of T-cell activation Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 241000598436 Human T-cell lymphotropic virus Species 0.000 description 1
- XQFRJNBWHJMXHO-RRKCRQDMSA-N IDUR Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(I)=C1 XQFRJNBWHJMXHO-RRKCRQDMSA-N 0.000 description 1
- 102100040061 Indoleamine 2,3-dioxygenase 1 Human genes 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 102100027268 Interferon-stimulated gene 20 kDa protein Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 206010061252 Intraocular melanoma Diseases 0.000 description 1
- 241000726306 Irus Species 0.000 description 1
- 102000002698 KIR Receptors Human genes 0.000 description 1
- 108010043610 KIR Receptors Proteins 0.000 description 1
- 208000008839 Kidney Neoplasms Diseases 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- 150000008575 L-amino acids Chemical class 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 239000005517 L01XE01 - Imatinib Substances 0.000 description 1
- 102000017578 LAG3 Human genes 0.000 description 1
- 101150030213 Lag3 gene Proteins 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 102000029749 Microtubule Human genes 0.000 description 1
- 108091022875 Microtubule Proteins 0.000 description 1
- 101100396982 Mus musculus Inmt gene Proteins 0.000 description 1
- 101100128278 Mus musculus Lins1 gene Proteins 0.000 description 1
- 208000014767 Myeloproliferative disease Diseases 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- 229910020700 Na3VO4 Inorganic materials 0.000 description 1
- IOVCWXUNBOPUCH-UHFFFAOYSA-M Nitrite anion Chemical compound [O-]N=O IOVCWXUNBOPUCH-UHFFFAOYSA-M 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- 239000004677 Nylon Substances 0.000 description 1
- 241000282320 Panthera leo Species 0.000 description 1
- 208000000821 Parathyroid Neoplasms Diseases 0.000 description 1
- 241000286209 Phasianidae Species 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 241000125945 Protoparvovirus Species 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 206010038389 Renal cancer Diseases 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 239000008156 Ringer's lactate solution Substances 0.000 description 1
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 1
- 239000012722 SDS sample buffer Substances 0.000 description 1
- 101001037255 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) Indoleamine 2,3-dioxygenase Proteins 0.000 description 1
- 201000004283 Shwachman-Diamond syndrome Diseases 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 239000004288 Sodium dehydroacetate Substances 0.000 description 1
- 101000677856 Stenotrophomonas maltophilia (strain K279a) Actin-binding protein Smlt3054 Proteins 0.000 description 1
- 241001415849 Strigiformes Species 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 102100024834 T-cell immunoreceptor with Ig and ITIM domains Human genes 0.000 description 1
- 229940123237 Taxane Drugs 0.000 description 1
- ATJFFYVFTNAWJD-UHFFFAOYSA-N Tin Chemical compound [Sn] ATJFFYVFTNAWJD-UHFFFAOYSA-N 0.000 description 1
- 101710183280 Topoisomerase Proteins 0.000 description 1
- 238000008050 Total Bilirubin Reagent Methods 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 102100030742 Transforming growth factor beta-1 proprotein Human genes 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 201000005969 Uveal melanoma Diseases 0.000 description 1
- 102100038282 V-type immunoglobulin domain-containing suppressor of T-cell activation Human genes 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 229940122803 Vinca alkaloid Drugs 0.000 description 1
- 108020000999 Viral RNA Proteins 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 208000004354 Vulvar Neoplasms Diseases 0.000 description 1
- IEDXPSOJFSVCKU-HOKPPMCLSA-N [4-[[(2S)-5-(carbamoylamino)-2-[[(2S)-2-[6-(2,5-dioxopyrrolidin-1-yl)hexanoylamino]-3-methylbutanoyl]amino]pentanoyl]amino]phenyl]methyl N-[(2S)-1-[[(2S)-1-[[(3R,4S,5S)-1-[(2S)-2-[(1R,2R)-3-[[(1S,2R)-1-hydroxy-1-phenylpropan-2-yl]amino]-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl]-3-methoxy-5-methyl-1-oxoheptan-4-yl]-methylamino]-3-methyl-1-oxobutan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]-N-methylcarbamate Chemical compound CC[C@H](C)[C@@H]([C@@H](CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C)[C@@H](O)c1ccccc1)OC)N(C)C(=O)[C@@H](NC(=O)[C@H](C(C)C)N(C)C(=O)OCc1ccc(NC(=O)[C@H](CCCNC(N)=O)NC(=O)[C@@H](NC(=O)CCCCCN2C(=O)CCC2=O)C(C)C)cc1)C(C)C IEDXPSOJFSVCKU-HOKPPMCLSA-N 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 231100000230 acceptable toxicity Toxicity 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- NFXWJYUDIOHFAW-UHFFFAOYSA-N acetic acid;tetradecanoic acid Chemical compound CC(O)=O.CCCCCCCCCCCCCC(O)=O NFXWJYUDIOHFAW-UHFFFAOYSA-N 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 208000009956 adenocarcinoma Diseases 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 239000003513 alkali Substances 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 229940045799 anthracyclines and related substance Drugs 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000001772 anti-angiogenic effect Effects 0.000 description 1
- 230000001028 anti-proliverative effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000005904 anticancer immunity Effects 0.000 description 1
- 238000011394 anticancer treatment Methods 0.000 description 1
- 210000000612 antigen-presenting cell Anatomy 0.000 description 1
- 238000003782 apoptosis assay Methods 0.000 description 1
- 230000036528 appetite Effects 0.000 description 1
- 235000019789 appetite Nutrition 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 230000005784 autoimmunity Effects 0.000 description 1
- 229960002756 azacitidine Drugs 0.000 description 1
- OHDRQQURAXLVGJ-HLVWOLMTSA-N azane;(2e)-3-ethyl-2-[(e)-(3-ethyl-6-sulfo-1,3-benzothiazol-2-ylidene)hydrazinylidene]-1,3-benzothiazole-6-sulfonic acid Chemical compound [NH4+].[NH4+].S/1C2=CC(S([O-])(=O)=O)=CC=C2N(CC)C\1=N/N=C1/SC2=CC(S([O-])(=O)=O)=CC=C2N1CC OHDRQQURAXLVGJ-HLVWOLMTSA-N 0.000 description 1
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 1
- 229960002170 azathioprine Drugs 0.000 description 1
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 1
- 239000013602 bacteriophage vector Substances 0.000 description 1
- 229960000686 benzalkonium chloride Drugs 0.000 description 1
- 229960001950 benzethonium chloride Drugs 0.000 description 1
- UREZNYTWGJKWBI-UHFFFAOYSA-M benzethonium chloride Chemical compound [Cl-].C1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 UREZNYTWGJKWBI-UHFFFAOYSA-M 0.000 description 1
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 1
- 108010087667 beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase Proteins 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 239000003139 biocide Substances 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 238000010170 biological method Methods 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- 201000000053 blastoma Diseases 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 229960000455 brentuximab vedotin Drugs 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- ZEWYCNBZMPELPF-UHFFFAOYSA-J calcium;potassium;sodium;2-hydroxypropanoic acid;sodium;tetrachloride Chemical compound [Na].[Na+].[Cl-].[Cl-].[Cl-].[Cl-].[K+].[Ca+2].CC(O)C(O)=O ZEWYCNBZMPELPF-UHFFFAOYSA-J 0.000 description 1
- 208000035269 cancer or benign tumor Diseases 0.000 description 1
- 229960004117 capecitabine Drugs 0.000 description 1
- 229960004562 carboplatin Drugs 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 238000005277 cation exchange chromatography Methods 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 239000002771 cell marker Substances 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 230000007969 cellular immunity Effects 0.000 description 1
- 230000006364 cellular survival Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 230000000973 chemotherapeutic effect Effects 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 229960002242 chlorocresol Drugs 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 230000007012 clinical effect Effects 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 230000001149 cognitive effect Effects 0.000 description 1
- 229960002424 collagenase Drugs 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 201000010989 colorectal carcinoma Diseases 0.000 description 1
- 238000004040 coloring Methods 0.000 description 1
- 238000004440 column chromatography Methods 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 230000004154 complement system Effects 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 230000000139 costimulatory effect Effects 0.000 description 1
- 229940109262 curcumin Drugs 0.000 description 1
- 235000012754 curcumin Nutrition 0.000 description 1
- 239000004148 curcumin Substances 0.000 description 1
- 208000030381 cutaneous melanoma Diseases 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 230000016396 cytokine production Effects 0.000 description 1
- 230000001461 cytolytic effect Effects 0.000 description 1
- 229940127096 cytoskeletal disruptor Drugs 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 239000002254 cytotoxic agent Substances 0.000 description 1
- 231100000599 cytotoxic agent Toxicity 0.000 description 1
- 230000009615 deamination Effects 0.000 description 1
- 238000006481 deamination reaction Methods 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000009795 derivation Methods 0.000 description 1
- 210000004207 dermis Anatomy 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 229910003460 diamond Inorganic materials 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- VFLDPWHFBUODDF-UHFFFAOYSA-N diferuloylmethane Natural products C1=C(O)C(OC)=CC(C=CC(=O)CC(=O)C=CC=2C=C(OC)C(O)=CC=2)=C1 VFLDPWHFBUODDF-UHFFFAOYSA-N 0.000 description 1
- 238000000375 direct analysis in real time Methods 0.000 description 1
- 238000002845 discoloration Methods 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 239000002612 dispersion medium Substances 0.000 description 1
- 239000003534 dna topoisomerase inhibitor Substances 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 229950005454 doxifluridine Drugs 0.000 description 1
- ZWAOHEXOSAUJHY-ZIYNGMLESA-N doxifluridine Chemical compound O[C@@H]1[C@H](O)[C@@H](C)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ZWAOHEXOSAUJHY-ZIYNGMLESA-N 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 238000012063 dual-affinity re-targeting Methods 0.000 description 1
- 108010011867 ecallantide Proteins 0.000 description 1
- 230000002500 effect on skin Effects 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 201000008184 embryoma Diseases 0.000 description 1
- 210000000750 endocrine system Anatomy 0.000 description 1
- 201000003914 endometrial carcinoma Diseases 0.000 description 1
- 230000002357 endometrial effect Effects 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 229960001904 epirubicin Drugs 0.000 description 1
- HESCAJZNRMSMJG-KKQRBIROSA-N epothilone A Chemical class C/C([C@@H]1C[C@@H]2O[C@@H]2CCC[C@@H]([C@@H]([C@@H](C)C(=O)C(C)(C)[C@@H](O)CC(=O)O1)O)C)=C\C1=CSC(C)=N1 HESCAJZNRMSMJG-KKQRBIROSA-N 0.000 description 1
- 150000003883 epothilone derivatives Chemical class 0.000 description 1
- 238000012869 ethanol precipitation Methods 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 208000021045 exocrine pancreatic carcinoma Diseases 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- IJJVMEJXYNJXOJ-UHFFFAOYSA-N fluquinconazole Chemical compound C=1C=C(Cl)C=C(Cl)C=1N1C(=O)C2=CC(F)=CC=C2N=C1N1C=NC=N1 IJJVMEJXYNJXOJ-UHFFFAOYSA-N 0.000 description 1
- 238000013467 fragmentation Methods 0.000 description 1
- 238000006062 fragmentation reaction Methods 0.000 description 1
- 238000002825 functional assay Methods 0.000 description 1
- 210000000232 gallbladder Anatomy 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 229960003297 gemtuzumab ozogamicin Drugs 0.000 description 1
- 238000001476 gene delivery Methods 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 125000000404 glutamine group Chemical group N[C@@H](CCC(N)=O)C(=O)* 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 230000037219 healthy weight Effects 0.000 description 1
- 229910001385 heavy metal Inorganic materials 0.000 description 1
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 231100000304 hepatotoxicity Toxicity 0.000 description 1
- 150000004687 hexahydrates Chemical class 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 229940121372 histone deacetylase inhibitor Drugs 0.000 description 1
- 239000003276 histone deacetylase inhibitor Substances 0.000 description 1
- 210000005104 human peripheral blood lymphocyte Anatomy 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 238000012872 hydroxylapatite chromatography Methods 0.000 description 1
- KTUFNOKKBVMGRW-UHFFFAOYSA-N imatinib Chemical compound C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 KTUFNOKKBVMGRW-UHFFFAOYSA-N 0.000 description 1
- 229960002411 imatinib Drugs 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 239000002955 immunomodulating agent Substances 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 229950004101 inotuzumab ozogamicin Drugs 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 230000035990 intercellular signaling Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 230000031146 intracellular signal transduction Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 229960005386 ipilimumab Drugs 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- VBGWSQKGUZHFPS-VGMMZINCSA-N kalbitor Chemical compound C([C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@H](C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]2C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=3C=CC=CC=3)C(=O)N[C@H](C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)NCC(=O)NCC(=O)N[C@H]3CSSC[C@H](NC(=O)[C@@H]4CCCN4C(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC=4C=CC=CC=4)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC=4C=CC=CC=4)NC(=O)[C@H](CO)NC(=O)[C@H](CC=4NC=NC=4)NC(=O)[C@H](CCSC)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCC(O)=O)CSSC[C@H](NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=4C=CC=CC=4)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC3=O)CSSC2)C(=O)N[C@@H]([C@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=2NC=NC=2)C(=O)N2CCC[C@H]2C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=2C3=CC=CC=C3NC=2)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N1)[C@@H](C)CC)[C@H](C)O)=O)[C@@H](C)CC)C1=CC=CC=C1 VBGWSQKGUZHFPS-VGMMZINCSA-N 0.000 description 1
- 229940018902 kalbitor Drugs 0.000 description 1
- 201000010982 kidney cancer Diseases 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 201000002250 liver carcinoma Diseases 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 229950003526 lorvotuzumab mertansine Drugs 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 230000001050 lubricating effect Effects 0.000 description 1
- 201000005249 lung adenocarcinoma Diseases 0.000 description 1
- 201000005243 lung squamous cell carcinoma Diseases 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 229960002337 magnesium chloride Drugs 0.000 description 1
- GRPSNTXTTSBKGW-BVGHQBMWSA-J magnesium;potassium;sodium;(3r,4s,5s,6r)-6-(hydroxymethyl)oxane-2,3,4,5-tetrol;triacetate;chloride Chemical compound [Na+].[Mg+2].[Cl-].[K+].CC([O-])=O.CC([O-])=O.CC([O-])=O.OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O GRPSNTXTTSBKGW-BVGHQBMWSA-J 0.000 description 1
- FVVLHONNBARESJ-NTOWJWGLSA-H magnesium;potassium;trisodium;(2r,3s,4r,5r)-2,3,4,5,6-pentahydroxyhexanoate;acetate;tetrachloride;nonahydrate Chemical compound O.O.O.O.O.O.O.O.O.[Na+].[Na+].[Na+].[Mg+2].[Cl-].[Cl-].[Cl-].[Cl-].[K+].CC([O-])=O.OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O FVVLHONNBARESJ-NTOWJWGLSA-H 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 238000010297 mechanical methods and process Methods 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000037353 metabolic pathway Effects 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- WSFSSNUMVMOOMR-NJFSPNSNSA-N methanone Chemical compound O=[14CH2] WSFSSNUMVMOOMR-NJFSPNSNSA-N 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 210000004688 microtubule Anatomy 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 229960001156 mitoxantrone Drugs 0.000 description 1
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 230000007659 motor function Effects 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- IOUNGFDUDUBFGX-UHFFFAOYSA-N n-(2-chlorophenyl)-2-[4-(2,4-dichlorophenyl)thiadiazol-5-yl]sulfanylacetamide Chemical compound ClC1=CC(Cl)=CC=C1C1=C(SCC(=O)NC=2C(=CC=CC=2)Cl)SN=N1 IOUNGFDUDUBFGX-UHFFFAOYSA-N 0.000 description 1
- 210000004898 n-terminal fragment Anatomy 0.000 description 1
- 201000011682 nervous system cancer Diseases 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 238000010606 normalization Methods 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 229920001778 nylon Polymers 0.000 description 1
- 201000002575 ocular melanoma Diseases 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 229960001756 oxaliplatin Drugs 0.000 description 1
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 1
- IWDCLRJOBJJRNH-UHFFFAOYSA-N p-cresol Chemical compound CC1=CC=C(O)C=C1 IWDCLRJOBJJRNH-UHFFFAOYSA-N 0.000 description 1
- 201000002094 pancreatic adenocarcinoma Diseases 0.000 description 1
- 208000003154 papilloma Diseases 0.000 description 1
- 210000002990 parathyroid gland Anatomy 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 239000002304 perfume Substances 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 201000002628 peritoneum cancer Diseases 0.000 description 1
- 150000002978 peroxides Chemical class 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 230000002085 persistent effect Effects 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 210000001539 phagocyte Anatomy 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 229960005323 phenoxyethanol Drugs 0.000 description 1
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 1
- 229940080469 phosphocellulose Drugs 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 230000010399 physical interaction Effects 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 210000002381 plasma Anatomy 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 239000003910 polypeptide antibiotic agent Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000001023 pro-angiogenic effect Effects 0.000 description 1
- 230000000861 pro-apoptotic effect Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000005522 programmed cell death Effects 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 238000012207 quantitative assay Methods 0.000 description 1
- 239000001397 quillaja saponaria molina bark Substances 0.000 description 1
- 230000007420 reactivation Effects 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 231100000205 reproductive and developmental toxicity Toxicity 0.000 description 1
- 229930002330 retinoic acid Natural products 0.000 description 1
- 239000012266 salt solution Substances 0.000 description 1
- 238000005185 salting out Methods 0.000 description 1
- 229930182490 saponin Natural products 0.000 description 1
- 150000007949 saponins Chemical class 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 238000007493 shaping process Methods 0.000 description 1
- 230000007781 signaling event Effects 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 238000009097 single-agent therapy Methods 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 201000003708 skin melanoma Diseases 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 230000000391 smoking effect Effects 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 229940079839 sodium dehydroacetate Drugs 0.000 description 1
- 235000019259 sodium dehydroacetate Nutrition 0.000 description 1
- DSOWAKKSGYUMTF-GZOLSCHFSA-M sodium;(1e)-1-(6-methyl-2,4-dioxopyran-3-ylidene)ethanolate Chemical compound [Na+].C\C([O-])=C1/C(=O)OC(C)=CC1=O DSOWAKKSGYUMTF-GZOLSCHFSA-M 0.000 description 1
- KISFEBPWFCGRGN-UHFFFAOYSA-M sodium;2-(2,4-dichlorophenoxy)ethyl sulfate Chemical compound [Na+].[O-]S(=O)(=O)OCCOC1=CC=C(Cl)C=C1Cl KISFEBPWFCGRGN-UHFFFAOYSA-M 0.000 description 1
- 206010041823 squamous cell carcinoma Diseases 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- 238000011287 therapeutic dose Methods 0.000 description 1
- 230000008719 thickening Effects 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 210000001685 thyroid gland Anatomy 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- MNRILEROXIRVNJ-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=NC=N[C]21 MNRILEROXIRVNJ-UHFFFAOYSA-N 0.000 description 1
- 229940044693 topoisomerase inhibitor Drugs 0.000 description 1
- 229960000303 topotecan Drugs 0.000 description 1
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000005026 transcription initiation Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 229960001612 trastuzumab emtansine Drugs 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- IHIXIJGXTJIKRB-UHFFFAOYSA-N trisodium vanadate Chemical compound [Na+].[Na+].[Na+].[O-][V]([O-])([O-])=O IHIXIJGXTJIKRB-UHFFFAOYSA-N 0.000 description 1
- 125000000430 tryptophan group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C2=C([H])C([H])=C([H])C([H])=C12 0.000 description 1
- 230000005909 tumor killing Effects 0.000 description 1
- 102000003390 tumor necrosis factor Human genes 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 208000012991 uterine carcinoma Diseases 0.000 description 1
- 229960000653 valrubicin Drugs 0.000 description 1
- ZOCKGBMQLCSHFP-KQRAQHLDSA-N valrubicin Chemical compound O([C@H]1C[C@](CC2=C(O)C=3C(=O)C4=CC=CC(OC)=C4C(=O)C=3C(O)=C21)(O)C(=O)COC(=O)CCCC)[C@H]1C[C@H](NC(=O)C(F)(F)F)[C@H](O)[C@H](C)O1 ZOCKGBMQLCSHFP-KQRAQHLDSA-N 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- 229960004355 vindesine Drugs 0.000 description 1
- UGGWPQSBPIFKDZ-KOTLKJBCSA-N vindesine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(N)=O)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1N=C1[C]2C=CC=C1 UGGWPQSBPIFKDZ-KOTLKJBCSA-N 0.000 description 1
- GBABOYUKABKIAF-GHYRFKGUSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-GHYRFKGUSA-N 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- 229950006959 vorsetuzumab Drugs 0.000 description 1
- 201000005102 vulva cancer Diseases 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
- 235000019786 weight gain Nutrition 0.000 description 1
- 230000036642 wellbeing Effects 0.000 description 1
Abstract
Provided are anti-human 4-1BB antibodies and fragments thereof with the specific mutations at position 94W of the light chain, and positions 5V, 68V, 91T, and 101K of the heavy chain that are not found in a reference anti-human 4- 1BB antibody, where said features may improve certain characteristics of the antibody relative to a reference antibody. Various in vitro and in vivo methods and reagents related to anti-human 4-1BB antibodies described herein are also provided. Methods include, for example, inducing T-cell proliferation, inducing T cell secretion of IFNγ, as well as detection, prevention, and/or therapeutic treatment of cancer using an anti-human 4-1BB antibody or fragment thereof. of the antibody relative to a reference antibody. Various in vitro and in vivo methods and reagents related to anti-human 4-1BB antibodies described herein are also provided. Methods include, for example, inducing T-cell proliferation, inducing T cell secretion of IFNγ, as well as detection, prevention, and/or therapeutic treatment of cancer using an anti-human 4-1BB antibody or fragment thereof.
Description
UMAN 4-IBB ANTIBODIES AND USES THEREOF
CROSS-REFERENCE TO RELATED APPLICATIONS
This application claims priority to and the benefit of US Patent Application No.
62/443,281, filed on January 06, 2017, the disclosure of which is incorporated herein by
reference in its ty.
BACKGROUND
Cancer remains one of the leading causes of death in the world. Recent statistics
report that 13% of the world population dies from cancer. ing to estimates from the
lntemational Agency for Research on Cancer (IARC), in 2012 there were 14.1 million new
cancer cases and 8.2 million cancer deaths worldwide. By 2030, the global burden is expected to
grow to 21.7 million new cancer cases and 13 million cancer deaths due to population growth
and aging and re to risk factors such as smoking, unhealthy diet and al
inactivity. Further, pain and medical expenses for cancer treatment cause reduced y of life
for both cancer patients and their families. It is apparent that, above all, cancer is a disease for
which it is necessary to urgently find improved treatment s.
The present disclosure provides, among other things, antibodies and fragments
thereof that bind to a human 4-lBB polypeptide. In some aspects, provided anti-human 4- 188
antibodies and fragments thereof are variants of a nce anti-human 4-lBB antibody in that
they contain one or more panicular structural features that are not found in the reference anti-
human 4-lBB antibody. The present disclosure encompasses a recognition that provided variant
anti-human 4—l BB antibodies have improved properties relative to a reference anti-human 4-1 BB
antibody lacking one or more structural features described . In some embodiments,
ed anti-human 4-lBB antibodies and nts thereof have one or more improved
properties, such as, for example, improved binding affinity, improved induction of T cell
proliferation (e.g., proliferation of CD8' T cells), increased ability to induce IFNy production by
T cells (e.g., proliferation of CD8‘ T cells), improved ability to reduce and/or eliminate cancer
proliferation in viva (e.g., at a lower dose).
In some embodiments, an antiIBB antibody or antigen-binding antibody
fragment includes 1, 2, or 3 heavy chain CDR sequences that are or include a sequence of SEQ
ID NOs: 5 to 8. In some embodiments, an antiIBB antibody or antigen-binding antibody
fragment includes one or more of: a heavy chain CDRI that is or es a sequence of SEQ ID
NO: 5, a heavy chain CDR2 that is or includes a sequence of SEQ ID NO: 6 and a heavy chain
CDR3 that is or includes a sequence of SEQ ID NO: 7 or 8. In some embodiments, an anti
IBB antibody or antigen-binding antibody fragment includes each of: a heavy chain CDRI that
is or includes a sequence of SEQ ID NO: 5, a heavy chain CDR2 that is or includes a sequence
of SEQ ID NO: 6 and a heavy chain CDR3 that is or includes a sequence of SEQ ID NO: 7 or 8.
In some embodiments, an anti1BB dy or antigen-binding antibody
fragment includes 1, 2, or 3 light chain CDR sequences that are or include a sequence of SEQ ID
NOS: 1-4. In some embodiments, an anti-4—IBB antibody or antigen-binding dy fragment
es one or more of: a light chain CDRI that is or includes a sequence of SEQ ID NO: I, a
light chain CDR2 that is or includes a sequence of SEQ ID NO: 2 and a light chain CDR3 that is
or includes a sequence of SEQ ID NO: 3 or 4. In some embodiments, an antiI BB antibody or
antigen-binding antibody fragment includes each of: a light chain CDRI that is or includes a
sequence of SEQ ID NO: I, a light chain CDR2 that is or includes a sequence of SEQ ID NO: 2
and a light chain CDR3 that is or includes a sequence of SEQ ID NO: 3 or 4.
In some embodiments, an anti1BB antibody or n-binding antibody
fragment includes a heavy chain variable domain that includes a heavy chain CDRI that is or
es a sequence of SEQ ID NO: 5, a heavy chain CDR2 that is or includes a sequence of
SEQ ID NO: 6 and a heavy chain CDR3 that is or includes a ce of SEQ ID NO: 7 or 8,
and/or a light chain variable domain that includes a light chain CDRI that is or includes a
sequence of SEQ ID NO: I, a light chain CDR2 that is or includes a sequence of SEQ ID NO: 2
and a light chain CDR3 that is or includes a sequence of SEQ ID NO: 4.
In some embodiments, an antiIBB antibody or antigen-binding antibody
fragment includes a heavy chain variable domain that includes a heavy chain framework I (FRI)
region comprising a sequence of SEQ ID NO' 16 or 17. In some ments, an -IBB
dy or n—binding antibody fragment es a heavy chain variable domain that
includes a heavy chain framework 3 (FR3) region sing a sequence of any one of SEQ ID
NOS: 18-20. In some embodiments, an anti—44 BB antibody or antigen-binding antibody
fragment includes a heavy chain variable domain that includes a heavy chain Framework 1 (FRI)
region comprising a sequence of SEQ ID NO: 16 or 17 and a heavy chain framework 3 (FR3)
region comprising a sequence of any one of SEQ [D NOs: 18-20.
In some embodiments, an anti1BB antibody or antigen-binding antibody
fragment includes substantial homology to an antibody or antibody fragment that includes a
heavy chain variable domain that is or es a sequence selected from SEQ ID NOS: 1 1—14.
In some embodiments, an -lBB antibody or antigen-binding antibody nt es a
heavy chain variable domain that is or includes a ce at least 90%, 91%, 92%, 93%, 94%,
95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4% or 99.5% identical to a sequence
selected from SEQ ID NOS: 1 1-14. In some embodiments, an antiIBB antibody or antigen-
binding antibody fragment includes a heavy chain variable domain that is or includes a sequence
selected from SEQ ID N05: 11-14.
In some embodiments, an antiIBB antibody or antigen-binding antibody
fragment includes substantial homology to an antibody or antibody nt that includes a light
chain variable domain that is or includes a sequence of SEQ ID NO: 9 or 10. In some
embodiments, an antil BB antibody or antigen-binding antibody fragment includes a light
chain variable domain that is or includes a sequence at least 90%, 91%, 92%, 93%, 94%, 95%,
96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4% or 9959/6 cal to a sequence of SEQ ID
NO: 9 or 10. In some embodiments, an anti1BB antibody or n-binding antibody
nt es a light chain variable domain that is or includes a sequence of SEQ ID NO: 9
or 10.
In some embodiments, an anti—4-1BB antibody or antigen-binding antibody
fragment includes substantial homology to an dy or antibody fragment that includes a
heavy chain variable domain that is or includes a sequence selected from SEQ ID NOS: 1 1-14
and a light chain variable domain that is or includes a sequence of SEQ ID NO: 10. In sotne
embodiments, an anti1 BB antibody or n-binding antibody fragment includes a heavy
chain variable domain that is or includes a sequence at least 90%, 91%, 92%, 93%, 94%, 959/ ,
96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4% or 99.5% identical to a sequence selected
from SEQ ID N05: 1 1-14 and a light chain variable domain that is or includes a sequence at least
90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99. 1%, 99.2%, 99.3%, 99.4% or
99.5% identical to a sequence of SEQ ID NO: 10. In some embodiments, an anti—4- I BB
antibody or antigen-binding antibody fragment includes a heavy chain le domain that is or
includes a sequence selected from SEQ ID NOS: 1 1-14 and a light chain variable domain that is
or es a sequence of SEQ ID NO: 10.
In some embodiments, a provided anti—human 4-lBB antibody or fragment
thereof is an agonistic antibody. In some embodiments, a provided anti—human 4-lBB antibody
or fragment thereof is terized as having superior agonistic activity than a humanized anti-
human 4-lBB antibody 94G] (i.e., an antibody ing light chain and heavy chain variable
domains of SEQ ID NOS: 9 and l 1, respectively). In some ments, a ed anti-human
4-1BB antibody or fragment thereof is characterized as having improved binding affinity than a
humanized anti-human 4-1BB antibody 94Gl (i.e., an antibody including light chain and heavy
chain variable domains of SEQ ID NOS: 9 and l 1, respectively).
In some embodiments, a provided anti-human 4-IBB antibody or fragment
thereof is or ses a humanized antibody. In some embodiments, a provided anti-human 4-
188 antibody or fragment thereof includes a human globulin constant domain, wherein
the constant domain is selected from an IgGl or a variant thereof, an IgGZ or a variant thereof,
an lgG4 or a variant thereof, an lgA or a variant thereof, an IgE or a variant thereof, an IgM or a
variant f, and an IgD or a variant thereof. In some ments, a provided uman 4-
188 antibody or fragment thereof is or comprises a human IgG1. In some embodiments, an
IgGl is or comprises a sequence that is at least 95% identical to SEQ ID NO: 22 or 23,
In some embodiments, a provided anti-human 4—lBB antibody or fragment
thereof is a monoclonal antibody.
In some embodiments, a provided anti-human 4-lBB antibody or fragment
thereof is a full length antibody. In some ments, a provided anti-human 4-lBB antibody
or fragment thereof is a Fab fragment, 3 Fab' fragment, a F(ab')2 fragment, a Fv fragment, a
ide-bonded Fv fragment, a scFv fragment, a single domain antibody, humabody, nanobody,
or a diabody.
In some embodiments, a provided anti-human 4-1BB antibody or fragment
thereof has a binding affinity (KD) for a human 4-1BB molecule of I X 10‘7 to 1X 10'l2 M. In some
embodiments, a provided anti-human 4-lBB antibody or fragment f has a binding affinity
(KD) for a human 4-lBB molecule of l x 10'8 to l>< IO'U M. In some embodiments, a provided
anti-human 4-IBB antibody or fragment thereof has a binding affinity (K0) for a human 4-lBB
molecule of l X l 0'9 to IX 10'12 M. In some embodiments, a provided anti-human 4-IBB antibody
or fragment thereof has a binding affinity (KD) for a human 4-lBB molecule of l x10'l0 to IX 10'
In some embodiments, a provided anti-human 4-IBB antibody or fragment
thereof binds to an epitope within the extracellular domain of a human 4- l BB polypeptide. In
some embodiments, a ed anti-human 4-lBB antibody or fragment thereof binds to an
epitope within the extracellular domain of human 4-IBB. In some embodiments, binding of a
provided anti-human 4- [BB antibody or fragment thereof is abrogated by one or more mutations
at positions N30, D38, N39, and R4] of SEQ ID NO: 44.
In some embodiments, a provided anti-human 4-IBB antibody or fragment
thereof fails to bind or weakly binds a non-primate 4- [BB polypeptide. In some embodiments, a
provided anti-human 4-IBB antibody or fragment f fails to bind or weakly binds a canine
4-IBB polypeptide.
In some ments, the present disclosure provides c acid molecules
encoding an antil BB dy or antigen-binding fragment. In some embodiments, the
present disclosure provides vectors that include a c acid molecule encoding an anti I BB
antibody or antigen-binding fragment. In some embodiments, the present disclosure provides
host cells that include a vector and/or nucleic acid molecule encoding an antil BB antibody or
antigen-binding fragment. In some embodiments, a host cell is selected from a ial, yeast,
insect or mammalian cell. In some embodiments, a is selected from the group consisting of
lion/i, P.pas!0ris, Sf‘9, COS, HEK293, CHO and a mammalian lymphocyte.
In some embodiments, the present disclosure provides ceutical
itions that include an anti—4-l BB antibody or antigen-binding fragment and a
phannaceutically acceptable carrier. In some embodiments, the present sure provides
pharmaceutical compositions that include a nucleic acid and/or vector encoding an antiIBB
antibody or antigen-binding nt and a ceutically able carrier.
In some embodiments, the present disclosure provides methods oftreating a
subject in need thereof, the method sing administering to the subject a composition that
comprises or delivers an antiIBB antibody or antigen-binding fragment. In some
embodiments, the present disclosure provides methods of treating a subject in need thereof, the
method comprising administering to the subject a composition that comprises or rs a
nucleic acid and/or vector encoding an antilBB antibody or antigen-binding fragment. In
some embodiments, a subject has or is at risk for developing cancer.
[0021'] In some embodiments, the t disclosure provides methods of inducing an
immune response in a subject in need thereof, the method comprising administering to the
subject a composition that comprises or delivers an antil BB antibody or antigen-binding
fragment. In some embodiments, the present disclosure provides methods of inducing an
immune response in a subject in need thereof, the method comprising administering to the
subject a ition that comprises or delivers a c acid and/or vector encoding an anti
IBB antibody or n-binding fragment. In some embodiments, a subject has or is at risk for
ping cancer.
In some embodiments, the present disclosure provides methods of enhancing an
immune response in a t in need thereof, the method comprising administering to the
subject a composition that comprises or delivers an anti l BB antibody or antigen—bindi ng
fragment. In some embodiments, the present disclosure provides methods of enhancing an
immune response in a subject in need thereof, the method comprising administering to the
subject a composition that comprises or delivers a nucleic acid and/or vector encoding an anti
IBB antibody or antigen-binding fragment. In some embodiments, a subject has or is at risk for
developing cancer.
In some embodiments, a cancer to be treated by a method of the present
disclosure in a t is selected from a bladder cancer, breast cancer, al cancer, colon
cancer, endometrial cancer, esophageal cancer, fallopian tube cancer, gall bladder ,
intestinal cancer, head and neck cancer, hematological cancer, laryngeal cancer, liver
cancer, lung , ma, melanoma, mesothelioma, n cancer, primary neal
cancer, salivary gland cancer, sarcoma, h cancer, thyroid cancer, pancreatic cancer, and
prostate cancer.
In some ments, a composition comprises or delivers an anti-human 4-lBB
antibody of the present disclosure or an antigen-binding fragment thereof at a dose of 0.0] mg/kg
to ICC mg/kg. In some embodiments, a composition comprises or delivers an anti-human 4-IBB
antibody or an antigen-binding fragment f at a dose of about 0.01 mg/kg, 0.025 mg/kg,
0.05 mg/kg, 0.075 mg/kg, 01 mg/kg, 0.25 mg/kg, 05 mg/kg, 0.75 mg/kg, l mg/kg, 2 mg/kg, 3
mg/kg, 4 mg/kg, 5 mg/kg, 8 mg/kg, 10 mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 40 mg/kg, 50
mg/kg, 50 mg/kg, 70 mg/kg, 80 mg/kg, 90 mg/kg, or 100 mg/kg.
In some embodiments, anti-human 4-lBB antibodies and/or fragments thereof
and/or compositions comprising the same are characterized by inducing increased T cell
proliferation (e.g., CD8' T cell proliferation) and/or increased IFNY secretion by T cells (e.g.,
CD8' T cells) in a subject.
In some embodiments, the present disclosure provides methods that include
administering to the t a composition that comprises or delivers an antil BB antibody or
antigen-binding fragment to a t that has been administered or will be administered one or
more additional anticancer therapies. In some ments, the t disclosure es
s that include administering to the subject a composition that comprises or delivers an
-l BB antibody or antigen-binding fragment to a subject that has been administered or will
be administered one or more of ionizing ion, a chemotherapeutic agent, an antibody agent,
and a ased therapy, such that the subject receives treatment with both.
In some embodiments, the present disclosure provides methods that include
administering to the subject a composition that comprises or delivers an antilBB antibody or
n-binding fragment to a subject that has been administered or will be administered one or
more of an immune checkpoint tor, IL-12, GM-CSF, an anti-CD4 agent, fluorouracil,
doxombicin, irinotecan, paclitaxel, cisplatin, or cyclophosphamidei
In some embodiments, the present disclosure provides methods that include
administering to the subject a composition that comprises or delivers an anti1BB antibody or
antigen-binding fragment to a subject that has been administered or will be administered a
composition comprising an immune checkpoint inhibitor, such that the subject receives treatment
with both. In some embodiments, an immune checkpoint inhibitor is an agent that ts PD-l
signaling. In some embodiments, an agent that inhibits PD—l signaling is an anti-PD-l antibody.
In some embodiments, an anti-PD-l antibody is nivolumab, pembrolizumab, atezolizumab,
durvalumab, or avelumab.
In some embodiments, the present disclosure provides methods of determining a
dose of an anti—4-l BB antibody or antigen binding fragment f for therapeutic treatment of
a subject in need thereof. In some ments, such a method includes (i) providing or
obtaining a measurement of secreted IFN-gamma in a biological sample from the subject,
wherein the subject has been administered a composition that comprises or delivers an amount of
an anti-4— IBB antibody or antigen-binding nt bed ; and (ii) comparing the
measurement of ed IFN-gamma to a nce value, where if the measurement of secreted
IFN-gamma is higher or lower than the reference value, adjusting the amount of an -lBB
antibody or antigen binding fragment thereof to be administered, thereby determining a dose for
therapeutic treatment of a subject, In some ments, a reference value comprises an index
value which includes a value d from one or more healthy subjects, a value derived from
one or more cancer diagnosed subject or a value derived from a cancer risk prediction algorithm.
In some embodiments, a biological sample is a sample of whole blood, plasma, or serum. In
some embodiments, a subject has or is at risk for developing cancer. In some embodiments, a
cancer is selected from a bladder cancer, breast cancer, cervical cancer, colon cancer,
endometrial cancer, esophageal cancer, fallopian tube cancer, gall bladder cancer.
intestinal cancer, head and neck cancer, hematological cancer, laryngeal cancer, liver
cancer, lung cancer, lymphoma, melanoma, mesothelioma, ovarian cancer, primary peritoneal
, salivary gland cancer, sarcoma, h , thyroid cancer, pancreatic cancer, and
prostate cancer.
In some embodiments, the present disclosure provides methods for increasing
secretion of IFN-y by a cell in vivo or in vitro that include: contacting the cell with an anti 1 BB
antibody or antigen-binding fragment described herein.
] In some embodiments, the present disclosure provides methods ex vivo
proliferation or isolation of activated T cells that include: ting a population of T cells with
an antiIBB antibody or antigen—binding fragment described herein, thereby increasing
proliferation of activated T cells.
In some embodiments, the present disclosure provides methods for isolating
antigen-specific activated T cells that include one or more steps of: (a) culturing eral blood
mononuclear cells (PBMC) in a medium together with a peptide of an epitope of interest and IL-
2; (b) inducing 4-] BB expression in the cultured cells by adding the peptide of the epitope of
interest; (c) contacting the cultured cells with a surface coated with an anti—4—IBB antibody or
antigen—binding fragment described herein, wherein cultured cells expressing 4-1BB adhere to
WO 27787 PCT/lBZOIS/(NMI043
the coated surface; and (d) removing unattached cells, thereby isolating antigen—specific
activated T cells. In some embodiments, activated T cells are CD8’ T cells.
In some embodiments, the present disclosure provides methods for treating or
preventing cancer in a subject in need thereof that includes stering to the subject a
composition that includes a therapeutically effective amount of activated T cells produced by any
of the method described herein. In some embodiments, a cancer is selected from a bladder
cancer, breast cancer, cervical cancer, colon cancer, endometrial cancer, esophageal cancer,
fallopian tube cancer, gall bladder cancer, gastrointestinal , head and neck cancer,
hematological cancer, laryngeal cancer, liver cancer, lung cancer, lymphoma, melanoma,
mesothelioma, ovarian cancer, primary peritoneal cancer, salivary gland cancer, sarcoma,
stomach cancer, thyroid cancer, pancreatic cancer, and te cancer. In some embodiments, a
composition es least 109, at least 10'" cells, or more than 10'0 activated T cells. In some
embodiments. activated T cells are CD8‘ T cells.
Also provided, among other things, are technologies for characterizing anti-
human 4-IBB antibodies and/or fragments thereof as described herein and/or compositions
comprising the same. In some embodiments, provided are methods for characterizing anti-
human 4- 1 BB antibodies and/or nts thereof and/or compositions comprising the same
binding to AML cells (e.g., HL60). In some embodiments, provided are methods for
characterizing anti-human 4-lBB antibodies and/or nts thereof and/or compositions
comprising the same are by ELISA, immunohistochemistry, Biacore g assays, mass
spectrometry, isoelectric focusing (IEF) tography, and/or western blot.
The present disclosure provides s technologies related to making or
manufacturing uman 4-1BB antibodies and/or fragments thereof as bed herein and/or
compositions containing said antibodies or fragments thereof.
As used in this application, the terms “about” and “approximately” are used as
equivalents. Any citations to publications, patents, or patent applications herein are incorporated
by reference in their entirety. Any numerals used in this application with or without
about/approximately are meant to cover any normal fluctuations appreciated by one of ordinary
skill in the relevant art.
Other features, objects, and advantages of the present invention are apparent in
the detailed description that follows. It should be understood, however, that the detailed
description, while indicating embodiments of the present invention, is given by way of
illustration only, not tion. Various s and modifications within the scope of the
ion will become apparent to those skilled in the art from the detailed ption.
BRIEF DESCRIPTION OF THE DRAWING
The g ed , which is comprised of the following Figures, is for
illustration purposes only and not for limitation. The foregoing and other objects, aspects,
features, and advantages of the present disclosure will become more apparent and better
understood by referring to the following description taken in conjunction with the accompanying
figures in which:
depicts human 4-1BB extracellular domain (ECD) constructs. At the top
is a schematic of a full length 4-IBB ECD (167 amino acids), and below is shown various
fragments ofa 4-lBB ECD: RI (1-55 aa), R2 (56-1 l0 aa), R3 (1 10-167 aa), Rl.l (1-45 aa),
R12 (I-35 aa), R13 (1 1-55 aa), R1.4 (21-55 aa) Rl.5 (I-25 aa) and Rl.6 (1-30 aa). Each of
these 4-IBB ECD constructs were fused with G‘ST. FIG. IB depicts a western blot showing
binding of an exemplary humanized antiIBB antibody to 4-1BB ECD fusion constructs as
described in . As shown, an ary humanized antiIBB antibody binds to a full
length 4-IBB ECD fusion polypeptide and to the RI fusion polypeptide, but not to the R2 or R3
fusion polypeptides. Molecular size markers are indicated in kDa on the left.
depicts an GE gel of whole cell extracts from cells expressing
4-IBB ECD fusion constructs. Fusion constructs as described above in were expressed
in E. coli BL2| cells induced with 1 mM IPTG, and whole cell extracts resolved by 12% SDS—
PAGE. As shown, all fusion constructs (ECD, RI, Rl.l, R1.2,Rl.3, RI .4, RI .5, and R16) have
robust protein expression. FIG. ZB depicts a western blot showing binding of an exemplary
humanized anti-44 BB antibody to full length 4-lBB ECD fusion ptide, and R1 .1, RI 2,
RI .3, and RI .6 fusion polypeptides, but not to the RI .4 or R1.S fusion polypeptides.
lmmunoblots were performed with an exemplary anti—human 4-1BB antibody. Molecular size
markers are indicated in kDa on the left.
depicts binding affinity of anti-4—IBB monoclonal antibodies for
recombinant human 4-l BB antigen, as measured by ELISA. 0mm...“ values are represented on
the y-axis, and increasing concentrations of anti—4-lBB antibodies (in ug/ml) along the x-axis.
BBK-4 (circles) is a murine anti—human 4-lBB antibody, 94G] (squares), 94K (upward pointing
triangles), 94KV (diamonds), 94KVT (stars) and EUlOl (downward pointing triangles) are
exemplary humanized variant antilBB antibodies.
depicts binding of anti-4~]BB monoclonal antibodies to 4-1BB sing
Jurkat T cells (Jurkat 8-1). Mean Fluorescence Intensity (MFI) values are represented on the y-
axis and LoglO concentration of antibody (in ug/ml) along the . BBK—4 es) is a
murine anti-human 4-IBB dy, 94G] (squares), 94K (upward pointing triangles), 94KV
nds), 94KVT ) and EUlOl (downward pointing triangles) are exemplary humanized
variant antiIBB antibodies.
provides a table listing in l’ill'O binding afiiniti es of variant antil BB
antibodies for 4-l BB. Binding affinity was measured using surface plasmon resonance (SPR,
Biacore 3000). 946] and EUIOI are exemplary humanized variant anti-4—lBB antibodies.
]0044] depicts binding of anti1BB monoclonal antibodies to 4-lBB expressing
CD8- T cells. CD8+ T cells were isolated from human PBMCs and activated by anti-CD3
antibody for 2 days. 4-lBB-PE is an exemplary commercially available antiIBB antibody,
BBK-4 is a murine anti-human 4-1BB antibody, 9401, 94K, 94KV, 94KVT and EUlOl are
exemplary humanized variant anti.4-lBB dies. The graph in the bottom panel reflects the
values shown for each antibody in the FACS data in the top panels.
depicts a graph quantifying in vitro proliferation of CD8’ T cells treated
with anti l BB antibodies. Proliferating CD8- T cells were treated with no antibody, human
lgG alone, BBK-4, or an exemplary humanized t antilBB antibody: 9461, 94K, 94KV,
94KVT and EU101 and treated with WST-l -soluble olium salt) to stain proliferating
(i.e., lically active) cells.
depicts a graph quantifying in vilro IFNY secretion by CD8' T cells treated
with - l BB antibodies. CD8“ T cells were isolated from human PBMCs and treated with no
antibody, human IgG alone, or 1 ug/ml of an antiIBB antibody: BBK-4, 9401, 94K, 94KV,
94KVT and EUIOI. IFNy secretion was evaluated on days 1, 3, and 5.
shows graphs depicting IFN-y secretion in (A) CD4- and (B) CD8‘. After
being isolated from PBMCs of a healthy donor, activated T cells present in the PBMCs were
rested in a RPMI-l 640+2%FBS medium for 24 hours, and the rested PBMCs were treated with
an iron beads-attached anti-CD4 antibody or anti-CD8 antibody, and CD4‘ cells or CD8' cells
were ed using an MACS magnetic separator. The isolated CD4' T cells or CD8’ T cells
were d with a T cell activator, anti-CD3, to induce 4-lBB expression, and treated with
EUlOl at ent concentrations (0.5, 1.0, 2.5, and 5,0 ug/ml) or a control human lgG (5.0
pg/ml) for 3 days. After 3 days, a culture medium excluding the cells was obtained, and
fluorescence of human IFN-y in the culture medium was assessed by ELISA (ebioscience).
Results were compared with a standard curve as ed in an IFN-y ELISA kit.
A shows a graph depicted antibody-dependent cytotoxicity (ADCC) of
exemplary anti-human 4-lBB antibodies BBK4, 94G], 94KVT and EU 10 l. 8 shows a
graph depicting complement-dependent cytotoxicity (CDC) of ary anti-human 4-l BB
antibodies BBK4, 9461, and EUlOl.
FIG. II shows in viva anticancer s of an exemplary uman 4-l BB
antibody (EUl 0 l ) by concentration, which are measured as tumor sizes after colon cancer tumor
cells (HT29) were subcutaneously injected into humanized mice, and when tumor sizes reach
100 to 200 mm", an exemplary anti-human 4-lBB antibody (EUlOl) was intravenously
administered to mice at doses of 1.0 mg, 5.0 mg and 10.0 mg per 1 kg ofa body weight once
every 5 days 3 times (representative data).
shows anticancer effects of an exemplary anti-human 4- 183 antibody
(EUlOl ) and an exemplary anti-PD-l antibody (Keytruda, “KD”) antibodies by concentration.
Anticancer effects were measured as tumor sizes after subcutaneous injection of colon cancer
tumor cells (HT29) into humanized mice and antibody treatment. When tumor sizes reached 100
to 150 mm, mice were treated with an exemplary anti-human 4-l BB antibody (EUlOl ) or an
exemplary anti—PD-l antibody uda) by intraperitoneal injection at a dose of 5.0 mg and
.0 mg per 1 kg of body weight once every 5 days three times.
] shows comparative anticancer effects of individual ent and
combination therapy of an exemplary uman 4-1BB antibody (EUIO l) and an exemplary
anti-PD-l antibody (Keytruda). Anticancer effects were measured as tumor sizes afier colon
cancer tumor cells (HT29) were aneously injected into humanized mice and antibody
treatment. When tumor sizes reach 300 to 450 mm}, an exemplary uman 4-] BB antibody
(EUlOl) was administered at 2.5 mpk for individual treatment, an exemplary anti-PD-l antibody
uda) was stered at 2.5 mpk for individual treatment, and EUIOI, 2.5 mpk +
Keytruda, 2.5 mpk were stered for combination therapy. Administration was by
intraperitoneal injection of mice, once every three days, for a total of three times.
A shows the numbers of human CD4* T cells and CD8? T cells circulated
in mouse blood or I gram of tumor tissue at 34 days after treatment with an exemplary anti-
human 4-lBB antibody (EUlOl) and an ary anti-PD-l antibody (Keytruda), individually
and in combination, on tumor-implanted humanized mice, as described in . The number
of T cell infiltrating lymphocytes (TILs) in tumor were measured by calculating tional
ratios of the total cell numbers by measuring ratios (%) ofCD4’ T cells and CD8' T cells using a
flow cytometer. Flow cytometry was performed to measure the ratios (9/0) of the CD4' T cells
and CD8’ T cells after cells are stained with a FITC-labeled CD4 antibody. a fluorescent BVS 10-
labeled CD8 antibody and a fluorescent APC-cy7-labeled CD45 antibody, and a human blood
cell marker, CD45-positive cells were separated from a flow cytometry program (gating). 8 shows a ratio of Treg (CD4’Foxp3high T cells) per ratio of CDS‘IFN-y‘ T cells measured
by calculating a proportional ratio between the ratio of the CDS‘IFN-y' T cells and the ratio of
Treg (CD4Toxp3high T cells) using a flow cytometer after the cells were stained with
fluorescent APC-cy7-labeled CD45, a fluorescent BVS 10-labeled CD8 dy, a fluorescent
FlTC-labeled CD4 antibody, cent PE-labeled INFy, and fluorescent APC- labeled Foxp3
antibody.
A and 3 show IFN-y analysis results through serum and tumor
fluid after individual and combination treatment of an exemplary anti-human 4—lBB antibody
(EUlOl) and an exemplary anti-PD-l antibody (Keytruda). After dissection performed on all of
the treated groups shown in FIGS. 15A and 15B, 10 pl of serum and [00 ul of tumor fluid were
analyzed with human IFN-y and human TGF-B ELISA kits.
A shows antigen-specific CD8’ T cell ratios (ratio of 4-1 BB’CD8‘ T
cells: 43.2%, ratio of CD8’ T cells: 58.6%) measured before panning with an exemplary anti—
human 4—lBB antibody (EUlOl ). 8 shows antigen-specific CD8’ T cell ratios (ratio of
pCMV’CDS‘ T cells: 600%, ratio of CD8’ T cells: 79.3%) measured after panning with an
exemplary anti-human 4-1BB antibody (EU | O 1 ).
CERTAIN DEFINITIONS
In the description that follows, a number ofterms used in inant DNA and
immunology are ively utilized. In order to provide a clearer and consistent understanding
of the specification and claims, including the scope to be given such terms, the following
definitions are provided.
|0056| About: The term “about”, when used herein in reference to a value, refers to a
value that is similar, in context to the referenced value. In general, those skilled in the art,
familiar with the context, will iate the relevant degree of variance encompassed by
“about” in that context. For example, in some embodiments, the term “about” may encompass a
range of values that within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%,
9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less of the referred value.
Administration: As used herein, the term “administration” typically refers to the
administration of a composition to a subject or system to achieve delivery of an agent that is, or
is included in, the composition. Those of ordinary skill in the art will be aware of a y of
routes that may, in appropriate stances, be utilized for administration to a subject, for
example a human. For example, in some embodiments, stration may be ocular, oral,
parenteral, topical, etc.. In some particular embodiments, administration may be bronchial (e.g.,
by bronchial instillation), buccal, dermal (which may be or comprise, for example, one or more
of topical to the dermis, intradermal, interdemtal, transdemial, etc), enteral, intra-arten'al,
intradennal, intragastric, intramedullary, intramuscular, intranasal, intraperitoneal, hecal,
intravenous, entricular, within a specific organ (e. g. intrahepatic), mucosal, nasal, oral,
rectal, aneous, sublingual, topical, al (e.g., by intratracheal instillation), vaginal,
vitreal, etc. In some embodiments, administration may involve only a single dose. In some
embodiments, administration may involve application of a fixed number of doses. In some
embodiments, administration may involve dosing that is intermittent (e.g., a plurality of doses
separated in time) and/or periodic (e.g., individual doses separated by a common period of time)
dosing. In some embodiments, administration may e continuous dosing (e.g., ion)
for at least a selected period of time.
Affinity: As is known in the art, “affinity” is a measure of the ess with a
particular ligand binds to its partner. Affmities can be ed in different ways. In some
embodiments, affinity is ed by a quantitative assay. In some such ments, binding
r concentration may be fixed to be in excess of ligand concentration so as to mimic
physiological conditions. Alternatively or additionally, in some ments, binding partner
concentration and/or ligand concentration may be varied. In some such embodiments, affinity
may be compared to a reference under comparable conditions (e.g., concentrations).
Agom‘st: Those skilled in the art will appreciate that the term “agonist” may be
used to refer to an agent condition, or event whose presence, level, degree, type, or form
correlates with an sed level or activity of another agent (i.e., the ed agent). In
general, an agonist may be or include an agent of any chemical class including, for example,
small molecules, polypeptides, nucleic acids, carbohydrates, lipids, metals, and/or any other
entity that shows the relevant activating activity. In some embodiments, an agonist may be
direct (in which case it exerts its influence directly upon its ); in some embodiments, an
agonist may be indirect (in which case it exerts its influence by other than binding to its ;
e.g, by cting with a regulator of the target, so that level or activity of the target is altered).
Animal: as used herein refers to any member of the animal kingdom. In some
embodiments, “cmimaf‘ refers to humans, of either sex and at any stage of development. In
some embodiments, “animal” refers to non-human s, at any stage of development. In
certain embodiments, the non-human animal is a mammal (e.g., a rodent, a mouse, a rat, a rabbit,
a monkey, a dog, a cat, a sheep, cattle, a primate, and/or a pig). In some embodiments, animals
include, but are not limited to, mammals, birds, reptiles, amphibians, fish, insects, and/or womis.
In some embodiments, an animal may be a transgenic animal, genetically engineered animal,
and/or a clone.
] nist: Those skilled in the art will appreciate that the term “antagonist", as
used herein, may be used to refer to an agent condition, or event whose presence, level, degree,
type, or form correlates with decreased level or activity of another agent (i.e., the inhibited agent,
or target). In general, an antagonist may be or include an agent of any chemical class including,
for e, small molecules, polypeptides, nucleic acids, carbohydrates, lipids, metals, and/or
any other entity that shows the relevant inhibitory activity. In some embodiments, an antagonist
may be direct (in which case it exerts its influence directly upon its target); in some
embodiments, an antagonist may be indirect (in which case it exerts its influence by other than
binding to its target; e.g., by interacting with a regulator of the target, so that level or activity of
the target is altered).
Antibody: As used herein, the term “antibody” refers to a polypeptide that
includes canonical immunoglobulin sequence elements ient to confer specific binding to a
particular target antigen. As is known in the art, intact antibodies as ed in nature are
approximately ISO kD tetrameric agents comprised of two identical heavy chain ptides
(about 50 kD each) and two identical light chain polypeptides (about 25 kD each) that associate
with each other into what is commonly referred to as a ped” structure. Each heavy chain
is comprised of at least four domains (each about I 10 amino acids long)— an amino-terminal
variable (VH) domain (located at the tips of the Y structure), followed by three constant
domains: CH1, CH2, and the carboxy-tenninal CH3 ed at the base of the Y’s stem). A
short region, known as the “switch”, connects the heavy chain variable and constant regions.
The “hinge” ts CH2 and CH3 domains to the rest of the antibody. Two disulfide bonds in
this hinge region connect the two heavy chain polypeptides to one another in an intact antibody.
Each light chain is comprised of two s — an terminal variable (VL) domain,
ed by a carboxy-tenninal constant (CL) domain, separated from one another by another
“switch”. Intact antibody tetramers are comprised of two heavy chain-light chain dimers in
which the heavy and light chains are linked to one another by a single disulfide bond; two other
disulfide bonds connect the heavy chain hinge regions to one another, so that the dimers are
connected to one another and the tetramer is . Naturally-produced antibodies are also
glycosylated, typically on the CH2 domain. Each domain in a natural antibody has a structure
characterized by an “immunoglobulin fold“ formed from two beta sheets (e.g., 3-, 4-, or S-
stranded ) packed against each other in a compressed antiparallel beta barrel. Each
variable domain contains three hypervariable loops known as ement determining regions"
(CDRl, CDRZ, and CDR3) and four somewhat invariant “framework” regions (FRI, FR2, FR3,
and FR4). When natural antibodies fold, the FR regions form the beta sheets that provide the
structural framework for the domains, and the CDR loop regions from both the heavy and light
chains are brought together in three—dimensional space so that they create a single hypervariable
antigen binding site d at the tip of the Y structure. The Fc region of naturally—occurring
antibodies binds to elements of the complement system, and also to ors on effector cells,
including for example effector cells that mediate cytotoxicity. As is known in the art, affinity
and/or other binding utes of Fe s for Fc receptors can be modulated through
glycosylation or other modification. In some embodiments, antibodies produced and/or utilized
in accordance with the present invention include glycosylated Fc domains, including Fc domains
with d or engineered such glycosylation. For purposes of the present invention, in certain
ments, any polypeptide or complex of polypeptides that includes sufficient
immunoglobulin domain sequences as found in natural dies can be referred to and/or used
as an “antibody", whether such polypeptide is naturally produced (e.g, generated by an organism
reacting to an antigen), or produced by recombinant engineering, chemical synthesis, or other
artificial system or methodology. In some embodiments, an antibody is polyclonal; in some
embodiments, an antibody is monoclonal. In some embodiments, an antibody has constant
region sequences that are characteristic of mouse, rabbit, primate, or human antibodies, In some
embodiments, antibody sequence elements are humanized, primatized, chimeric, etc, as is known
in the art. Moreover, the term “antibody” as used herein, can refer in appropriate embodiments
(unless otherwise stated or clear from context) to any of the art-known or developed ucts
or s for utilizing antibody structural and functional features in altemative presentation,
For e, ments, an antibody utilized in accordance with the present invention is in a
format ed from, but not limited to, intact lgA, lgG, IgE or lgM antibodies; bi- or multi-
specific antibodies (e.g., Zybodies®, etc); antibody fragments such as Fab nts, Fab’
fragments, F(ab’)2 fragments, Fd’ fragments, Fd nts, and ed CDRs or sets f;
single chain Fvs; polypeptide-PC fusions; single domain antibodies (e.g., shark single domain
antibodies such as lgNAR or fragments thereof); cameloid antibodies; masked antibodies (e.g,
Probodies®); §mal| Modular immunoflharmaceuticals (“SM H’smi); single chain or Tandem
diabodies (TandAb®); humabodies, VHHs; lins®; Nanobodies® minibodies; BiTE®s;
ankyrin repeat proteins or DARPINs®; Avimers®; DARTs; TCR—like antibodies;, Adnectins®;
Affilins®; bodies®; Affibodies®; TrimerX®; roteins; Fynomers®, Centyrins®;
and KALBITOR®S. In some embodiments, an antibody may lack a covalent modification (e.g.,
ment of a glycan) that it would have if produced naturally. In some embodiments, an
antibody may contain a covalent modification (e.g., attachment of a glycan, a payload [e.g., a
detectable moiety, a therapeutic moiety, a catalytic moiety, etc], or other pendant group [e.g.,
poly-ethylene glycol, etc]
WO 27787 PCT/lBZlIlS/(Illll043
Antibodyfragment: As used , an ody fragment” refers to a portion of
an antibody or antibody agent as described herein, and typically refers to a portion that includes
an antigen-binding portion or variable region thereof. An antibody nt may be produced
by any means. For e, in some embodiments, an antibody fragment may be enzymatically
or chemically produced by fragmentation of an intact antibody or antibody agent. Alternatively,
in some embodiments, an antibody fragment may be recombinantly produced (i.e., by expression
of an engineered nucleic acid sequence. In some embodiments, an antibody fragment may be
wholly or partially synthetically produced. In some embodiments, an antibody fragment
(particularly an antigen-binding dy fragment) may have a length of at least about 50, 60,
70, 80, 90, IOO, 110, 120, I30, I40, ISO, 160, I70, I80, 190 amino acids or more, in some
embodiments at least about 200 amino acids.
Binding: It will be understood that the term “binding”, as used herein, typically
refers to a non-covalent association between or among two or more entities. “Direct" binding
involves physical contact between entities or es; indirect binding involves physical
interaction by way of al contact with one or more intermediate entities. g between
two or more entities can typically be assessed in any of a variety of contexts — including where
interacting entities or moieties are studied in isolation or in the context of more complex systems
(e.g., while covalently or otherwise associated with a carrier entity and/or in a biological system
or cell).
Cancer: The terms r”, “malignancy”, “neoplasm", “tumor”, and
“carcinoma", are used herein to refer to cells that exhibit relatively al, uncontrolled,
and/or autonomous growth, so that they t an aberrant growth phenotype characterized by a
significant loss of control of cell proliferation. In some embodiments, a tumor may be or
comprise cells that are precancerous (e. g., benign), malignant, pre-metastatic, metastatic, and/or
tastatic . The present disclosure specifically identifies certain cancers to which its
teachings may be particularly relevant. In some embodiments, a relevant cancer may be
characterized by a solid tumor. In some embodiments, a relevant cancer may be characterized by
a hematologic tumor. In general, examples ofdifferent types of s known in the art
include, for example, hematopoietic cancers including leukemias, lymphomas (Hodgkin’s and
non-Hodgkin’s), myelomas and myeloproliferative disorders; as, melanomas, adenomas,
carcinomas of solid tissue, squamous cell omas of the mouth, throat, latynx, and lung, liver
cancer, genitourinary s such as prostate, al, r, e, and endometrial cancer
and renal cell carcinomas, bone cancer, pancreatic cancer, skin cancer, cutaneous or intraocular
melanoma, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid
gland, head and neck cancers, breast cancer, gastro—intestinal cancers and nervous system
cancers, benign lesions such as papillomas, and the like.
CDR: as used herein, refers to a mentarity ining region within an
antibody variable region. There are three CDRs in each of the variable regions of the heavy
chain and the light chain, which are designated CDR I CDRZ and CDR3, for each of the variable
regions, A “set ofCDRs” or “CDR set” refers to a group of three or six CDRs that occur in
either a single variable region capable of g the antigen or the CDRs of cognate heavy and
light chain variable regions capable ofbinding the antigen. Certain systems have been
established in the art for defining CDR boundaries (e.g., Kabat, Chothia, etc); those skilled in
the art appreciate the differences between and among these systems and are capable of
understanding CDR boundaries to the extent required to understand and to practice the claimed
invention.
Chemotherapeutic Agent: The term “chemotherapeutic agent”, has used herein
has its art-understood meaning referring to one or more pro-apoptotic, atic and/or cytotoxic
agents, for example cally including agents utilized and/or recommended for use in treating
one or more es, disorders or conditions associated with undesirable cell proliferation. In
many embodiments, chemotherapeutic agents are useful in the treatment of cancer. In some
embodiments, a chemotherapeutic agent may be or comprise one or more alkylating agents, one
or more anthracyclines, one or more cytoskeletal disruptors (e. g. microtubule targeting agents
such as taxanes, maytansine and analogs f, of), one or more epothilones, one or more
histone deacetylase inhibitors HDACs), one or more topoisomerase inhibitors (e.o., inhibitors of
topoisomerase I and/or topoisomerase 11), one or more kinase inhihitors, one or more nucleotide
analogs or tide precursor analogs, one or more peptide antibiotics, one or more platinum—
based agents, one or more retinoids, one or more vinca alkaloids, and/or one or more analogs of
one or more ofthe following (i.e., that share a relevant anti-proliferative activity). In some
particular embodiments, a chemotherapeutic agent may be or comprise one or more of
mycin, All-trans retinoic acid, an Auiristatin, Azacitidine, Azathioprine, Bleomycin,
omib, Carboplatin, Capecitabine, Cisplatin, Chlorambucil, hosphamide, Curcumin,
Cytarabine, ubicin, Docetaxel, Doxifluridine, Doxorubicin, Epirubicin, Epothilone,
Etoposide, Fluorouracil, Gemcitabine, yurea, icin, Imatinib, Irinotecan,
Maytansine and/or analogs thereof (e. g. DMl) Mechlorethamine, Mercaptopurine, Methotrexate,
Mitoxantrone, a sinoid, Oxaliplatin, Paclitaxel, exed, Teniposide, Tioguanine,
Topotecan, Valrubicin, Vinblastine, Vincn'stine, Vindesine, Vinorelbine, and combinations
thereof. In some embodiments, a chemotherapeutic agent may be utilized in the t of an
antibody-drug conjugate. In some embodiments, a herapeutic agent is one found in an
antibody-drug conjugate selected from the group consisting of: ML 1 -doxorubicin, hRS7-SN-3 8,
hMN-l4-SN-38, hLL2-SN-38, hA20-SN-38, hPAM4-SN-38, hLLl-SN-38, hRS7-ProP-Dox,
hMN-l4-ProP-Dox, hLLZ-Pro-Z-P-Dox, hA20-Pro—2-P-Dox, hPAM4-Pro—2-P-Dox, hLLl-
Pro-Z-P-Dox, P4/DlO-doxorubicin, gemtuzumab ozogamicin, brentuximab vedotin, trastuzumab
emtansine, inotuzumab ozogamicin, glembatumomab vedotin, SAR34I9, SARS66658, BIIBO l 5,
BT062, SGN-75, SGN-CD19A, AMG-l72, AMG-595, BAY9343, ASG-SME, ASG-22ME,
M8F, MDX-1203, MLN—0264, anti-PSMA ADC, RG—7450, RG-7458, RG—7593, RG-
7596, RG—7598, RG—7599, RG-7600, RG-7636, ABT-4l4, [MON-853, [MON-529,
vorsetuzumab tin, and lorvotuzumab mertansine.
Combination therapy: As used herein, the term “combination y” refers to
those situations in which a subject is aneously exposed to two or more therapeutic
ns (e.g., two or more therapeutic agents). In some embodiments, the two or more
eutic regimens may be administered simultaneously. In some embodiments, the two or
more therapeutic regimens may be administered sequentially (e.g., a first regimen stered
prior to administration of any doses of a second regimen). In some embodiments, the two or
more therapeutic regimens are administered in overlapping dosing ns. In some
embodiments, administration of combination therapy may involve administration of one or more
therapeutic agents or modalities to a subject receiving the other s) or modality.
Carr-espomling to: As used herein, the term “corresponding to” may be used to
designate the position/identity of a structural element in a compound or composition through
comparison with an appropriate reference compound or composition. For e, in some
embodiments, a monomeric residue in a polymer (e.g., an amino acid residue in a polypeptide or
a nucleic acid residue in a polynucleotide) may be identified as “corresponding to” a residue in
an appropriate reference polymer. For example, those of ordinary skill will appreciate that, for
es of simplicity, residues in a polypeptide are often designated using a canonical
numbering system based on a reference related polypeptide, so that an amino acid
“corresponding lo" a residue at position 190, for example, need not actually be the 190m amino
acid in a particular amino acid chain but rather corresponds to the e found at 190 in the
reference polypeptide; those of ordinary skill in the art readily appreciate how to fy
“corresponding” amino acids. For example, those skilled in the art will be aware of various
sequence alignment gies, ing re programs such as, for example, BLAST, CS—
BLAST, CUSASWH, DIAMOND, FASTA, GGSEARCH/GLSEARCH, Genoogle, HMJVIER,
HHpred/l-II-Isearch, IDF, Infernal, KLAST, USEARCH, parasail, PSI-BLAST, PSI-Search,
ScalaBLAST, Sequilab, SAM, SSEARCH, SWAPI—II, SWAPHI-LS, SWIMM, or SWIPE that
can be utilized, for example, to identify “corresponding” residues in ptides and/or nucleic
acids in accordance with the present disclosure.
Engineered: In general, the term “engineered” refers to the aspect of having been
manipulated by the hand of man. For example, a polypeptide is considered to be “engineered”
when the polypeptide sequence manipulated by the hand of man. For example, in some
embodiments of the present invention, an engineered polypeptide comprises a sequence that
includes one or more amino acid ons, deletions and/or insertions that have been introduced
by the hand of man into a reference polypeptide sequence. Comparably, a cell or organism is
considered to be “engineered” if it has been manipulated so that its genetic information is altered
(e.g., new genetic material not previously t has been introduced, for example by
transformation, mating, c ization, transfection, transduction, or other mechanism, or
previously present genetic material is d or removed, for example by substitution or deletion
mutation, or by mating ols). As is common practice and is understood by those in the art,
tives and/or progeny of an engineered polypeptide or cell are typically still referred to as
“engineered“ even though the actual manipulation was performed on a prior entity.
Epitope: as used herein, includes any moiety that is specifically recognized by
an immunoglobulin (cg, antibody or receptor) binding component. In some embodiments, an
epitope is comprised of a ity of chemical atoms or groups on an antigen. In some
embodiments, such chemical atoms or groups are surface-exposed when the antigen adopts a
relevant three-dimensional conformation. In some embodiments, such chemical atoms or groups
are physically near to each other in space when the antigen adopts such a conformation. In some
embodiments, at least some such chemical atoms are groups are physically separated from one
another when the antigen adopts an alternative conformation (e.g., is linearized).
Ex vivo: as used herein refers to biologic events that occur outside of the context
of a multicellular organism. For example, in the context of cell-based systems, the term may be
used to refer to events that occur among a population of cells (e.g., cell proliferation, cytokine
ion, etc.) in an ial environment.
[0073| Framework ework region: as used herein, refers to the ces of a
variable region minus the CDRs. Because a CDR sequence can be determined by different
systems, likewise a framework sequence is subject to pondingly different interpretations.
The six CDRs divide the framework regions on the heavy and light chains into four sub-regions
(FRl, FR2, FR3 and FR4) on each chain, in which CDR] is positioned between FRI and FR2,
CDR2 between FRZ and FR3, and CDR3 between FR3 and FR4 Without specifying the
particular sub-regions as FRI, FR2, FR3 or FR4, a framework region, as ed by others,
represents the combined FRs within the variable region of a single, naturally occurring
immunoglobulin chain. As used herein, a FR represents one of the four sub-regions, FRl, for
example, represents the first framework region closest to the amino terminal end of the variable
region and 5' with respect to CDR], and FRs represents two or more of the sub-regions
constituting a framework region.
Humanizerl: as is known in the art, the term “hmmmized’ is commonly used to
refer to antibodies (or antibody components) whose amino acid sequence includes VH and VL
region sequences from a reference dy raised in a non-human species (e.g., a mouse), but
also es modifications in those sequences relative to the reference antibody intended to
render them more “human-like", i.e., more similar to human getmline variable sequences. In
some embodiments, a “humanized” antibody (or antibody ent) is one that
immunospecifically binds to an antigen of interest and that has a framework (FR) region having
substantially the amino acid sequence as that of a human dy, and a complementary
determining region (CDR) having substantially the amino acid ce as that of a non-human
antibody. A humanized antibody comprises substantially all of at least one, and typically two,
variable domains (Fab, Fab', F(ab')2, FabC, Fv) in which all or substantially all of the CDR
regions correspond to those of a man immunoglobulin (i.e., donor immunoglobulin) and
all or ntially all of the framework s are those of a human immunoglobulin consensus
sequence. In some embodiments, a zed antibody also comprises at least a portion of an
globulin constant region (Fc), typically that of a human immunoglobulin constant
region. In some embodiments, a zed antibody contains both the light chain as well as at
least the variable domain of a heavy chain. The antibody also may include a CH1, hinge, CH2,
CH3, and, optionally, a CH4 region of a heavy chain constant region.
In vitro: The term “in vilro” as used herein refers to events that occur in an
artificial environment, e.g., in a test tube or reaction , in cell culture, etc, rather than within
a multi-cellular organism.
|0076] In vivo: as used herein refers to events that occur within a multi-cellular
organism, such as a human and a man animal. In the context of cell-based systems, the
term may be used to refer to events that occur within a living cell (as opposed to, for example, in
vilro systems).
Isolated: as used herein, refers to a substance and/or entity that has been (1)
separated from at least some of the components with which it was associated when initially
produced er in nature and/or in an experimental setting), and/or (2) designed, produced,
ed, and/or manufactured by the hand of man. Isolated substances and/or entities may be
separated from about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about
70%, about 80%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about
96%, about 97%, about 98%, about 99%, or more than about 99% of the other components with
which they were initially associated. In some embodiments, isolated agents are about 80%,
about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%,
about 97%, about 98%, about 99%, or more than about 99% pure. As used herein, a substance is
“pure" if it is substantially free of other components. In some embodiments, as will be
understood by those skilled in the art, a substance may still be considered led” or even
, after having been combined with certain other components such as, for example, one or
more carriers or excipients (e.g., buffer, solvent, water, etc); in such embodiments, percent
isolation or purity of the substance is calculated without including such carriers or excipients. To
give but one example, in some embodiments, a biological polymer such as a polypeptide or
polynucleotide that occurs in nature is considered to be “isolated’ when, a) by virtue of its origin
or source of derivation is not associated with some or all of the components that accompany it in
its native state in nature; b) it is substantially free of other polypeptides or nucleic acids of the
same species from the species that produces it in nature; c) is expressed by or is otherwise in
ation with components from a cell or other expression system that is not of the species that
produces it in nature. Thus, for instance, in some embodiments, a polypeptide that is chemically
synthesized or is sized in a cellular system different from that which produces it in nature
is considered to be an “isolated‘ polypeptide. Alternatively or additionally, in some
embodiments, a polypeptide that has been subjected to one or more purification ques may
be ered to be an “isolated” polypeptide to the extent that it has been separated from other
components a) with which it is associated in ; and/or b) with which it was associated when
initially produced.
'1).- as used herein, refers to the dissociation constant of a binding agent (e.g., an
antibody or binding component thereof) from a complex with its partner (e.g., the epitope to
which the antibody or binding component thereof binds).
Operably linked: as used herein, refers to ajuxtaposition wherein the components
described are in a relationship permitting them to function in their ed manner. A control
t "operab/y linked" to a functional element is associated in such a way that expression
and/or ty of the functional element is achieved under ions compatible with the
control element. In some ments, "operably linked“ control elements are contiguous (e.g.,
covalently linked) with the coding elements of interest; in some embodiments, control elements
act in from to or ise at a from the functional element of interest.
Pharmaceutical composition: As used , the temt “pharmaceutical
composition“ refers to a ition in which an active agent is formulated together with one or
more phamtaceutically acceptable carriers. In some embodiments, the composition is suitable
for administration to a human or animal subject. In some embodiments, the active agent is
present in unit dose amount appropriate for administration in a therapeutic regimen that shows a
statistically significant probability of achieving a predetermined therapeutic effect when
administered to a nt population.
Polypeptide: The term “polypeptide", as used herein, generally has its artrecognized
meaning of a polymer of at least three amino acids. Those of ordinary skill in the art
will appreciate that the term “polypeptide” is intended to be sufficiently general as to encompass
not only polypeptides having a complete sequence recited herein, but also to encompass
polypeptides that represent functional fragments (i.e., fragments retaining at least one activity) of
such complete polypeptides. Moreover, those of ordinary skill in the art understand that n
sequences generally tolerate some substitution without destroying activity. Thus, any
polypeptide that retains activity and shares at least about 30-40% overall sequence identity, often
greater than about 50%, 60%, 70%, or 80%, and further usually including at least one region of
much higher identity, oflen greater than 90% or even 95%, 96%, 97%, 98%, or 99% in one or
more highly conserved regions, usually assing at least 3-4 and often up to 20 or more
amino acids, with another polypeptide of the same class, is encompassed within the relevant term
“polypeptide” as used herein. Polypeptides may contain L-amino acids, D-amino acids, or both
and may contain any of a variety of amino acid modifications or analogs known in the
art. Useful modifications include, e.g., terminal acetylation, amidation, methylation, etc. In
some embodiments, proteins may comprise natural amino acids, non-natural amino acids,
synthetic amino acids, and combinations thereof. The term “peptide” is generally used to refer to
a polypeptide having a length of less than about 100 amino acids, less than about 50 amino acids,
less than 20 amino acids, or less than 10 amino acids. In some embodiments, proteins are
antibodies, antibody fragments, ically active portions f, and/or characteristic
portions thereof.
Prevent or prevention: as used herein when used in tion with the
occurrence of a disease, er, and/or condition, refers to reducing the risk of developing the
disease, disorder and/or condition and/or to delaying onset and/or ty of one or more
characteristics or symptoms of the disease, disorder or condition. In some embodiments,
prevention is assessed on a population basis such that an agent is considered to “prevent” a
particular disease, disorder or condition if a statistically significant decrease in the development,
frequency, and/or intensity of one or more symptoms of the disease, disorder or condition is
observed in a tion susceptible to the disease, disorder, or ion.
Recombinant: as used , is intended to refer to polypeptides that are
ed, engineered, prepared, sed, created, manufactured, and/or or isolated by
recombinant means, such as polypeptides sed using a recombinant expression vector
transfected into a host cell; polypeptides isolated from a recombinant, atorial human
polypeptide library; polypeptides isolated from an animal (e.g., a mouse, rabbit, sheep, fish, etc)
that is transgenic for or otherwise has been lated to express a gene or genes, or gene
components that encode and/or direct expression of the polypeptide or one or more
component(s), portion(s), element(s), or domain(s) thereof; and/or polypeptides prepared,
expressed. created or isolated by any other means that involves splicing or ligating selected
nucleic acid ce elements to one another, chemically synthesizing ed ce
elements, and/or otherwise generating a nucleic acid that encodes and/or directs expression of the
polypeptide or one or more component(s), portion(s), element(s), or domain(s) thereof. In some
embodiments, one or more of such selected sequence elements is found in nature. In some
embodiments, one or more of such selected sequence elements is designed in silica. In some
embodiments, one or more such selected ce elements results from mutagenesis (e.g., in
vivo or in viiro) ofa known sequence element, e.g., from a natural or synthetic source such as,
for example, in the germline of a source organism of interest (e.g., of a human, a mouse, etc).
Specific binding: As used herein, the term “specific binding" refers to an ability
to discriminate between possible binding partners in the environment in which binding is to
occur. A binding agent that interacts with one particular target when other potential targets are
present is said to “bind .specific‘a/bl” to the target with which it interacts. In some embodiments,
specific binding is assessed by ing or detennining degree of association between the
binding agent and its partner; in some embodiments, specific binding is assessed by detecting or
determining degree of dissociation of a binding agent-partner complex; in some embodiments,
specific binding is assessed by detecting or ining ability of the binding agent to compete
an ative interaction between its r and another entity. In some embodiments, specific
binding is assessed by performing such detections or determinations across a range of
concentrations.
Subject: As used herein, the term “subject” refers an organism, typically a
mammal (e.g., a human, in some embodiments including prenatal human forms). In some
embodiments, a subject is ing from a relevant disease, disorder or condition. In some
embodiments, a subject is susceptible to a disease, er, or condition. In some embodiments,
a subject displays one or more symptoms or characteristics of a disease, disorder or condition. In
some embodiments, a subject does not display any symptom or characteristic of a disease,
disorder, or ion. In some ments, a subject is someone with one or more features
teristic of susceptibility to or risk of a disease, disorder, or condition. In some
ments, a subject is a t. In some embodiments, a subject is an individual to whom
diagnosis and/or y is and/or has been administered.
Therapeutic agent: As used herein, the phrase peutic agent” in general
refers to any agent that elicits a d cological effect when administered to an
organism. In some embodiments, an agent is considered to be a therapeutic agent if it
demonstrates a statistically significant effect across an appropriate population. In some
embodiments, the appropriate population may be a population of model organisms. In some
embodiments, an appropriate population may be defined by s criteria, such as a certain age
group, gender, genetic background, preexisting clinical ions, etc. In some embodiments, a
therapeutic agent is a substance that can be used to alleviate, ameliorate, relieve, inhibit, prevent,
delay onset of, reduce severity of, and/or reduce incidence of one or more symptoms or features
ofa e, disorder, and/or condition. In some embodiments, a “therapeutic agent” is an agent
that has been or is required to be ed by a government agency before it can be marketed for
administration to humans. In some embodiments, a “therapeutic agent” is an agent for which a
medical iption is required for stration to humans.
Therapeutically Effective : As used herein, the term “therapeutically
effective amount” means an amount that is sufficient. when administered to a population
suffering from or susceptible to a disease, disorder, and/or condition in accordance with a
therapeutic dosing regimen, to treat the disease, disorder, and/or condition. In some
embodiments, a therapeutically effective amount is one that reduces the incidence and/or severity
of, stabilizes one or more characteristics of, and/or delays onset of, one or more symptoms of the
disease, disorder, and/or condition. Those of ordinary skill in the art will appreciate that the term
“therapeutically ive amount” does not in fact require successful treatment be achieved in a
particular dual. Rather, a therapeutically effective amount may be that amount that
provides a particular desired pharmacological response in a significant number of subjects when
administered to ts in need of such treatment. For example, in some embodiments, term
“therapeutically effective amount”, refers to an amount which, when administered to an
individual in need thereof in the context of inventive therapy, will block, stabilize, ate, or
reverse a cancer-supportive s occurring in said dual, or will enhance or increase a
cancensuppressive process in said individual. In the context of cancer treatment, a
“therapeutically effective amount” is an amount which, when administered to an individual
diagnosed with a cancer, will prevent, stabilize, inhibit, or reduce the further development of
cancer in the individual. A particularly preferred “therapeutically effective amount” of a
composition described herein reverses (in a therapeutic treatment) the development of a
malignancy such as a pancreatic carcinoma or helps achieve or prolong remission of a
malignancy. A eutically effective amount administered to an individual to treat a cancer in
that individual may be the same or different from a therapeutically effective amount
administered to promote remission or inhibit asis. As with most cancer therapies, the
therapeutic methods described herein are not to be interpreted as, restricted to, or otherwise
limited to a “cure“ for cancer; rather the methods of treatment are directed to the use of the
described compositions to “treat” a cancer, i.e., to effect a desirable or beneficial change in the
health of an dual who has cancer. Such benefits are recognized by skilled healthcare
providers in the field of oncology and include, but are not limited to, a stabilization of patient
condition, a decrease in tumor size (tumor regression), an improvement in vital functions (e.g.,
improved function of cancerous tissues or organs), a decrease or inhibition of further asis,
a decrease in opportunistic ions, an increased survivability, a decrease in pain, improved
motor function, improved cognitive fimction, improved feeling of energy (vitality, decreased
e), improved feeling of well-being, restoration of normal appetite, restoration of healthy
weight gain, and ations thereof In addition, regression of a particular tumor in an
individual (e.g., as the result of treatments described herein) may also be assessed by taking
s of cancer cells from the site of a tumor such as a pancreatic adenocarcinoma (e.g., over
the course of treatment) and testing the cancer cells for the level of metabolic and signaling
markers to r the status of the cancer cells to verify at the molecular level the regression of
the cancer cells to a less malignant phenotype. For example, tumor regression d by
employing the methods of this invention would be indicated by finding a decrease in any of the
pro-angiogenic markers sed above, an increase in anti-angiogenic markers bed
herein, the normalization (i.e., alteration toward a state found in normal individuals not suffering
from cancer) of metabolic pathways, intercellular signaling pathways, or intracellular signaling
pathways that exhibit abnormal activity in individuals diagnosed with cancer. Those of ordinary
skill in the art will appreciate that, in some embodiments, a therapeutically effective amount may
be formulated and/or stered in a single dose. In some embodiments, a therapeutically
effective amount may be formulated and/or stered in a plurality of doses, for example, as
part of a dosing regimen.
Variant: As used herein in the context of molecules, e.g., nucleic acids, ns,
or small molecules, the term “variant“ refers to a molecule that shows significant structural
identity with a reference molecule but differs structurally from the nce molecule, e.g., in
the presence or absence or in the level of one or more chemical moieties as compared to the
reference entity. In some embodiments, a variant also differs functionally from its reference
molecule. In general, whether a particular molecule is properly considered to be a “variant” of a
reference molecule is based on its degree of structural ty with the reference molecule. As
will be appreciated by those skilled in the art, any ical or chemical reference molecule has
certain characteristic structural elements. A variant, by definition, is a distinct molecule that
shares one or more such characteristic structural elements but differs in at least one aspect from
the reference molecule. To give but a few examples, a ptide may have a characteristic
sequence element comprised ofa plurality of amino acids having designated ons relative to
one another in linear or three-dimensional space and/or buting to a particular structural
motif and/or biological function; a nucleic acid may have a characteristic sequence element
comprised of a plurality of nucleotide residues having designated positions relative to on another
in linear or three-dimensional space. In some embodiments, a variant polypeptide or nucleic acid
may differ from a reference polypeptide or nucleic acid as a result of one or more differences in
amino acid or tide sequence. In some embodiments, a variant polypeptide or nucleic acid
shows an overall sequence identity with a reference polypeptide or nucleic acid that is at least
85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94915, 95‘3”, 96%, 97%, or 99%. In some
embodiments, a variant polypeptide or nucleic acid does not share at least one characteristic
ce element with a reference ptide or nucleic acid. In some embodiments, a
reference polypeptide or nucleic acid has one or more biological activities. In some
embodiments, a variant polypeptide or nucleic acid shares one or more of the biological activities
of the reference polypeptide or c acid.
Vector: as used herein, refers to a nucleic acid molecule capable of transporting
another c acid to which it has been linked. One type of vector is a “plasmid”, which refers
to a circular double stranded DNA loop into which additional DNA segments may be ligated.
Another type of vector is a viral vector, wherein additional DNA segments may be ligated into
the viral genome. Certain vectors are capable of autonomous replication in a host cell into which
they are introduced (e.g., ial vectors having a bacterial origin of replication and episomal
mammalian vectors). Other vectors (e.g, non-episomal mammalian vectors) can be integrated
into the genome of a host cell upon introduction into the host cell, and thereby are replicated
along with the host genome. er, certain vectors are capable of directing the expression of
genes to which they are operatively linked. Such vectors are referred to herein as “expression
vectors.” Standard techniques may be used for recombinant DNA, ucleotide synthesis, and
tissue culture and transformation (e.g., electroporation, ction). Enzymatic reactions and
purification techniques may be performed according to manufacturer's specifications or as
commonly accomplished in the art or as described herein. The foregoing techniques and
procedures may be generally performed according to conventional methods well known in the art
and as described in various general and more specific references that are cited and discussed
throughout the present specification. See e.g., Sambrook et al.. Molecular Cloning: A
tory Manual (2“ ed, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY.
(1989)), which is incorporated herein by reference for any purpose.
DETAILED DESCRIPTION OF ARY EMBODIMENTS
[0090'] The present disclosure relates, inter alia, to 4- l BB, which is an ble co-
stimulatory molecule, and eutic antibodies that bind thereto that have been engineered to
have improved characteristics over a reference antilBB antibody. For e, engineered
antibodies provided herein have been d to enhance antigen affinity relative to that of a
reference agonist antibody that specifically recognizes an epitope within the extracellular domain
of human 4-1BB (Korean Patent No. 10-0500286, Accession No: KCTC ). Specifically,
as described herein, the inventors engineered a reference humanized anti-human 4-IBB
antibody, 9461 (US Patent No. 045). As described es herein, the light chain and
heavy chain CDR sequences of a reference antibody 94Gl, were separately engineered to
improve the affinity of each chain. Moreover, as described herein, exemplary engineered anti
lBB antibodies can effectively induce eration of activated T cells. Notably, ary
engineered antil BB antibodies are capable of inducing surprisingly ed activity of
CD8- T cells due to the stimulation caused by the 4-lBB humanized antibody binding to a 4-
188 molecule and inhibiting activation-induced cell death (AICD). Thus the present disclosure
es engineered anti-human 4—1BB antibodies with improved properties over a reference
antibody, and moreover demonstrate that these dies have surprisingly beneficial activity in
vitro and in viva.
4-1BB (also referred to as CD137, TNFRSF9, etc) is a receptor belonging to the
tumor necrosis factor or (TNFR) superfamily. 4-lBB is a co-stimulatory molecule
generally expressed in activated T lymphocytes and involved in immunity and autoimmune
diseases (Kwon et al. PNAS84:2896,1987; Kwon et al. PNAS (1989) 86: I963; Son et al. Journal
Q/‘Immzmological Methods (2004) 286(1-2):187-201, each of which is herein incorporated by
reference in its entirety). Human 4-1 BB is a 255 amino acid protein (Accession No.
NM_001561; NP_001552). The complete human 4~1BB amino acid sequence is provided in
SEQ ID NO: 44. 4-lBB is expressed on the cell surface in monomer ('30 kDa) and dimer (55
kDa) forms and likely trimerizes with 4-1BB ligand to signal.
Current tanding of 4- 18B suggests that it is constitutively expressed on a
number of cells, albeit at low levels, including Foxp3’ Tregs and dendritic cells (DC). (See,
Vinay and Kwon (2014) BMB Rep. 47(3): 9, which is incorporated by reference herein.)
tion with a number of agonists, such as cytokines (e.g., 1L-2, IL—4), polyclonal activators
(cg, Con A and PHA), cell surface molecules (e. g., anti-CD3 and anti-CD28) and promoters of
Caz- ion and PKC activity (e.g., ionomycin and photbol myristate acetate) further enhance
expression of 4-1BB. Id.
Numerous studies of murine and human T cells indicate that 4-1BB promotes
enhanced cellular proliferation, survival, and cytokine production (Croft, 2009, Nm. Rev.
lmmzmol. 9:271-285). Studies have indicated that some 4-1 BB agonist monoclonal antibodies
can increase costimulatory molecule expression and markedly enhance cytolytic T lymphocyte
responses, resulting in anti-tumor efficacy in s models. 4-lBB agonist monoclonal
antibodies have demonstrated efficacy in prophylactic and therapeutic settings. Further, 4—lBB
monotherapy and combination therapy tumor models have established durable anti-tumor
protective T cell memory ses (Lynch (2008) l. Rev. 22: 277—286). 4-1BB agonists
also have been shown to t autoimmune reactions in a y of art-recognized
autoimmunity models (Vinay .]. Mol. Med. 84:726-736). This dual activity of 4-1BB
offers the potential to provide anti-tumor ty while dampening autoimmune side effects that
can be associated with immunotherapy approaches.
4-] BB antibodies and nts thereof
The present sure provides, at least in part, engineered anti-human 4-] BB
antibodies and fragments f that exhibit markedly, and unexpectedly, superior
characteristics in vitro and/or in viva. For example, certain provided antibodies have increased
y relative to a reference humanized uman 4-‘l BB antibody.
|009Sl In some embodiments, an anti I BB antibody or antigen-binding antibody
fragment includes 1, 2, or 3 heavy chain CDR sequences that are or include a sequence of SEQ
ID NOS: 5 to 8. In some embodiments, an anti1BB antibody or antigen-binding dy
fragment includes one or more of: a heavy chain CDR] that is or includes a sequence of SEQ ID
NO: 5, a heavy chain CDR2 that is or includes a sequence of SEQ ID NO: 6 and a heavy chain
CDR3 that is or includes a sequence of SEQ ID NO: 7 or 8. In some embodiments, an anti
lBB antibody or antigen-binding antibody fragment includes each of: a heavy chain CDRI that
is or includes a sequence of SEQ ID NO: 5, a heavy chain CDR2 that is or includes a sequence
of SEQ ID NO: 6 and a heavy chain CDR3 that is or includes a sequence of SEQ ID NO: 7 or 8.
In some embodiments, an antil BB antibody or antigen-binding antibody
fragment includes 1, 2, or 3 light chain CDR sequences that are or include a sequence of SEQ ID
NQs: 1-4. In some embodiments, an -1BB dy or antigen-binding antibody fragment
includes one or more of: a light chain CDR] that is or includes a sequence of SEQ ID NO: I, a
light chain CDR2 that is or includes a sequence of SEQ ID NO: 2 and a light chain CDR3 that is
or includes a sequence of SEQ ID NO: 3 or 4. In some embodiments, an -IBB antibody or
antigen-binding antibody fragment includes each of: a light chain CDR] that is or includes a
sequence of SEQ ID NO: 1, a light chain CDR2 that is or includes a sequence of SEQ ID NO: 2
and a light chain CDR3 that is or includes a sequence of SEQ ID NO: 3 or 4.
|0097| In some ments, an anti l BB antibody or antigen—binding antibody
nt includes a heavy chain variable domain that includes a heavy chain CDRI that is or
includes a sequence of SEQ fl) NO: 5, a heavy chain CDR2 that is or includes a sequence of
SEQ ID NO: 6 and a heavy chain CDR3 that is or includes a sequence of SEQ ID NO: 7 or 8
and/or a light chain variable domain that includes a light chain CDR] that is or includes a
sequence of SEQ ID NO: 1, a light chain CDR2 that is or includes a sequence of SEQ ID NO: 2
and a light chain CDR3 that is or includes a sequence of SEQ ID NO: 4.
In some embodiments, an antiIBB antibody or antigen-binding antibody
fragment includes a heavy chain variable domain that includes a heavy chain CDR2 that is or
includes a sequence of SEQ ID NO: 6 where the 5'h amino acid, asparagine (N), was substituted
with glutamine (Q), glutamic acid (E) or serine (S). In some embodiments, an anti—4-1BB
dy or antigen-binding antibody fragment includes a heavy chain variable domain that
includes a heavy chain CDR2 that is or includes a sequence of SEQ ID NO: 6 where the 5”]
amino acid, asparagine (N), was substituted with valine (V), glycine (G), or proline (P).
In some embodiments, an anti IBB antibody or antigen-binding dy
nt includes a light chain le domain that es a light chain CDR3 that is or
includes a sequence of SEQ ID NO: 3 or 4 where the 6‘h amino acid position of LCDR3 is
mutated.
In some embodiments, an -IBB antibody or antigen-binding antibody
fragment es a heavy chain le domain that includes a heavy chain framework I (FRI)
region comprising a sequence of SEQ ID NO: l6 or 17. In some embodiments, an antiIBB
antibody or antigen-binding antibody fragment includes a heavy chain variable domain that
includes a heavy chain ork 3 (FR3) region comprising a sequence of any one of SEQ ID
NOs: 18-20. In some embodiments, an anti1BB antibody or antigen-binding antibody
fragment includes a heavy chain variable domain that includes a heavy chain framework 1 (FRI)
region comprising a sequence of SEQ ID NO: 16 or 17 and a heavy chain framework 3 (FR3)
region comprising a ce of any one of SEQ ID NOs: 18-20.
In some embodiments, an anti lBB antibody or n-binding antibody
fragment includes substantial homology to an antibody or antibody fragment that includes a
heavy chain variable domain that is or includes a sequence selected from SEQ ID NOS: I 1-14.
In some embodiments, an anti-4—IBB dy or antigen-binding antibody fragment includes a
heavy chain variable domain that is or es a sequence at least 90%, 91%, 92%, 93%, 94%,
95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4% or 99.5% identical to a sequence
selected from SEQ ID N05: 1 1-14. In some embodiments, an antiIBB antibody or antigen-
binding antibody fragment includes a heavy chain variable domain that is or includes a sequence
selected from SEQ ID NOS: 1 l-I4.
In some embodiments, an antilBB antibody or antigen-binding antibody
fragment includes substantial homology to an antibody or antibody fragment that includes a light
chain variable domain that has or includes a ce of SEQ ID NO: 9 or 10. In some
embodiments, an anti—4-1BB antibody or antigen-binding antibody fragment includes a light
chain variable domain that is or includes a sequence at least 90%, 91%, 92%, 93%, 94%, 95%,
96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.39" of SEQ ID
, 99.4% or 99.5% identical to a ce
NO: 9 or 10. In some embodiments, an anti1BB antibody or n-binding antibody
fragment includes a light chain variable domain that is or includes a sequence of SEQ ID NO: 9
or 10.
In some embodiments, an anti1BB antibody or n-binding antibody
fragment includes substantial homology to an antibody or antibody fragment that includes a
heavy chain variable domain that is or includes a sequence selected from SEQ ID NOs: I 1-14
and a light chain variable domain that is or includes a ce of SEQ ID NO: 10. In some
embodiments, an anti1BB dy or antigen-binding antibody nt includes a heavy
chain variable domain that is or includes a sequence at least 90%, 91%, 92%, 93%, 94%. 95%,
96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4% or 99.5% identical to a sequence selected
from SEQ ID NOS: 1 1-14 and a light chain le domain that is or includes a sequence at least
90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4% or
99.5% identical to a sequence ofSEQ ID NO: 10. In some embodiments, an antilBB
antibody or antigen-binding antibody fragment includes a heavy chain variable domain that is or
includes a sequence ed from SEQ 11) NOS: 1 1-14 and a light chain variable domain that is
or includes a sequence of SEQ ID NO: 10.
Amino acid sequences of anti-human 4-1BB antibody or antigen-binding
fragment binds of the present disclosure may be substituted through conservative tution.
The term “conservative substitution" used herein refers to modification of a ptide in which
one or more amino acids are substituted with an amino acid having a similar biochemical
property so as not to cause the loss of a biological or biochemical function of the corresponding
polypeptide. The term “conservative ce variant” or “conservative amino acid
substitution” used herein is the substitution of an amino acid residue with an amino acid residue
having a r side chain Amino acid residues having a similar side chain are defined in the
art. Those residues encompass amino acids with a basic side chain (e.g., lysine, arginine, and
histidine), amino acids with an acidic side chain (e.g., aspartic acid and glutamate), amino acids
with a non-charged polar side chain (e.g., glycine, asparagine, glutamine, serine, threonine,
tyrosine, and cysteine), amino acids with a non-polar side chain (cg, alanine, valine, leucine,
isoleucine, proline, phenylalanine, methionine, and tryptophan), amino acids with a beta-
branched side chain (e. g., threonine, , and isoleucine) and amino acids with an ic
side chain (e.g., tyrosine, phenylalanine, tryptophan, and ine). Therefore, it is expected
that the antibody of the t invention can have conservative amino acid substitution,
and still ensure an activity.
In some embodiments, an uman 4-1BB antibody or antigen-binding
fragment of the present disclosure may include a constant region selected from an IgGl constant
domain, an IgG2 constant domain, an IgGl/IgG2 hybrid constant , a human IgG4
constant domain, an IgA nt domain, an IgE constant domain, an lgM constant domain, and
an IgD constant domain.
In some embodiments, an anti-human 4-1BB antibody or antigen-binding
fragment of the present disclosure is or es an IgA, IgD, IgE, lgM, IgG, or variants thereof.
In some embodiments, an anti-human 4- I BB antibody of the present disclosure
includes a t Fc-region that has an amino acid mutations and/or tutions at one or more
positions of 234, 235, 236, 237, 238, 239, 253, 254, 265, 266, 267, 268, 269, 270, 288, 297, 298,
299, 307, 311, 322, 327, 328, 329, 330, 331, 332, 434 and 435.
In some embodiments, an anti-human 4-lBB dy or antigen-binding
fragment of the present disclosure is human IgG] isotype. In some embodiments, an anti-human
4-IBB antibody or antigen-binding fragment of the present disclosure includes a variant IgGl.
In some embodiments, an anti-human 4-1BB antibody or antigen-binding fragment includes an
IgGl polypeptide that has amino acid mutation at one or more positions of 233, 234, 23 5, 236,
265, 297, 329, 33] and 322.
In some embodiments, an anti-human 4-1 BB antibody or antigen—binding
fragment includes an IgGl polypeptide containing one or more mutations in L234, L235, D270,
N297, E318, K320, K322, P331 and P329. In some embodiments, an anti—human 4-lBB
antibody or antigen-binding fragment es an IgGl polypeptide containing two, three, four,
or more mutations in L234, L235, D270, N297, E318, K320, K322, P331 and P329. In some
WO 27787 PCT/lBZOlS/(Nfll043
embodiments, an anti—human 4-lBB dy or antigen-binding fragment includes an IgGl
polypeptide with mutations in L234A and L235A.
|0110| In some embodiments, an anti-human 4-1BB antibody or antigen-binding
fragment includes a light chain constant region. In some embodiments, an uman 4-lBB
antibody or antigen-binding fragment includes a kappa (K) and/or lambda 0») light chain and/or a
variant f.
In some embodiments, an anti-human 4-l BB antibody or antigen-binding
fragment is a monoclonal antibody. In some embodiments, an anti-human 4-IBB antibody or
antigen-binding fragment is a Fab fragment, a Fab' nt, a F(ab')2 fragment, a Fv fragment,
a disulftde—bonded Fv fragment, a scFv fragment, a single domain antibody, humabody,
nanobody, and/or a diabody. In some embodiments, an anti—human 4—lBB antibody or n-
binding fragment is a monovalent antibody. In some ments, an anti-human 4-lBB
antibody or antigen-binding nt is a multivalent antibody. In some embodiments, an anti-
human 4-lBB antibody or antigen-binding fragment is a multi-specific antibody (e.g., a
bispecific antibody).
In some embodiments, the present disclosure encompasses methods of modifying
the carbohydrate content of an antibody of the disclosure by adding or deleting a glycosylation
site. Methods for modifying the carbohydrate content of antibodies are well known in the art and
encompassed within the disclosure, see, e.g., US. Pat. No. 6,218,149; EP 0 359 096 B 1; US.
Publication No. US 2002/0028486; W0 835; U.S. Publication No. 2003/01 l5614; US.
Pat. No. 6,218,149; US. Pat. No. 6,472,51 1; all of which are incorporated herein by nce in
their entirety. In other embodiments, the present disclosure asses methods of modifying
the carbohydrate content of an antibody of the present disclosure by deleting one or more
endogenous carbohydrate moieties of the antibody. In a specific embodiment, the present
disclosure encompasses deleting the glycosylation site of the Fc region of an antibody, by
modifying position 297 from asparagine to alanine. In some ments, an uman 4-
188 antibody or antigen-binding fragment ses a N297A mutation in the CH2 domain. In
some embodiments, the N297A mutation results in aglycosylation, which reduces FcR or C lq
binding. In some embodiments, an anti-human 4-lBB antibody or antigen-binding fragment
comprises a heavy chain comprising an Fc region sing a N297A mutation and a K322A
mutation. In some etnbodiments. an anti-human 4—IBB antibody or antigen-binding fragment
comprises a heavy chain comprising an Fc region comprising a N297A mutation and a 0265A
mutation. In some embodiments, an anti-human 4-IBB antibody or antigen-binding nt
comprises a heavy chain comprising an Fc region comprising a N297A mutation, at 0265A
mutation, and a K322A mutation. In some ments, an anti—human 4—lBB antibody or
antigen-binding fragment ses an Fc region with a L234A mutation and/or a L23 5A
mutation. In some embodiments, an anti-human 4-1 BB antibody or antigen-binding fragment
comprises an Fc region with one or more mutations selected from L234A—, L23 5A, N297A,
D265A, and K322A. In some ments, an anti—human 4-1BB antibody or antigen-binding
fragment comprises Fc region with two or more mutations selected from L234A—, L23 5A,
N297A, D265A, and K322A. In some ments, an anti-human 4-lBB antibody or antigen-
binding fragment comprises Fc region with three, four, or five mutations selected from L234A~,
L235A, N297A, D265A, and K322A.
|0113| Engineered glycoforms may be useful for a variety of purposes, including but not
limited to enhancing or reducing effector function. Engineered glycofonns may be generated by
any method known to one skilled in the art, for example by using engineered or variant
expression s, by co-expression with one or more enzymes, for example Dl N-
acetylglucosaminyltransferase III (GnTIl 1), by expressing a molecule comprising an Fc region
in various organisms or cell lines from various organisms, or by modifying ydrate(s) after
the molecule comprising Fc region has been expressed. Methods for generating engineered
glycoforms are known in the art, and include but are not limited to those described in Umana et
al, 1999, Nat. Biotechnol 172176-180; Davies et al., 20017 Biotechnol Bioeng 742288-294;
Shields et a1, 2002, J Biol Chem 277:26733-26740; Shinkawa et al., 2003, J Biol Chem
278:3466-3473) US. Pat. No. 6,602,684; US. Ser. No. 10/277,370; US. Ser. No. 10/] 13,929;
PCT W0 00/61739A1; PCT W0 01/292246A1; PCT W0 02/31 1 140A]; PCT W0 54A1;
POTILLEGENTTM technology (Biowa, Inc. Princeton, N.J.); ABTMglycosylation
engineering technology RT biotechnology AG, Zurich, Switzerland); each of which is
incorporated herein by reference in its entirety. See, e.g., W0 39; EA01229125; US
200301 15614; Okazaki et a1., 2004, JMB, 336: 1239-49 each of which is incorporated herein by
reference in its entirety.
In some ments, an anti-human 4— 1 BB antibody or antigen—binding
fragment of the present disclosure is as an agonist for human 44 BB.
In some embodiments, an anti-human 4-1BB antibody or antigen—binding
fragment of the present sure binds to a human 4-1 BB molecule. In some embodiments, an
anti-human 4-IBB antibody or antigen-binding fragment of the present disclosure specifically
binds to a human 4-1 BB molecule.
In some embodiments, an anti-human 4- 1 BB antibody or antigen-binding
fragment binds to a sequence that is or includes that of SEQ ID NO: 15. In some embodiments,
an anti-human 4-lBB dy or antigen-binding fragment binds to an epitope of 4-lBB
extracellular domain that is or es a sequence of SEQ ID NO: 15.
|01|7| In some embodiments, binding of an anti-human 4-IBB antibody or antigen-
binding fragment of the present disclosure with human 4-1 BB extracellular domain is abrogated
by one or more mutations of SEQ ID NO: 44 selected from N30, D38, N39, R41, A56, G57, R60
or T61,
In some embodiments, an anti-human 4-1BB antibody or antigen-binding
fragment of the present disclosure binds to a human 4-l BB molecule with a binding affinity
(KB) of lx lO‘7 to lxlO'” M. In some embodiments, an anti-human 4-lBB antibody or n-
binding fragment of the present disclosure binds to a human 4-l BB molecule with a binding
affinity (KD) of lxlO'“ to 1x 10'12 M. Binding affinity (KD) may be measured, for e, by
surface plasmon resonance, for example, using a BIACORE .
In some embodiments, an anti-human 4-1BB antibody or antigen-binding
nt of the present disclosure binds to a human 4-lBB le or a fragment thereof at a
binding affinity (KB) of less than l,0><10'R M. In some embodiments, an anti-humanized 4- lBB
antibody or antigen-binding fragment of the present disclosure binds to a human 4-lBB molecule
or a nt thereof at a binding affinity (KD) of less than 1.0><IO"’ M. In some embodiments,
an anti-humanized 4- lBB antibody or n-binding fragment of the present disclosure binds
to a human 4-lBB molecule or a fragment f at a binding affinity (K0) ofless than LONG
|0120| In some embodiments, an anti—4- 1 BB antibody or antigen-binding fragment of the
present disclosure fails to bind or weakly binds a non-primate 4—lBB polypeptide (e.g., a canine,
mouse and rat 4~IBB polypeptide). In some embodiments, an anti1BB antibody or antigen—
binding fragment of the present sure binds efficiently to human or monkey 4-lBB. This
binding affinity suggests that the structure and/or sequence of epitope for a primate 4-IBB
antibody may be quite different from canine, mouse and rat.
|0121| In some embodiments, an anti-human 4-lBB antibody or n-binding
fragment of the present disclosure is an agonistic antibody. In some embodiments, an anti-
human 4-lBB antibody or antigen-binding fragment of the present disclosure mediates T cell
activation. In some embodiments, an anti-human 4-1BB antibody or antigen-binding fragment
of the present disclosure binds CD8? and/or CD4“ T cells expressing human 4-IBB_
In some embodiments, an anti-human 4-lBB antibody or antigen-binding
fragment of the present disclosure does not have or has low ADCC activity. In some
embodiments, an anti-human 4- IBB antibody or antigen-binding fragment of the present
disclosure does not have or has low CDC activity. In some embodiments, an anti-human 4—l BB
antibody or antigen-binding fragment of the present disclosure does not have or has low ADCC
ty and CDC activity. In some embodiments, an anti-human 4-1BB antibody or antigen-
binding fragment of the present disclosure has an ADCC cell killing activity of less than about
less than about 20%, less than about l0°/o, less than about 8%, or less than about 5%. In some
embodiments, an anti-human 4-l BB antibody or antigen-binding fragment of the present
disclosure has an ADCC cell killing activity of less than about l0°/o. In some embodiments, an
anti-human 44 BB antibody or antigen-binding nt ofthe t sure has a CDC
cell killing ty of less than about 30%, less than about 20%, less than about 109/6, less than
about 8%, or less than about 59/6. In some embodiments, an uman 4-IBB dy or
antigen-binding fragment of the present disclosure has a CDC cell killing activity of less than
about 20%.
In some embodiments, an uman 4-lBB antibody or antigen-binding
fragment of the present disclosure is characterized by low toxicity (e.g, a low degree of post
administration cell death). In some ments, an anti-human 4-lBB antibody or antigen-
binding fragment of the present disclosure is characterized by low hepatoxicity. In some
ments, a subject that has been administered an anti—human 4-IBB antibody or antigen-
binding fragment of the present disclosure at a therapeutic dose has levels of one or more of
ALT, AST and total bilirubin in a normal range. In some ments, an uman 4-1BB
antibody or antigen-binding fragment ofthe present disclosure is characterized by an ability to
treat ts for extended periods with measurable alleviation of symptoms and low and/or
acceptable toxicity. Low or acceptable immunogenicity and/or high affinity, as well as other
suitable properties, can contribute to the therapeutic results ed. "Low immunogenicity" is
defined herein as raising significant HAHA, HACA or HAMA responses in less than about 75%,
or preferably less than about 50% of the patients treated and/or raising low titres in the patient
treated (Elliott et al., Lancet 344:] 125—1 127 (1994), entirely incorporated herein by reference).
Nucleic Acids
The sure provides polynucleotides comprising a nucleotide sequence
encoding uman 4-lBB antibodies of the present disclosure and fragments thereof. Anti-
human 4-IBB antibodies and nts thereof as described herein may be produced from
nucleic acid molecules using molecular biological methods known to the art. Nucleic acids of
the present disclosure include, for example, DNA and/or RNA.
In some embodiments, nucleic acid constructs include regions that encode an anti-
human 4-1BB antibody or fragment thereof (e.g., 94K, 94KV, 94KVT, EUlOl). In some
embodiments, such antibodies or fragments thereof will include VH and/or VL regions. An anti-
human 4-1BB antibody or fragment f may be identified and/or selected for a desired
binding and/or functional properties, and variable regions of said dy isolated, amplified,
cloned and/or ced. Modifications may be made to the VH and VL nucleotide sequences,
including additions of nucleotide sequences encoding amino acids and/or canying restriction
sites, and/or substitutions of nucleotide sequences encoding amino acids. In some embodiments,
a nucleic acid sequence may or may not include an intron sequence.
Where appropriate, nucleic acid sequences that encode anti-human 4- 1 BB
dies and fragments thereof (e.g., 94K, 94KV, 94KVT, EUlOl) may be modified to include
codons that are optimized for expression in a particular cell type or organism (e.g., see US.
Patent No. 5,670,356 and US. Patent No. 5,874,304). Codon optimized sequences are tic
sequences, and preferably encode the identical polypeptide (or a biologically active nt of a
full length polypeptide which has substantially the same activity as the full length polypeptide)
d by the non-codon optimized parent polynucleotide. In some embodiments, the coding
region of the genetic material encoding dy ents, in whole or in part, may include
an altered sequence to optimize codon usage for a particular cell type (e.g., a eukaryotic or
prokaryotic cell). For example, a coding ce for a humanized heavy (or light) chain
variable region as described herein may be optimized for expression in a bacterial cells.
Alternatively, the coding sequence may be optimized for expression in a ian cell (_e.g., a
CHO cell). Such a sequence may be described as a codon-optimized sequence.
Nucleic acid constructs of the present disclosure may be inserted into an
expression vector or viral vector by methods known to the art, and nucleic acid molecules may
be ly linked to an expression control sequence. A vector comprising any of the above-
described nucleic acid molecules, or fragments thereof, is further provided by the present
disclosure. Any of the above nucleic acid molecules, or nts thereof, can be cloned into
any suitable vector and can be used to transform or transfect any suitable host. The selection of
vectors and methods to construct them are commonly known to persons of ry skill in the
art and are described in general technical references (see, in general, binant DNA Part
D,” Methods in Enzymology, Vol. 153, Wu and Grossman, eds, Academic Press (1987)).
In some embodiments, conventionally used techniques, such as, fore example.
electrophoresis, calcium phosphate precipitation, extran transfection, lipofection, etc.
may be used to introduce a foreign nucleic acid (DNA or RNA) into a prokaryotic or otic
host cell. Desirably, a vector may include regulatory ces, such as transcription and
translation initiation and ation codons, which are specific to the type of host (e.g.,
bacterium, fimgus, plant or animal) into which the vector is to be introduced, as appropriate and
taking into consideration whether the vector is DNA or RNA. In some embodiments, a vector
comprises regulatory sequences that are c to the genus of the host. Preferably, a vector
comprises tory sequences that are specific to the species of the host.
In addition to the replication system and the inserted nucleic acid, a c acid
construct can include one or more marker genes, which allow for selection of ormed or
transfected hosts. Marker genes include biocide resistance, e.g., resistance to antibiotics, heavy
metals, etc., complementation in an ophic host to provide prototrophy, and the like.
Suitable vectors include those designed for propagation and expansion or for
expression or both. For e, a cloning vector is selected from the group consisting of the
pUC series, the pBluescript series (Stratagene, LaJolla, Calif), the pET series (Novagen,
Madison, Wis), the pGEX series (Pharmacia Biotech, Uppsala, Sweden), and the pEX series
(Clontech, Palo Alto, Calif). Bacteriophage vectors, such as XGTIO, kGTl l, kZapII
(Stratagene), XEMBL4, and KNM] 149, also can be used. Examples of plant expression vectors
include pBll 10, pBllOl .2, pBIlOl .3, pBIlZl and pBlNl9 ech). Examples of animal
expression vectors include pEUK-C l and pMAMneo (Clontech). The TOPO cloning
, pMAM
system (lnvitrogen, Carlsbad, Calif.) also can be used in ance with the manufacturer's
recommendations.
An sion vector can comprise a native or nonnative promoter operably
linked to an isolated or purified nucleic acid molecule as described above. Selection of
promoters, e.g., strong, weak, inducible, -specific and developmental-specific, is within the
skill in the art. Similarly, combining of a nucleic acid molecule, or fragment thereof, as bed
above with a promoter is also within the skill in the art.
Suitable viral vectors include, for example, retroviral vectors, parvovirus-based
vectors, e.g., adeno-associated virus (AAV)-based vectors, AAV—adenoviral chimeric vectors,
and adenovirus—based vectors, and lentiviral vectors, such as Herpes x (HSV)-based
vectors. These viral vectors can be prepared using standard inant DNA techniques
described in, for example, Sambrook et al., lar Cloning, a Laboratory Manual, 2d
edition, Cold Spring Harbor Press, Cold Spring Harbor, NY. (1989); and Ausubel et al., Current
Protocols in Molecular Biology, Greene Publishing Associates and John Wiley & Sons, New
York, NY. (1994).
A retroviral vector is derived from a retrovirus. Retrovims is an RNA virus
capable of infecting a wide variety of host cells. Upon infection, the retroviral genome integrates
into the genome of its host cell and is ated along with host cell DNA, thereby constantly
ing viral RNA and any nucleic acid sequence incorporated into the retroviral genome. As
such, long-term sion of a therapeutic factor(s) is achievable when using irus.
Retroviruses contemplated for use in gene therapy are relatively non-pathogenic, although
pathogenic retroviruses exist. When employing pathogenic retroviruses, e.g., human
immunodeficiency virus (HIV) or human T-cell lymphotrophic s (HTLV), care must be
taken in altering the viral genome to eliminate toxicity to the host. A retroviral vector
additionally can be manipulated to render the virus replication-deft cient. As such, iral
vectors are considered particularly useful for stable gene transfer in viva. Lentiviral vectors, such
as HIV-based vectors, are exemplary of retroviral vectors used for gene delivery. Unlike other
retroviruses, HIV-based vectors are known to incorporate their passenger genes into non-
dividing cells and, therefore, can be of use in ng persistent forms of disease.
Additional sequences can be added to such cloning and/or expression sequences
to optimize their function in cloning and/or expression, to aid in isolation of the polynucleotide,
or to improve the introduction of the polynucleotide into a cell. Use of g vectors,
expression vectors, rs, and linkers is well known in the art. (See, e.g., Ausubel, supra; or
Sambrook, supra).
[0135'] In some ments, nucleic acids and vectors of the present disclosure may be
ed and/or purified. The present disclosure also provides a composition comprising an
described isolated or d nucleic acid molecule, optionally in the form of a vector.
Isolated nucleic acids and vectors may be prepared using standard techniques known in the art
including, for example, alkali/SDS treatment, CsCl binding, column chromatography, agarose
gel electrophoresis and other ques well known in the an. The composition can comprise
other components as described further herein.
In some embodiments, nucleic acid molecules are inserted into a vector that is
able to express an anti-human 4-lBB antibody or fragment thereof when introduced into an
appropriate host cell. Appropriate host cells include, but are not limited to, bacterial, yeast,
insect, and mammalian cells. Exemplary host cells e prokaryotes (e.g., I}. coli) and
eukaryotes (e.g., a COS or a CHO cell). Mammalian host cells that could be used include human
Hela 293, H9 and Jurkat cells, mouse NIH3T3 and C 127 cells, Cos l, Cos 7 and CV l, quail
QCl-3 cells, mouse L cells and e hamster ovaiy (CHO) cells (e.g., DG44 cells). In some
embodiments, a mammalian host cell suitable for the expression of the antibody may be a
Chinese Hamster Ovary ('CHO) cell (for example, ing DHFR-CHO cells used along with a
DHFR-selectable marker), an NSO myeloma cell, a COS cell or an SP2 cell.
Any (s) known to one skilled in the art for the insertion of DNA fragments
into a vector may be used to uct expression vectors encoding an anti-human 4-lBB
antibody or fragment thereof of the present disclosure under control of transcriptional/
translational control s. These methods may include in vitro recombinant DNA and
synthetic techniques and in viva recombination (See, e.g., Ausubel, supra; or Sambrook, supra).
Production of Antibodies
Antibodies and n-binding nts of the t invention may be
prepared and/or purified by any technique known in the art, which allows for the subsequent
formation ofa stable antibody or antibody fragment.
A nucleic acid ng an anti-human 4-l BB antibody and/or antigen-binding
fragment of the present disclosure may be easily ed and sequenced by conventional
procedures. For example, an ucleotide primer designed to specifically amplify
ponding heavy chain and light chain-coding regions from a hybridoma or phage template
DNA may be used. ed nucleic acids may be inserted into an expression vector, and then
desired monoclonal antibodies may be produced from a suitable host cell (that is, transformant)
transformed by introducing the expression vector to the host cell. In some embodiments, a
method for preparing anti -human 4-1 BB antibody and/or antigen—binding fragment of the present
sure may include amplifying an expression vector including a nucleic acid encoding the
antibody, but is not d thereto.
In some embodiments, a host cell is eukaryotic host cell, including, for example,
yeast, higher plant, insect and mammalian cells. Depending upon the host employed in a
recombinant production procedure, antibodies and antibody fragments of the t disclosure
can be glycosylated or can be non-glycosylated. In some embodiments, a recombinant
expression vector encoding an anti-human 4-lBB antibody and/or antigen-binding fragment of
the t disclosure is introduced into a mammalian host cell and an antibody may be prepared
by culturing the host cell for a sufficient time to s the antibody. In some embodiments, a
mammalian host cell is cultured for a sufficient time to secrete an antibody or antibody fragment
of the present disclosure in a culture medium.
In some embodiments, an sed antibody of the present disclosure may be
uniformly purified after being isolated from the host cell. Isolation and/or ation of an
antibody of the present disclosure may be performed by a conventional method for isolating and
purifying a protein. For example, not wishing to be bound by theory, an anti-human 4—lBB
antibody and/or antigen—binding fragment of the present disclosure can be recovered and purified
from inant cell cultures by well-known methods including, but not limited to, protein A
purification, protein G purification, ammonium sulfate or ethanol precipitation, acid extraction,
anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic
interaction chromatography, affinity chromatography, hydroxylapatite chromatography and
lectin chromatography. High performance liquid chromatography ") can also be
employed for purification. See, e.g., Colligan, Current Pro/owls in Immunology, or Current
Protocols in Protein Science, John Wiley & Sons, NY, N.Y., (1997-2001), e.g., chapters 1, 4, 6,
8, 9, and 10, each entirely incorporated herein by reference. In some embodiments, an antibody
of the present disclosure may be isolated and/or purified by additionally combining filtration,
superfiltration, salting out, dialysis, etc.
Purified anti-human 4-IBB antibodies and/or antigen-binding fragments of the
present disclosure can be characterized by, for example, ELISA, T, flow cytometry,
immunocytology, BlACORETM analysis, SAPIDYNE KINEXATM c exclusion assay, SDS-
PAGE and Western blot, or by HPLC analysis as well as by a number of other functional assays
disclosed herein.
Therapeutic Applications
The present disclosure encompasses a recognition that engineered anti-human 4-
lBB antibodies and antigen-binding fragments may be useful for sis, prevention, and/or
treatment of certain diseases such as, for example, cancer. Any of the antilBB antibodies or
antigen-binding fragments provided herein may be used in therapeutic methods. For example, an
antil BB antibody or antigen-binding fragment of the present disclosure can be used as
immunotherapeutic agents, for example in the treatment of a malignant disease (e.g, cancer).
The present disclosure provides methods for ng and/or preventing a
malignant disease, said methods including administering an anti1BB antibody or antigen-
binding fragment of the t disclosure to a subject. s for modulating or treating at
least one malignant disease in a cell, tissue, organ, animal or patient, include, but are not limited
to, cancer and/or and the treatment of matory diseases.
Cancer treatments in the context of the present disclosure may be mediated
through increasing xic T cells and anti-cancer cytokines. Generally, antigen-specific cell-
mediated immunity is caused by cytotoxic T cells, and includes two signaling : a first
signaling event is induced when a T cell recognizes an antigen from an antigen-presenting cell
via a or, and a second signaling is d by co—stimulatory les. Due to the first
and second stimuli, T cell activity and related factors are increased, thereby g T cells
specifically functioning in cancer ent, and the formed T cells are increased in cytotoxicity,
cell division, cell viability and anti-cancer cytokine secretion due to stimulation with the co-
stimulatory molecules.
Specifically, it has been demonstrated that stimulation by 4-lBB can e the
activity of CD8' T cells, increase secretion of anti-cancer cytokines such as interferon gamma
(IFNy), se expression of anti-apoptotic molecules such as Bel-2, BchL and Bfl—l, and/or
inhibits activation-induced cell death (AICD). In some embodiments, an anti-human 4-lBB
antibody or antigen-binding fragment of the present disclosure can enhance or increase one or
more of CD8‘ T cell activity, secretion of anti-cancer nes such as interferon gamma
(lFNy), expression of anti-apoptotic molecules such as Bel-2, BchL and Bfl-l, and inhibition of
activation-induced cell death (AICD). In some embodiments, therapeutic treatment with an anti-
human 4-lBB antibody or antigen-binding nt of the present sure can reduce and/or
inhibit growth of cancer cells.
In some embodiments, the present disclosure provides a method for delaying or
inhibiting tumor growth, comprising regulation of cytokine secretion in vivo or in vilro by
administering an anti-human 4-1 BB antibody or antigen-binding fragment of the present
disclosure. l n some embodiments, the present disclosure es a method for reducing tumor
burden, comprising regulation of cytokine secretion in vivo or in vilro by administering an anti-
human 4- 1 BB antibody or antigen-binding fragment of the present disclosure.
In some embodiments, the t disclosure provides a method for treating
cancer or tumor by monitoring to a biological subject of cancer or tumor to be treated,
sing: (i) strating an anti-human 4-1BB antibody or antigen-binding fragment of the
present disclosure to a subject, (ii) separating then isolating a biological sample from the t,
(iii) measuring a secretion amount of INFy or TGFB from the sample and ting a proportion
ratio and (iv) ining a therapeutically effective amount of the antibody or antigen-binding
fragment thereof by comparing the control samples which are administrated or not administrated
with the anti-human 4-lBB antibody or antigen-binding fragment thereof.
In some embodiments, the present disclosure provides a method of treating a
subject in need f, the method comprising a step of administering to the subject a
composition that comprises or delivers an antilBB dy or antigen-binding fragment of
the present disclosure and/or a nucleic acid the same. In some embodiments, a subject has or is
at risk for developing cancer. In some ments, the present disclosure provides a method
W0 27787 PCT/lBZOIS/(llltl043
for preventing or treating cancer or tumor of a patient, which includes administering a
therapeutically effective amount of the humanized 4-lBB antibody or the antigen-binding
fragment thereof to a patient with cancer or tumor.
In some ments, the present disclosure provides a method of inducing an
immune response in a subject in need thereof, the method comprising a step of administering to
the subject a composition that comprises or delivers an antilBB antibody or antigen-binding
fragment of the present disclosure and/or a nucleic acid the same. In some embodiments, a
subject has or is at risk for ping cancer.
[0151[ In some embodiments, the present disclosure provides a method of enhancing an
immune response or increasing the activity of an immune cell in a subject in need thereof, the
method comprising a step of administering to the subject a composition that comprises or
rs an anti 1 BB antibody or n-binding fragment of the present disclosure and/or a
nucleic acid the same. In some embodiments, a subject has or is at risk for developing cancer.
Cancers le for treatment with method of the present disclosure can e,
but are not limited to, bladder cancer, breast cancer, cervical cancer, colon cancer, endometrial
cancer, esophageal cancer, fallopian tube cancer, gall bladder cancer, gastrointestinal ,
head and neck cancer, hematological cancer, laryngeal cancer, liver cancer, lung cancer,
lymphoma, melanoma, elioma, ovarian cancer, primary peritoneal cancer, salivary gland
cancer, sarcoma, stomach cancer, thyroid cancer, pancreatic cancer, and prostate cancer. In
some embodiments, a cancer for ent with an antiIBB antibody or antigen-binding
fragment of the present disclosure may include, but is not d to, oma, lymphoma (e.g.,
Hodgkin’s and non-Hodgkin’s lymphomas), blastoma, sarcoma and leukemia. In some
embodiments, cancer may include squamous cell carcinoma, small cell lung cancer, all
cell lung cancer, lung adenocarcinoma, squamous cell carcinoma of the lung, peritoneal cancer,
hepatocellular carcinoma, gastric cancer. pancreatic cancer, glioma, cervical cancer, ovarian
cancer, liver cancer, bladder cancer, hepatocellular carcinoma, breast cancer, colon cancer,
colorectal , endometrial or uterine carcinoma, salivary oma, kidney cancer, prostate
cancer, vulvar cancer, thyroid cancer, liver carcinoma, leukemia and other proliferative
disorders, and s types of head and neck cancer.
A composition including an antilBB antibody or antigen-binding fragment of
the present disclosure may be administered at a ceutically effective amount to treat cancer
cells or metastasis thereof, or inhibit the growth of cancer. For use in eutic methods, an
anti1BB antibody or antigen-binding fragment of the present disclosure would be formulated,
dosed, and stered in a fashion consistent with good l ce. Factors for
consideration in this context e the particular disorder being treated, the particular mammal
being d, the clinical condition of the individual patient, the age of the patient, the weight of
the patient, the cause of the disorder, the site of delivery of the agent, the method of
administration, the scheduling of administration, and other factors known to medical
practitioners.
|0154| The present disclosure es high afi'mity anti-human 4-lBB dies that
may have superior properties relative to a reference antibody. The present disclosure
encompasses a recognition that these antibodies may have improved ability to induce T cell
activation and/or secretion of cytokines such as IFNy. Accordingly, the present disclosure
encompasses a recognition that an anti-human 4-lBB antibody or antigen binding fragment of
the present sure may be administered a dose lower than reference antibody.
In some embodiments composition that includes an antilBB antibody or
antigen—binding fragment of the t disclosure may be administered to a patient as a bolus or
by continuous injection when . In some embodiments, bolus administration is of an anti-
4-1 BB Fab of the present sure and may be administered at a dose of 0.0025 to 100 mg/kg,
0.025 to 0.25 mg/kg, 0.010 to 0.10 mg/kg, or 0.10 to 0.50 mg/kg. 1n the case ofthe continuous
injection, the antibody of the present invention presented as a Fab nt may be administered
at a dose of0.001 to 100 mg/kg/min, 0.0125 to 1.25 mg/kg/min, 0.010 to 0.75 mg/kg/min, 0.010
to 1.0 mg/kg/min or 0.10 to 0.50 mg/kg/min for 1 to 24 hours, 1 to 12 hours, 2 to 12 hours, 6 to
12 hours, 2 to 8 hours, or 1 to 2 hours. In some embodiment, an antibody of the present
disclosure is a full~length antibody (having a complete constant domain). In some embodiments,
a full-length antibody is administered at a dose of approximately 0.01 to 10 mg/kg, 1 to 8 mg/kg,
or 2 to 6 mg/kg. In some embodiments, a full-length antibody is administered by injection for 30
to 35 s. Administration ncy may vary depending on the severity of a condition. For
example, the frequency may be once every 2 to 7 days, once a week, or once every I, 2, 3 or 4
weeks.
In some embodiments, a composition may be administered to a patient by
subcutaneous injection. Specifically, the antibody may be administered to a patient at a dose of
0.1 to 100 mg by aneous injection once every 2 to 7 days, every week, once every two
weeks, or every month.
Combination Therapies
The present disclosure provides therapeutic methods that include administration
of an anti-human 4-1BB dy or antigen-binding fragment of the present disclosure in
ation with one or more other therapies.
In some embodiments, an anti-human 4—lBB antibody or antigen-binding
fragment is administered in combination with one or more therapies that have been approved for
treatment of cancer. For example, combination treatment of with an anti 1 BB antibody and a
conventional chemotherapeutic, cisplatin, has been shown to have synergistic activity in tumor
killing and prevention of organ-specific toxicity—. (Kim et al., Cancer Research (2008)
68( l 8): 7264-9)
In some embodiments, an anti-human 4-IBB antibody or antigen-binding
fragment of the present disclosure is administered in combination with a second therapy selected
from an immune checkpoint inhibitor, eukin 12 (IL-12), Granulocyte-macrophage colony-
ating factor (GM-C SF), an anti-CD4 agent, and a chemotherapeutic agent, such that the
subject receives treatment with both.
In some embodiments, an anti-human 4-1BB antibody or antigen-binding
fragment of the t disclosure is administered to a t that been administered or will be
administered a composition comprising a chemotherapeutic agent, such that the t receives
treatment with both. Therapeutic methods of the present disclosure may include stration
of any chemotherapeutic agent known in the an. In some ments, chemotherapeutic agent
is stered to a subject that been administered or will be administered a composition
comprising an anti-human 4-lBB antibody or antigen—binding fragment.
In some embodiments, an anti-human 4-1BB antibody or antigen—binding
fragment is stered to a subject that been administered or will be administered a
composition comprising fluorouracil. In some embodiments, fluorouracil is administered to a
subject that been administered or will be administered a composition comprising an anti—human
4-1BB antibody or antigen-binding fragment. In some ments, an anti-human 4-lBB
antibody or antigen-binding fragment is stered to a subject that been administered or will
be administered a composition comprising doxorubicin. In some embodiments, doxorubicin is
administered to a subject that been administered or will be administered a composition
comprising an anti-human 4-lBB dy or antigen-binding fragment. In some embodiments
an anti-human 4-IBB antibody or antigen-binding fragment is administered to a subject that been
administered or will be administered a composition comprising irinotecan. In some
embodiments, irinotecan is administered to a subject that been administered or will be
administered a composition comprising an anti-human 4-IBB antibody or antigen—binding
fragment. In some ments, an anti-human 4-IBB antibody or antigen-binding fragment is
administered to a subject that been administered or will be administered a composition
comprising paclitaxel. In some ments, paclitaxel is administered to a subject that been
administered or will be stered a composition comprising an anti-human 4—IBB antibody
or antigen-binding nt,
In some embodiments, an uman 4-lBB antibody or antigen-binding
fragment is administered to a subject that been administered or will be administered a
composition comprising cisplatin. In some embodiments, cisplatin is administered to a subject
that been administered or will be administered a composition sing an anti-human 4-lBB
antibody or antigen-binding fragment. In some embodiments, an anti-human 4-IBB antibody or
antigen-binding fragment is administered to a subject that been administered or will be
administered a composition sing cyclophosphamide. In some embodiments,
cyclophosphamide is administered to a t that been administered or will be stered a
composition comprising an anti-human 4— 1 BB dy or antigen-binding fragment.
In some embodiments, an anti-human 4-IBB antibody or antigen-binding
fragment of the present disclosure is administered to a subject that been administered or will be
administered a composition sing GM-CSF, such that the subject receives treatment with
both. In some embodiments, GM-CSF is administered to a subject that been administered or will
be administered a composition comprising an anti-human 4-lBB antibody or antigen-binding
fragment.
In some embodiments, an anti-human 4-1BB antibody or antigen-binding
fragment of the present disclosure is administered to a subject that been administered or will be
W0 27787 PCT/lBZOlS/(NIO043
administered a composition comprising IL-IZ, such that the subject receives treatment with both.
In some embodiments, IL-12 is administered to a subject that been administered or will be
administered a composition comprising an anti-human 4-IBB antibody or antigen-binding
fragment.
In some embodiments, an anti—human 4-lBB antibody or antigen-binding
fragment of the present disclosure is administered to a subject that been stered or will be
administered a composition comprising an anti-CD4 agent, such that the subject receives
treatment with both, In some ments, an anti-CD4 agent is administered to a t that
been administered or will be administered a composition comprising an anti-human 4~lBB
dy or antigen-binding fragment.
In some embodiments, an anti-human 4-]BB antibody or antigen-binding
fragment of the present disclosure is administered to a subject that been administered or will be
administered a composition comprising a checkpoint inhibitor (e.g., an immune checkpoint
inhibitor), such that the subject receives treatment with both. In some embodiments, an immune
oint inhibitor is administered to a t that been administered or will be administered a
composition comprising an uman 4-] BB antibody or antigen-binding fragment.
A checkpoint tor used in ation with an anti-human 4—1BB antibody
or anti gen-binding fragment of the present disclosure can be, for example, any immune
checkpoint inhibitor. Examples of inhibitory checkpoint molecules include A2AR, B7-H3, B7-
H4, BTLA, CTLA—4, CD277, IDO, KIR, PD-l, LAG-3, TIM-3, TIGIT and VISTA. An immune
checkpoint inhibitor may refer to any compound that ts the function of an immune
inhibitory checkpoint protein. Inhibition includes ion of function and full blockade. In
some embodiments, an immune checkpoint inhibitor is an antibody that specifically recognizes
an immune checkpoint protein. A number of immune checkpoint inhibitors are known and in
analogy of these known immune checkpoint n inhibitors, ative immune checkpoint
inhibitors may be developed in the (near) future. Immune checkpoint inhibitors include, but are
not limited to, peptides, antibodies, nucleic acid molecules and small molecules.
In some embodiments, an immune checkpoint inhibitor is an inhibitor of CTLA—
4. In some embodiments, a checkpoint inhibitor is an antibody that targets CTLA—4, such as, for
example, ipilimumab. In some embodiments, a checkpoint inhibitor targets CD366, which is a
transmembrane protein also known as T cell immunoglobulin and mucin domain containing
protein—3 (TIM-3). In some embodiments, an immune checkpoint inhibitor is an agent that
inhibits PD-l signaling.
[0l69l PD-l (i.e. programmed cell death n-l), is a protein that is distributed on the
surface of an immune cell such as a T or B cell and is also known as CD279. In a human, PD—l
is expressed by a PDCDI gene located at the 2p37.3 position on chromosome 2. PD-l is known
to bind two ligands, PD-Ll and PD-LZ.
In some embodiments, an D-l agent is administered to t who is
receiving, has received or will e treatment with an anti-human 4-] BB antibody or antigenbinding
fragment of the t disclosure. In some certain embodiments, an anti-human 4-IBB
antibody or antigen-binding fragment of the present disclosure is administered to patient who is
receiving, has received or will receive treatment with an anti-PD-l agent.
In some embodiments, an anti-PD-Ll agent is administered to patient who is
receiving, has received or will receive treatment with an anti-human 4—IBB antibody or antigenbinding
fragment of the present disclosure. In some certain embodiments, an anti-human 4-] BB
antibody or antigen-binding fragment of the present disclosure is administered to patient who is
receiving, has received or will receive treatment with an anti-PD-Ll agent. In some
embodiments, agents that inhibit PD-Ll include, for example, AMP-244, 736,
MPDL328 0A, MIl-Il.
In some embodiments, an anti-PD-l agent is an agent that inhibits PD-l. In some
embodiments, an anti-PD-l agent is an agent that inhibits PD-Ll and/or PD-LZ. In some
embodiments, an antibody agent that ts PD-I signaling is a onal antibody or a
fragment f. In some embodiments, an antibody agent that inhibits PD~1 signaling is an
anti~PD~l antibody or fragment thereof.
In some ments, an anti-PD-I antibody is administered to patient who is
receiving, has ed or will receive treatment with an anti-human 4-l BB dy or n—
binding fragment of the present disclosure. In some certain embodiments, an uman 4—IBB
antibody or antigen—binding fragment of the t disclosure is administered to patient who is
receiving, has received or will receive treatment with an anti-PD-l antibody. Anti-PD~I
antibodies include, for example, nivolumab, pembrolizumab, atezolizumab, durvalumab, and
W0 27787 PCT/lBZOIS/(l00043
avelumab. olizumab (Keytruda, Merck) is an antibody therapeutic that inhibits PD-I
activity.
As described in the Examples of the present application, administration of an anti-
human 4-lBB antibody or antigen-binding fragment of the present disclosure in ation
with an anti-PD-l antibody may enhance efficacy relative to either treatment alone, and further
may also reduce tionally known side effects.
In some certain embodiments, pembrolizumab is administered to patient who is
receiving, has received or will receive ent with an anti-human 4—l BB antibody or antigenbinding
fragment ofthe present disclosure. In some certain embodiments, an anti—human 4-l BB
antibody or antigen-bi nding fragment of the present disclosure is administered to patient who is
receiving, has received or will e ent with pembrolizumab.
In some embodiments, an immune checkpoint tor (cg, an anti-PD-l agent)
is administered to a patient in an amount of from about 0.01 mg/kg to about 100 mg/kg. In some
embodiments, an immune checkpoint inhibitor (e.g., an anti-PD-I agent) is administered to a
patient in an amount within a range bounded by a lower limit and an upper limit, the upper limit
being larger than the lower limit. In some embodiments, the lower limit may be about 0.01
mg/kg, 0.025 mg/kg, 005 mg/kg, 0.075 mg/kg, 0.] mg/kg, 0.25 mg/kg, 0.5 mg/kg, 0.75 mg/kg, I
mg/kg, 2 mg/kg, 3 mg/kg, 4 mg/kg, 5 mg/kg, 8 mg/kg, 10 mg/kg, 20 mg/kg, 25 mg/kg, 30
mg/kg, 40 mg/kg, 50 mg/kg, 50 mg/kg, 70 mg/kg, 80 mg/kg, or 90 mg/kg. In some
embodiments, the upper limit may be about 0.025 mg/kg, 0.05 mg/kg, 0.075 mg/kg, 0.1 mg/kg,
0.25 mg/kg, 0.5 mg/kg, 0.75 mg/kg, l mg/kg, 2 mg/kg, 3 mg/kg, 4 mg/kg, 5 mg/kg, 8 mg/kg, l0
mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 40 mg/kg, 50 mg/kg, 50 mg/kg, 70 mg/kg, 80 mg/kg, 90
mg/kg, or l00 mg/kg. In some embodiments, an immune checkpoint inhibitor (e.g., an anti—PD-l
agent) may be administered to a patient in an amount of from about I mg/kg to about 20 mg/kg,
from about 1 mg/kg to about 10 mg/kg, from about 1 mg/kg to about 5 mg/kg, from about 2
mg/kg to about 5 mg/kg, from about 2 mg/kg to about 4 mg/kg, from about 3 mg/kg to about 5
mg/kg, or from about 3 mg/kg to about 4 mg/kg. In some embodiments, an immune checkpoint
inhibitor (e.g., an anti-PD—l agent) may be administered to a patient in an amount of about I
mg/kg, about 2 mg/kg, about 3 mg/kg, about 4 mg/kg, or about 5 mg/kg.
In some embodiments, treatment with a ation of an immune checkpoint
inhibitor and an anti-human 4-IBB antibody or n-binding fragment of the present
disclosure may e proliferation, ion, persistence and/or cytoxic activity of CD8‘ T
cells in a subject.
Cell-based Applications
Yet another object of the present invention is to provide a method for proliferating
activated T cells ex vivo by administering the 4- I BB humanized antibody or antigen-binding
fragment thereof.
In some embodiments, a method for ex viva proliferation and/or isolation of
activated T cells includes contacting a population of T cells with an antilBB antibody or
anti gen-binding fragment of the present disclosure, thereby increasing proliferation of activated
T cells.
In some embodiments, a method for erating activated T cells ex vivo
includes stering an antiIBB antibody or antigen-binding fragment of the present
disclosure. In some embodiments, activated T cells are proliferated and/or ed from a
sample of eral blood mononuclear cells (PBMC). PBMCs can be obtained/isolated using
methods known in the art.
In some embodiments, a method for ex vivo proliferation and/or isolation of
activated T cells includes administration of an D3 monoclonal antibody to the culture
medium (e.g., at a concentration of at least about 0.5 ng/ml). [n some ments, a method for
ex vivo proliferation and/or isolation of activated T cells includes administration of IL~2 and/or
IL-IS to the culture medium (e.g., at concentration that is at least about l0 units/ml).
|0182'] In some embodiments, a method for isolating antigen—specific activated T cells
includes (a) culturing peripheral blood mononuclear cells (PBMC) in a medium together with a
peptide of an epitope of interest and lL—2; (b) inducing 4-lBB expression in the ed cells by
adding the e of the epitope ofinterest; (c) contacting the cultured cells with a surface
coated with an anti1BB antibody or antigen—binding fragment, wherein cultured cells
expressing 4- 188 adhere to the coated surface; and (d) removing unattached cells, thereby
isolating antigen-specific activated T cells.
In some embodiments, the activated T cells are CD8- T cells.
In some embodiments. lymphocytes (e.g., T cells) are cultured at a temperature of
at least about 25 °C, preferably at least about 30 °C, more preferably about 37 °C.
The present disclosure asses the recognition that activated T cells (e. g.,
CD8" T cells). generated by the methods described herein may be therapeutically useful (veg, for
the treatment of ).
Cell-based ies
[0186‘] The present disclosure provides methods to selectively isolate and mass culture
CD8' T cells which recognize an autologous cancer antigen (self-tumor antigen), for example, an
autologous cancer n that overexpressed in cancer cells while present in a low ratio in
normal cells. The present sure that cells (e.g., CD8- T) isolated by these methods may be
useful for the treatment of cancer.
In some embodiments, a method for treating and/or preventing cancer in a subject
in need thereof includes administering to the subject a therapeutically effective amount of
activated T cells produced by an ex vim method such as those described herein.
Upon appropriate reactivation, tumor antigen specific T cells can recognize and
eliminate gous tumor cells. For example, tumor antigen specific T cells can be generated
ex vivo using methods as bed herein. Upon adoptive transfer, specifically reactivated T
cells from cancer patients can efficiently reject autologous human tumors in viva.
The t disclosure provides methods for preventing and/or ng cancer
and/or tumor of a patient, which include administering a therapeutically effective amount of
activated T cells prepared ex vim by administering an anti1BB antibody or antigen-binding
fragment of the present sure.
In some embodiments, T cells for using in a therapeutic method are nic
(from the same species but different donor) as the recipient subj ect. In some embodiments, T
cells for using in a therapeutic method are autologous (the donor and the recipient are the same).
In some embodiments, T cells for using in a therapeutic method are syngeneic (the donor and the
recipients are different but are identical twins).
VI’1!
In some embodiments, the cells are formulated by first harvesting them from their
e medium, and then washing and concentrating the cells in a medium and container system
suitable for administration (a "pharmaceutically acceptable" carrier) in a treatment-effective
amount. Suitable infusion medium can be any isotonic medium formulation, typically normal
saline, Normosol R (Abbott) or Plasma-Lyte A (Baxter), but also 5% dextrose in water or
Ringer's lactate can be utilized. The infusion medium can be supplemented with human serum
albumin.
A treatment-effective amount of cells in the composition is at least l0“, typically
greater than 108, at least 109 cells, and generally more than low. The number of cells will depend
upon the ultimate use for which the composition is intended as will the type of cells included
therein. For e, if cells that are specific for a ular antigen are desired, then the
population will contain greater than 70%, lly greater than 80%, 85% and 90-95% of such
cells. For uses ed herein, the cells are lly in a volume of a liter or less. In some
embodiments, cells for administration are in a volume of less than 500 ml, less than 250 ml, or
100 ml or less. In some embodiments, a density of the desired cells is typically greater than 10"
ml and generally is greater than [07 cells/ml, generally 108 ml or greater. A clinically
relevant number ofimmune cells can be apportioned into multiple infusions that cumulatively
equal or exceed 108 cells, l0° cells, 10'0 cells. 10ll cells, or 10[2 cells.
Compositions
Provided herein are compositions comprising dies and antigen binding
fragments that specifically bind to an epitope of a human 4- 13B polypeptide. Compositions of
the present disclosure (eg, compositions that r an anti -human 4-] BB antibody or antibody
fragment) may include any suitable and effective amount of a composition for use in delivering 3
provided anti-human 4- 138 antibody or antibody fragment to a cell, tissue, organ, animal or
patient in need of such modulation, treatment or therapy. Also provided herein are compositions
that include activated cell populations (e.g., activated T cell population) that have been ted
via a method of the present disclosure (e.g., a method that includes a step contacting a cell with
an anti-human 4-lBB antibody or antibody fragment).
W0 27787 PCT/[BZOIS/(NNNH3
Compositions of the present disclosure include ceutical compositions that
include an anti—human 4-lBB antibody or antigen-binding nt disclosed herein and/or a
cell population obtained by a method disclosed herein. In some embodiments, a pharmaceutical
composition can include a buffer, a diluent, an excipient, or any combination thereof. In some
ments, a composition, if desired, can also contain one or more additional therapeutically
active substances.
In some ments, an antiIBB dy, n-binding fragment and/or
cell population of the present disclosure are suitable for administration to a mammal (e.g., a
human). Although the descriptions of pharmaceutical compositions provided herein are
principally ed to ceutical compositions that are suitable for ethical administration to
humans, it will be understood by the skilled artisan that such compositions are generally suitable
for administration to s of all sorts. Modification of pharmaceutical compositions suitable
for administration to humans in order to render the compositions suitable for administration to
various animals is well understood, and the ordinarily skilled veterinary pharmacologi st can
design and/or perform such modification with merely ordinary, if any, experimentation.
In some embodiments, compositions are formulated for parenteral administration.
For example, a pharmaceutical composition provided herein may be provided in a sterile
injectable form (e.g., a form that is suitable for subcutaneous injection or intravenous infusion),
For example, in some embodiments, a pharmaceutical compositions is provided in a liquid
dosage form that is suitable for injection. In some embodiments, a pharmaceutical composition
is provided as powders (e.g., lyophilized and/or sterilized), optionally under vacuum, which can
be reconstituted with an aqueous diluent (e.g., water, buffer, salt solution, etc.) prior to injection.
In some embodiments, a pharmaceutical composition is diluted and/or tituted in water,
sodium chloride solution, sodium acetate solution, benzyl alcohol solution, ate buffered
saline, etc. In some embodiments, a powder should be mixed gently with the aqueous diluent
(e.g., not ).
]0197'] In some embodiments, an antilBB antibody, antigen-binding fragment, and/or
cell tion of the present disclosure is formulated with a phannaceutically acceptable
parenteral vehicle. Examples of such vehicles are water, saline, Ringer‘s solution, dextrose
solution, and l— 10% human serum albumin. Liposomes and nonaqueous es such as fixed
oils can also be used. A vehicle or lyophilized powder can contain additives that maintain
isotonicity (e.g., sodium chloride, ol) and al stability (e.g., buffers and
preservatives) In some embodiments, a formulation is sterilized by known or suitable
techniques.
Formulations of the phamiaceutical compositions described herein may be
prepared by any method known or ter developed in the art of pharmacology. In general,
such preparatory methods include the step of bringing the active ingredient into association with
a diluent or another excipient and/or one or more other accessory ingredients, and then, if
necessary and/or desirable, shaping and/or ing the product into a desired single- or multi-
dose unit.
In some embodiments, a pharmaceutical composition including an antiI BB
antibody, antigen-binding fragment, and/or cell population of the present disclosure can be
included in a container for storage or administration, for e, an vial, a syringe (e.g., an IV
e), or a bag (e.g., an IV bag). A pharmaceutical composition in accordance with the
present disclosure may be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or
as a plurality of single unit doses. As used herein, a “unit close” is discrete amount of the
pharmaceutical composition comprising a predetermined amount of the active ingredient. The
amount of the active ingredient is generally equal to the dosage of the active ingredient that
would be administered to a subject and/or a convenient fraction of such a dosage such as, for
example, one-half or one-third of such a dosage.
ve amounts of the active ingredient, the pharmaceutically acceptable
excipient, and/or any additional ients in a ceutical composition in accordance with
the disclosure will vary, depending upon the identity, size, and/or condition of the subject d
and further depending upon the route by which the composition is to be administered. The
examples below describe, in part, dosing of an exemplary anti-human 4—lBB antibody to a
rodent. Standard methods are known in the art of how to scale dosing in animal systems. See,
for example, J Basic (‘lin Pharm. March 2016-May 2016; 7(2): 27—3 1, which is incorporated
herein by reference in its entirety. By way of example, the composition may se n
0.1% and 100% (w/w) active ingredient.
In some embodiments, a composition comprises or delivers an anti-human 4-1BB
dy or antigen-binding fragment of the present disclosure at a dose of 0.0] mg/kg to 100
mg/kg. In some embodiments, a composition comprises or rs an anti-human 4-IBB
WO 27787 PCT/lBlelS/(lllll043
antibody or antigen-binding fragment at a dose in an amount within a range bounded by a lower
limit and an upper limit, the upper limit being larger than the lower limit. In some embodiments,
the lower limit may be about 0.01 mg/kg, 0.025 mg/kg, 0.05 mg/kg, 0.075 mg/kg, 0.] mg/kg,
0.25 mg/kg, 0.5 mg/kg, 0.75 mg/kg, 1 mg/kg, 2 mg/kg, 3 mg/kg, 4 mg/kg, 5 mg/kg, 8 mg/kg, 10
mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 40 mg/kg, 50 mg/kg, 50 mg/kg, 70 mg/kg, 80 mg/kg, or
90 mg/kg. In some embodiments, the upper limit may be about 0.025 mg/kg, 0.05 mg/kg, 0.075
mg/kg, 0.] mg/kg, 0.25 mg/kg, 0.5 mg/kg, 0.75 mg/kg, 1 mg/kg, 2 mg/kg, 3 mg/kg, 4 mg/kg, 5
mg/kg, 8 mg/kg, IO mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 40 mg/kg, 50 mg/kg, 50 mg/kg, 70
mg/kg, 80 mg/kg, 90 mg/kg, or 100 mg/kg.
|0202| A pharmaceutical composition may additionally comprise a pharmaceutically
acceptable excipient, which, as used herein, es any and all solvents, dispersion media,
diluents, or other liquid vehicles, dispersion or suspension aids, e active agents, isotonic
agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as
suited to the particular dosage form desired. Remington's The e and Practice of
Pharmacy, let n, A. R. Gennaro (Lippincott, Williams & Wilkins, Baltimore, MD, 2006)
discloses various excipients used in formulating pharmaceutical compositions and known
ques for the preparation thereof. Except insofar as any tional excipient medium is
incompatible with a substance or its derivatives, such as by producing any undesirable biological
effect or otherwise interacting in a rious manner with any other component(s) of the
pharmaceutical composition, its use is contemplated to be within the scope of this disclosure.
|0203| In some embodiments, a ceutically acceptable excipient is at least 95%, at
least 96%, at least 97%, at least 98%, at least 99%, or [00% pure. In some embodiments, an
excipient is approved for use in humans and for veterinary use. In some embodiments, an
excipient is approved by the United States Food and Drug Administration. In some
embodiments, an excipient is pharmaceutical grade. In some embodiments, an excipient meets
the standards of the United States Pharmacopoeia (USP), the European Pharmacopoeia (EP), the
British Pharmacopoeia, and/or the International Pharmacopoeia.
Pharmaceutically acceptable excipients used in the manufacture of pharmaceutical
compositions include, but are not limited to, inert diluents, dispersing and/or granulating .
surface active agents and/or emulsifiers, disintegrating agents, binding agents, vatives,
buffering agents, lubricating , and/or oils. Such excipients may optionally be included in
pharmaceutical formulations. Excipients such as cocoa butter and itory waxes, coloring
agents, g , sweetening, flavoring, and/or perfuming agents can be present in the
composition, according to the judgment of the formulator.
In some embodiments, a provided pharmaceutical composition ses one or
more phannaceutically acceptable excipients (e.g., vative, inert diluent, dispersing agent,
surface active agent and/or emulsifier, buffering agent, etc). In some embodiments, a
pharmaceutical composition comprises one or more preservatives. In some embodiments,
pharmaceutical compositions comprise no preservative.
|0206| In some embodiments, a composition including an anti-human 4-1BB antibody or
antigen-binding fragment of the present disclosure is stably formulated. In some embodiments, a
stable formulation of an anti-human 4-1BB antibody or antigen-binding nt of the t
sure may comprise a ate buffer with saline or a chosen salt, as well as preserved
solutions and formulations containing a preservative as well as multi—use preserved formulations
le for pharmaceutical or veterinary use. Preserved formulations contain at least one known
preservative or optionally selected from the group consisting of at least one phenol, m-cresol, p-
cresol, o-cresol, chlorocresol, benzyl alcohol, phenylmercuric nitrite, phenoxyethanol,
formaldehyde, chlorobutanol, magnesium chloride (e.g., hexahydrate), alkylparaben (methyl,
ethyl, propyl, butyl and the like), benzalkonium chloride, benzethonium chloride, sodium
dehydroacetate and osal, or mixtures thereof in an aqueous diluent. Any suitable
concentration or mixture can be used as known in the art, such as 0.001-5%, or any range or
value therein, such as, but not limited to 0.001, 0.003, 0.005, 0.009, 0.01, 0.02, 0.03, 0.05, 0.09,
0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2,
2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.3, 4.5, 4.6, 4.7,
4.8, 4.9, or any range or value therein. Non-limiting examples include, no preservative, 0.1—29/0
m—cresol (e.g., 0.2, 0.3. 0.4, 0.5, 0.9, 1.0%), 01-396 benzyl alcohol (e.g., 0.5, 0.9, 1.1, 1.5., 1.9,
2.0, 2.5%), 0.001-0.5°/o thimerosal (e.g., 0.005, 0.01), 0001-2094: phenol (e.g., 0.05, 0.25, 0.28,
0.5, 0.9, 1.0%), 0.0005-1 .0% alkylparaben(s) (e.g., 0.00075, 0.0009, 0.001, 0.002, 0.005, 00075,
0.009, 0.01, 0.02, 0.05, 0.075, 0.09, 0.1, 0.2, 0.3, 0.5, 0.75, 0.9, 1.0%), and the like.
In some embodiments, a pharmaceutical composition is provided in a form that
can be refrigerated and/or . In some embodiments, a pharmaceutical composition is
ed in a form that cannot be refrigerated and/or frozen. In some embodiments,
reconstituted solutions and/or liquid dosage forms may be stored for a certain period of time after
reconstitution (e.g., 2 hours, 12 hours, 24 hours, 2 days, 5 days, 7 days, 10 days, 2 weeks, a
month, two months, or ). In some embodiments, storage of antibody itions for
longer than the specified time results in antibody degradation.
Liquid dosage forms and/or reconstituted solutions may comprise particulate
matter and/or discoloration prior to administration. In some embodiments, a solution should not
be used if discolored or cloudy and/or if particulate matter remains after filtration.
General considerations in the formulation and/or manufacture of pharmaceutical
agents may be found, for example, in Remington: The Science and Practice of Pharmacy 2151
ed, Lippincott Williams & s, 2005.
The present disclosure further provides a pharmaceutical pack or kit comprising
one or more containers filled with at least one anti-human 4-lBB antibody or antibody fragment
as described . Kits may be used in any able method, including, for example,
therapeutic methods, diagnostic methods, cell proliferation and/or isolation methods, etc.
Optionally ated with such container(s) can be a notice in the form ibed by a
governmental agency regulating the manufacture, use or sale of pharmaceuticals or ical
ts, which notice reflects (a) approval by the agency of manufacture, use or sale for human
administration, (b) directions for use, or both.
In some embodiments, a kit may include one or more reagents for detection (e.g,
detection of an anti-human 4-1BB antibody or antibody fragment). In some embodiments, a kit
may include an anti-human 4-lBB antibody or dy fragment in a detectable form (e. g.,
covalently associated with detectable moiety or entity).
In some embodiments. an anti~human 4-1 BB antibody or antibody fragment as
provided herein may be included in a kit used for treatment of subjects. In some embodiments,
an anti-human 4-lBB antibody or dy fragment as provided herein may be included in a kit
used for proliferation and/or isolation of T cells (e.g., CD8° T cells).
The contents of all cited references (including literature references, issued patents,
published patent ations, and co-pending patent applications) cited throughout this
ation are hereby expressly incorporated by reference.
Other features of the invention will become apparent in the course of the
following descriptions of exemplary embodiments. However, the following examples are merely
provided to illustrate the t invention, but the scope of the present invention is not limited
to the following examples.
EXAMPLES
The present disclosure es, at least in part, humanized anti-human 4-] BB
antibodies and nts thereof with ed properties that contain one or more ural
features that are not found in a reference humanized anti human 4-IBB antibody, 94Gl. 94Gl
was generated by humanization of the murine anti human 4-lBB antibody BBK-4 antibody.
Antigen-recognizing sites (CDR regions) were determined using CDR loop assignment (lMGY':
Lefranc, 1997) and a 3—D model (Swiss—de Viewer (www.cxpasyorg». A phage display
library was prepared with diversity in a total of 10 sites ing 4 sites on the amino acid
sequence of the light chain and 6 sites of the heavy chain was constructed. After panning,
approximately 14 humanized antibody clones out of 1,000 clones were selected (for a total of six
humanized scFvs), and among the selected clones, 94Gl, was obtained (Son et al. J. Immunol.
thods (2004) 286: 187-201). These humanized antibodies, including 94Gl, had affinities for
human 4-IBB n that were less than H IO'h that of BBK-4, but were active in l’i/I'O, The
present disclosure encompassed the recognition that structural variants of 9461, may have
improved properties. Generation and characterization of t humanized anti-human 4-]BB
antibodies and fragments thereof is described in further detail in the following examples
Example I —— Preparation of humanized anti-human 4-] BB antibodies
This example describes the production of an ary anti-human 4-] BB
antibodies with improved affinity over a reference 94G] antibody. 94G] was generated by
humanizing a murine anti human 4-lBB antibody (BBK 4) as described in Son et al. J. Immunol.
Mel/10d; (2004) 286: l87-20 l, which is herein incorporated by reference in its entirety. Also
used herein is a H4-lBB antigen (Accession No: KCTC ) that is specifically ed
from activated T cells (e.g., activated T cell line), and has not been identified from unstimulated
T cells. For e, a H4-1BB antigen can be isolated from T cells that have been matured by
phorbol myristate acetate (PMA), ionomycin, Concanavalin A, or anti CD3i, This H4-lBB
antigen has a size of 1.4 kb, and 60% gy with mouse 4-lBB (GarnioWagner et al.,
Cellular logy (I996) 169: 91-98, which is herein incorporated by reference in its
entirety). In this example, 9401 was divided into a light chain and a heavy chain vectors, each
of optimized to generate ed humanized antibodies.
l0217| The present disclosure encompasses a recognition that a suitable method for
generating improved humanized anti—human 4-lBB antibodies or fragments thereof is through
single, stepwise amino acid substitutions and/or combinations thereof. The present disclosure
es various structural variants of humanized anti-human 4-l BB antibodies and fragments
thereof with one or more structural features (e.g., amino acid substitutions) that are not found in
a 940] dy. The t disclosure further encompasses a recognition that structural
features can be combined for stepwise improvements in one or more antibody properties (e.g,
increased antigen affinity).
First, a humanized uman 4-lBB antibody with increased affinity relative to
94G] nce antibody was obtained by ng a CDR region of a light chain, rather than a
heavy chain. This light chain structural variant was fixed, and combined with zed anti-
human 4-lBB antibody heavy chains structural variants with, e.g., mutations in the CDR region
of 946l . Further structural features were integrated to generate humanized anti-human 4-l BB
antibodies with high affinity and/or other improved characteristics.
1.] Cons/merit)” of ors
|0219] Vectors with a 940] light chain and 9461 heavy chain, respectively, were
constructed by changing pComb3H-HA to be sed in a Fab type to improve a heavy chain
and a light chain of a humanized antibody in E. coli (.l. Immuno/ Mel/rods (2008) 329(1-2):176-
83; Virology (2004) 318: 598). Specifically, a 940] light chain was inserted into a vector
designed by changing an APZ tag (SEQ ID NO: 42 — NANNPDWDFNP) with a flag tag (SEQ
ID NO: 43 - DK), the flag tag is designed to be located downstream thereof, and has a
human heavy chain sequence (Accession No. ABOIQ438) obtained from known data of the
NCBI GenBank was placed as a constant domain in a heavy chain position. In addition, after a
94G] light chain sequence was cloned into the vector, it was transferred to Eco/i (e.g., TGl) (F'
[traD36 proAB+lachlacZAM15]supE thi-l A(lac-proAB) A(mch- hstM)5, (rK-mK-) by
transformation, followed by selection of a transformed vector called pCOM-Fab—94G l -L, which
was used as a backbone to induce affinity tion of the light chain (Table I). The above-
described method was similarly d out for the 94G] heavy chain, and a ed vector was
called pCOM-Fab-94Gl-H. An improved light chain, 94/w, was designed as the light chain of
pCOM-Fab-94G l, which served as backbone for production of heavy chain variants with
improved affinity.
Table l - 94G! and 94/w LCDR amino acid sequences
SEQ ID NO: I QTISDY LCDR l
SEQ ID NO: 3 QDGHSFPPT LCDR 3
SEQ ID NO: 4 QDGHSWPPT LCDR 3.6
variant 94/w
I. 2 Aflinily maturation ofhumanized uman 4-]BB antibody lighl chain
|0221| Described herein is the development a humanized anti-human 4-lBB antibody
with a light chain variant that has improved binding affinity. An antibody with a high affinity
was obtained by changing LCDR3 (SEQ ID NO: 3) ofa 94G] light chain in the context of the
ab-94Gl-L vector described above as follows. Various DNA sequences encoding a light
chain were amplified by PCR using primers [using NNS (N: A, T, C, G; S: C, 0)] designed to
insert 19 different amino acids into each amino acid position of the 9 amino acids SEQ ID NO:
3, constituting the LCDR3 part of the 946] light chain. Amplified products were ligated to a
light chain position of the vector and then transformed into Eco/i TO]. All clones with light
chain structure variants of LCDR3 were substituted in different forms and collected to prepare
nine position mixes. To assess whether each amino acid position was substituted with a ent
amino acid, two clones changed in respective positions were randomly chosen and analyzed by
sequencing using an ABl-3 730xl sequencer. which showed that the amino acid residues at
tive positions were substituted at various positions.
To see r 94G] Fab variants with mutations at different LCDR3 positions
had increased antibody ty, each position mix was expressed by adding IPTG (to a final
concentration of lmM) to Eco/i T01, and then Fab antibody present in a supernatant was
ted to ELISA. Specifically, each on mix was cultured with shaking in a 2YT
medium in a 37 °C incubator until the culture had an absorbance at 600 nm of 0.8 or more, then
overnight cultured at 30 °C with IPTG (e.g., at a final concentration of 1 mM). ELISA was
performed the following day on a supernatant obtained by centrifugation at 12,000 rpm for 10
minutes at 4 °C. Binding affinities were determined for the various 94G] LCDR3 variant Fabs by
dividing the binding activities of each clones with respect to 4-lBB Fab by the expression levels
for the respective mutant clone. A 94G| LCDR3 variant with a mutation position 6 of LCDR3
.6) showed the t binding affinity.
Subsequently, to determine how various mutations of 94Gl at the LCDR3.6
position impacted antibody affinity, 25 monoclonal antibodies were isolated from pCOM-
Fab94GI-LCDR3.6 position mix and expressed by adding IPTG (e.g., at a final concentration of
1 mM) to E. coli (e.g., TG] ), cultured, and ELISA was performed on a Fab antibody t in a
supernatant. Binding affinities were determined for the various 94G] LCDR3.6 clones by
dividing the 4-lBB Fab binding activities of each clones by the sion levels for each.
A 94G] LCDR3.6 variant with phenylalanine at the LCDR3.6 position substituted
with tryptophan exhibited the highest binding affinity. A Fab dy prepared by substituting
the constant heavy chain of pCOM-Fab94Gl-L with the heavy chain of the backbone 9461 on
the ed 940] light chain was called 94/w. Thus, a 94/w t includes an improved
94G] light chain in which the 6“1 amino acid of LCDR3 is substituted with tryptophan (W)
(QDGHSWPPT — SEQ ID NO: 4) and a 94G] heavy chain. IPTG-induced expression in Eco/i
and ELISA ofa 94/w Fab was used to determine binding affinity as described above. Using this
method, it was ined that a 94/w Fab antibody has a binding ty 3.5 times higher than
that of 9461 (Fab antibody) (data not shown).
I. 3 Afliiiity maturation ofhumanized anti-human 4- IBB antibody hearty chain CDRs‘
Described herein is the pment humanized anti-human 4- l BB antibodies
with heavy chain structural variants that have improved binding affinity. To achieve further
improved anti~human 4-]BB dies, a 94/w light chain as described above was used and the
946] heavy chain was affinity matured. Provided in Table 2 below are the HCDR amino acid
sequences for a reference 940! antibody heavy chain.
Table 2 - 9461 and 94K HCDR amino acid sequences
SEQ ID NO 5 GYTFSSYW HCDR l
SEQ ID NO: 6 INPGNGHT HCDR 2
SEQ ID NO: 7 ARSFTTARAFAY HCDR 3
HCDR 3.5
SEQ ID NO. 8. ARSFKTARAFAY
variant 94K
Improvement of a heavy chain using 94/w as a starting sequence was performed
by similar methods as described for the 94G! light chain above. Particularly, to e a 94Gl
heavy chain, amino acid residues were substituted with various amino acids at respective amino
acid positions of HDRZ and/or HCDR3. In the case of the third CDR of the heavy chain
(HCDR3, SEQ ID NO: 7), clones were produced with random substitution amino acid residues
of 94/w HCDR3 by different amino acids were collected to e 12 position mixes. A mutant
clone that ses the length of HCDR3 was also prepared. When the 5m amino acid residue of
HCDR3 was substituted with a different amino acid, an affinity increase was observed.
Subsequently, to detemtine how s mutations at the HCDR3.5 position impacted affinity of
the 94/w antibody, 19 monoclonal antibodies were ed from a position mix in which the
HCDR3.5 position of the 94/w antibody was randomly tuted. HCDR3.5 variant Fabs were
expressed in Eco/i by adding lPTG (e.g., to a concentration of 1 mM) and ELISA was
performed using a Fab antibody t in a atant. Sequencing identified that when
threonine was substituted with lysine at HCDR3.5 (5"1 position) position (SEQ ID NO: 8 -
ARSFKTARAFAY), the highest affinity was shown, and the resulting product was called
94K/w.
In the case of the second CDR of the heavy chain (HCDRZ), a position mix was
prepared by random substitution of each of 9 amino acids of a 94G] HCDR2 (SEQ ID NO: 6)
for ELISA. The ELISA results showed that when amino acid residues at 2"“, 5'“ and 6'h positions
were changed, the affinity increased. From each of the 94/w HCDR2.2, HCDR2.5 and HCDR2.6
on mixes, 22, I9, and 36 monoclonal antibodies were isolated, respectively, and the binding
activity of each clone with respect to 4-1BB was analyzed depending on an Fab expression level
In the case of HCDR2.5, an ELISA value was relatively higher than those when asparagine was
substituted with valine (V), glycine (G), or proline (P). In addition, according to sequencing data
for antibody heavy chains, there was a risk of deamination at the 5lll amino acid, asparagine (N).
ofHCDR2 (SEQ ID NO: 6), and variant HCDR2 sequences were also ed with
substitutions at this residue with each of glutamine (Q), glutamic acid (E), and serine (S).
DNAs of 9401 structural variants with mutations in HCDR3 and/or HDRZ of the
heavy chain prepared as described above, were amplified by PCR using a three—base sequence
NNS, ligated to the heavy chain position of a vector having a constant domain of the 94/w light
chain, and then transformed into E. 0011' TO] by the method used in improvement of the light
chain as described above.
1. 4 Optimization nized anti-human 4—!BB antibody heavy chain/i‘amework regions
Heavy chain variants were also produced with optimized framework sequences.
For example, heavy chain framework ] (FRI) regions were ed where the heavy chain FR]
(SEQ ID NO: 16) was modified so that the 5'" amino acid, glutamine (Q), was substituted with
valine (V). ary FRI regions are ed in Table 3 below.
Table 3 — 94G] heavy chain FRI and ions thereof
SEQ ID N0: 16 QVQLQQSGAEVKKPGASVKLSCKAS
SEQ ID NO: l7 QVQLVQSGAEVKKPGASVKLSCKAS FRI Gln 5 Val
|0232] Also, framework 3 (FR3) regions were produced where the heavy chain FR3
(SEQ ID NO: 18) was modified as such: the 10‘11 amino acid, e (A), and/or the 33rd amino
acid, serine (S), which were murine sequences, were substituted with valine (V) and threonine
(T), respectively. Exemplary FR3 regions are provided in Table 4 below.
Table 4 — 94Gl heavy chain FR3 and variations thereof
SEQ ID NO: 18 NYNEKFKSRATMTRDTSTSTAYMELSSLRSED 94Gl FR3
SAVYYC
SEQ ID N0: 19 NYNEKFKSRVTMTRDTSTSTAYMELSSLRSED FR3 Ala 10 Val
SAVYYC
SEQ ID NO: 20 NYNEKFKSRVTMTRDTSTSTAYMELSSLRSED FR3 Ala l0 Val;
TAVYYC FR3 Ser 33 Thr
1.5 Preparation nized anti-human 4-]BB variable regions andfli/l-lenglh antibodies
Anti-human 4-lBB antibody variable regions were produced that include various
combinations of the above described heavy chain and light chain CDRs and framework regions.
For example, a Fab-type w antibody was produced with the 5lh amino acid, threonine, at
CDR3 of a heavy chain was substituted with lysine (K), and the 10‘“ amino acid of heavy chain
FR3, alanine, and the 33rd amino acid of heavy chain FR3, serine, were substituted with valine
(V) and 'threonine (T), respectively to produce heavy chain and light chain variable region
sequence that are or include SEQ ID NO: 30 and SEQ ID NO: 34, respectively. In addition,
94KVT heavy chain variants were produced where the 5“1 amino acid of HCDR2 (SEQ ID NO:
6), asparagine (N), was substituted with glutamine (Q) glutamic acid (E) or serine (S).
ary heavy chain and light chain variable domain sequences are provided in Table 5 below
(CDR ces underlined).
Table 5 — Exemplary humanized anti—human 4-1BB antibody le domains
Antibody Light chain variable domain Heavy chain variable domain
SPAFLSVTPGEKVTIT QVQLQQSGAEVKKPGASVKLS
CRASQTISDYLHWYQQKPDQ CKASGYTFSSYWMHWVRQAP
APKLLIKYASQSISGIPSRFSGS GQGLEWIGEINPGNGHTNYNEK
TFTISSLEAEDAATYY FKSRATMTRDTSTSTAYMELSS
CQDGHSFPPTFGQGTKLEK LRSEDSAVYYCARSFTTARAFA
(SEQ ID NO: 9) XWGQGTLVTVSS
(SEQ ID NO: ll)
DIVMTQSPAFLSVTPGEKVTIT QVQLQQSGAEVKKPGASVKLS
CRASQTISDYLHWYQQKPDQ CKASGYTFSSYWMHWVRQAP
APKLLIKXLLSQSISGIPSRFSGS GQGLEWIGELWTNYNEK
TFTISSLEAEDAATYY FKSRATMTRDTSTSTAYMELSS
CQDGHSWPPTFGQGTKLEIK LRSEDSAWYCARSFTTARAFA
(SEQ ID NO: l0) XWGQGTLVTVSS
(SEQ ID NO: 11)
SPAFLSVTPGEKVTIT QVQLQQSGAEVKKPGASVKLS
CRASQTISDYLHWYQQKPDQ CKASGYTFSSYWMHWVRQAP
APKLLIKmQSISGIPSRFSGS GQGLEWIGEINPGNGHTNYNEK
GSGTDFTFTISSLEAEDAATYY FKSRATMTRDTSTSTAYMELSS
CQDGHSWPPTFGQGTKLEIK AVYYCARSFKTARAFA
(SEQ ID NO: 10) XWGQGTLVTVSS
(SEQ ID NO: 12)
DIVMTQSPAFLSVTPGEKVTIT QVQLVQSGAEVKKPGASVKLS
ISDYLHWYQQKPDQ CKASGYTFSSYWMHWVRQAP
APKLLIKXASQSISGIPSRFSGS GQGLEWIGEWNYNEK
GSGTDFTFTISSLEAEDAATYY FKSRVTMTRDTSTSTAYMELSS
CQDGHSWPPTFGQGTKLEIK LRSEDSAVYYCARSFKTARAFA
(SEQ ID NO: 10) XWGQGTLVTVSS
(SEQ ID NO: 13)
94KVT/w, DIVMTQSPAFLSVTPGEKVTIT QVQLVQSGAEVKKPGASVKLS
CRASQTISDYLHWYQQKPDQ CKASGYTFSSYWMHWVRQAP
APKLLIKY_ASQSISGIPSRFSGS GQGLEWIGEINPGNGHTNYNEK
GSGTDFTFTISSLEAEDAATYY FKSRVTMTRDTSTSTAYMELSS
CQDGHSWPPTFGQGTKLEIK LRSEDTAVYYCARSFKTARAFA
(SEQ ID NO: 10) XWGQGTLVTVSS
(SEQ ID NO: l4)
For conversion to a ength anti-human 4-lBB antibodies (whole [g type), an
Fc domain was ted to the respective Fab. For example, a 94K/w Fab composed of a
heavy chain in which threonine is tuted with lysine at HCDR3.5 and a light chain with
94/w variant in which the 6'“ amino acid of LCDR3 is tuted with hyptophan (W), and
respective regions extended from CH2 and CH3 domains and a sequence of human IgG1 were
amplified by PCR to p and subjected to splice PCR to produce full [gG DNA, and then the
resulting DNA was cloned in a mammalian expression vector. Full length antibodies for other
humanized anti-human 4—IBB antibodies described herein were produced in a similar manner.
Exemplary immunoglobulin constant region sequences are provided in Table 6 below.
Table 6 — Exemplary immunoglobulin constant domains
SEQ ID NO: 21 RTVAAPSVFIFPPSDEQLKSGTASWCLLNNF K constant
YPREAKVQWKVDNALQSGNSQESVTEQDSK domain
DSTYSLSSTLTLSKADYEKHKVYACEVTHQ
GLSSPVTKSFNRGEC
SEQ ID NO: 22 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY lgGl
VSWNSGALTSGVHTFPAVLQSSGLYS
LSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK
KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPP
KPKDTLMISRTPEVTCVVVDVSHEDPEVKFN
WYVDGVEVHNAKTKPREEQYNSTYRVVSVL
TVLHQDWLNGKEYKCKVSNKALPAPIEKTIS
KAKGQPREPQVYTLPPSRDELTKNQVSLTCL
VKGFYPSDIAVEWESNGQPENNYKTTPPVLD
SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE
ALHNHYTQKSLSLSPGK
SEQ ID NO: 23 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY IgGl t
VSWNSGALTSGVHTFPAVLQSSGLYS (L234; L235;
LSSWTVPSSSLGTQTYICNVNl-IKPSNTKVDK [(3 22)
KVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPP
KPKDTLMISRTPEVTCVVVDVSHEDPEVKFN
EVHNAKTKPREEQYNSTYRVVSVL
TVLHQDWLNGKEYKCAVSNKALPAPIEKTIS
KAKGQPREPQVYTLPPSRDELTKNQVSLTCL
VKGFYPSDIAVEWESNGQPENNYKTTPPVLD
LYSKLTVDKSRWQQGNVFSCSVMHE
ALHNHYTQKSLSLSPGK
As used herein a full length 94KVT/w antibody includes an IgGl sequence, such
as that of SEQ ID NO: 22. Additionally, a full length antibody, referred to herein as EU 101, was
produced that includes 94KVT/w variable domains descn'be above (SEQ ID N05: 10 and 14, for
light chain and heavy chain variable domains, respectively), with a variant IgGl constant domain
that includes 3 mutations: L234, L235, and K322 (SEQ ID NO: 23). Thus, example provides a
number of ary humanized anti-human 4- l BB antibodies and antibody fragments that have
been engineered to potentially enhance antigen binding affinity. These exemplary antibodies and
fragments are characterized in the following examples.
Example 2 — Characterization of binding of humanized anti—human 4-lBB antibodies
2. I DelermiI-Iing binding epilope Qfami-human 4-IBB all/ibodies
The present disclosure encompasses a recognition that humanized anti-human 4-
lBB antibodies ed herein may be useful for 4-1 BB co—stimulation. Therapeutic
applications of dies of the present disclosure may include promoting anti-cancer immunity
and/or anti-viral immunity. r, for clinical applications, it is important to identify which
part of human 4-IBB is recognized by and/or reacts with an anti-humanized 4-lBB antibody
(i.e., a binding epitope). 4- [BB antibodies that recognize different epitopes of 4-1 BB molecule
have identified, and these antibodies can have been shown to have ent clinical effects. (See,
e.g., Kwon et al. Eur. J. genetics (2002) 29: 449-452, herein orated by reference in
its ty). Epitope mapping encompasses methods for identifying a molecular determinant of
antibody-antigen recognition. This example describes epitope mapping of an exemplary anti-
human 4-1BB antibody as engineered in Example 1 above. cally, this example assesses
the binding epitope of a humanized anti-human 4-lBB antibody with 94KVT/w variable
domains, EU101.
A human 4-lBB antigen for investigating an e of the humanized 4-lBB
antibody is derived from a cDNA library ctured from human peripheral blood
lymphocytes that was generated by at least some of the ors of the present application (See,
e.g., Kwon et al. Cellular Immunology (1996) 169: 91-98; Immunol. Lett. (1995) 45: 67-73; and
Korean Patent No. 10-0500286, each of which is orated herein by reference). cDNA
encoding an extracellular domain (ECD) of the obtained human homologue of 4-1 BB cDNA
(hereinafter, referred to as H4-1BB) was selected, fused with GST, and then ed into a
vector (pGEX-6T) to express. A cell line producing a GST1BB fusion polypeptide as used
herein, was deposited as part of the disclosure for Korean Patent No. 10-0500286, Accession No:
KCTC 09SZBP. A full length sequence of human 4~lBB is provided as SEQ ID NO: 44, below.
The extracellular domain of human 4-lBB corresponds to amino acids 1 to 167 of the full length
H4-1BB sequence.
SEQ ID NO: 44 - Full length human 4-] BB ce
MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPN
SFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSM
CEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVN
GTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQIISFFLALTSTALLF
LLFFLTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGG
|024Z| To ine an epitope of 4-lBB recognized by humanized anti-human 4-] BB
antibodies of the present disclosure, constructs were generated with fragments of a 4- 1 BB
ellular domain of various sizes (e.g., R1, R2, R3), fused to GST, and replicated. A
schematic of GSTIBB polypeptides as used in the present example is provided in .
and exemplary primer sequences used herein for generating different 4- [BB extracellular domain
constructs are ed in Table 7 below. Individual recombinant GST-HIBB constructs
were cultured with 1 mM IPTG and produced in E. coli BL2lDX5a cells, and the fusion
polypeptides were purified using a glutathione-agarose column.
Table 7 — Exemplary primers used to generate human 4- 1 BB extracellular domain
frauments useful for epitope mapping
-5Fonward Reverse
GGATCCACAAGATCATTGCA TTGAGCTCGAGCCTGGTCCTGAAA
G-3’ (SEQ ID NO. 24) ACA-3(SEQ ID NO. 25)
57- S,-
CGCGTGGATCCAAGGAGTGTTCCTC TCGAGACGTTTCTGATCG
CA~3’ (SEQ ID NO. 26) TTA—3’ (SEQ ID NO. 27)
’- 5’—
CGCGTGGATCCGGCATCTGTCGACC TTGAGCTCGAGGATCTGCGGAGAG
CT-3’ (SEQ ID NO. 28) TGT-3‘ (SEQ ID NO. 29)
’- 5’-
GGATCCACAAGATCATTGCA CTCGAGGCATATGTCACAG
G-3’ (SEQ ID NO. 30) GT-3’ (SEQ ID NO. 3 l)
’- 5’—
GGATCCACAAGATCATTGCA CTCGAGGCTGGAGAAACT
G-3’ (SEQ ID NO. 32) AT-3’ (SEQ ID NO. 33)
’- 5’-
GGATCCTGCCCAGCTGGTA TTGAGCTCGAGCCTGGTCCTGAAA
C-3’ (SEQ ID NO. 34) ACA-3‘ (SEQ ID NO. 35)
52 5’-
GGATCCAGGAATCAGATTTG TCGAGCCTGGTCCTGAAA
C-3’ (SEQ ID NO. 36) ACA-3’ (SEQ ID NO. 37)
’- 5’-
ACAAGATCATTGCA CTCGAGGCAAATCTGATTC
G-3’ (SEQ ID NO. 38) CT-3‘ (SEQ ID NO. 39)
,- 55-
GGATCCACAAGATCATTGCA CTCGAGTGGAGGACAGGGA
G-3’ (SEQ [D NO. 40) CT-3’ (SEQ ID NO. 41)
Purified protein samples were obtained from transformed bacterial cells by a lysis
buffer (e.g., 10 mM Tris-HCI — pH 7.4, 50 mM NaCl, 5mM EDTA, 30 mM NaF, 0.1 mM
Na3VO4, 1% Triton X-100, 0.5% t P—40, 1 mM PMSF, and protease inhibitor mixture).
Approximately 20 pg of each fusion polypeptide sample was diluted in a 4X SDS sample buffer,
subjected to electrophoresis on SDS-PAGE gels, and then transferred to nitrocellulose
membranes (Millipore, Bedford, MA). On the cellulose membranes, anti-human 4-] BB mAb
was reacted with anti-mouse lgG adish peroxide (HRP). Binding antibodies were
recognized by enhanced chemiluminescence (ECL) (Amersham Pharmacia Biotech, Little
Chalfont, UK).
As described above and shown in , when each of three non-overlapping
H4-lBB ECD fragment-GST fusion polypeptides, R1, R2, and R3, were treated with GST-
binding, respectively. It was determined that an exemplary humanized antilBB dy
encompassed by the present disclosure (EUl 01) binds to an N-terminal fragment construct (Rl)
fusion uct of approximately 32 kDa (amino acids 1 to 55 of 4-IBB) by western blotting.
Moreover, this binding was specific, as no binding was observed with either of the R2 or R3
fusion constructs. See .
Furthermore, to ine the minimal binding site of the humanized antilBB
antibody, an R1 extracellular domain fragment was further divided into 6 smaller fragments:
R1,] (amino acids 1 to 45 of4—lBB), R12 (amino acids 1 to 35 B), Rl.3 (amino acids
H to 55 of4—lBB), R14 (amino acids 2] to 55 of4-lBB), R1 .5 (amino acids 1 to 25 of4—lBB),
and R] .6 (amino acids 1 to 30 of 4-1BB) polypeptide fragments, as depicted in , and
WO 2018/]27787 PCTllBZOIS/(Ilfll043
fused to GST (Glutathione S-Transferase, 27 kDa). ary primer pairs used for the
tion of these constructs are provided in Table 7 above. Fusion ptide constructs
were produced in E. coli BLZ] cells with IPTG induction (e.g., lmM IPTG) and bacterial whole
cell extract was ed by 12% SDS-PAGE. As shown in , SDS-PAGE confirmed
that individual 4-IBB fusion polypeptides are well expressed.
SDS-PAGE was transferred to a nitrocellulose membrane and blotting
was performed using an exemplary anti-human 4~lBB antibody. EUlOl. As shown in ,
it was ed that a ce of amino acids 10 to 30 of the extracellular domain of H4- l BB
is significant for binding an exemplary humanized antilBB antibody. This analysis indicates
that an exemplary anti-human 4-lBB dy of the present sure (EUlOl) binds to an
epitope of human 4—1BB whose sequence is or includes CPAGTFCDNNRNQICSPCPP (SEQ ID
NO: l5). It was also confirmed that a sequence including amino acids 35 to 50 of the 4-lBB
extracellular domain is not significant for binding an exemplary humanized antibody described
herein (FIG. ZB).
2.2 Assessing binding qffinily ofexemplary humanized anti-human 4—18/3 antibodies to J—IBB
antigen
Binding ability of exemplary anti-human 4-1 BB antibodies
To examine the binding ability of exemplary humanized anti-human 4- 1 BB
antibodies described in Example I to a human 4-lBB antigen (H4—lBB). ELISA was performed.
E. ooh-expressed recombinant human 4-lBB was used for antigen.
A murine BBK-4 antibody, a reference 940] humanized antibody, and exemplary
engineered antibodies 94K, 94KV, 94KVT and EUlOl as described in Example 1 were each
d on 96 well plates coated with histidine—tagged 4- 1 BB extracellular domain recombinant
protein (H4-1BB). Exemplary ELISA affinity analysis employed a total volume of mo pl at a
concentration of 10 ug/ml, and the reaction was allowed to proceed at room temperature for 1
hour. Horseradish peroxidase (I-IRP)-labeled anti—human IgG and lgG-HRP, as
appropriate, recognizing an antibody was treated thereto, and allow to react at room temperature
for 40 minutes. After washing, treatment with an ABTS solution (Sigma-Aldrich), which is a
substrate for a ng reaction, and the reaction to allow to d at room temperature for 30
minutes, and an absorbance at 450 nm in the coloring on was detected using an ELISA
reader to analyze a binding activity of the antibodies. Results are shown in As shown
in as antibody concentration ses, binding between each antibody and 4- | BB
antigen (H4-1BB) is improved This data confirms that antibodies encompassed by the t
sure specifically bind to 4-1 BB.
Binding of exemplary anti-human 4-1BB antibodies to cell-expressed antigen
The ability of exemplary humanized anti-human 4- [BB antibodies to bind a
human 4- I BB antigen (H4-l BB) in a cellular t was assessed. Iurkat 8-l cells were
genetically engineered for overexpressing 4-IBB. ary engineered antibodies 94K, 94KV,
94KVT and EU l 0] as described in Example I, along with that of a murine BBK-4 antibody, and
a reference 940] humanized antibody were each assessed for binding to Jurkat 8~l cells using an
anti-mIgG-HRP or IgG-HRP secondary antibody, as appropriate, and analyzed by FAC S.
As shown in each of the antibodies were able to effectively bind 4-IBB expressed by
Jurkat 8-I cells and the affinity of 94KVT and EUIOI was higher than BBK-4 and 9401,
In vitro binding affinity of exemplary anti-human 4-lBB antibodies to antigen
[025” In vitro binding affinity of exemplary engineered antibody EUIOI as described in
Example I, along with that of a reference 940] humanized antibody were each determined by
Biacore analysis. Anti-human IgG was immobilized on a CMS chip, and coupled to the Fab
antibodies prepared above by flowing over the chip, and ultimately reacted with a human 4-lBB
antigen (H4—IBB) to measure the g activity between the antibody and the antigen
re3000, sensor chip CMS). Affinity measurement results are shown in Ka (l/Ms)
and Kd (l/s) values ent how fast an antibody associates with and iates from an
antigen, respectively. A iation constant (K9) is obtain by dividing Kd by Ka (Kd/Ka= KB).
As a dissociation constant decreases, it can be reted that dissociation occurs
at a lower concentration and that affinity is sing. As shown in the exemplary
engineered anti-human 4—lBB antibody had improved binding affinity relative to a reference
94Gl.
Exemplag anti-human 4-IBB antibodies recognize 4-1BB expressed by activated CD8‘ T cells
CD8‘ T cells were isolated from human PBMCs and activated with lug/ml anti—
CD3 antibody —for 2 day. The ability of exemplary humanized anti-human 4- [BB antibodies
(94K, 94KV, 94KVT and EUIOI) described in Example 1 to detect a 4-1BB on the surface of
activated CD8’ T cells was assessed relative to an exemplary commercially available anti [BB
antibody (4-lBB-PE). Also shown is detection with a BBK-4 a murine anti—human 4-lBB
antibody and a 94Gl reference humanized antibody. Treatment with 4—] BB antibodies was at a
concentration of 25 ng/ml.
Exemplary antibodies were detected with an anti-mIgG~Dylight488 or anti-h1g6-
Dylight488 as appropriate, and analyzed by FAC S. s are shown in While a
reference 946] antibody ed 4-IBB on 17.93 "/0 of CD8- T cells, each ofa 94KVT and
EUlOl antibody showed robust detect of 25.3% and 28.33%, respectively. Demonstrating that
exemplary antibodies 94KVT and EUlOIboth had improved binding properties over BBK—4 and
9401. Thus, humanized variant antibodies of the present disclosure have superior binding to
activated T cells in vilro.
Example 3 - Analysis of in vitro cy of humanized anti-human 4-IBB antibodies
AntiIBB antibodies have usly been demonstrated to provide signal
stimulation to a co-stimulation molecule expressed in ted CD8. T cells, 4- I BE, to activate
the CD8” T cells, induce proliferation and increase TH l-type cytokine expression. In this
example, activity of ary humanized uman 4-lBB antibodies described in Example I
to induce proliferation of CD8* T cells and THl-type cytokine sion was examined.
3.] Exemplary uman 4—lBB antibodies induce cell pro/(fanatic): QfCD8+ Toe/ls
To assess proliferation ofCD8‘ T cells, cells were d with WST-l (water-
soluble tetrazolium salt) is a cell proliferation reagent. WST-l—labeled CDST T cells were
prepared and activated with 0.5 ug/ml of anti-CD3 antibody. The activated CD8’ T cells were
treated with 1,0 [lg/ml of iso-type l antibody, mutine BBK-4 antibody, reference 946]
antibody, and exemplary humanized anti-human 4-lBB antibodies (94K, 94KV, 94KVT and
EUlOl) described in Example 1. Cells were analyzed using a MACS system and results are
shown in ing to it was confirmed that exemplary humanized anti-human
4- 1 BB antibodies of the present disclosure induce cell proliferation of CD8‘ T cells. er, a
degree of CD8’ T cell activation increases in an order of 946] < 94K/94KV < 94KVT / EU WI.
3. 2 Exen-iplary anti-human 4- 1BB antibodies slimy/ale ne secretion
IFN-y is a representative cytokine ily secreted from a T lymphocyte or a
natural killer cell (NK cell) and exhibiting eration and anti-viral activities. In on, [FN-
y is a major activator for a hage, and particularly, a major cytokine distinguishing TH]
cells from other types of cells. IFN—y secretion plays a major role in the activation of cytotoxic T
cells, phagocytes and B cells. Consequently, efficiency of an anticancer agent can be evaluated
with an increased amount of TH] inducing IFN-y. For this reason. measurement of secretion of
LFN-y by specific stimulation may be an optimal standard which can be used as a quantitative
criterion for a functional change of T cells.
CD8- T cells were isolated from human PBMCs and treated with 05 ug/ml of an
anti-CD3 mAb antibody and then treated with either no antibody, or with 1.0 [1le of an anti
IBB antibody: BBK-4, 940 I, 94K, 94KV, 94KVT and EUlO l. IFNy secretion was evaluated
on days I, 3, and 5. Results are shown in As can be seen in IFNy secretion
increased in all antilBB dy treated samples, and this increase correlated with duration
of dy treatment. Treatment with 94KVT and EUIOI antibody reached a secretion level
that was 13-fold higher than the control group as day 5. Accordingly, exemplary humanized
antibodies 94KVT and EUIOI can both induce [FNy secretion more efficiently than 94G]
reference antibody.
3. 3 Increase in lFN—y level according to ent afaclivaled (‘D-i"; Tee/ls or (‘1)8‘ Tee/ls
with an exemplmy uman 4- 1BB antibody
Blood was collected from three healthy donors, PBMCs obtained there from
were isolated by Ficoll—plaque gradient centrifugation, and active T cells present in the PBMCs
were rested in a RPMI- l 640+2°/o FBS medium for 24 hours. The rested PBMCs were treated
with an iron beads-attached anti-CD4 antibody or anti-CD8 antibody, and CD4' cells or CD8‘
cells were isolated using an MACS magnetic separator. The isolated CD4- T cells or CD8' T
cells were treated with a T cell activator, anti —CD3, to induce 4-IBB expression, and treated with
EUlOl at different concentrations (0.5, 1.0, 2.5, and 5.0 ug/ml) for 3 days. After 3 days, a
culture medium excluding the cells was obtained, and fluorescence of human IFN—y in the
culture medium was assessed by ELISA (ebioscience), and the result was compared with the
standard curve provided in an IFN-y ELISA kit (.
As shown in expression levels of [FN-y in the CD4' T cells and CD8' T
cells dose-dependently increased. Particularly, when 5.0 ug/ml of EUIOI was treated, compared
with a 278% increase in the CD4' T cells, the expression level of IFN-y increased 612% in the
CD8‘ T cells. According to the T-cell specific expression pattern of lFN-y involved in the
conversion of the T cells into TH I, an exemplary anti-human 4-lBB antibody of the present
disclosure, EU I 01, has sufficient in vii/‘0 activity to suggest it may be ive for prevention
and/or treatment of cancer.
3. -/ Measure/”en! ofAlX‘C and (‘1)(‘ aclivilies ofan exemplary (viii-human 4—IBB antibody
] An immune system recognizes and s virus-infected cells or cancer cells, and
antibodies may be used to induce xicity mediated sis. For such an immune ,
two types of mechanisms such as antibody-dependent cellular cytotoxicity (ADCC) and
complement-dependent cytotoxicity (CDC) may be used. In both cases, apoptosis may be
mediated by an antibody binding to a target on a cell surface. That is, when an antibody has an
ADCC ty, a cell ized by the antibody results in apoptosis mediated by a natural killer
(NK) cell, and when an antibody has a CDC activity, g is mediated by a complement
protein. Therefore, in the case of the development of an antagonistic antibody therapeutic, a
degree of g cells ized by an antibody can be identified through analyses of the
ADCC and CDC activities. However, a target for the humanized 4-lBB antibody disclosed in the
t disclosure is T cells, not cancer cells. That is, in consideration of a mechanism for
inducing activation of T cells by binding a 4-l BB dy as an agonistic antibody, an antibody
that does not have the ADCC and CDC activities may be preferably for therapeutic uses.
In the present disclosure, for an ADCC assay, human PBMCs were isolated by
Ficoll centrifugation using the same density difference. The PBMCS were incubated into RPM]
(Thermo Fisher Scientific) and 10% PBS with lL-2 (lOOU/ml) for overnight cultured. Target
cells (4-IBB expressing cell lines) were harvested, resuspended in a culture medium at I ml, and
labeled with 5 uM CFSE at 37 °C for 5 min. Effector/Target cells of the present disclosure were
washed in a ratio of IO: 1 counted and then dispensed. For analysis, an antibody of the present
disclosure was prepared for a final concentration of 10 nM (1.5 rig/ml), and cultured on a plate at
37 °C for 4 hours. 5 ul of 7-AAD was added to each well and transferred to a FACS tube, and
then the sample was analyzed by FAC S manufactured by BDFACScan. Frequencies of non-
viable target cells (CFSE ' 7—AAD ') viable target cells (CFSE ’ ) were measured.
ADCC was assessed with a frequency of viable cells of the total cells (A).
A complement-dependent cytotoxicity (CDC) assay was ted similarly to
the ADCC assay described above using FACS as a read-out value, with the above Target cells
incubated with anti—4-IBB dies at ice for 30 min and then added the human supplemented
serum at a final concentration of 20 % at 37 °C for 30 minutes. ard, resulting samples
were each transferred to a FACS tube, and assessed by FACS manufactured by BDFACScan
(FIG. IOB). The results in A and B confirm that an exemplary humanized 4-
18B antibody, EUlOl, has almost no ADCC and CDC effects. Therefore, it can be said that an
exemplary EUlOl antibody of the present sure has beneficial ADCC and CDC properties
for an agonist antibody, and is a good candidate for ancer treatment in viva.
Example 4 — Confirmation of in viva ncy of an exemplary humanized anti-human 4-
188 antibody
The anti-human 4-] BB antibody, EU l 01, of the present disclosure showed a
dose- ent effect in an in vim) example, and showed a considerably superior effect to a
conventional antibody. This example is to check if the anti-human 4-1BB antibody, EU 10], is
able to be used alone or in combination with a different composition to diagnose, prevent or treat
cancer or tumor in viva, and to effectively inhibit the growth of tumor.
4.1 NOD-said11.2Rgammdm” mouse engrqftmem of human peripheral blood mononuclear
cells and anti-tumor activity ofanti-hllmml 4—188 antibody
Peripheral venous blood collected from a 4-type healthy donor was
treated with heparin, and subjected to concentration-gradient centri fugation on -paque (GE
Healthcare, Piscataway, NJ) to harvest PBMCs. The PBMCs were washed with an RPMI-1640
medium, and 3x106 of the cells were intraperitoneally injected into immnodeficient mice, that is,
NSG mice (NODCg-Prkdcm" l/2r_ ”WI/82]; NOD-scid ILZry""", Jackson Laboratory).
is of humanized mice was performed by flow cytometty to check whether
human T cells were present in the mouse blood collected by mouse orbital blood tion after
weeks of the ment of human PBMCs. 7-week-old NSG mice (Jackson Laboratory,
Barharbor, ME) were raised under a specific pathogen-free (SPF) environment.
Flow cytometry was performed to check ratios of CD4 and CD8 after the cells
were stained with human blood cell markers such as an APC-cy7 fluorescence- labeled CD45
antibody and a FITC fluorescence—labeled CD4 antibody, and a BVSlO cence-labeled
CD8 antibody. After l blood collection from each mouse, human T cells from mouse blood
samples were observed to check if a human immune system is engrafted into the mouse. Human
tumor cells were prepared in an HLA type humanized mouse model and l x 107 cells were
subcutaneously injected into the back of each mouse. When a tumor size reached 100 to 200
mm3, a preparation of exemplary anti-human 4-1BB antibody (EU 10]) was intravenously
administered at 1.0 mg, 5.0 mg or 10.0 mg per 1 kg of body weight once every 5 days total 3
times. As a control, human IgG was used. Tumor volume (mm3) of each mouse was measured
in every 3 days (). Results shown confirm that tumor size in mice treated with
an exemplary anti-human 4-] BB antibody (EUlOl) was reduced relative to mice treated with
human lgG, and moreover that this ion was proportional to antibody concentration.
Particularly, tumor regression in a 5 mg/kg dy-administered group occurred rapidly.
Within a week after stration at a 5 mg/kg dose, tumor size settled in a zed mouse
and tumor growth was eradicated. Therefore, an exemplary antibody EUlOl of the present
disclosure shows an anticancer effect in viva.
Consequently, the above results show that an exemplary anti-human 4-lBB
antibody (EUlOl) that specifically recognizes an epitope (SEQ ID NO: 15) of H4-IBB, but due
to improved characteristics of this exemplary antibody, such as, for example, improved affinity,
this antibody shows superior effects in an in viva mouse model. Thus, the example suggests that
an antibody assed by the present disclosure can be used as an anticancer agent at a lower
dosage than reference antibody.
4. 2 Is Qfmhibiling IllmOI' growth with an exemplary anti—human 4—!BB antibody and an
anti-PD-I agent
Comparison of effects caused by individual treatment of an exemplary anti-human 4-lBB
antibody (EU 1 01 i and an exemplary anti-PD-l agent after tumor injection to humanized mice
Humanized mice were prepared by the same method described in Example 4.]
above. To perform an experiment confirming an increase in anti-cancer effect according to
doses of an exemplary anti-human 4-lBB antibody (EUIOI) and an ary D-l agent
(Keytruda)(purchased from MSD, GER), l x 107 cells of a HLA—A-type matched human
colorectal adenocarcinoma cell line, HT29, were subcutaneously injected into the previously~
prepared humanized mice. When the volume of the injected tumor reached 100 to ISO mm}, the
mice were divided into a total 5 groups of three mice, and to compare the effect of EUlOl on
tumor inhibition, each group of mice were treated with each of five three administration
conditions (Control: IgG, Treated group 1: 5 mg/kg, and Treated group 2: 10 mg/kg) at 5 day
intervals 5 3 times, and for anti-PD—l, the same procedures were carried out (). As a
result of the experiment, in both cases of EUIOI and keytruda (anti-PDI), tumor volumes
were dose-dependently reduced. However, in , 5 mg/kg of EUlOl did not have an
influence on the tumor growth, but according to the ent with 5 mg/kg and 10 mg/kg of
EUlOl, an anti-tumor activity was ependently ted. In addition. it was confirmed that
EUlOl ted higher efficiency at a lower dose than keytruda (anti-PD-l ), and the tumor
growth was tely blocked ularly by the treatment with 5 mg/kg of EUlOl.
Treatment of humanized mice with combination of EU 1 Oland an anti-PD-l agent after tumor
injection
Since co-inhibitory receptors (PD-l and CTLA-4) signals and a co-stimulation
(CD137)T cell signal are differentiated for the same purpose of inhibiting tumor growth,
ation of the two receptors can expect a synergyic effect (Chen er al., Cancer l. Res.
(2015) 3: l49-160; Bartkowiak et 0]., From 011001. (20l5) 5: I 17, both of which are incorporated
by reference herein). In addition, PDI imrnunotherapy showed a possibility of an anticancer
treatment effect for some of cancer patient populations, but the administration of a low dose in
combination therapy with a different anticancer agent may still be ed in more extensive
patient population. To igate the anti—tumor effect caused by a combination y of an
exemplary anti-human 4—lBB antibody (EUIOl) and an exemplary anti-PD-l agent (Keytruda),
tumor-bearing humanized mice were treated with the combination therapy of EU 1 0| and
Keytruda. Preparation of humanized mice was performed by the same method as described in
Example 4.1
Eye bleeding was performed to identify humanized mice. Among the humanized
mice, HT29, colon carcinoma were subcutaneously injected into HLA-A24 mice maintaining a
normal condition at lxlO7 cells/mice. When a tumor size was 300 to 450 mm3, an experiment
was performed as follows.
As known from this example, gh tumor growth was not d with
individual injection at the minimum concentration or less (EUlOl: 2.5 mg/kg, Keytruda
(manufactured from MSD, GER): 2.5 mg/kg), tumor was greatly regressed with combination
y of EUIOI and Keytruda. This is the result showing that exemplary anti-human 4-lBB
antibodies provided herein (e.g, EU] 01) are good candidates for combination therapy with
different anticancer agents, including in combination with one or more immune checkpoint
inhibitors ().
Analyses of T cell infiltrating cytes [TILs] in normal tissue and human colorectal
adenocarcinoma tissue after individual and combination treatment of an exemplam anti-human
4-l BB antibody and an exemplam anti-PD-l agent
[0273'] After individual administration of an exemplary anti-human 4-lBB antibody
(EUlOl) and an exemplary D-l agent (Keytruda) (purchased from MSD, GER) and
combination administration of EU] 01 and Keytruda to HTZQ-implanted zed mice, on the
day when the effect analysis is ated, all groups were ted to separate tumor and
blood. After the ted tumor was treated with collagenase [V at 37 °C for 30 minutes, cells in
the tumor tissue were dissociated by a mechanical method and then washed with leBS. PBMCs
were ted from the separated blood by Ficoll gradient centrifugation, and separated tumor
cells and PBMCs were subjected to the following experiment. Red blood cells (RBCs) were
d from washed cells using RBC lysis buffer and then washed with leBS. Tangled cell
debris was removed from the washed cells using a 40-um nylon cell strainer to create a single
cell state, and the single cells were washed with leBS, followed by counting T cells separated
from each group using a cell counter.
The separate T cells were stained with human blood cell markers such as a CD45
antibody (fluorescent APC-cy7 labeled), a fluorescent FITC-labeled human CD4 antibody and a
fluorescent BVSIO-labeled human CD8 antibody, and then subjected to FACS assay. The FACS
assay was carried out based on a ratio (9/0) of CD4 and CD8 cell groups, which were gated from
the CD45 group (A).
Particularly, to identify a Treg group among the separated T cells, the surfaces of
cells were d with human blood cell s such as a CD45 antibody scent APC-
cy7 labeled), a human cent FITC-labeled CD4 antibody and a human fluorescent PE-cyS-
labeled CD25 antibody, and ellular and intranuclear staining with a cell transcription factor
Foxp3 (human fluorescent APC-labeled Foxp3 antibody) were performed using a Foxp3/
Transcription Factor Staining Buffer Set kit (ebioscience). In the PAC S assay, a CD45 group was
separated to gating RI , a CD4°CD25high group was separated to gating R2, and a ratio (°/o) of a
Foxp3high group was measured in the RI and R2 groups. To identify IFN-y'CD8' T cells in the
separated cells, the cell es were stained with the blood cell markers such as the fluorescent
APC—cy7-labeled human CD45 antibody and the fluorescent BVSlO—labeled human CD8
antibody, fixed with 2% PFA, and reacted with a 0.5% saponin solution and a fluorescent PE—
cy7-labeled human IFN-y antibody. Afterward, cytokine IFN-y’ cells in the CD8 T cell group
were measured by FACS assay. The cells were identified in a ratio by the same method as
described above and a proportional ratio of the CD8‘IFN-y’ ratio and the Treg ratio was
calculated, shown in 8.
According to the result of this embodiment, other than the individual
administration, the combination administration of EUlOl and Keytruda greatly increased
infiltration of the combination of tumor tissue and a T lymphocyte. Further more specific
results of the combination treatment are as follows. When the ation treatment was
performed on PBMCs in the y humanized mouse as a control, the number of lymphocytes
sed approximately 3 times, and the infiltrated cytes per 1 g of tumor increased 76
times in tumor tissue. This means that most of tumor-specific lymphocytes were activated and
recruited to tumor tissue to kill target cells. ularly, when PBMCs in the combination
y group were measured, as shown in A, the CD4‘ T cells do not highly increased,
but cytotoxic CD8' T cells were increased approximately 5 times. Moreover, the combination
therapy group showed a lOO-fold increase in CD8~ Tcell count per 1 g of tumor tissue. In
addition, as a result, a ratio of CD8' T cells secreting IFN-y and regulatory T cells was also
greatly increased (B). That is, it can be said that the combination treatment of EU 1 Ol
and anti-PD-I agent gives a sharp increase of effector T cells and thus tumor inhibition is
effectively ied.
es of IFN-x in serum or tumor fluid obtained from human ctal adenocarcinoma
tissue after individual and combination treatment with an ary anti-human 4-1BB antibody
gEUlOl') and an exemplary anti-PD-l agent (Keytruda)
After individual administration and combination administration of an exemplary
anti-human 4-l BB antibody (EU [0 l) and an exemplary anti-PD-l agent (Keytruda) to I-IT29-
implanted humanized mice. On the day when effect. analyses were ated, all groups were
dissected to separate tumor and blood. In tumor dissection to separate a tumor fluid present in
the separated tumor, 300 pl of 1x PBS was injected into the upper n of a tumor membrane
using a Ice—syringe, and a flowing solution is taken from the lower n of the tumor
membrane using an insulin syringe. In addition, in dissociation of the tumor tissue, the taken
solution was added to dissociate the tumor tissue, and then stored. In addition, as a serum, the
serum stored when PBMCs were separated from blood by Ficoll gradient centrifugation. The
stored serum and a tumor fluid were dissolved and filtered using a 0.22 pm fliter unit
(manufacturer: coming). 10 pl of serum was used for each group, and IOO ul of the tumor fluid
was used to measure human IFN-y and human TGF-B using a human [FN-y ELISA SET-
Go kit (eBioscience) and a Human TGF beta 1 ELISA Ready-SET-Go kit (eBioscience).
Results were analyzed by comparing the standard curve provided in each ELISA kit.
As a result, compared to the individual administration of EUIOIand Keytruda, in
the combination stration, the tration of interferon in serum of the tumor group was
the highest. Since a EUIOI mechanism can be explained with a correlation between LPN-y and
an anti-tumor effect, expression levels of IFN-y and TGF-B in serum of a healthy donor and
serum of a tumor group, to which the combination therapy had been applied, were evaluated.
According to the material of the example on the serum of the healthy donor, in the combination
therapy group shown in A, IFN-y was increased approxiamtely 16 times, but a cytokine
secreted from Treg cells, TGF-B, was decreased approximatley 65%. In addition, in 3, the IFN-y concentration caused by the combination administration in the tumor fluid was
considerably higher (approximately 213-fold) than that in the control. As a result of the
examples, due to EUIOI, particularly, compared to the control group, the combination group
showed sharp increases in IFN-y secretion. Therefore, it can be confirmed that the anti-cancer
effect caused by an improved anti-humanized 4-l BB antibody of the present disclosure gives
effective tumor-infiltrati on of effector T cells directly d to apoptosis of cancer cells, and a
erably specific effect in the tumor tissue, compared to the non-treated group. In other
words, in the present disclosure, it was confirmed that EUlOl, as an anti-cancer agent, has the
optimal conditions for sis of cancer cells. Conventional] y, in cancer patients, anti-cancer
cytokine and anti—cancer cellular immunity were considerably reduced, but it can be expected in
the present disclosure that EU l O] induces the increases in anti—cancer cytokine and anti-cancer
cellular ty, resulting in a considerable therapeutic effect.
Thus, an exemplary anti-human 4-1 BB antibody EUIOI exhibits an anti-tumor
effect mediated by the high expression of IFN-y, and such an effect is dose-dependently
exhibited, as such, an IFN-y concentration in a serum of a cancer t can be used as a
biomarker to diagnose and estimate tumor. Therefore, according to effective treatment of cancer
or tumor through the combination treatment of EUIOl and anti-PD-l and progmosis through the
measurement of an lFN-y concentration. it is expected to perform more effective treatment with
respect to each patient.
Example 5 — Separation and massive proliferation of CD8+T cells ex vivo using
an exemplary humanized anti-human 4-lBB antibody
The inventors used 4-lBB expression in antigen-specifically activated CD8+ T
cells in isolation and purification of 4-lBB'CD8° T cells specific to various antigens using an
-lBB antibody (Korean Patent No. 104503341). A subsequent experiment was performed
to examine if the EU l 01 antibody developed herein is also used for isolation and mass-
proliferation of antigen-specific CD8‘ T cells.
[028 l[ uction of PBMCs from peripheral blood of a cancer patient was performed
as described in Example 4. 1. However, in this example, cancer antigen-specific undifferentiated
T cells may be obtained by the method described in Korean Patent Application No. 10
0165224, filed by the inventors. In this e, for effective separation of 4-1 BB‘CD8’T cells
and roduction of the 4-1BB'CD8'T cells with high purity, a g method using an
anthhuman 4—lBB antibody (EUIOI) was used. 10 ug/ml of the uman 4-lBB antibody
(EU lOI) antibody diluted in PBS was added to a 10 ml flask, and then stored at 4 °C for 20 to 24
W0 27787 PCT/lBZOIS/(lllll043
hours. After storage, a supernatant containing the dy was removed, and without washing,
a solution ot'BSA dissolved at 2.5% in PBS was added to cell pellets in the 10 ml flask and then
stored at 4 °C for 20 to 24 hours Afterward, the BSA solution was removed, and each flask was
washed twice with 15 ml of PBS. The previously-prepared cells were ded in an X-VIVO
medium, added to a EUIOI antibody-coated flask, and then incubated at 37 °C in a C02
incubator for 1 hour. After incubation, a supernatant was removed, and cell pellets were washed
twice with 10 ml of RPMI] 640 medium to remove non-specifically binding cells. 1% of self
serum and a IOOO IU/ml lLcontaining X-VIVO 10 medium were added to the flask, followed
by ing for 14 days. In the example, some cells were harvested and then stained to measure
the purity and phenotypes of the isolated cells. As shown in FIGS. 16A and 168, it was
confirmed that, before g with the 94 kvt antibody, a ratio of antigen-specific 4-lBB-CD8'
T cells increased 43.2% (CD8' T cell ratio: 586%), and after g with the EUIOl antibody,
a ratio of antigen-specific pCMV'CD8' T cells increased 60.0% (CD8- T cell ratio: 79.3%). This
means that the antigen-specific 4-lBB’CD8‘ T cells can be isolated with high purity using a
EU l0]. Antigen-specific 4-1 BB’CDS' T cells isolated as described above may be easily mass-
produced by the method described in Korean Patent Application No, lO-20l6-0165224 filed by
the inventors.
From the above description, it will be understood by those of ordinary skill in the
art that the present invention can be realized in different specific forms without ng the
technical idea or essential characteristics of the present invention. However, there is no intention
to limit the present invention to the specific exemplary embodiments, and it should be
understood that all modifications or modified forms deduced from the meaning and range of the
following claims and equivalents thereof are included in the scope of the present disclosure,
rather than the detailed description.
uman 4—] BB antibodies encompassed by the present disclosure
demonstrated a number ofbeneficial properties, such as, for example, superior affinity to a
nce antibody, and/or can be used alone or in combination with another anticancer agent to
diagnose, prevent or treat cancer or tumor, or used to inhibit the growth of cancer.
Above, the present invention has been described with reference to examples, but it
can be understood by those of ry skill in the art that the present ion may be changed
and modified in s forms without departing from the spirit and scope of the present
invention, which is described in the accompanying claims.
E UIVALENTS
Those skilled in the art will recognize or be able to ascertain using no more than
routine experimentation, many equivalents to the specific embodiments of the invention
described herein. The scope of the present invention is not intended to be limited to the above
Description, but rather is as set forth in the claims.
Claims (17)
1. A nucleic acid molecule encoding an anti1BB antibody or antigen-binding fragment comprising: (a) a heavy chain CDR1 comprising a sequence of SEQ ID NO: 5, a heavy chain CDR2 comprising a sequence of SEQ ID NO: 6 and a heavy chain CDR3 comprising a sequence of SEQ ID NO: 7 or 8; and (b) a light chain CDR1 comprising a sequence of SEQ ID NO: 1, a light chain CDR2 comprising a ce of SEQ ID NO: 2 and a light chain CDR3 comprising a sequence of SEQ ID NO: 4; (c) a light chain variable domain comprising a ce at least 98% identical to a sequence of SEQ ID NO: 10; and (d) a heavy chain variable domain comprising a sequence at least 98% identical to a sequence of SEQ ID NO: 14, wherein the heavy chain variable domain ses a valine at position 5, a valine at position 68, a threonine at position 91, and a lysine at position 101.
2. A recombinant vector comprising the nucleic acid le of claim 1.
3. A host cell comprising the recombinant vector of claim 2 and/or the c acid molecule of claim 1.
4. The host cell of claim 3, wherein the host cell is selected from a bacterial, yeast, insect or mammalian cell.
5. The host cell of claim 4, wherein the host cell is selected from the group consisting of , P.pastoris, Sf9, COS, HEK293, CHO, and a ian lymphocyte.
6. Use of an anti1BB antibody or antigen-binding fragment comprising: (a) a heavy chain CDR1 comprising a sequence of SEQ ID NO: 5, a heavy chain CDR2 comprising a sequence of SEQ ID NO: 6 and a heavy chain CDR3 comprising a sequence of SEQ ID NO: 7 or 8; and (b) a light chain CDR1 comprising a sequence of SEQ ID NO: 1, a light chain CDR2 comprising a sequence of SEQ ID NO: 2 and a light chain CDR3 comprising a sequence of SEQ ID NO: 4; (c) a light chain variable domain comprising a sequence at least 98% identical to a sequence of SEQ ID NO: 10; and (d) a heavy chain variable domain comprising a sequence at least 98% identical to a sequence of SEQ ID NO: 14, n the heavy chain variable domain comprises a valine at position 5, a valine at position 68, a threonine at position 91, and a lysine at position 101, a nucleic acid of claim 1, or a recombinant vector of claim 2, in the manufacture of a medicament for the treatment of .
7. Use of an -1BB antibody or antigen-binding fragment comprising: (a) a heavy chain CDR1 comprising a sequence of SEQ ID NO: 5, a heavy chain CDR2 comprising a ce of SEQ ID NO: 6 and a heavy chain CDR3 comprising a sequence of SEQ ID NO: 7 or 8; and (b) a light chain CDR1 comprising a sequence of SEQ ID NO: 1, a light chain CDR2 comprising a sequence of SEQ ID NO: 2 and a light chain CDR3 sing a sequence of SEQ ID NO: 4; (c) a light chain le domain comprising a ce at least 98% identical to a sequence of SEQ ID NO: 10; and (d) a heavy chain variable domain comprising a sequence at least 98% identical to a sequence of SEQ ID NO: 14, wherein the heavy chain variable domain comprises a valine at position 5, a valine at position 68, a threonine at position 91, and a lysine at position 101, a nucleic acid of claim 1, or a recombinant vector of claim 2, in the manufacture of a medicament for inducing an immune response or increasing the activity of an immune cell.
8. The medicament of claim 6, where in the cancer is selected from a bladder cancer, breast cancer, cervical cancer, colon cancer, endometrial cancer, esophageal cancer, fallopian tube cancer, gall r cancer, gastrointestinal cancer, head and neck cancer, hematological , laryngeal cancer, liver cancer, lung cancer, ma, ma, mesothelioma, ovarian , primary peritoneal cancer, salivary gland cancer, sarcoma, stomach cancer, thyroid cancer, pancreatic cancer, and prostate cancer.
9. The medicament of claim 6, wherein the subject has been administered or will be administered one or more additional anticancer ies selected from ionizing radiation, a chemotherapeutic agent, an antibody agent, and a cell-based therapy, such that the subject receives treatment with both.
10. The medicament of claim 9, wherein the one or more additional anticancer therapies comprise an immune checkpoint inhibitor, IL-12, , an anti-CD4 agent, cisplatin, uracil, doxorubicin, irinotecan, paclitaxel, or cyclophosphamide.
11. The medicament of claim 10, wherein the t has been administered or will be administered a composition comprising an immune checkpoint inhibitor, such that the subject receives treatment with both.
12. The medicament of claim 11, wherein the immune checkpoint inhibitor is an agent that inhibits PD-1 ing.
13. The medicament of claim 12, wherein the agent that inhibits PD-1 signaling is a PD-1 antibody.
14. A method for increasing secretion of IFN-γ by a cell in vitro, the method comprising: ting the cell with an anti1BB dy or antigen-binding fragment comprising: (a) a heavy chain CDR1 comprising a sequence of SEQ ID NO: 5, a heavy chain CDR2 comprising a sequence of SEQ ID NO: 6 and a heavy chain CDR3 comprising a sequence of SEQ ID NO: 7 or 8; and (b) a light chain CDR1 comprising a sequence of SEQ ID NO: 1, a light chain CDR2 comprising a sequence of SEQ ID NO: 2 and a light chain CDR3 comprising a sequence of SEQ ID NO: 4; (c) a light chain variable domain comprising a sequence at least 98% identical to a sequence of SEQ ID NO: 10; and (d) a heavy chain variable domain comprising a sequence at least 98% identical to a sequence of SEQ ID NO: 14, wherein the heavy chain variable domain comprises a valine at position 5, a valine at position 68, a threonine at position 91, and a lysine at on 101.
15. A method for ex vivo proliferation or isolation of activated T cells, the method comprising: contacting a population of T cells with an anti1BB antibody or antigen-binding fragment sing: (a) a heavy chain CDR1 comprising a sequence of SEQ ID NO: 5, a heavy chain CDR2 comprising a sequence of SEQ ID NO: 6 and a heavy chain CDR3 comprising a sequence of SEQ ID NO: 7 or 8; and (b) a light chain CDR1 sing a sequence of SEQ ID NO: 1, a light chain CDR2 sing a sequence of SEQ ID NO: 2 and a light chain CDR3 comprising a sequence of SEQ ID NO: 4; (c) a light chain variable domain comprising a sequence at least 98% identical to a sequence of SEQ ID NO: 10; and (d) a heavy chain variable domain comprising a sequence at least 98% cal to a sequence of SEQ ID NO: 14, n the heavy chain variable domain comprises a valine at position 5, a valine at position 68, a threonine at position 91, and a lysine at position 101.
16. A method for isolating antigen-specific activated T cells, the method comprising: (a) culturing peripheral blood mononuclear cells (PBMC) in a medium together with a peptide of an epitope of interest and IL-2; (b) inducing 4-1BB expression in the cultured cells by adding the peptide of the epitope of interest; (c) ting the cultured cells with a surface coated with an anti1BB antibody or antigen-binding fragment of any one of claims 1-14, wherein cultured cells expressing 4- 1BB adhere to the coated surface; and (d) removing unattached cells, thereby isolating antigen-specific activated T cells.
17. The method of claim 16, wherein the activated T cells are CD8+ T cells. FIG. IA llllllllllll[III/IIIIIIIII[III/IIIIIIIIIII[III/IIIIIIIII[III/IIIIIIIIIIIIII/[IIIIIllllIll/Ill]llIIllllllllll/I/I/I/I/IlllngW\\\“kw\x\\\\\\\\\wa\\\\\\\\\\\\\\\\\\\\\\\\\VNM\W Ig1f 1 55 11 16 / \ R1 (1-55 aa) l WWWW\ \ \ :1» \\ - R2 (56-110 aa) R3 (110-167 aa) R1 I 1 R2 l I -—-——---I R1.1 (1-45 aa) --—-‘ L___B§___
Publications (1)
| Publication Number | Publication Date |
|---|---|
| NZ768752A true NZ768752A (en) | 2020-10-30 |
Family
ID=
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11859004B2 (en) | Anti-human 4-1BB antibodies and uses thereof | |
| US20160376365A1 (en) | Tigit-binding agents and uses thereof | |
| US20210277139A1 (en) | Ifn-gamma-inducible regulatory t cell convertible anti-cancer (irtca) antibody and uses thereof | |
| EP4047021A1 (en) | Ox40/pd-l1 bispecific antibody | |
| NZ753036B2 (en) | Anti-human 4-1 bb antibodies and use thereof | |
| RU2777573C2 (en) | Antibodies against human 4-1bb and their use | |
| HK40006081B (en) | Anti-human 4-1 bb antibodies and use thereof | |
| HK40006081A (en) | Anti-human 4-1 bb antibodies and use thereof | |
| HK40016571B (en) | Anti-human 4-1 bb antibodies and use thereof | |
| HK40016571A (en) | Anti-human 4-1 bb antibodies and use thereof |