NZ755670B2 - Multispecific antibodies, multispecific activatable antibodies and methods of using the same - Google Patents

Abstract

The invention relates to a bispecific activatable antibody comprising (i) a first arm comprising an antigen-binding fragment of an immune effector cell engaging antibody that includes a first antibody or antigen-binding fragment thereof (AB1) that binds a first target, wherein the first target is an immune effector cell target; (ii) a second arm comprising an antigen-binding fragment of a target binding antibody that includes a second antibody or antigen-binding fragment thereof (AB2) that binds a second target; wherein the AB1 is attached to a first masking moiety (MM1) such that coupling of the MM1 to the AB1 reduces the ability of the AB1 to bind the first target; wherein the MM1 is coupled to the AB1 via a first cleavable moiety (CM1) sequence that includes a substrate for a protease; wherein the first arm of the bispecific activatable antibody in an uncleaved state has a structural arrangement from N-terminus to C-terminus as follows: MM1-CM1-AB1, wherein the structural arrangement optionally comprises a linkage peptide between MM1 and CM1 and optionally comprises a linkage peptide between CM1 and AB1; wherein the AB2 is attached to a second masking moiety (MM2) such that coupling of the MM2 to the AB2 reduces the ability of the AB2 to bind the second target; wherein the MM2 is coupled to the AB2 via a second cleavable moiety (CM2) sequence that includes a substrate for a protease; and wherein the second arm of the bispecific activatable antibody in an uncleaved state has a structural arrangement from N-terminus to C-terminus as follows: MM2-CM2-AB2, wherein the structural arrangement optionally comprises a linkage peptide between MM2 and CM2 and optionally comprises a linkage peptide between CM2 and AB2. an immune effector cell target; (ii) a second arm comprising an antigen-binding fragment of a target binding antibody that includes a second antibody or antigen-binding fragment thereof (AB2) that binds a second target; wherein the AB1 is attached to a first masking moiety (MM1) such that coupling of the MM1 to the AB1 reduces the ability of the AB1 to bind the first target; wherein the MM1 is coupled to the AB1 via a first cleavable moiety (CM1) sequence that includes a substrate for a protease; wherein the first arm of the bispecific activatable antibody in an uncleaved state has a structural arrangement from N-terminus to C-terminus as follows: MM1-CM1-AB1, wherein the structural arrangement optionally comprises a linkage peptide between MM1 and CM1 and optionally comprises a linkage peptide between CM1 and AB1; wherein the AB2 is attached to a second masking moiety (MM2) such that coupling of the MM2 to the AB2 reduces the ability of the AB2 to bind the second target; wherein the MM2 is coupled to the AB2 via a second cleavable moiety (CM2) sequence that includes a substrate for a protease; and wherein the second arm of the bispecific activatable antibody in an uncleaved state has a structural arrangement from N-terminus to C-terminus as follows: MM2-CM2-AB2, wherein the structural arrangement optionally comprises a linkage peptide between MM2 and CM2 and optionally comprises a linkage peptide between CM2 and AB2.

Description

PECIFIC ANTIBODIES, MULTISPECIFIC ACTIVATABLE ANTIBODIES AND METHODS OF USING THE SAME RELATED APPLICATIONS This application is a divisional of New Zealand Application No. 716064 filed on July 25, 2014, derives from , and claims the benefit of U.S. ional Application No. 61/858,402, filed July 25, 2013, the ts of which are orated herein by reference in their entirety.

FIELD OF THE INVENTION The invention relates generally to multispecific antibodies and to multispecific activatable antibodies that specifically bind to two or more different targets or epitopes, as well as to methods of making and using these multispecific antibodies and/or multispecific activatable antibodies in a variety of therapeutic, diagnostic and prophylactic indications.

BACKGROUND OF THE INVENTION Monoclonal antibodies have emerged as molecules for therapeutic intervention in a variety of disorders. However, targeting or neutralizing a single protein is not always sufficient for effective treatment of certain disorders, which limits the therapeutic use of monospecific monoclonal antibodies. Moreover, antibody-based therapies have proven effective treatments for some diseases but in some cases, toxicities due to broad target expression have limited their therapeutic effectiveness. In addition, antibody-based therapies have ted other limitations such as rapid clearance from the circulation following administration.

Accordingly, there exists a need for antibodies and therapeutics that enable targeting of multiple targets and/or multiple epitopes with a single molecule and also e for increased ivity for the intended s and for a reduction of e effects upon administration.

SUMMARY OF THE INVENTION The present sure provides pecific antibodies and multispecific activatable antibodies. The multispecific antibodies provided herein are antibodies that recognize two or more different antigens or epitopes. The multispecitic table antibodies ed herein are n'rultispeeific antibodies that include at least one masking moiety (MM) linked to at least one antigenv or whore—binding domain of the multispeeific antibody such that coupling of the MM reduces the ability of the n-- or epitope-binding domain to bind its . ln some embodiments, the MM is coupled to the antigen— or epitope~binding domain of the inultispecific antibody Via a cleayable moiety (CM) that functions as a. ate for a protease. The activatable multispecific antibodies provided herein are stable in circulation, activated at intended sites of therapy and/or sis but not in normal, :7, 12., healthy , and, when activated, exhibit binding to a target that is at least comparable to the eorrespon ding, unmodified multispecilic antibody, {69%} hi some embodiments, the pecillc antibodies and/or multispecific activatable dies are designed to engage immune effector cells, also referred to herein as ~effeetor engaging n'iultispeeific antibodies and/or immune—effector engaging multispecific activatable antibodies. in some embodiments, the multispecific antibodies and/or rnultisnecitic activatable antibodies are designed to engage leukocytes, also referred to herein as leukocyte engaging multispeeilic antibodies and/or leukocyte engaging multispecitie activatahle antibodies. in some embodiments, the multispecific dies and/or multispecific activatable antibodies are designed to engage T cells, also referred to herein as T~cell engaging multisnecific antibodies and/or l—cell engaging rnultispecitic aetivatable antibodies. in some embodiments, the multispecitic antibodies and/or multispeeific activatable antibodies engage a surface antigen on a leukocyte, such as on a T cell, on a. natural killer (NK) cell, on a myeloid mononuclear cell, on a, macrophage, and/or on another immune effector cell. in some embodiments, the immune effector cell is a leukocyte, in some ments, the immune effector cell is a T cell. in some embodiments, the immune effector cell is a NK cell. ln some embodiments, the immune effector cell is a clear cell, such as a d mononuclear cell. ln some embodiments, the n'rultispecific antibodies and/or multispecifie activatable antibodies are designed to bind or otherwise interact with more than one target an d/or more than one epitope, also referred to herein as inulti—antigen targeting antibodies and/or multi—antigen targeting activatable antibodies. As used herein, the terms "target" and en" are used interchangeably. {6997} hi some embodiments, the immune effector cell engaging multispecific antibodies include a targeting antibody or antigen—binding fragment thereof and an immune effector cell engaging antibody or antigen—binding portion f in some embodiments, the immune effector cell ng multispecific antibodies include a cancer targeting antibody or n~binding fragment thereof and an immune effector cell engaging antibody or antigen-binding portion thereof. in some embodiments, the immune effector cell engaging multispecific antibodies e a cancer targeting lgG antibody or antigen~ binding fragment thereof and an immune effector cell engaging scFy. ln smne embodiments, the immune effector cell is a yte. in some embodiments, the immune effector cell is a T cell. ln some embodiments, the immune effector cell is a NK cell. in some embodiments, the immune effector cell is a myeloid mononuclear cell. {lltltlll} In some embodiments, the T—eell ng multispecitie antibodies include a targeting antibody or antigen-binding fragment thereof and a T—cell engaging antibody or antigen—binding portion thereof. in some embodiments, the T—cell engaging multispecific antibodies include a cancer targeting antibody or antigen—binding nt thereof and a T- cell engaging antibody or antigen-binding portion thereof. in some embodiments, the T-cell engaging multispeciflc antibodies include a cancer targeting lg6 antibody or antigen— binding fragment thereof and a T—cell engaging sefv, in some embodiments, the T—cell engaging pecific antibody includes an anti—CD3 epsilon (CD38, also referred to herein as CD3e and CD3) scFy and a targeting dy or antigen-binding fragment thereof. in some embodiments, the T—cell engaging multispecil‘ic antibody includes an anti—CD38 scFy and a cancer targeting antibody or an tigen—binding fragment thereof. in some embodiments, the 'l"~cell engaging multispeeific antibody includes an anti~Cf33tt scf'v and a cancer targeting lgG antibody or n-binding fragment f. ln some embodiments, the T" cell engaging multispecifie antibody includes an D3 epsilon (CD38) scFV that is derived from OKTS, ln some embodiments, the T—cell ng peeific antibody includes an anti-C'l‘LA-d scFV. l‘fil in some embodiments, immune effector cell engaging multispecific aetivatable antibodies of the disclosure include a targeting antibody or an ti gen—binding fragment thereof and an immune e, fector cell engaging antibody or anti nding portion f, where at least one of the targeting antibody or antigen—binding fragment thereof and/or the immune effector cell engaging antibody or antigen—binding portion thereof is masked in some embodiments, the immune effector cell engaging antibody or antigen binding fragment f includes a first antibody or antigen-binding fragment thereof (ABl) that binds a first, immune effector cell engaging target, Where the ABl is attached to a masking moiety l) such that coupling of the Mix/ll reduces the ability of the A81 to bind the first target! ln some embodiments, the targeting antibody or antigen ~binding fragment thereof includes a second antibody or fragment f that includes a second antibody or antigen-binding fragment thereof (ABE) that binds a second target, Where the A82 is attached to a mashing moiety le) such that coupling of the MIX/l2 reduces the ability of the A82 to hind the second target. In some embodiments? the immune effector cell engaging antibody or antigen binding fragment thereof es a first antibody or antigen—binding fragment thereof (ABl) that binds a first, immune effector cell engaging target, where the ABl is attached to a masking moiety (MMl) such that coupling of the Ml‘vl‘t reduces the ability of the ABl to bind the first target, and the targeting antibody or antigen-binding fragment thereof includes a second antibody or fragment thereof that includes a second antibody or antigen—binding fragment thereof (ABE) that binds a second target, where the ABE is attached to a mashing moiety (MMZ) such that coupling of the Mix/l2 reduces the ability of the ABE to bind the second target. ln some embodiments, the non—immune effector cell engaging antibody is a cancer targeting antibody. in some ments the non—immune cell effector antibody is an lgG. in some embodiments the immune effector cell engaging antibody is a scFy. ln some embodiments the targeting antibody e.g., non-immune cell effector dy) is an lgG and the immune ef ‘ector cell engaging antibody is a scFy. ln some embodiments; the immune or cell is a leukocyte. In some embodiments, the immune effector cell is a T cell. in some embodiments, the immune effector cell is a NK cell, ln some embodiments, the immune ef ector cell is a myeloid mononuclear cell.

Eillllllll} ln some ments, T—cell engaging n'rultispecific activatable antibodies of the disclosure include a targeting antibody or antigen—binding fragment thereof and a "ll cell engaging antibody or antigen-binding n thereof, Where at least one of the targeting antibody or antigen~binding fragment thereof and/or the T—cell ng antibody or antigen~binding portion f is maslted. in some en'rbm’lin'rents, the T~cell ng antibody or antigen binding nt f includes a first antibody or antigen~binding fragment thereof (AB t) that binds a first, T—cell engaging , where the ABl is attached to a masking moiety (MMl) such that coupling of the MMl reduces the ability of the ABl to bind the first target In some embodiments, the ing antibody or antigenbinding fragment thereof includes a second antibody or fragment thereofthat includes a second antibody or antigen—binding fragment thereof (AB2) that binds a second target; where the A32 is attached to a masking moiety (MMZ) such that counting of the Mth reduces the ability of the A82 to bind the second target in some embodiments, the T—cell engaging antibody or antigen binding nt thereof includes a first antibody or antigen—binding fragment thereof (AB i) that binds a first, 'l'-—cell engaging target, where the ABl is attached to a mashing moiety (Mb/ll i) such that coupling of the MMl reduces the y of the ABl to bind the first target, and the targeting antibor y or antigen g fragment thereof includes a second dy or fragment thereof that includes a second antibody or antige -- binding fragment thereof (A82) that binds a second target, where the A32 is attached to a masking moiety (MM2) such that coupling of the MMZ reduces the ability of the AB? to bind the second target, Etilitllll in some embodiments, the 'l‘--ceil engaging multispecifrc activatable dies include a cancer targeting dy or antigen—binding fragment thereof and a T— cell engaging antibody or antigen—binding n thereof, where at least one of the cancer targeting antibody or antigen-binding fragment thereof and/or the 'l‘uceil engaging antibody or antigen~binding portion thereof is masked. in some embodiments, the T~cell engaging antibody or n binding fragment thereof includes a first antibody or antigen—binding fragment thereof (AB i) that binds a first, T~cell engaging target, where the A31 is ed to a mashing moiety (Mb/ll) such that coupling of the lViMl reduces the ability of the A31 to bind the first . in some embodiments, the cancer targeting antibody or antigen— binding fragment thereof includes a second antibody or tiagrnent thereof that includes a second antibody or antigen vbiiiding fragment thereof (ABE) that binds a second, cancer— d targe where the A82 is attached to a mashing moiety (Milt/l2) such that coupling of the MMZ reduces the y of the ABE to bind the second, cancer—related target, in some embodii ents, the T~cell engaging antibody or antigen binding fragment f includes a first antibody or antigen-binding fragment thereof (AB ii that binds a first, il engaging target, where the ABl is attached to a mashing moiety (hills/ll) such that coupling of the MMl reduces the ability of the ABl to bind the first target, and the cancer targeting antibody or antigen—binding fragment thereof es a second antibody or fragment thereof that includes a second antibody or antigen—binding fragment thereof (AB2) that binds a second, cancer-related target, where the ABE is attached to a g moiety (MMZ) such that ng of the Mix/l2 reduces the ability of the A82 to bind the second, cancer-related target.

Etilllllll} in some ments, the T—cell engaging rnultispecific activatable antibodies include a cancer targeting lgG antibody or antigen~binding fragment f and a 'l"~cell engaging scFv, where at least one of the cancer ing lgG antibody or antigen— binding fragment thereof and/or the T—cell engaging antibody or antigen-binding portion thereof is masked. in some ments, the T—cell engaging antibody or n g fragment thereof includes a first antibody or antigen—binding fragment thereof (ABt) that binds a first, ’l'ncell engaging target, Where the A51 is attached to a masking moiety (Ml‘vll) such that coupling of the Mix/ll reduces the ability of the Mill to bind the first target. in some embodiments, the cancer targeting lgG antibody or an tigen—binding fragment f includes a second antibody or fragment thereof that includes a second dy or antigen- binding fragment f (A32) that binds a second, s-related target, where the A32 is attached to a masking moiety (MMZ) such that coupling of the MIX/l2 s the ability of the ABE to bind the , cancer~related target, in some embodiments, the T—cell engaging antibody or antigen binding fragment thereof includes a first antibody or antigen-- binding fragment thereof (ABl ) that binds a first, T—cell engaging target, where the A81 is attached to a masking moiety (MM l) such that coupling of the MMl reduces the ability of the AB l to bind the first target, and the cancer targeting lgG antibody or antigen—binding fragment thereof includes a second antibody or fragment thereofthat es a second antibody or antigen—binding fragment thereof (ABE) that binds a second, cancer—related target, where the ABE is attached to a inaslring moiety (MMZ) such that coupling of the Mix/t2 reduces the ability of the ABE to bind the second, cancer~related target. {tilllllj} in some embodiments of an immune or cell engaging multispecific actiyatable antibody, one antigen is typically an antigen present on the surface of a tumor cell or other cell type associated with disease, such as, but not limited to, any target listed in Table 1, such as, but not limited to, EGFR, erbB2, EpCAM, lagged, , 57H}, or CD7l (transferrin receptor), and another antigen is lly a stimulatory or inhibitory receptor present on the surface ofa T—cell, natural killer (NK) cell, niyeloid rnononuclear cell, macrophage, an dl’or other immune effector cell, such as, but not limited to, B7UH4, BTLA, CD3, :34, CDX, CDl tia, CD25, CD27, CD28, CD32, CD56, CDl37, CTLA—t’l, GlTR, llVlEh/l, lCOS, LAGS, NKGZD, 0X40, PD—l, TlGlT, TIMB, or VISTA. in some embodiments, the antigen is a stimulatory receptor present on the surface of a T cell or NK cell; examples of such stimulatory receptors include, but are not limited to, CD3, CD27, CD28, CDl3'7 (also referred to as 4—lBB), GlTR, H‘v’EM, lCOS, NKGZD, and 9X40. ln some embodiments, the antigen is an inhibitory receptor present on the surface of a T~cell; examples of such inhibitory receptors include, but are not limited to, BTLA, CTLAJl, LAGS, P‘D—l, 'l'lGl'l", "fllVl3, and NK~expressed Kle, The antibody domain conferring specificity to the 'l‘mcell surface antigen may, also be substituted by a ligand or ligand domain that binds to a T~cell receptor, a NK—cell receptor, a macrophage receptor, and/or other immune or cell receptor, such as, but not limited to, B7~l Pl) , 87—21, B7H3, l’f)~lfl,l, L2, or 'l'NFSlF‘).

Ellllllldl One embodiment of the disclosure is a multispecil‘ic activatable antibody that is activatable in a cancer rnicroenvironment and that includes an antibody, for example a lgG or scli‘v, directed to a tumor target and an agonist antibody, for e an lgG or scFv, directed to a co-stimulatory receptor expressed on the surface of an activated T cell or NK cell, wherein at least one of the cancer target antibody and/or agonist antibody is .

Examples of(so—stimulatory receptors include, but are not limited to, (71327, CDlSTI’, GlTR, HVEM, NKGZD, and Gth). in this embodiment, the multispecific activatable antibody, once activated by tumor~associated ses, would effectively crosslinh and activate the T cell or NK cell sed co—stirnulatory receptors in a turner-dependent manner to enhance the activity of T cells that are responding to any tumor antigen via their endogenous T cell antigen or NK-activating receptors, The activation-vdependent nature of these T cell or NK cell costimulatory receptors would focus the activity of the activated rnultispecitic activatable antibody to tumor—specific T cells, t activating all T cells ndent of their antigen specificity, in one embodiment, at least the (so—stimulatory receptor antibody of the multispecific activatable antibody is masked to prevent activation of eactive T cells that may be present in tissues that also express the antigen recognized by the tumor tar et—directed antibody in the multis ecific activatable dy, but whose activity is restricted by lack of co-—receptor engagement. idllllldl One embodiment of the sure is a multispecitic activatahle antibody that is activatable in a disease characterized by T cell overstimulation, such as, but not limited to, an autoimmune disease or inflammatory disease microenvironment. Such a niultispecitic activatable antibody includes an dy, for example a lgG or scFv, directed to a target comprising a e antigen expressed in a tissue targeted by a T cell in autoimmune or inflammatory disease and an antibody, for example a lgG or scli‘v, directta' to an inhibitory receptor expressed on the surface of a T cell or NK cell, n at least one of the disease tissue target antibody and/or T cell inhibitory or antibody is masked. es of inhibitory receptors include, but are not limited to, BTLA, CTLA—d, LAG3, PD—l and NK-expressed Kle.

, TlGlT, TlM3, es ofa tissue n targeted by T cells in autoimmune disease e, but are not limited to, a surface antigen expressed on niyelin or nerve cells in multiple sclerosis or a surface n expressed on pancreatic islet cells in Type l diabetes. in this embodiment, the inultispecific activatable antibody when localized in the tissue under autoimmune attacl< or inflammation is activated and covengages the T cell or NK cell inhibitory receptor to suppress the activity of autoreactive T cells responding to any disease tissue—targeted antigens via their endogenous TCR or activating receptors. in one ment, at least one or multiple antibodies are masked to prevent suppression of d T cell responses in non—disease tissues where the target antigen may also be expressed.

Ellllllltii in some embodiments, the T—cell engaging multispecific activatable antibody includes an anti—CD3 epsilon (CD38, also referred to herein as ClT33e and CD3) scFv and a targeting antibody or antigen-binding fragment thereof, where at least one of the anti-CD3s scFv and/or the targeting antibody or antigen—binding portion thereof is masked. In some embodiments, the CD38 scFv includes a tirst dy or antigen—bim’ling fragment f (ABl) that binds CD38, Where the ABl is attach ed to a masking moiety (Mb/l l) such that coupling of the Ml‘vll reduces the ability of the ABl to bind CD38. ln some embodiments, the targeting dy or antigen—binding fragment thereof includes a second antibody or fragment f that includes a second antibody or antigen—binding tragment thereof (A82) that binds a second target, where the A32 is attached to a mashing moiety (MMZ) such that coupling of the MMZ reduces the ability of the A82. to bind the second target. ln some embodiments, the CD38 scFv includes a tirst antibody or antigen—bim’ling fragment thereof (ABl) that binds CD38, Where the ABl is attached to a maskin g moiety (Mitill) such that coupling of the Ml‘vll reduces the ability of the ABl to bind CD38, and the targeting antibody or antigen—binding fragment thereof includes a second antibody or fragment thereof that es a second antibody or an tigen—binding fragment thereof (A82) that binds a second target, Where the A82 is attached to a masking moiety (MMZZ) such that coupling of the Mth reduces the ability of the A82 to bind the second target. {tilllll’ll in some ments, the T—cell engaging rnultispecitic table antibody includes an anti—CDSs schv and a cancer targeting antibody or anti gen—binding fragment thereof, Where at least one of the anti-CD38 scFv and/or the cancer ing antibody or antigen—binding portion thereof is masked. In some embodiments, the CD38 scFv includes a first dy or antigen~binding fragment thereof (A331) that binds CD38, where the A31 is attached to a g moiety ) such that ng of the MM} reduces the abiiity of the A31 to bind CD38. in some embodiments, the cancer targeting antibody or antigen— binding nt f inciudes a second antibody or fragment thereof that es a second antibody or antigen—binding fragment thereof (A82) that binds a second, cancer— related tar et, where the A32 is attached to a maskin g moiety (Mir/12) such that coupling of the MMZ reduces the ability ofthe A82 to bind the second, cancer-reiated target. in some embodiments, the CD38 scEy inciudes a first antibody or antigen~binding fragment thereof (A31) that binds CD}, a, where the AB} is attach ed to a masking moiety (MM 1) such that eouphng of the MM‘t reduces the ahiiity of the AB! to bind Cilia, and the cancer targeting antibody or antigen-binding fragment thereof inchrdes a second antibody or fragment thereof that inciudes a second antibody or n~binding fragment thereof (ABZ) that binds a second, cancer—related , where the A32 is attached to a g moiety (Mb/f2) such that coupiing of the MM2 s the abiiity of the A82 to bind the second, cancer—related target.

{Width} in some embodiments, the T—ceii engaging muitispecific activatabie antibody inciudes an DSE scf'v and a cancer targeting igG antibody or antigenvbinding fragment thereof, where at least one of the anti-CDEs scFV and/or the cancer targeting igG antibody or antigen—binding portion thereofis . in some embodiments, the CD38 scFV inciudes a first antibody or antigen-binding fragment thereof (AB} :3 that binds CD35, Where the A31 is attached to a masking moiety (MM 1) such that counting of the MMi reduces the abiiity of the A81 to bind CD38. in some embodiments, the cancer targeting ng antibody or antigen—binding fragment thereof includes a second antibody or fragment thereof that inciudes a second antibody or antigenvbinding fragment thereof (A82) that binds a second, cancer-related target, where the A82 is attached to a mashing moiety (MMZ) such that counting of the i‘s/iMZ reduces the ability of the ABE to bind the second, cancer-reiated target. in some embodiments, the CD38 scFv includes a first antibody or antigen~binding fragment thereof (A81) that binds CD38, Where the A31 is attached to a masking moiety (MME) such that coupling of the MM] s the abiiity of the A131 to bind CD33, and the cancer targeting antibody igG or antigen—binding fragment thereof inehides a second antibody or fragment thereof that inciudes a second antibody or antigen- g fragment thereof (AB2) that binds a second, -reiated target, where the A32 is attached to a masking moiety (Mir/I2) such that coupling of the MMQ reduces the ability of the A32 to bind the second, ~retated target. with"); in some embodiments, the 'l‘—ceil ng pecific activatable antibody includes an anti-CD'S epsilon (CD38) scf‘v that is derived from OKTB, where at least one of the targeting antibody or antigen—binding fragment thereof and/or the OKT3 scFV or OKTZL deriyed scFy is masked. In some embodiments, the OKT3 scFV or OK'l‘S—derived scFV includes a first antibody or antigen-binding fragment thereof (ABl) that binds CD38, Where the A81 is attached to a masking moiety (Midi) such that coupling of the MMi reduces the ability of the ABl to bind (2338. in some embodiments, the ing antibody or antigen— binding fragment thereof includes a second antibody or fragment thereof that includes a second antibody or antigen-binding fragment thereof (ABE) that binds a second target, where the A332 is ed to a masking moiety (Mir/I2) such that coupling of the MMQ reduces the ability of the ABE to bind the second target. In some embodiments, the OKT3 scFV or Oli'f3uderiyed scFV includes a first antibody or antigen-binding nt thereof (ABl ) that binds CD38, where the ABl is attached to a masking moiety (MM 1) such that coupling of the MMI reduces the ability of the ABl to bind (2338, and the targeting antibody or antigen~binding fragment thereof includes a second antibody or fragment thereof that es a second antibody or n-binding fragment thereof (ABZ) that binds a second target, where the A82 is attached to a mashing moiety (MMZ) such that coupling of the MMZ reduces the ability of the AB? to bind the second target. {@9928} In some embodiments, the T—eell engaging multispecific activatable dy includes an GKT3 scFv or OK'l‘BK-derived scFv and a cancer targeting dy or antige -- binding fragment f, Where at least one of the OKT3 scFV or OKTS—derived scFV and/or the cancer targeting antibody or antigenbinding portion thereof is masked. In some embodiments, the 0K3?) scE'V or CRIB-derived scE'V includes a first antibody or antigen-- binding fragment thereof (ABl) that binds CD38, where the A31 is attached to a masking moiety (MMl) such that coupling of the MMl reduces the ability of the ABI to bind CD38. in some embodiments, the cancer targeting antibody or antigen ~binding fragment thereof includes a second antibody or fragment thereof that includes a second antibody or antigen— g fragment thereof(ABE) that binds a second, cancer—related target, where the ABE is attach ed to a g moiety (MJVIZ) such that ng of the MME reduces the ability of the A82 to bind the second, cancer-related . In some embodiments, the CECE?) scE'V or OKT3~deriyed scFy includes a first antibody or antigen—binding fragment thereof (AB I i) that binds CD38, where the AB} is attached to a mashing moiety (Mb/ll i) such that coupling of the Ml‘vfl reduces the ability of the ABi to bind (3338, and the cancer targeting antibody or antigen~binding fragment thereof includes a second antibody or fragment thereof that includes a second antibody or antigen-binding fragment thereof (ABE) that binds a second, cancer—related target, where the A332 is attached to a masking moiety (Mix/l2) such that coupling of the Mix/l2 reduces the ability of the ABE to bind the , cancer~reiated target, liltiflill} in some embodiments, the f—celi engaging pecifrc activatable dy includes an OKT3 scFv or OKT3—deriyed scFv and a cancer targeting lgG antibody or antigen—binding fragment thereof, Where at least one of the OK'l'S scFy or OK’l‘3—deriyed scFV and/or the cancer targeting lgG antibody or antigen-binding portion thereof is masked. ln some embodiments, the QKTEi scFv or OKTS-derived scFv includes a first antibody or antigen-binding fragment thereof (ABl) that binds CD38, Where the ABl is attached to a masking moiety (MMl) such that coupling of the MMl s the ability of the A51 to bind CD343. ln some embodiments, the cancer ing lgG antibody or n—binding fragment thereof includes a second dy or nt thereof that includes a second antibody or antigen~binding fragment thereof (ABE) that binds a second, cancer~i'elated target, Where the A82 is attached to a mashing moiety (MMZ) such that coupling of the MMZ reduces the ability of the A332 to bind the second, cancer—related . in some embodiments, the QKT3 scliy or OKTS—deriyed scliy includes a first antibody or antigen— binding fragment thereof (A31) that binds C838, Where the ABl is attached to a mashing moiety {Mb/fly) such that coupling of the MMl reduces the ability of the A31 to bind CD38, and the cancer targeting antibody lgG or antigen~binding fragment thereof includes a second antibody or fragment thereof that includes a second dy or antigen—binding fragment thereof (ABE) that binds a second, cancer-related target, where the A82 is attached to a mashing moiety (Mb/12) such that coupling of the MIX/f2 reduces the ability of the ABE to bind the second, cancer—related target" {@9922} In some embodiments, the T—cell ng multispecific activatabie antibody includes an anti—CTLA—L‘t scFv, where at least one of the targeting antibody or antigen~ binding fragment thereof and/or the TLA—il scFv is . in some embodiments, the anti—C'l'l'sfivd scFV includes a first antibody or antigen—bind ing fragment thereof (AB l) that binds C'l‘LA-4, where the ABl is attached to a g moiety (Mix/ll) such that coupling of the Ml‘vll reduces the ability of the A131 to bind (FLA—4. in some embodiments, the targeting antibody or antigen—binding fragment thereof includes a second antibody or fragment thereof that includes a second dy or antigen~binding fragment thereof (ABE) that binds a second target, where the A82 is attached to a mashing moiety (MMZ) such that coupling of the MMZ reduces the ability of the A82 to bind the second target. in some embodiments, the anti~CTLA—4 scEy includes a first antibody or n~ binding nt f (ABl) that binds CTLA '4, where the Afll is attached to a masking moiety (MMl) such that coupling of the MMl reduces the ability of the A51 to bind CTLA—L‘l, and the targeting antibody or antigen—binding fragment thereof includes a second antibody or fragment thereof that includes a second dy or antigen—binding fragment thereof (AB2) that binds a second target, where the A32 is attached to a masking moiety (MME) such that coupling of the hilt/l2 reduces the y of the A82 to bind the second target. {99923} in some embodiments, the T—cell engaging multispeeific activatable antibody includes an anti-Cl'LAnd scFy and a targeting lgG antibody or antigen-binding fragment f, where at least one of the anti—CTLA—L‘l scFy and/or the targeting lgG antibody or antigen—binding portion thereof is masked. in some embodiments, the anti—CTLA—él scFV includes a first antibody or antigen~binding fragment thereof (A81) that binds l, Where the ABl is attached to a masking moiety (Mix/ll) such that coupling of the ll reduces the ability of the A131 to bind CTLA—d. in some embodiments, the targeting lgG antibody or antigen—binding fragment thereof includes a second antibody or nt thereof that includes a second antibody or antigen—binding fragment thereof (A82) that binds a second target, Where the A82 is attached to a masking moiety (MMZ) such that coupling of the Mth reduces the ability of the A82 to bind the second target in some embodiments, the anti"C‘TliA—dL scf'v includes a first antibody or antigen—binding nt thereof (A81) that binds C'l‘LA-d, Where the ABl is ed to a mashing moiety (Mb/ll) such that coupling of the MMl reduces the ability of the A81 to bind CTLA—él, and the targeting antibody lgtfi or antigen—binding nt thereof includes a second antibody or fragment thereof that includes a second antibody or antigen—binding fragment f (A82) that binds a second target, where the A82 is attached to a mashing moiety (MMZ) such that coupling of the Mth reduces the ability of the A82 to bind the second target, {$3824} in some embodiments, the antigen targeting antibodies and/or mu lti— antigen targeting activatable antibodies include at least a first antibody or antigen-binding fragment thereof that binds a first target and/or first e and a second antibody or antigen—binding fragment thereof that binds a second target and/or a second epitope. in some embodiments, the multi—antigen targeting antibodies an d/or multi—antigen targeting activatable antibodies bind two or more different targets, in some embodiments, the multi— antigen targeting antibodies and/or antigen targeting activatable antibodies bind two or more different epitopes on the same target. ln some ments, the mnlti—antigen targeting antibodies and/or mnlti—antigen targeting activatable antibodies bind a combination of two or more ent targets and two or more different epitopes on the same target.

EilllllZE} Various embodiments of multispecific activatable antibodies of the disclosure are shown in Figures 3A, and 5—9, in some embodiments, a, mnltispecii‘ic activatable antibody comprising an lgG has the lgG variable domains mashed. in some embodiments, a multispecil‘ic activatable antibody comprising a scFv has the scFv domains maslted. in some en'ibt’xlin'ients, a multispecific table antibody has both lgG variable domains and schv domains, where at least one of the lgG variable domains is coupled to a masking moiety. in some ments, a multispecilic activatable antibody has both lgG variable domains and scFv domains, where at least one of the scFv domains is d to a g moiety: in some embodiments, a mnltispecilic activatable antibody has both lgG variable domains and schv domains, where at least one of the lgG variable domains is coupled to a mashing moiety and at least one of the scFy domains is coupled to a mashing moiety in some embodiments, a maltispecillc activatable antibody has both lgG variable domains and scl3y domains, where each of the lgG variable domains and the sch‘v domains is coupled to its own g moiety. in some embodiments, one dy domain of a. maltispecific activatable antibody has specificity for a target antigen and another antibody domain has specificity for a 'l‘—cell surface antigen, in some embodiments, one antibody domain of a mnltispecific activatable antibody has specificity for a target antigen and another antibody domain has city for another target antigen. in some embodiments, one antibody domain of a m ultispecilic activatable antibody has specificity for an e of a target antigen and another antibody domain has city for r e of the target antigen.

Eillllthi} in a n'niltispecitic activatable ai'itibody, a scFy can be fused to the carboxyl terminus of the heavy chain of an lgG actiyatable antibody, to the earboxyl terminus of the light chain of an lgG activatable antibody, or to the yl i of both the heavy and light chains of an lgG activatable antibody. in a mtritispeciiic activatable antibody, a scFV ma. 1,49 can be fused to the amino terminus of the heavy Chain of an igG aetivatable antibody, to the amino terminus oi‘the Eight chain of an igG activatahie antibody, or to the amino termini of both the heayy and Eight ehains of an lgG aetiyata‘oie dy. in a mnitispeeifie aetivatahie antibody, a son can be fused to any ation of one or more carbonyl termini and one or more amino termini of an igG table antibody. in some ments, a masking moiety (MM) iinked to a eieavabie moiety (CM) is attached to and masks an antigen binding domain of the igG. in some embodiments, a masking moiety (MM) linked to a eleavahie moiety (CM) is attached to and masks an antigen binding domain of at ieast one scFV. in some embodiments, a masking moiety (MM) linked to a eieavabie moiety (CM) is attached to and masks an antigen binding domain of an igG and a masking moiety (MM) linked to a eieavahle moiety (CM) is attached to and masks an antigen binding domain of at least one SCFV. {99927} The disclosure provides exarnpies ot‘ i'nuitispecitie aetiva‘tahle antibody stmetui'es which include, but are not iitnited to, the ing: (\I’L-—CL)2:(VH-CH1CHE-- L4~Vi—i*i3 —VL*—L2~CM—Li —MM)3; (Vite—(314)} :(Vi-E—Ci-i i —Ci-i2—Ci-i3 —L4~VL*—L3— VH3" ~L2—Ci‘y’i—i... i —MM)Z; (MM—L i -t:fh/i—i_..2—V"L—Ci_i)3 : (VHCH} {HZ—CH3 —i_..4—VH*-i_.3 _ ‘Vli‘fig; (MM—L i,~CM~L2Wings);(Vii—CHl —CH2~CH3 ~i..r4—VL*—i..r3—VH*)2; (Vb CL)2I(MM--Li LZuVL*--L3-—VH* -vL4--VH-CH1-VCH2--CH3)2; (V L-CLbIM‘i‘s/i-LiCM L2—VH*—L3—VL*~L4—VH~CH l ~CH2~CH3)2; (MM—L l ~CM—LZ—VL—CL)?:(VL’B—L3—VHKL4— 1~Cli»i2—CIHS)2; (MM—L l ~CM—LZ—Vi_..—CL)2:(VH’k-LS—VL*—L4—VH—CH 1 (H?— CH3)3 ; (V’LuCLuLZt-N’Hgk--L3 --Vif x-LZ-{TMnLi -I\di\li)2i(VH--CH1--CHZ--CH3)3; (VL-CL-L4u \I’L*~L3—VH*~L2—CM—Li~h/ih'i:)2:(Vi-i—CE-ii—CE—i2—CE— 3h; (MM—Li—CM—L2—VL*~L3—VH*— i..4—‘v"L—CL)2:(VH{1H i -CH2—CH3)2; (MM—Li —Ci\’i—i_..2—VH* ~13 —VL* —i_J4—Vi_i—CL)2:(VH— CH 1 UCHE—CH3)2; (VLvCL—i/l—VHWLS~Vl.i*—i_/2vCM—L l $4M); (MM—L i ~CMUlJ2—X/Lit— L3--VH*~L4--VH~CH1~CH2-CH3)2; (VL—CL--L4-—VB?"--L3--VL*--L2~CM-Ll"Evin/Eb: (MM-- L i l,— L2~Vi-i*—L3 —VL*—L4~Vi—i—Ci-i l —CE—i2—CE—i3 )2; (VL—CL~L4—VL*—L3 —VH*—L2—Ci‘vi— L i —MM)2: (MM—Li ~CM—LZ—‘V’L* —Lf§—VH*~LL‘i—VH—CHE ~CHZ—CH3 )3 ; (Vi...—CL—i_..4—V"L*—LS — VHii‘x-LZ-Ci‘vinhi-MM)22 (MM-Li--CM--L2x-VFW-LE--VL*--L4-VH—-CHl--CHZ--CH3)2; (VLCL —Léi—V’i-fi—LES—VLfig: (Mix/iii~CM~L2—VL*—L3—VH*~L4—VH~CH i~CH2~Ci-i3)z; (Vb Ci...—Léi—‘v’i»i*—L3-VL*)g: (MM—Li ~CiVCt—L‘2—VH’1‘~13,—‘v’L*-L4—VH—CHiCHZ-C’HPih; (VL— —i/l—VL*~L3 —VH*)3: (MMUL l —Cl\/l~i..2—VL*~L3 —VH*~i..r4—VH~CH i, ~CH2~CH3)2; (Vb —VL*-—L3--VH*)22 (Mix/i-le-{Th/t-LEUVH*--L3~VL*-—L4--VH-—CH1-—CH2-—CH3)2; (VL- CL—Léi—VH*—L3—VL*—L2~Ch/1~Ll—MM)22 (Vie/’1‘—L3—‘v’E-i*—L4~Vi-i—CE—ii—CHZ—Ci—i3)2; (VL— CiL—Lél—Vl-fi—LES—VL*~L2—CM—LI~Mi‘s/llg: (VH*~L3—VL*—L4—VH~CH1~CH2—Cl-l3)2; (Vb Cl.;—Ld—VL*—L3—VH*—L‘2—Ch’i—Ll $4M); (VL’l‘~L3"Viv-LAVH—CH l-Cl’lZ-i:li’l3)g; or (Vb CL—i/l—VIJ‘41.3—VH*—l_/2wChI—I.II ans/n2; (VH*as v‘t/Ii‘Jed—VH~CH l, ~CH2~CH3 )2, wherein: VL and VB represent the light and heavy variable domains of the first specificity, contained in the igG; VL’Z‘ and Vl—i* ent the variable domains of the second specificity, contained in the scFv; LI is a linlrer peptide connecting the inaslring moiety (MM) and the cleavable moiety (CM); L2. is a linker peptide connecting the cleavable moiety (CM), and the antibody; L3 is a iinlrer e connecting the variable domains of the scFv; L4 is a linker peptide connecting the antibody of the first specificity to the dy of the second specificity; CL is the light-chain constant domain; and CH1, CH2, CH3 are the heavy chain constant domains. The iirst and second specificities may be toward any antigen or epitope. {99928} in some embodiments of a T—ceIl ng rnnltispecii'ic activatabie antibody, one antigen is typically an antigen t on the surface of a tumor cell or other cell type associated with disease, such as, but not limited to, any target listed in Table 1, such as, but not limited to, EGFR, erbBZ, EpCAM, .Iagged, PD—Ll, B7l’I3, or CIJ7l (transferrin receptor), and another n is typically a stimulatory (also re e "ed to herein as activating) or tory receptor present on the surface ofa Tnceil, natural killer (NK) cell, d rnononnclear cell, macrophage, and/or other immune effector cell, such as, but not limited to, 87—H4, BTLA, CD3, C134, CITES, CDI 6a, CUES, (2927, (2928, C2332, (2356, CHI 37 (also referred to as 'I'NFRSF9), CTLA '4, GITR, HVEh/l, ICOS, LAGS, NKGZD, 0X40, PD-i, TIGl'l‘, 'l'lM3, or VlS’l‘A. The antibody domain conferring specificity to the T—celI surface antigen may also be substituted by a ligand or ligand domain that binds to a T—cell receptor, a NK—cell or, a macrophage receptor, and/or other immune effector cell receptor, such as, but not limited to, B7-—l, 37-2, B7H3, PD-Ll, Pill-LE, or lNFSFQ. in some embodiments of a multi—antigen targeting activatable antibody, one antigen is selected from the group of targets listed in Table l, and another antigen is selected from the group of s listed in Table It Etllltlllgl in some embodiments, the targeting antibody is an GFR antibody. in some ernbodirnents, the targeting antibody is CZZSVS, which is specific for binding to EGFR in some embodiments, the targeting dy is C225, which is specific for g to EGFR. in some embodiments, the targeting antibody is C225V4, which is specific for binding to EGFR. in some embodiments, the targeting antibody is 7225x165, which is specific for binding to EGFR. in some ments, the targeting antibody is an anti~ Jagged antibody. in some embodiments, the targeting antibody is 43l l, which is specific for binding to human and mouse lagged l, and lagged 2, in some ments, the targeting antibody is élDl lv2, which is specific for binding to human and mouse lagged l and Jagged 2. {99938} In some embodiments, the targeting antibody can be in the form an activatable antibody. in some embodiments, the scFV(s) can be in the form of a Pro-scFV (see, e.g., liil} in some embodiments, the scFv is specific for binding CD38, and is or is derived from an antibody or fragment f that binds €338, erg, CH2527, EN l8, HL‘ZC, OKTB, 2C1 l, UCHTl, or V9. in some embodiments, the scFV is specific for binding CTLA—ll (also referred to herein as CTLA and CTLAd).

{MERE} in some ments, the anti~C33s seFv includes a sequence selected from the group consisting of those sequences shown in Table 7 and/or in Example 5. in some ments, the anti—C333 scFV es an amino acid sequence that is at least 90%, 9 %, 9 %, 939/0, 94%, 95%, 96%, 97%, 98%, 9 % or more identical to an amino acid sequence selected from the group consisting of those sequences shown in Table 7 and/or in Example 5,, {@9933} in some embodiments, the scFV is specific for binding one or more 'l‘--cells, one or more NK—cells and/or one or more macrophages. in some embodiments, the scFV is specilic for binding a target selected from the group ting ot‘BillZl, BTLA, CD3, 034-, C38, (33162:, C325, C327, C328, C332, C356, C3l37, Ath Gl’l‘R, HVEM, lCOS, LAG3, NKGZD, OX4tl, l’D-Vl, 'l‘lGlT, Hit/l3, or VlSTA. {96363343 in some embodiments, the multispecific antibodies, multispeciiic activatable antibodies, conjugated multispecific antibodies and/or conjugated iniiltispeci’ric activatable antibodies provided herein include at least a first antibody or antigen binding fragment f (A131) that specifically binds a Jagged target, e.g., Jagged 1 and/or lagged 2, and that contains a combination of a Vii CDRl sequence, a Vii CDR2 sequence, and a Vll CURB sequence, wherein at least one of the Vii CDRl sequence, the VH (DRE sequence, and the 7H CDR3 sequence is selected from a VB CDRl that sequence includes at least the amino acid ce SYAMS (SEQ ll) N3: 6); a Vl-l (332 sequence that includes at least the amino acid sequence SIDPEGRQTYYA3$VKG (SEQ ID NO: 7); a VH C393 ce that includes at least the amino acid sequence DIGGRSAFDY (SEQ ll) NO: 8), and combinations thereof. {dilllffidj in some embodiments, the ntultispecii‘ic antibodies, multispecific activatahle antibodies, conjugated multispecitic dies and/or conjugated multispecific activatable dies provided herein include at least a iirst antibody or n binding fragment thereof (Alli 7; that specifically binds a lagged target, eg lagged l and/or lagged 2, and that contains a combination of a VL CDRl sequence, a VL CDRB sequence, and a VL CDREl sequence, wherein at least one of the VL CDRl sequence, the VL CDR2 sequence, and the VL (IDES sequence is selected from a VL ClTJRl sequence that includes at least the amino acid sequence RASQSISSY (SFQ ll.) N0: 9); a VL CDRZ sequence that, includes at least the amino acid sequence AASSLQS (SEQ ll) NO: ill); a VL CDR3 sequence that es at least the amino acid sequence QQTVVAPPL (SEQ ll) NO: ll), and combinations thereof. lfillllBti} in some embodiments, the multispecitic dies, multispecific activatable antibodies, conjugated rnultispeciiic antibodies and/or coniugated multispecilic activatable antibodies ed herein e at least a first antibody or antigen binding fragment thereof (ABl) that specifically binds a lagged target, e.g., lagged l and/or lagged 2, and that contains a combination of a VB CDRl sequence, a VB CDRZ sequence, and a Vll CURB sequence, wherein at least one of the Vl-l CDRl sequence, the Vl-l CURE sequence, and the Vll CURE sequence is selected from a Vll CDRl sequence that includes a sequence that is at least 90%, 91%, 92%, 93%, 94%, 959/ 99% or more identical to , 96%, 97%, 98%, the amino acid sequence SYAMS (SEQ lD NO: 6); a Vll CDZ ce that includes a sequence that is at least 90%, Ella/ti, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to the amino acid sequence Sllfil’FGRQTYY/aDSVKG (SFQ ll.) NO: 7); a Vii CDRB sequence that includes a sequence that is at least 99%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more cal to the amino acid ce DlGGRSAFDY (SEQ ll) NO: 8.), and combinations thereof.

} In some embodiments, the inultispecitic antibodies, inultispecitic activatahle antibodies, conjugated rnultispeciiic antibodies and/or coniugated multispecilic activatable antibodies provided herein include at least a first antibody or antigen binding fragment thereof (ABl) that specifically binds a lagged , e.g., lagged l and/or lagged 2, and that contains a combination of a VL CDRl sequence, a VL CDRZ sequence, and a VL CDRS sequence, wherein at least one of the VL CDRl sequence, the VL (DDR2 sequence, and the VL CD113 sequence is selected from a VL CDRl sequence that es a sequence that is at least 909/11, 91%9 %,939/11, 94"/I11,95°1'€1, 96%, 979/11, 989/. 910111 or more ide1'1tical to the amino acid sequence RASQSlSSY (SEQ .11) NO: 9); a V11 CUR}: sequence that es a sequence that1s at least 911911, 919/11, 92921939111, 94%, 959/121, 99/11, 9°111, 989/11, 99% or more identicai to the amino acid sequence AII‘tSSLQStSEQ 11) NO: 10); and a VL CDR3 sequence that inc1udes a sequence that is at least 9119/11,919/11, 9.>91'3, 93%, , 959,6 969111, 979/11, 98"721., 999111 or more identical to the amino acid sequence QQI‘VVAPPL (SEQ 111 NO: 11), and combinations thereof. 111111138} In some embodiments, the n'1ultispecific antibodies, mu1tispecilic activatahle antibodies, conjugated multispecific antibodies and/or conjugated multispecitic activatahle antibodies provided herein include at least a first dy or n binding fragment thereof (ABl) that specificahy binds a Jagged target, eg, lagged l and/or‘ia{IQ010',__ed19 .and that ns a conihinatio1'1 eta V11 C1391 sequence, a V11 CDRZ sequence, 21 V11 CDR3 sequence, a VL {713111 sequence, a VL CDRZ ce, and a V11 (3139.3 sequence, n the ‘vi—lCDRl sequence includes at least the amino acid sequence S‘rAMS (SEQ 11) NO: 6),; the Vil C112 sequence includes at least the amino acid ce Sll)1’EGRQ"1‘YYADESK/KG (SEQ 1.1) NO: 7); the V11 C1393 sequence inc1udes at 1east the amino acid sequence DlGGRSAEDY (SEQ 11) NO: 8,); the VL CDRl sequence includes at least the amino acid sequence RASQS1SSY (SEQ 113 NO: 9); the VL CDRZ ce includes at least the amino acid sequence AASSLQS (SEQ 11) NO: l0); and the V1. CD913 sequence includes at least the amino acid sequente1.'QQ1\IVA1991. (SEQ l1) NO;1 l1 {9111139} In some embodiments, the intiltispecitic antibodies, mu1tispecific activatab1e antibodies, conjugated 1'nul'tispecitic antibodies and/or conjugated mu1tispeciiic activatable antibodies provided herein include at least a first antibody or antigen binding fragment thereof (ABl) that ically binds a Jagged target. e.g., lagged 1 and/or jagged 2, and that contains a combination of a VH {DDR1 sequence, 21 V11 CDRZ sequence, a \"1-1 CDR3 sequence, a VI. C1911 ce, a VLtD1312 sequence, and a \I’l. C1311:~ sequence, n the V11 C1311 1 sequence includes a sequence thatis at least 9119/11, 9 1°"1.11 929’111, 939/11, 94%, 959/11, , 97'1'11. 911°111, 999/151 or more identica1 to the amino acid sequence SYAMS (SEQ l1) NO: 6); the V11 CD2 sequence i1'1c1udes a sequence that is at least 909/11,, 91%.92°1'11, 93%, 9/49121 959/, 969/11, 97°1'.11 989’111, 999/ or more identical to the amino acid ce SlDPEGRQTYYADSVKG (SEQ 11) NO: 7,); the VB CD113 sequence inc1udes a sequence thatis at 1east 911911, 91%, 92911, 93%,. 94%, 959/151, 96%,. 97%, 98911, 99911 or more identical to the amino acid sequence DIGGRSAEDY (SEQ 113 N13: 83; the VL {DDR1 ce includes a sequence that is at 1east 909/11, 91%92m, 93%, 949711, 95%, 96%, 979/11, 981%, 91% or more identical to the amino acid sequence RASQSISSY (SEQ 113 NO: 93; the "1/1.. CDRZ sequence includes a ce thatis at least 913%, 91 %, 929/11, 93%, 94%, 959/11, 96% 97%, 989//0 9 % or more cal to the amino acid sequence AASSLQS (SEQ 11) NO: 103; and the VL C13R3 sequence includes a ce that is at least 911%,919/11,§12%93%, 949/11, 959/11,9(19/E1, 97%, 98"10, 999/11 or rnore identical to the amino acid sequence QQ'l‘V‘v’APl’L (SEQ 113 NO: 11). 1111111411} in some embodiments, the multispecific dies, ntuitispecific activatable antibodies, conjugated multispecific antibodies and/or conjugated multispecific activatable antibodies ed herein include at least a first antibody or antigen binding fragment theieol ("11813 that spec1fitally binds Epidermal Growth Fact01 or(EGFR): and that contains a combination of a ‘\.I11 CIDRl sequence, a ‘v’li CIDR2 sequence, and a Vii CI13R3 sequence, wherein at least one of the Vll .1 sequence, the V11 CDR2 sequence, and the Vl—i CDR3 sequence is selected from a VH {DDR1 sequence that includes at least the amino acid sequence NYCl‘tIlitSEQ 113 NO:123, a V11 (.132 sequence that includes at 1east the amino acid sequence VIWSGGN'LDYN'FRF’ES (SEQ 113 NO: 133; a V11 C13R3 sethence that includes at least the amino acid sequence AL'LYYD‘YEFAY (SEQ 113 NO: 14); and combinations thereof. {1311114111 111 some einbt'idiinents, the tnultispecitic antibodies, inultispecific activatable antibodies, conjugated multispecific antibodies and/or conjugated multispecitic activatable antibodies provided herein e at least a first antibody or antigen binding fragment thereof (A1313 that specihcally binds EGFR and that contains a combination of a "l. CDRl sequence,a V1 Cl3R2 sequence, and a Vi C13R3 SIequence, wherein at least one of the "1/1..

CDRl sequence the \IL CDR2 sequence and the VL CDR3 sequence is selected from a VL CDR1 sequence that includes at least the amino acid sequence RASQSILtTNll-l (SEQ 113 NO: 153, a V1... C13R2 sequence that includes at least the amino acid sequence RYASlIS1S (S130 113 NO: 163; and a Vi C13R3 SIequencetthat includes at least the amino acid sequence QQNNNWPTT (SEQ 113 NO: 1 ’3 and combinations the1eo1 {11111142.} in some embodiments, the multispecific antibodies, ntuitispecific activatable antibodies, ated multispIecittc antibodies and/o1 conjugated multispecific activatable antibodies provided herein include at least a first antibody or n g fragment thereof (ABl) that ically binds ECEFR and that ns a combination of a V11 CDRl ce, 21 V11, CDR2 sequence, and 21 V11, CURB sequence, wherein at 1eas‘1 one of the VE-i CDR1 sequence, the Vi1 CDRZ seque1',1ce and the VH CURE~ sequence is se1ecte=d ho1n 21 V11 CD111 sequence that inciudes a sequence that is at 1east 911%,91%, , 93%, 949/11, 95""221, 96%, 97%, 980A1, 99% or more identicai to the amino acid sequence NYGVH (SEQ 1113 NO: 12); a V11 CD2 sequence that inciudes a ce that is at 1eas‘1 1, 919/114 92%, 93%, 94%, 95%, 96%, 97969891199921 or more identicai to the amino acid sequence Vi‘y’VSGGN1119191171171S (SEQ 113 N0213);a 911 CDR3 sequence that inciudes a sequence that is at 1east 90921, 919’/c4 9 %, 939/151, 94911, 95°/21, 969-41, 97'7/21, 989/114 99% or more ide1=1ticai to the amino acid sequence D‘YEFAY (91.7171 11) NO: 14); and combinations thereof. 1111111431 111 some embodiments, the niuitispecific dies, inuitispecific activatahie antibodies, conjugated n1u1tispecifie antibodies and/o1 conjugated 1nuhisr1ecitic activatahie antibodies provided herein e 2tt 1e21st 21 first antibody o1 a1'1tigen binding nt thereof (ABi) that specificaiiy binds EGFR and that contains a combination of a VL CDRi sequence, 21 VL CD112 sequence, and a VL (DDR3 sequence, wherein at 1east one of the VL (1)1121 sequence, the V1. CD112 sequence, and the VI. 1T’DR3 sequence is seiected troin a V1.1 CD111 sequence that inciut es a seqt ence that is at 1east 911%, 91%,92%, 93 9:1, 94%, 95""221, 96/21, 97%, 98"721 999c or more identicai to the amino acid sequence 1L’1SQS1G’1‘N1H (SEQ 11) N10: 15); a VL CDR2 sequence that inciudes 21 sequence that151 at 1east 911°/21, 91%, 92%939/21, 94%, 95911, 969"97%, 989/11, 99% or more identicai to the amino acid ce KYAhhS19 (SEQ 11) NO:16); and a V1 CUR} sequencethat inciudes a sequence thatis at 1east 911921, 91%, 9791. 93%, 94%, 959/11, 96%, 97921, 98%, 991/11 or more identicai to the amino acid ce QQNNNW1‘11 (SEQ 11) NO: 17), and combinations thereof. {11111144} in some embodiments, the niuitispeeific antibodies, pecific activatahie antibodies, conjugated inuitispeeifie antibodies and/or conjugated muitispecific activatahie antibodies provided herein inciude at 1e21st 21 first antibody or antigen binding fragment thereoi‘ (A‘Bi) that s1=ciiica11y binds EGFR and that contains a ation ot 21 V11 C1TJR1 sequence, a V11 CURE sequence, a V11 CD113 sequence, a V11 CURi sequence, . CDR2 sequence, and 2t VL CERES sequence, wherein the Vi—1 CDRi sequence ineiudes at 1e21st the amino acid sequence NYGV1:1 (SEQ 11) NO: 12); the V11 C1312 sequence inciudes at least the amino acid sequence V1WSGGN'TD’Y’N'I‘PF'i"S (SFQ 11.) NO: 13); the V11 CD113 ce es at 1east the amino acid sequence AL’i‘Y‘i’DYEFAY {SEQ 11) NO: 141); the VL CDR1 sequence inciudes at 1east the amino acid sequence RASQSiGTNiE-i (SEQ 11) NO: l5); the VL CDRZ sequence includes at least the amino acid sequence KYASESlS (SEQ ll) NO: 16); and the VL CDRB sequence includes at least the amino acid sequence QQNNNWP'IT (SFQ ll) N0: t7). {999453 in some embodiments, the niultispecitic antibodies, inultispecii‘ic activatable antibodies, conjugated ntultispecilic antibodies and/or conjugated inultisnecitic activatable antibodies provided herein include at it.'1st 21 first antibody or n binding nt thereof (ABl) that specifically binds EGFR and that contains a combination of a Vii CDRl sequence, a Vi-l CDR2 sequence, a Vi-l CDR3 ce, a VL CDRl sequence, a VL {DDR2 sequence, and a VL CDR3 sequence, wherein the Vll CDRl sequence includes a sequence that is at lcast 999/, 91%, i1, 93/0,94%, 95%, 96%, 979/11, 98%, 99% or more identical to the amino acid sequence NYGVH (SEQ lD NO: l2); the Vii CDZ sequence includes a sequence thatis at least 90911, 91911, 92%, 93%, 94%, 959/21, 96%, 97%, 989/151, 9996 or more identical to the amino acid ce V1WSGGNTDYNTFTT":(SEQ ll") NO: l 31 the Vll (LDRZi sequence includes a sequence thatis at least 99%,9l9/11, 97911 93%, 9490, 95%, 96%, 97%, 98921, 99% or more identical to the amino acid sequence ALTYYDYEFAY (SEQ ll) NO: l4); the VL ClTJRl sequence includesa'asequence thatis at least 909/11, 9t 9/:(1, 929/11,93911, 9/49l1',t1 959/, 96%, 97911,1 989111, 999/ or more identical to the amino acid sequentc RASQSlG’l‘NlH (SEQ ll) NO: 15); the ‘VL CDRZ sequence includes a sequence that is at least 90921, 9l%, 92911, 93911, 949/6, 95911, '9/11 989%, 99916 or more identical to the amino acid sequence KYASESlS (SEQ ll) N0: l6); and the VL CUR?) sequence includes a sequence that is at least 909/11, 9l9111, 929/11, 93%, 94%, 959«{1,9t‘:19/t1,9 '96, 989111, 99% or more identical to the amino acid sequence QQNNN WP'iT (SEQ ll) NC}: l7). lililil4ti} in some embodiments, the n'iultispecific antibodies, rnultispecillc activatable antibodies, conjugated specitic antibodies and/or conjugated specitic table antibodies provided herein include at least a heavy chain amino acid sequence selected from the group consisting of those sequences shown in Table 7 and/or in Example 5 including Table ll therein, ln some embodiments, the rnultispecilic antibodies, multispecil‘ic activatable antibodies, conjugated niultispecitic dies and/or conjugated specitic activatable antibodies provided herein include at least a light chain amino acid sequence selected from the group consisting of those cessshown in Table 7 and/or in ple , including Table ll n, in some embodiments, the niultisiecitic antibodies, niultispecific activatable antibodies, conjugated ntnltispecitic antibodies and/or conjugated multisnecilic activatable antibodies provided herein include at least a heavy chain amino acid sequence seleCted iiom thegrenp CCnSiSting 01 those sequenCes 11 Table? and/or in ExampleC .including TablC ll , n, and a light Chain amine aCid SCun111Ce SeleCted from the group Consisting efthesC1SequenCSSliewn in Table 7 and/011a Example , including Table ll therein. {999473 in some einhediinents, the pecilic antibodies, multispecil’ic aCtivatahle antibodies,cenjugated tnultispC1CiflC antibodieS and/or conjugated multiSpeCific activatable dies provided herein include at leaSt a heavy, chain amino acid sequence that is at leaSt 90/0, 9l°/Et, 92%, 93°A), 94%,95%, 96%, 97%, 989/151, 99% 01' more identical to an amino aCid Sequence SeleCted from the group consisting of those sequenceSSS"hnw11i11Tahle7 and/111111 Example 5, including Table l l therein. In some embodiments, the multiSpecific antihedies, niultispecific aCtivatahle dieS, conjugated multiSpeCitlc antibodies and/01‘ conjugated multispecitic aCtivatahle antibodies provided herein inClude at least a light Chain amine aeid seunnee thatis at leaSt 91°/0, 91%, 929/11,, 93%, 94%o, 959/, 96%, 97%, 98,0, 99°76 or more identiCal to an amino acid sequence ed from the grnup censisting of those sequenCes shown in Table 7 and/or in Example 5, including Table l l therein. in some emhediinents, the 1nultiSpCeil'1c antihodieS, multispeCilie activatahle antibodieS, conjugated multiSpecitiC dieS and’ot ated multiSpCCitie activatable antihedim provided herein include at leaSt a heavy, Chain antino aCid sequenCe that18 at leaSt 90% 9l°/0, 92°,0, 939/11, 94%, 95%, 96%,’ %,/ 98°, o, 99921 111' more identiCal tn an antino aCid sequenCe seleCted from the greup conSiSting ‘of those sequences shown in Table 7 and/011111 Example 5, including Tahle ll thCtein and a light Chain atnino aCid Sequenee that15 at leaSt 90°«1, 9l%, 92%, 93%, 94%, 95%, 96°72; 97%, 98°,0, 99% or more identiCal to an amino acid sequence seleCted from the group Consisting of these sequences Shownin Table", and/or in Example 5, including Table ll n. {9994-83 in some einhndiinentS, the niultispecifiC antibody and/or inultiSpeCifiC aetivatable dy alse includes an agent coniugated to the AB. in same embodiments, the agent iS a tl'ierapeutie agent. in Seine e1'nhodi1'ne11ts,the agent iS an antineoplastie agent in Some ments, the agent iS a toxin er ftagrnent thereof. in Some embodiments, the agent iS cenjugated to the inultispecihc via a linker in some emhediinents, the linkei1s a non-cleavable linker. Tn SOmt: e1'nhedi1ne11tS, the agent iS a niiei‘otuhnle tor. ln some embodiments, the agent is a nucleic aCid damaging agent, such aS a DNA alltylator or DNA interCalator, or other DNA damaging agent. ln some embodiments, the linker iS a Cleavable . in some emhediments, the agent is an agent seleCted from the group listed in Table 4. In some embodiments, the agent is a dolastatin. in some embodiments, the agent is an auristatin or derivative thereof. in some embodiments, the agent is anristatin E or a derivative the eof. in some ments, the agent is monoinetliyl auristatin F (MMAE), in some embodiments, the agent is monomethyl auristatin D tlvlh’lAD). in some embodiments, the agent is a maytansinoid or maytansinoid derivative. in some embodiments, the agent is Dix/ll or Dir/ill. in some embodiments, the agent is a duocarmycin or derivative thereof. in some embodiments, the agent is a calicheamicin or derivative thereof. in some embodiments, the agent is a pyrrolobenzodiazepine.

Eilllll49} in some embodiments, the rnultispecific dy and/or inultispecitic actiyatable antibody also includes a detectable moiety, in some embodiments, the able moiety is a stic agent.

Eddhfitll in some embodiments, the multispecitic antibody and/or multispecitlc activatable antibody naturally contains one or more dis ultide bonds, in some embodiments, the multispecil‘ic antibody and/or rnultispecitic activatable antibody can he ered to include one or more disull’ide bonds.

Eiltltifil} The disclosure also provides an isolated nucleic acid molecule encoding a multispeciiic antibody and/or niultispecilic activatahle antibody described herein, as well as vectors that include these isolated nucleic acid sequences. The sure es methods of producing a multispecitic antibody by ing a cell under conditions that lead to sion of the antibody, wherein the cell comprises such a nucleic acid molecule. in some embodiments, the cell comprises such a vector, iddttfill The disclosure also p ‘ovides pecitic activatable antibodies and/or teciiic actiyatable antibody conrpositirms that e at least a lirst antibody or antigen—binding fragment thereof (ABl) that specifically binds a first target or first epitope and a second antibody or antigen-hiding fragment thereof (ABE) that binds a second target or a second epitope, where at least AB} is coupled or otherwise ed to a masking moiety (MMl ), such that coupling of the MMl reduces the ability of ABl to bind its target in some embodiments, the Ml‘vil is coupled to ABl via a first cleavable moiety (CMl) sequence that includes a substrate for a se, for example, a protease that is co—locaiized with the target of ABl at a treatment site or a diagnostic site in a subject, The mnltispeciiic actiyatable antibodies ed herein are stable in circulation, activated at intended sites of therapy and/or diagnosis but not in normal, Le, healthy tissue, and, when activated, exhibit binding to the target of ABE that is at least comparable to the corresponding, unmodified niultispecific antibody } ln some embodiments, the multispecific activatahle antibody ses a linking peptide between the MMl and the CMl.

Ellllllfidl in some embodiments, the pecitic activatable antibody ses a linking peptide between the CM} and the ABE. {tillllfifii in some embodiments, the activatahle antibody comprises a first linking peptide (LPl) and a second g peptide (LPQ), and at least a portion of the rnultispecific actiyatable antibody has the structural arrangement from N—terminus to C—terminus as follows in the uncleayed state: Ml‘vl‘t —LFl—Cl\v’ll—Ll)2—Al3l or ABl—i..i’2~Ch/,ll~l..l’l hilt/EL in some embodiments, the two linking peptides need not be identical to each other. {999563 in some ments, at least one ol'iLPl or Ll?2 includes an amino acid sequence selected from the group consisting ottGS)", (868)", (GSGG'S)11 (SEQ. ll) N0: l8) and (GGGS)n (SEQ ll) N0: l9), Where n is an integer of at least one. in some embodiments, at least one of LPl or LPZ includes an amino acid sequence selected from the group ting of GGSG (SEQ ll) NO: 20), (36886 (SEQ ii) NO: 21), GSGSG (SEQ ll?) NO: 22), GSGGG (SEQ ii) N0: 23), GGGSG (SEQ ll) NO: 24), and GSSSG (SFQ ll) NO: 25). {999573 in some embodiments, the multispecitic activatable antibody includes at least a lirst antibody or antigen—binding fragment thereof (ABl) that specifically binds a first target or first epitope and a second antibody or antigen ~binding fragment thereof (ABE) that specifically binds a second target or second epitope. in some embodiments, each of the AB in the multispecilic activatabie antibody is independently selected from the group consisting of a monoclonal antibody, domain antibody, single chain, Fab fragment, a F'tah'h fragment, a scFV, a scAh, a dAh, a single domain heavy chain antibody, and a single domain light chain antibody. in some embodiments, each of the AB in the mnltispecil‘ic activatable antibody is a rodent (cg, mouse or rat), chimeric, humanized or fully human monoclonal antibody.

Etlllllfitil in some ments, each of the AB in the specilic activatable antibody has an equilibrium dissociation constant of about lGG anl or less for g to its ponding target or epitope.

EiltltlSQ} in some embodiments, MMl has an equilibrium dissociation constant for binding to its corresponding AB that is greater than the equilibrium dissociation constant of the AB to its corresponding target or epitope. gasses; in some embodiments, Mir/ll has an equilibrium dissociation nt for binding to its ponding AB that is no more than the equilibrium dissociation constant of the AB to its ponding target or epitopel {tilllltil} in some embodiments, MMl does not interfere or compete with its corresponding AB for binding to the ponding target or e when the multispecil‘ic activatable antibody is in a cleaved state. {lllllle} in some embodiments, Mlvll is a polypeptide of about 2 to 40 amino acids in length. in some embodiments, each of the MM in the multispeciflc activatable antibody is a, polypeptide of no more than 40 amino acids in length. {99963} in some embodiments, MMl has a polypeptide sequence that is different from that ol‘target of the corresponding AB.

Eiltltlhd} in some embodiments, MMl has a polypeptide ce that is no more than 50% identical to any natural binding partner of the corresponding AB. in some embodiments, Mix/ll has a ptide sequence that is no more than 25% identical to any l binding partner of the corresponding AB. in some embodiments, Ml‘vll has a polypeptide sequence that is no more than ltl‘E/o identical to any natural binding partner of the corresponding AB. {@9965} In some embodiments, the coupling of Mir/ll reduces the ability of the corresponding AB to bind its target or epitope such that the dissociation constant (lid) of the AB when coupled to the Mix/ll towards its corresponding target or epitope is at least 20 times greater than the Kd of the AB when not coupled to the Mir/ll towards its corresponding target or epitope.

Million; in some embodiments, the coupling of l reduces the ability of the ct‘rrresponding AB to bind its target or epitope such that the dissociation constant (Kid) of the AB when coupled to the Mir/ll towards its corresponding target or epitope is at least 4t) times r than the lid of the AB when not d to the Mix/ll towards its ponding target or epitope. {lllllld’l} in some embodiments, the coupling of MMl reduces the ability of the corresponding AB to bind its target or epitope such that the dissociation constant (Kid) of the AB when coupled to the MMl towards its corresponding target or epitope is at least lOG 7’ ‘2 .r.i./ times greater than the lid of the AB when not coupled to the Mix/ll s its corresponding target or epitope. {arises} in some embodiments, the coupling of MMl reduces the ability of the corresponding AB to bind its target or epitope such that the iation constant (lg) of the AB when coupled to the MMl towards its corresponding target or epitope is at least lOGG times greater than the Kd of the AB when not coupled to the Milt/ll towards its corresponding target or epitope.

Shilling} in some embodiments, the ng of MMl reduces the ability of the corresponding AB to bind its target or epitope such that the dissociation constant (Kd) of the AB when coupled to the MMl towards its corresponding target or epitope is at least lQflOO times r than the Kd of the AB when not coupled to the MMl towards its corresponding target or epitope. {99978} In some embodiments, MMl is an amino acid sequence selected from a MM shown in the Examples provided herein. l’l’l} in some embodiments, the speeilic activatahle antibody includes at least a second masking moiety (MME) that ts the binding of the A82 to its target when the multispeeiiie activatahle antibody is in an uncleave' state, and a second cleavahle moiety (CMZ) d to the A32, wherein the CM}: is a ptide that functions as a substrate for a second protease. in some embodiments, Cit/l2 is a polypeptide of no more than 15 amino acids long. ln some ments, the second protease is co—localized with the second target or epitope in a tissue, and wherein the second protease cleaves the CM2 in the multispeciiic activatable antibody when the inultispecitic activatable dy is exposed to the second se. in some embodiments, the first protease and the second protease are eo—loealized with the first target or epitope and the second target or epitope in a tissue. in some embodiments, the first protease and the second protease are the same protease. in some embodiments, (Ills/ll and CMZ are different substrates for the same protease. in some embodiments, the protease is selected from the group consisting of those shown in Table 3. in some embodiments, the first protease and the second protease are different proteases, in some embodiments, the first protease and the second protease are different proteases selected from the group consisting of those shown in Table 3. {$3872} in some embodiments, each of the MM in the multispecifie activatable antibody, eg MM} and at least MME, has an equilibrium dissociation constant for binding to its corresponding AB that is greater than the equiiibrinm dissociation constant of the AB to its corresponding target or epitope {$3873} in some embodiments, each of the MM in the muitispeeific activatahie antibody has an equiiibriurn dissociation nt for binding to its corresponding AB that is no more than the equilibrium dissociation constant of the AB to its corresponding target or epitope.

EQtBtBM} in some ments, each of the MM in the muitispeciiic activatabie antibody does not interfere or compete with its corresponding AB for binding to the con‘esponding target or epitope when the rnuitispeciiie activatabie antibody is in a cieaved state: {8963753 in some ments, each of the MM in the speciiic tahie antibody is a polypeptide of about 2 to 40 amino acids in length. in some embodiments, each of the MM in the rnuitispecitic activatabie antibody is a polypeptide of no more than 4() amino acids in iength.

Etititi’i’di In some embodiments, each of the MM in the ispeciiic activatabie dy has a poiypeptide sequence that is ent from that of target of the corresponding AB {8963773 in some ments, each of the MM in the rnuitispeciiic activatahie antibody has a polypeptide sequence that is no more than 50% identicai to any naturai binding partner of the corresponding AB. in some embodiments, each of the MM in the muttispecitie aetivatabie antibody has a polypeptide sequence that is no more than 25% identical to any naturai binding partner of the corresponding AB. in some embodiments, each of the MM in the n'iuitispecifie tabie antibody has a poiypeptide sequence that is no more than 19% identicai to any naturai binding partner of the corresponding AB. {@9978} in some embodiments, the coupiing of each of the MM reduces the y of the corresponding AB to bind its target or epitope such that the dissociation constant (Kd) of the AB when coupled to the MM towards its corresponding target or epitope is at ieast 20 times greater than the rid of the AB when not conpied to the MM towards its corresponding target or epitope.

{BMW} In some embodiments, the coupiing of each of the MM reduces the ability of the corresponding AB to bind its target or epitope such that the iation constant (Kd) of the AB when coupled to the MM towards its corresponding target or epitope is at ieast 4i) times greater than the lid of the AB when not coupled to the MM towards its corresponding target or e. ltlil} in some embodiments, the coupling of each of the MM reduces the ability of the corresponding AB to bind its target or epitope such that the dissociation constant (Kd) of the AB when coupled to the MM towards its corresponding target or epitope is at least 100 times greater than the Kd of the AB when not coupled to the MM towards its corresponding target or epitope.

Eiltitittl} In some embodiments, the coupling of each of the MM reduces the ability of the corresponding A3 to bind its target or epitope such that the dissociation nt (Kl) of the AB when coupled to the Mh'l towards its corresponding target or epitope is at least l times r than the Kd of the AB when not coupled to the MM towards its ponding target or epitope, {@9982} In some embodiments, the coupling of each of the MM redu "es the ability of the ponding AB to bind its target or epitope such that the dissociation constant (lid) of the AB when coupled to the MM towards its corresponding target or epitope is at least lbfifitl times greater than the Kd of the AB when not coupled to the MM towards its corresponding target or epitope. 3 in some embodiments, each of the MM is an amino acid ce selected from a MM shown in the Examples provided herein. {99984} in some ments, the protease that cleaves the lirst ble moiety (CMl) sequence is co-—localized with the target of the ABl in the multispecitic activatable antibody in a tissue, and the protease cleaves the CMl in the multispecific activatahle antibody when the niultispeeit‘ic actiyatable antibody is exposed to the protease. {lllllltloi} in some embodiments, the niultispeeific activatable antibody includes more than one cleavable moiety sequence, and the protease that cleaves at least one cleayable rnoiety sequence is co—localized with the target of at least one of the AB regions in the rnultispecitic tahle antibody in a tissue, and the protease cleaves the CM in the multispecitic activatahie antibody when the inultis eci’tic actiyata‘oie antibody is e 'posed to the protease.

Etitltlliti} In some embodiments, each CM, e.g., CMl and at least CM2, is positioned in the mnltispeeitic table antibody such that in the uncleayed state, binding of the multispecilic activatahle antibody to a target of one of the AB regions is reduced to occur with an equilibrium dissociation constant that is at least 20~told greater than the equilibrium dissociation nt of an unmodified AB binding to its target, and whereas in the cleaved state, the AB binds its target. {llililil’ll ln some embodiments, each CM is positioned in the multispecitic activatahle antibody such that in the uncleaved state, binding of the multispeeific activatahle antibody to a target of one of the AB regions is reduced to occur with an equilibrium iation constant that is at least zl-(lvfold greater than the equilibrium dissociation constant of an unmodified AB binding to its target, and s in the d state, the AB binds its target.

Eiltltlilii} in some embodiments, each CM is positioned in the multispecific activatable antibody such that in the uncleaved state, binding of the multispecific activatable antibody to a target of one of the AB regions is d to occur with an equilibrium dissociation constant that is at least 50—fold greater than the equilibrium dissociation constant of an ilied AB binding to its target, and Whereas in the cleaved state, the AB binds its target, Etltltléiél} In some embodiments, each CM is positioned in the niultispecitlc activatable antibody such that in the uneleaved state, binding of the multispecitic activatable antibody to a target of one of the AB regions is reduced to occur with an equilibrium dissociation constant that is at least ltltlufold greater than the equilibrium dissociation constant of an untnodilied AB binding to its target, and whereas in the cleaved state, the AB binds its target, {@9998} In some embodiments, each CM is positioned in the inultispecii‘ic activatable antibody such that in the uncleaved state, binding of the multispecitic aetivatahle dy to a target of one of the AB s is reduced to occur with an equilibrium dissociation constant that is at least mil—fold greater than the brium dissociation constant of an unmodified AB g to its target, and Whereas in the cleaved state, the AB binds its {999%} in some embodiments, each CM in the multispecitic activatable antibody is a polypeptide of up to t5 amino acids in .

Eiltltlilll} In some embodiments, at least one (M in the inultispecilic activatable antibody includes the amino acid sequence LSGRSDNH (SEQ ll?) NO: 26). in some embodiments, at least one cleavahle moiety is selected for use with a specific protease, for example a protease that is known to be co-iocalized with at least one target of the inultisnecitic activatable antibody. For example, suitable cleavable moieties for use in the nmltispecilie activatable antibodies of the disclosure are cleaved by at least a protease such as nrohinase, legurnain, and/or rnatriptase (also refen‘ed to herein as MT-SPI or MTSEl ).

In some embodiments a suitable eleavable moiety includes at least one of the ing sequences: PSWV (SEQ lD NO: 27); SARGPSRW (SEQ ID NO: 28); 'I'ARGPSFK (SEQ ll) N0: 29:); LSGRSDNE—I (SEQ ID NO: 26); GGWHTGRN (SEQ ID NO: 30); H’l‘GRSGAL (SEQ II) NO: 3 l); Pljl‘GRSGG (SEQ. ll) NO: 32); AARGI’AIH (SEQ II) NO: 33); RGI’AE‘NI’M (SEQ Ii) NO: 34); AYL (SEQ ID NO: 35); RGI’A’I‘I’IM (SEQ ID NO: 36); RGPA (SEQ ID NO: 37); Psili'h/l‘th’ili'ii’ (SEQ ID NO: 38); ITGL (SEQ II) N0: 39‘); VHMPLGFLGP (SEQ ll?) NO: 40); SPLTGRSG (SEQ II) NO: Ill); SAGFSLPA (SEQ ll) NO; 42); IAAPIerIsQRR (SEQ ll) NO: 43); SGGI’LGVR (SEQ ID NO: 44); and/or l’LGL (SEQ ID NO: 45). 33 In some ments, each Cit/l, in the mnitispecific aetivatahle antibody is a substrate for a se selected from the group consisting of those shown in Table 3. In some embodiments the protease is selected from the group consisting of nPA, legumain, MT—Sl’l, ADAMW, Bh/lP—l, TMI’RSS3, TMPRSSL‘l, nentrophii se, MMRI MMP—9, MMP—l 2, IS, and MMILI 4. In some embodiments, the se is a sin, such as, but not limited to, cathepsin S. In some embodiments each CM in the inultispecific activatable antibody is a substrate for a protease selected from the group consisting of nPA (nrokinase piasminogen activator), legnmain and MT—SEl (inatriptase). In some embodiments, the protease comprises tiPA. In some en'ibodiments, the protease comprises in. In some embodiments, the protease comprises lVl’IlSPli In some embodiments, the protease comprises a matrix metalloproteinase (ls/IMP). lilllllga’l} In some embodiments, at least one CM in the rnnltispecitic aetivatabie antibody is a substrate for at least two proteases. In some embodiments eaeli protease is selected from the group consisting of those shown in Table 3. In some embodiments at least one CM in the nmltispecilie activatable antibody is a substrate for at least two proteases, wherein one of the proteases is selected from the group consisting oi’uPA, legumain and IVI’I‘—SI)l and the other protease is selected from the group consisting of those shown in Table 3. in some embodiments, at least one CM in the mnitispecific aetivatahle antibody is a substrate for at least two proteases selected from the group consisting of uPA, legumain and Ml‘vSl’l. {899953 in some embodiments, the multispecific activatable antibody includes at least a first CM (CMI i) and a second CM (CMZ). In some embodiments, Civil and CMQ are part ofa single cleavable linlter that joins an MM to an AB. in some embodiments, CMl is part ofa cleavable linl Etltltig’l’} in some embodiments, the rnultispeeilic activatable antibody also includes a signal peptide. in some embodiments, the signal peptide is conjugated to the multispecitic activatable antibody via a spacer. in some embodiments, the spacer is conjugated to the multisbecific activatable antibody in the absence of a signal peptide. in some embodiments, the spacer is joined directly to at least one of the MM of the multispecitic actiyatabie antibody. {tillmd} in some embodiments, the mnltispecitic table dy in an uncleaved state comprises a spacer that is joined directly to a tirst MM and has the structural arrangement from N—terminus to (fl—terminus of spacer—MMl Chit-ASL in some embodiments, the spacer includes at least the amino acid ce QGQSGQ (SEQ. ll) NO: 46). {dilllggl in some embodiments, the serum half—lite of the multispecil’ic activatabie antibody is longer than that of the corresponding multispecitic antibody; e.g., the {iii of the pecitic activatable antibody is longer than that of the ponding mnltispecific antibody. in some embodiments, the serum half—life of the ninltispecil‘ic aetivatable antibody is similar to that of the ponding nmltispecitie antibody. in some embodiments, the serum half—life of the innltispeeitie activatable antibody is at least l5 days when administered to an organism. in some ments, the serum ife of the multisnecitic activatable antibody is at least l2 days when administered to an organism. in some embodiments, the serum iite of the multispecitie activatable antibody is at least l l days when administe ed to an organism, in some embodiments, the serum half—life of the mnltispecitic activatable dy is at least l0 days when administered to an organism. in some embodiments, the serum haltllit‘e of the multispecitic activatable antibody is at least 9 days when administered to an sm. in some embodiments, the serum half~life of the multisbecific activatable antibody is at least 8 days when administered to an organism. in some embodiments, the serum hall‘llife of the mnltispecitic activatable antibody is at least 7 days when administered to an sm. in some embodiments, the serum half—life of the iniiltispeei’rie activatable antibody is at least 6 days when administered to an organism. in some embodiments, the serum half—life of the multispecitic activatable antibody is at least 5 days when administered to an organism. in some embodiments, the serum half—life of the pecifie activatable antibody is at least 4 days when administered to an organism. in some ments, the serum half-life of the mnltispecitic activatable antibody is at least 3 days when administered to an organism. ln some embodiments, the serum haililife of the mnltispecilie actiy'atabie antibody is at least 2 days when administered to an organism. in some embodiments, the serum haltllife of the innltispecitic activatable antibody is at least 24 hours when administered to an organism. in some embodiments, the serum half~li "e of the mnltispeeific table antibody is at least 2.0 hours when administered to an organism. in some embodiments, the serum half—life oi‘the multispecitic activatable antibody is at least l8 hours when administered to an organism. in some embodiments, the serum half— li ‘e of the multispecifie activatable antibody is at least l6 hours when administered to an organism. in some embodiments, the serum ite of the multispecilic table antibody is at least l4 hours when administered to an organism. in some embodiments, the serum half—life of the inititispeciiic aetivatable antibody is at least 12 hours when administered to an organism. in some embodiments, the serum half-iife of the multispecifie aetivatable antibody is at least it) hours when administered to an organism. in some embodiments, the serum halillitl: of the multisteciiic aetiyatable antibody is at least 8 hours when administered to an organism. in some embodiments, the serum half-life of the mnltispecilie actiyatable antibody is at least 6 hours when administered to an organism. in some ments, the serum haltllife of the specitic activatable antibody is at least 4 hours when administered to an organism. in some embodimentsfl the serum half—life of the mnitispecific activatable antibody is at least 3 hours when administered to an organism. {ddiillliil The disclosure also provides compositions and methods that include a innltispceitic activatable antibody that includes at least a iirst dy or antibody fragment (ABl) that specifically binds a target and a second antibody or antibody fragment (AB2) where at least the first AB in the mnltispecitic aetiyatabie antibody is d to a mashing moiety (MMl) that decreases the ability ofABl to bind its . in some embodin'ients, each AB is coupled to a MM that decreases the ability of its corresponding AB to each . for e, in bispecific activatable dy embodiments, ABl is coupled to a, lirst mashing moiety (Mix/ll) that decreases the ability ot‘ABl to bind its target, and A132 is coupled to a second mashing moiety (MMZ) that ses the ability of ABE to bind its . in some embodiments, the multispeeifie activatable antibody comprises more than two AB regions; in such embodiments, ABl is coupled to a lirst mashing moiety (Mix/ll) that ses the ability of ABl to bind its target, A32 is coupled to a second mashing moiety (Mb/l2) that decreases the y of A82 to bind its target, A83 is coupled to a third mashing moiety (Milt/l3) that decreases the ability of AB3 to bind its target, and so on for each AB in the mnltispecilie activatable antibody. (,4 1,49 liltltlltll} in some embodiments, the inultispecitic actiyatable dy turther includes at least one cleavable moiety (CM) that is a substrate for a se, where the CM links a MM to an AB. For example, in some embodiments, the mnltispecific activatable antibody includes at least a first antibody or antibody fragment (A31) that specifically binds a targe and a second antibody or antibody fragment (AB2), where at least the tirst AB in the multispecific activatable antibody is coupled via a first cleavable moiety (CMl) to a masking moiety (MMl) that ses the ability of A81 to bind its . in some bispecilic activatabie antibody embodiments, ABl is coupled via CMl to MMl, and A82 is coupled via a second cleavable moiety (CM?) to a second mashing moiety (MMZ) that decreases the ability of A32 to bind its . In some embodiments, the pecific activatable antibody ses more than two AB regions; in some of these embodiments, ABl is coupled via CMl to i‘s/lMl, A82 is coupled Via Cit/l2 to MMZ, and A33 is coupled via a third cleayable moiety (CM3) to a third mashing moiety (MMS) that decreases the y of A83 to bind its target, and so on for each AB in the multispecitic table lithium} The compositions and methods provided herein enable the attachment of one or more agents to one or more cysteine residues in any of the AB regions without compromising the activity (eg, the masking, activating or binding activity) of the multispecitic activatable antibody. in some embodiments, the compositions and methods provided herein enable the attachment of one or more agents to one or more cysteine residues in any of the AB regions without reducing or oth em'ise disturbing one or more disulfide bonds Within any of the MM. The compositions and methods provided herein produce a nniltispecitic aetivatable antibody that is conjugated to one or more agents, ex ., any of a variety of therapeutic, diagnostic and/or prophylactic agents, preferably without any of the ageiit(s) being conjugated to any of the MM of the multispecitic activatable antibody. The compositions and methods provided herein produce conjugated inultispecitic activatable antibodies in which each of the MM retains the y to effectively and efficiently mash its corresponding AB of the niultispecifie activatable antibody in an uncleaved state. The compositions and methods provided herein e conjugated multispecitic activatable antibodies in which the activatable antibody is still ted, lien, cleaved, in the presence of a protease that can cleave the CM. 3} The multispecific activatable dies have at least one point of coniugation for an agent, but in the methods and compositions provided herein less than all possible points of conjugation are available for conjugation to an agent. In some ments, the one or more points of conjugation are sulfur atoms involved in disullicle bonds. ln some embodiments, the one or more points of ation are sulfur atoms involved in interchain disul’lide bonds. in some embodiments, the one or more points of conjugation are sulfur atoms involved in interchain sulfide bonds, but not sulfur atoms involvedin intrachain disultide bonds in some embodiments the one or more points of conjugation are sulfur atoms of cysteine or other amino acid residues ning a sulfur atom. Such residues may occur naturally in the antibody structure or may be incorporated into the an tihody by site—directed mutagenesis, cheinical conversion, or niis~incorporation of non~natural amino acids, {000104} Also provided are methods of preparing a conjugate of a multispecitic activatahle antibody having one or more interchain dis uliide bonds in one or more of the AB and one or more intrachain dis ulfide bonds in the corresponding MM, and a drug reactive with free thiols is provided. The method generally includes partially reducing interchain disullide bonds in the activatahle antibody with a ng agent, such as, for e, TCEF; and conjugating the drug reactive with free thiols to the partially reduced activatable antibody. As used herein, the term partial reduction refers to ions where a multisbecific activatahle antibody is ted with a, reducing agent and less than all disultide bonds, cg, less than all possible sites of conjugation are reduced in some embodiments, lesss than 99,0, 985%), 97%, 96"/o, 959/09,0% 85"me80"x6, 75%7,00At, 65"/o, (50%, 55% 50/0, 45%, 40°at, 35°m, 30%,25%, 200’/o l50’m, l0% or less than 5% of all possible sites of conjugation are reduced. } in vet other embodiments, a method of reducing and conjtgtating an agent eg, a drug, to a multispecitic activatable antibody resulting in selectivity in the placement of the agent is provided. The method generally includes partially reducing the multispecific activatahle antibody with a ng agent such that any conjugation sites in any of the masking moieties or other non—AB n of the activatable antibody are not reduced, and conjugating the agent to interchain tliiols in one or more of the AB regions of the multispecilic activatahle antibody. The conjugation site(s) are selected so as to allow desired placement of an agent to allow conjugation to oce ur at a desired site. The reducing agent is for example, lCFl’ The reduction reaction conditions such as mple the ratio of reducing agent to activatable antibody, the length of tion, the temperature during the incubation, the pH of the reducing reaction solution, etc, are determined by identifying the conditions that produce a eoniugated aetiyatab1e antibody in which the MM retains the abi1ity to et‘t‘eetiye1y and efficientiy mask the AB of the aetiyatab1e antibody in an une1eayed state, The ratio of reduction agent to mu1tispeeitie aetiyatab1e antibody wi11 vary depending on the aetiyatab1e antibody. in some embodiments, the ratio ofredueing agent to inu1tispeeiftc aetiyatah1e antibody W111 be in a range from about 20:1 to 1 :1, from about 111:1 to 1:1, from about 9:1 to 1:1, from about 8:1 to 1:1, from about 7:1 to 1:1, from about 6:1 to 1:1, from about 5:1 to 1:1, from about 4:1 to 1:1, from about 3:1 to 1:1, from about 2:1 to 1:1, from about 20:1 to 1:15, from about 10:1 to 121.5, from about 9:1 to 1:15, from about 8:1 to 1:15, from about 7:1 to 1 :1.5, from about 6:1 to 1:1.5, from about 5:1 to 1:15, from about 41:1 to 1:15, from about 3:1 to 1:15, from about 2:1 to 1:15, from about 1.521 to 121.5, or from about 1:1 to 1:15. 1n some embodiments, the ratio is in a range of from about 5:1 to 1:1. 1n some embodiments, the ratio is in a range oft‘rom about 5:1 to 1.5: 1. in some embodiments, the ratio is in a range of from about 4:1 to 1:1. 1n some embodiments, the ratio is in a range from about 4:1 to 1.5: 1. In some embodiments, the ratio is in a range from about 8:1 to about 1:1. 1n some embodiments, the ratio is in a ran{70A\J of from about 2.5:1 to 1:1. {1111111116} 111 some embodiments, a method of ng interehain disu1tide bonds in one or more of the AB regions of a niu1tispeeifie aetiyatab1e antibody and conjugating an agent, e.g., a third—containing agent such as a drug, to the resu1ting hain thio1s to iye1y 1oeate agent(s) on the AB is provided. The method genera11y ine1udes partia11y ng one or more of the AB s with a reducing agent to form at 1east two interehain thio1s Without forming a11 possib1e hain thiois in the aetiyatab1e antibody; and ating the agent to the interehain thio13 of the partia11y reduced AB. For exarnp1e, one or more of the A13 regions of the muitispeeifie aetivatab1e antibody is partia11y reduced for about 1 hour at about 370C at a desired ratio of reducing agentaotivatabie antibody. 1n some embodiments, the ratio of reducing agent to aetiyatab1e antibody wi11 he in a range from about 20:1 to 1:1, from about 10:1 to 1:1, from about 9:1 to 1:1, from about 8:1 to 1:1, from about 7:1 to 1:1, from about 6:1 to 1:1, from about 5:1 to 1:1, from about 4:1 to 1 :1, from about 3:1 to 1:1, from about 2:1 to 1:1, from about 211:1 to 1:15, from about 10:1 to 1:15, from about 9:1 to 1:1.5, from about 8:1 to 1:15, from about 7:1 to 1:15, from about 6:1 to 1:15, from about 5:1 to 115, from about 4:1 to 1:1.5, from about 3:1 to 1:1.5, from about 2:1 to 115, from about 1.5:1 to 111.5, or from about 1:1 to 1:15. 1n some embodiments, the ratio is in a range of from about 5:1 to 1:1. 1n some embodiments, the ratio is in a range of from about 5:l to l5: l. In some embodiments, the ratio is in a range ot‘from about 4:l to l: l. in some embodiments, the ratio is in a range from about 4M to l.5:l. ln some embodiments, the ratio is in a range from about 8:l to about lzl. ln some embodiments, the ratio is in a range ol‘from about 2.521 to l:l. {dtltllll‘l’i The thiol—eontaining reagent can be, for example, cysteine or N—acetyl cysteine. "l‘he reducing agent can be, for example, 'l‘ClELP. in some ments, the reduced activatable antibody can be purified prior to conjugation, using for e, column chromatography, dialysis, or diai’iltration. Alternatively, the reduced antibody is not purified alter partial reduction and prior to conjugation. {tlllhliltl} The disclosure also es partially reduced multispeeit‘ic table antibodies in which at least one interchain disulfide bond in the multispecitic activatable antibody has been reduced with a reducing agent without disturbing any hain disuitide bonds in the rnuitispecilic activatable antibody, wherein the multispecitic activatable antibody includes at least a first antibody or an antigen binding fragment thereof (A81) that specifically binds to a target, a lirst masking moiety (MM 1) that inhibits the binding of the ABl of the multispecilic activatable antibody in an uncleaved state to the target, a first eleavable moiety (Ch/ll) coupled to the ABl, wherein the Civil is a polypeptide that ons as a substrate for a protease, and a second antibody or an antigen binding fragment thereof (ABE) that specifically binds to a second target. ln some embodiments, the MMl is coupled to the ABl via the Civil. ln some embodiments, one or more hain disultide bondt’s) of the pecitic activatable antibody is not disturbed by the reducing agent. ln some ments, one or more intrachain disultide bonds) of the MMl Within the multistecilic activatable antibody is not disturbed by the reducing agent. in some embodiments, reducing agent is "l‘CEl’. {9639199} ln some embodiments, the multispecitic antibodies and/or multispecific activatable dies bed herein are used in conjunction with one or more additional agents or a combination of additional agents. Suitable additional agents include current pharmaceutical and/or surgical therapies for an intended application, such as, for example, cancer. For example, the speeitie antibodies and/or multispecil‘ic aetivatable antibodies can be used in conjunction with an additional chemotherapeutic or anti— neoplastic agent. {titlillltl} ln some embodiments, the multispecitic antibody and/or pecific activatable antibody and additional agent are formulated into a single therapeutic composition, and the multispecilic antibody and/or multispecilic activatahle antibody and additional agent are administered aneously. Alternatively, the tnultispecitic ’idy and/or multispecitic activatable antibody and additional agent are separate from each other, e.g, each is formulated into a separate therapeutic composition, and the pecific dy and/or multispecilic activatable antibody and the additional agent are administered simultaneously, or the multispecific antibody and/or specific activatahle antibody and the additional agent are administered at different times during a treatment regimen. For example, the rnultispecitic antibody and/or multispecilic activatable antibody is administered prior to the administration of the additional agent, the rnultispecilic antibody and/or mu ltispecitic table antibody is administered subsequent to the administration of the additional agent, or the multispecitic antibody and/or multispecific activatable antibody and the additional agent are administered in an alternating fashion. As described , the anti— rnultispeeilic antibody and/or tnnltispecitic activatable antibody and additional agent are administered in single doses or in multiple doses.

Ellllllllll The disclosure also provides an isolated nucleic acid molecule encoding a multispecilie antibody and/or multispecilic activatable antibody described herein, as well as vectors that include these isolated nucleic acid sequences. The disclosure provides methods of producing a multispecilic antibody and/or multispecilic activatable antibody by culturing a cell under conditions that lead to sion of the multispecilic antibody and/or i'nnltispecitic table dy, wherein the cell comprises such a nucleic acid molecule, in some embodiments, the cell comprises such a vector.

{Milli 12} The disclosure also provides a method of manufacturing multispecific antibodies of the disclosure and/or rnnltispecitic activatable antibodies of the diselos are by (a) ing a cell comprising a nucleic acid construct that s the multispecifie antibody and/or multispecific activatable antibody under conditions that lead to sion of the multispecitic antibody and/or multispecil‘ic activatable, and (b) recovering the innltispecitic antibody and/or rnultispecilic table antibody {$89113} The present disclosure also provides methods of ng, preventing, delaying the progression of or otherwise ameliorating a symptom of one or more pathologies or ating a symptom associated with such pathologies, by administering a multispecitic antibody and/or multispecitic activatable antibody of the disclosure to a subject in which such treatment or prevention is desired. The subject to he treated is, eg, human or other mammal. in some embodiments, the t is a non—human mammal, such as a non—human primate, companion animai (e. {[01, cat, dog, , farm animal, worlt animal, or zoo animal in some embodiments, the subject is a rodent {tidbit-4} The present disclosure also provides methods to induce target—dependent T— cell activation and g of a target cell by administering a multispecitic activatable antibody of the disclosure to a subiect in which such induction is desired, wherein when the iniiitispettifie activatable antibody is in the cleaved state, e.g.,, each masking moiety in the pecific activatable antibody is no longer attached or otherwise ated with the corresponding AB domain, target~dependent T—cell activation and killing of the target cell , and when the multispecitic activatable antibody is in the uncleaved state, eg. at least one masking moiety of the specitie activatable antibody is attached or otherwise associated with the corresponding AB domain, target-dependent T-vceli tion and killing of the target cell is reduced or otherwise inhibited. Any of the niultispecitic activatable antibodies described herein are suitable for use in such methods. The subject to be treated is, eg, human or other mammal. in some embodiments, the subject is a non-- human mammal, such as a non—human primate, companion animal (cg, cat, dog, horse), farm animal, work animal, or zoo animal. in some embodiments, the subject is a , {$883.15} A multispecitic antibody and/or multispeciiic tabie antibody used in any of the embodiments of these methods and uses can be administered at any stage of the disease and/or any stage in which l—ceil activation and hiiling ofa target cell is desired. For example, such a multispecitic antibody and/or multispeciiic activatable antibody can be administered to a patient suffering cancer of any stage, from early to metastatic, The terms subject and patient are used interchangeably herein. A multispecific antibody and/or multisrecitic activatable antibody used in any of the embodiments of these methods and uses can be used in a ent regimen comprising neoadjuvant therapy, A multispecitic dy and/or muitispecifrc activatabie antibody used in any of the ments of these s and uses can be administered either alone or in combination with one or more additional agents, inciuding smail le inhibitors, other antibody—based therapies, polypeptide or peptide—based therapies, nucleic acid—based therapies and/or other biologics iiiti} The disclosure also provides s and kits for using the multispecific antibody and/or muitispeciiic activatable antibodies in a variety of diagnostic and/or prophylactic indications For example, the disclosure provides methods and kits for detecting presence or absence of a cleaving agent and a target of interest in a subject or a. sample by (i) contacting a subiect or sample with a inultispeciiic activatable antibody that includes at least a first g moiety (MIX/ll), a lirst cleavable moiety ) that is cleaved by the cleaving agent, and at least a first antigen binding domain or fragment thereof (ABl) that specifically binds the target of interest and a second antigen binding domain or fragment thereof (A32) that specifically binds a second target and/or a second e, (a) wherein the i‘vllvll is a peptide that inhibits binding of the ABl to the target, and wherein the Mir/ll does not have an amino acid ce of a naturally occurring hin ding partner of the ABl and is not a modified form of a natural binding partner of the A81; and (b) wherein, in an ved, non—activated state, the i‘vllvll interferes with specilic g of the ABl to the target, and in a cleaved, activated state the MMl does not interfere or compete with specific binding of the ABl to the target; and (ii) measuring a level of activated multispecitic activatable antibody in the subject or sample, wherein a. detectable level of activated multispecilic activatable antibody in the subject or sample indicates that the cleaving agent and the target are present in the subject or sample and wherein no detectable level of activated pecific activatable antibody in the subject or sample indicates that the ng agent, the target or both the cleaving agent and the target are absent and/or not sufficiently present in the sub} ect or sample. {$388117} ln some embodiments, the activatable multispecitic activatable antibody is an activatable multispecific activatable antibody to which a therapeutic agent is ated. in some embodiments, the activatable multispecilic activatable antibody is not ated to an agent. in some embodiments, the activatable rnultispecil'ic activatable antibody comprises a de ectable label. in some ments, the detectable label is positioned on the A31. in some embodiments, measuring the level of activatable multispecitic activatable antibody in the subject or sample is accomplished using a secondary reagent that specifically binds to the activa ,ed multispecific activatahle antibody, wherein the reagent comprises a able label. in some embodiments, the secondary reagent is an antibody comprising a detectable label. ltllllll ill} in some embodiments of these methods and hits, the activatable multispecil‘ic activatahle dy es a detectable label. In some embodiments of these methods and hits, the detectable label es an imaging agent, a contrasting agent, an enzyme, a fluorescent label, a chrornophore, a dye, one or more metal ions, or a ligandbased label. in some ments of these methods and hits, the imaging agent comprises a radioisotope, in some embodiments of these methods and hits, the radioisotope is indium or technetium. in some embodiments of these methods and hits, the contrasting agent comprises iodine, gadolinium or iron oxide. in some embodiments of these methods and hits, the enzyme comprises horseradish peroxidase, alkaline phosphatase, or li—galactosidase. in some embodiments of these methods and hits, the fluorescent label comprises yellow fluorescent protein (Y’Fl’), cyan fluorescent protein (CFP‘), green cent protein (GEP), modified red scent protein , red fluorescent protein tdimeer (RF? tdiiner2), l-lCRED, or a europium derivative. ln some embodiments of these methods and hits, the luminescent label comprises an N— acrydium derivative. ln some embodiments of these s, the label comprises an Alexa Fluor® label, such as Alex Fluor® 680 or Alexa Fluor® 750. ln some embodiments of these methods and hits, the ligand~based label comprises biotin, avidin, streptayidin or one or more s. {999119} ln some embodiments of these methods and hits, the subject is a mammal. in some embodiments of these methods and hits, the subject is a human. in some embodiments, the subject is a non—human mammal, such as a non—human primate, companion animal (eg, cat, dog, horse), farm animal, work animal, or zoo animal. in some embodiments, the subject is a rodent. liltilllle} in some embodiments of these s, the method is an in viva method. in some embodiments of these methods, the method is an in site method. in some embodiments of these methods, the method is an ex vivo method. in some embodiments of these methods, the method is an in viz‘ro method. {999121} in some embodiments of the methods and hits, the method or hit is used to identify or otherwise reline a patient population suitable for treatment with a multispecilic activatable dy of the disclosure. for example, patients that test positive for both the target and a protease that cleaves the substrate in the first cleavable moiety (Civil :3 of the multispecilie actiyatable antibody being tested in these methods are identified as suitable candidates for treatment with such a, multispecific activatable dy sing such a CMl. Likewise, patients that test ve tor both the target and the protease that cleaves the substrate in the Civil in the multispeciiic activatable antibody being tested using these methods might be identili ed as le candidates for another form of therapy, liltitllZZ} in some embodiments, a method or hit is used to identity or ise rel’ine a patient population suitable for treatment with a pecilie activatable antibody and/or eonjugated multispecitic aetivatable antibody (eg, multispeeifie activatable antibody to which a therapeutic agent is conjugated) of the disclosure, followed by ent by administering that multispecil’ic antibody and/or multispecitic activatable antibody and/or conjugated multispecitic table antibody to a subject in need thereof. For example, patients that test positive for both the target and a protease that cleaves the substrate in the first ble moiety (Ch/ll) of the niultisiecitic activatahle antibody and/or conjugated multispecific activatable antibody being tested in these methods are identified as suitable candidates for treatment with a specilic activatable antibody comprising such a Civil and/or conjugated multispecific activatahle antibody comprising such a Chill, and the patient is then administered a eutically effective amount of the multispecific table antibody and/or coniugated inultispecitic tahle antibody that was . likewise, ts that test negative for either or both of the target and the se that cleaves the substrate in the Civil in the specitic activatable antibody and/or ated multispecific activatable antibody eing tested using these methods might be identified as suitable candidates for another form of therapy. {999123} in some embodiments, such patients can he tested with other multistecific dies and/or multispecific activatable antibodies and/or conjugated multispecific activatable antibodies until a suitable multispeciiic activatable antibody and/or conjugated multispecifie tahle antibody for treatment is identified, eg, a nniltispecitic table antibody and/or conjugated niultispecific activatable antibody comprising a CM that is cleaved by the patient at the site of disease. in some embodiments, the patient is then administered a therapeutically effective amount of the multispecific activatable antibody and/or conjugated rnultispecil'ic activatahle antibody for which the patient tested positive. {earn 24} Pharmaceutical compositions according to the disclosure can include a multispecific antibody and/or a. multispecitic activatahle antibody of the disclosure and a carrier. These pharmaceutical compositions can be included in ltiiS, such as, for example, diagnostic hits, {899125} One skilled in the art will appreciate that the antibodies of the disclosure have a variety ot‘uses. F "ir example, the proteins of the disclosure are used as therapeutic agents for a variety of disorders. The antibodies of the disclosure are also used as reagents in diagnostic kits or as diagnostic tools, or these antibodies can be used in coniietition assays to generate therapeutic reagents.

BRlEF DESCREPTHEN OF DRAWINGS Etitltliifiti} Figure l is an illustration depicting various bispecil‘ic antibody formats t adapted from Chan and , Nat. Rev, lmmunol. auto).

EiititBEZ’Z’} Figures 2A~2C are a series of iiiustrations depicting various muitispecil‘ic antibody formats suitable for use in the compositions and methods of the disciosure. in a bispecific antibody, a scFv can be fused to the carboxyi terminus of the heavy chain (He) of a igG antibody (Figure 2A); to the carboxyi-terminus of the Eight chain (Le) (Figure 2B); or to the carboxyl terminus ot‘both the heavy and tight chains (Figure 2C). Figure 23 is a diagram of a singie genetic uct for the expression of muitispecitic antibody fusions" {flitting} Figure 3A is a series oi‘iiiustrations depicting various multispeeitic activatable antibody formats suitable for use in the compositions and methods of the disclosure Figure 33 is a diagram of c ucts for the expression of n'ruitispecitic activatabie antibody fusions {8639129} Figure 4,», Panels Aid, are a series of schematic ms of a seiected set of the possible permutations oi‘muitispecitic antibodies of the disclosure. Gray—shaded boxes cover the configurations ented in Figure 2 and are included here for con'rpleteness and comparison.

Etitititffib} Figure 5, Panels A—J, are a series of schematic diagrams of a ed set of the possibie permutations of pecitic activatable antibodies of the disclosure. Gray— shaded boxes cover the rations represented in Figure 3 and are inchided here for completeness and comparison. in particuiar, this figure shows muitispecific activatable antibodies in which the primary antigen binding site is masked (i.e., activatable) and the additional antigen-binding domaint’s) is not masked {$630131} Figure 6;, Panels A—L are a series of schematic diagrams of an array of muitispecific activatable antibodies in which ail antigen-binding domains are . {iiiiiiBE} Figure 7, Panels A J, are a series of schematic diagrams of an array of muitispeciiic activatable antibodies in which the secondary antigen—binding domain is masked and the additionai antigen-binding domaint’s) is not masked.

Eddflifidi Figure 8, Panels Ad, are a series of schematic diagrams of an array of rnuitispecii‘ic activatable dies in which the majority/9 but not ali of the antigen—binding domains are masked and at least one additional antigen—binding domain(s) is not mashed.

EiititilM} Figure 9, Panels A—D, are a series of schematic ms of an array of peciiie activatable antibodies in which the primary n—binding domain and another anti gen—binding domain are masked, and the remaining antigen~binding doniain(s) is not masked. #-1,..9 [Annotation] CLGUS Aug 2021 [000135] Figure 10 is a photograph depicting PAGE analysis of multispecific antibodies and pecific activatable antibodies demonstrating the molecular weights of the scFv fused heavy , samples 1-8, as compared to the respective monospecific antibodies or activatable antibodies, samples 9-11.

Figure 11 is a graph depicting the ability of multispecific dies to bind 2020200981 specifically to their cognate antigens.

Figures 12A-12B are a series of graphs depicting the ability of multispecific antibodies and multispecific activatable antibodies that include anti-human CTLA-4 scFvs to bind specifically to (A) mouse and (B) human CTLA-4. 8] Figure 13 is a graph depicting the ability of the OKT3-containing multispecific activatable dies referred to herein as anti-EGFR multispecific activatable antibody 3954C225v5—OKT3 and anti-Jagged multispecific activatable antibody 53424D11v2—OKT3 to ically bind human CD3ε in ELISA binding experiments.

Figure 14 is a series of photographs ing PAGE analysis of uPA digests demonstrating activation of multispecific activatable antibodies without cleavage of heavy chain scFv fusions.

Figure 15 is a series of graphs depicting the ability of activated multispecific activatable antibodies to bind various targets. 1] Figure 16A is a graph depicting g of multispecific antibodies of the disclosure to CD3-positive Jurkat T cells.

Figure 16B is a graph depicting ding of multispecific antibodies of the disclosure to CD3-positive Jurkat T cells and EGFR.

Figure 17 is a series of graphs depicting EGFR-dependent activation of Jurkat T cells by pecific antibodies of the disclosure.

Figure 18A is a graph depicting EGFR-dependent activation of primary CD8+ T cells by multispecific antibodies of the disclosure.

Figure 18B is a graph depicting EGFR-dependent killing of target cells by multispecific antibodies of the disclosure.

Figure 18C is a series of graphs depicting CD69 activation of primary T cells by pecific antibody C225v5-OKT3m-H-N in EGFR-expressing SW480 cells compared to l activation in EGFR-negative U266 cells.

Etititildfl Figure lbD is a series of graphs depicting EGFR—dependent killing of target cells by rnuitispeeitic antibody CZZSVS—OKTfi'n—PLN in EGFR—expressing SWdSG cells compared to negligible killing in EGFRmegative U266 cells. {999148} Figure l9 is a series of graphs depicting priinaiy 'l‘ ceil lysis of a panel of EGFR—expressing cell lines by specitie antibody €225V5—0KT3fll—H~N compared to there being no lysis of the ROPE—negative U266 cell line.

EGtBtBMQE Figure 2tiA and Figure 205 are a series of graphs ing decreased binding of inultispecifie activatable antibody 3954~l204—(3225V5—Ol{T3ni~H—N to EGFR~ expressing cells cornpared to EGFR binding by ntultispeeit‘ie antibody CZZSVS—OKUrnJE— N Furthermore, Figures 29A and 2GB trate that protease activation of inuitispecitic activatable antibody 3954-12tl4-{7225VS-vOK'l‘3rn--ii--N by rnatriptase (also referred to herein as l‘s/lTSPl or MT—SPI ) restores EGFR binding to a ievel equivalent to that exhibited by rntdtispecitic antibody C22SVS—OKT3m-PLN. Figures 20A and ZOB also demonstrate that such niultispecific activatable dy and rnuitispeciiic antibody bind EGFR in a manner sirniiar to that of the respective inonospecitic activatable dy and inonospecilfiic antibody. {bilillfitl} Figure LiiA and Figure 218 are a series of graphs depicting binding of rnultispecific activatable antibody 3954"lZiitil-{jZZSVS-'Oi ElliiiiiS3} Figure 233 is a graph depicting decreased enendent killing oftai‘get cells by rntiitispecilic table antibody 3954—i Edd—C225VS-OKTSm—H—N compared to killing by rnnltispecific dy C225v5—0K'T3m—H~N, rmore, the figure trates that se activation of niultisnecific activatable antibody 3954- CQZSvS—OK'Hmd-l—N by niati‘iptase restores EGFR~denendent target cell killing to a level equivalent to that exhibited by mnitispecilic antibody C225v§ —0i 'AllJEl} BESCRIFHON {earn 54} The present disclosure provides multispecifie antibodies and/or rnnltispecific activatable antibodies. As used herein, a niultisnecific antibody is an antibody that recognizes two or more different antigens or epitopes, and a snecilfiic activatable antibody is a rntiltispeciiic antibody that includes at least one masking rnoiety (MM) linked to at least one antigen— or epitope—binding domain of the multispecifie antibody such that coupling of the MM reduces the ability of the antigen- or epitope—binding domain to bind its target, The activatabie nmltispeeific antibodies provided herein are stable in Circulation, activated at intended sites of therapy and/or diagnosis but not in norrnalfl i,€., healthy tissue, and, when activated, exhibit binding to a target that is at least comparable to the corresponding, unmodified mnltispecil‘ic antibody.

HERMES} Non—limiting examples of inultispeciiic antibodies include bispeciflc antibodies, trispecifie antibodies, tetraspecific antibodies, and other rnnltispecific antibodies. pecific antibodies provided herein are also multivalent; as used herein, rnultivalency refers to the total number of binding sites on the antibody, regardless of Whether the bin ding sites recognize the same or different antigens or epitopes. Nonwliiniting examples of mnltispeeific activatable antibodies include bispecific activatable antibodies, trispecific activatable antibodies, tetraspecilic table antibodies, and other mnltispecific activatable antibodies. Mttltispecii‘ic activatabie antibodies ed herein are also ntnltivalent {999156} in some embodiments, the niultisnecific antibodies or fragments thereof and/or ninltispecific activatable antibodies or ii'aginents thereof are designed to engage T cells and/or other immune e ,feetor cells. Multispecitic aetivatable antibodies or nts thereof that engage T cells are also referred to herein as T-cell engaging intiltispecific antibodies or fragments thereof and/or T—cell engaging pecil‘ic table dies or fragments thereof Multispecihe activatable antibodies or fragments thereof that engage immune or cells are also referred to herein as immune effector cell engaging multispecifie dies or fragments thereof and,"or immune effector cell engaging multispecifie aetiyatable dies or nts thereof in some embodiments, the multispecific antibodies or fragments thereof and/or pecific aetiyatable antibodies or fragments thereof are designed to bind or otherwise interact with more than one target an dl'or more than one epitope, also referred to herein as antigen targeting antibodies or fragments thereof and/or multi-antigen targeting activatable antibodies or fragments thereof. liltltllfifl in some embodiments, a multispecific antibody or fragment thereof includes an lgG domain and a seFv domain. in some ments, a multispecitic antibody or fragment thereof includes an lgG variable domain and a scFy domain. in some embodiments, one antibody domain of a multispecific antibody or fragment thereof has specificity for a target antigen and another antibody domain has specificity for a T—cell surface antigen. ln some embodiments, one antibody domain of a multispecilic antibody or fragment thereof has specificity for a target antigen and another antibody domain has specificity for another target antigen. in some embodiments, one dy domain ofa multispecifie antibody or nt, f has icity for an epitope of a target antigen and another antibody domain has specificity for another epitope of the same target antigen. {8639158} Various embodiments of mnltispecific actiyatable antibodies or fragments thereofof the disclosure are shown in Figures 3A, and 54}. in some embodiments, a rnultispecitic activatable antibody or nt thereof comprising an lgG has the lgG variable domains mashed. in some embodiments, a multispeeilic activatable antibody or fragment thereof comprising a seFV has the scf'y domains mashed. in some embodiments, a multisr. ecifie actiyatable antibody or f"agment thereof has both lgG variable domains and scFy domains, Where at least one of the lgG variable s is coupled to a mashing moiety. in some embodiments, a pecific activatabie antibody or fragment thereof has both igG variable domains and ser domains, where at least one of the scFy domains is coupled to a mashing moiety. in some embodiments, a n'rultispeeific table antibody or fragment thereof has both igG variable s and scf'v domains, where at least one of the lgG variable domains is coupled to a masking moiety and at least one of the scFy domains is coupled to a g . in some embodiments, a n'rultispeeific actiyatable antibody or fragment thereof has both igG variable domains and scf'v domains, where each of the igG variable domains and the scFy domains is coupled to its own mashing moiety. in some embodiments, one antibody domain of a multispeciiic actiyatable antibody or fragment thereofhas specificity for a target antigen and another antibody domain has specificity for a T—cell surface antigen. in some embodiments, one antibody domain of a multispecific activatahle antibody or fragment the eof has specificity for a target antigen and r antibody domain has specificity for another target antigen. in some embodiments, one antibody domain of a pecific activatable antibody or fragment thereof has specificity for an e of a target antigen and another antibody domain has specificity for another epitope of the same target antigen. liltltllfiill In some ments, multispecific antibodies or fra 'ments thereof of the{IQ disclosure include at least (i) a T—cell engaging antibody or fragment f that includes a first antibody or antigen~binding fragment thereof (AB l) that binds a first, T—cell engaging target that is a surface antigen on a T cell and (ii) a second antibody or nt thereof that includes a second antibody or antigen—binding fragment thereof (ABE) that binds a second target, in some embodiments, the first and second targets are the same n, ln some embodiments, the first and second targets are different antigens. in some embodiments, the first and second targets are different epitopes on the same antigen. in some ments, the T—cell engaging antibody or fragment thereof is attached the N-terminus of the heavy chain of the target—specific antibody, in some ments, the 'l‘—cell engaging dy or fragment thereof is attached the C-terminus of the heavy chain of the targe --specific antibody. in some embodiments, the T~cell engaging antibody or nt thereof is attached the ‘iinus of the light chain of the target—specific antibody. in some embodiments, the "l‘—cell engaging antibody or fragment thereof is attached the C—terminus of the light chain of the target-specific antibody. in some embodiments, the pecific antibody comprises T—cell engaging antibodies or fragments thereof attached to a combination of one or more N—termini and/or one or more Cvtermini of the rntrltispeci’tic antibody. The disclosure also es necific antibodies that comprise another immune effector cell engaging antibody or fragment thereof, such as one that binds a surface antigen ofa natural ltiller (NK) cell, a clear cell, such as a myeloid mononuclear cell, a macrophage, and/or other immune effector cells. liltltlldtl} In some embodiments, the multispecific antibody or fragment thereof of the disclosure includes at least two T—cell engaging antibodies or fragments thereof that engage one or more 'l‘ cell activating receptors, such as, for example, 'l'~cell engaging scf'v fragments, including but not limited to, GXdO/Gl’l‘lt, CDl37/ Gilli, 0X40, CD2'7/NKGZD, and additional combination of activating receptors, and one target~binding antibody such that the T—ceil engaging ser fragments are linked to both arms of the target binding antibody. in some embodiments, the multispecific antibody or fragment thereof of the disclosure includes two 'I'~ceil engaging antibodies or fragments thereof that engage one or more 1‘ cell inhibitory receptors, and one target-binding antibody such that the 'f-ceil engaging scFv fragments are linked to both arms of the target g antibody. in some embodiments, the two T~eeil engaging antibody fragments bind the same i engaging target, In some embodiments, the two T-cell engaging antibody fragments bind different 'I'-- cell engaging targets. in some embodiments, the two l—ceii engaging antibody fragments bind different epitopes on the same T-ceil engaging .

{Millet} In some embodiments, the specifie antibody or fragment thereof of the disclosure includes at least ti) a first arm comprising an antigen-binding fragment of a T" cell engaging antibody that includes a first antibody or antigen~binding fragment thereof (ABl) that binds a first, T—celi engaging target and (ii) a second arrn comprising an antigen— binding nt of a target binding antibody that includes a second antibody or antigen-- binding fragment thereof (A82) that binds a second target. in some embodiments, the multispecific dy or fragment thereof includes (iii) at least a third antigen—binding fragment of a target binding antibody that includes a third antibody or antigen—binding fragment thereof (ABE) that binds a third target, In some ments, the second and third or more targets are the same antigen. In some embodiments, the second and third or more targets are different antigens. In some embodiments, the second and third or more targets are different epitopes on the same antigen, li In some embodiments, specific table antibodies or fragments thereof of the disclosure include at least (i) a T-ceil engaging antibody or fragment thereof that includes a first antibody or antigen binding nt thereof (A81) that binds a first, T— celi engaging target that is a surface antigen on a T cell, where the A31 is attached to a mashing moiety (Mix/l) such that coupling of the MM reduces the ability of the A81 to bind the first target and (ii) a second antibody or fragment thereof that es a second dy or antigen—binding fragment thereof (A82) that binds a second target: In some embodiments, the first and second targets are the same antigen. In some embodiments, the first and second targets are different antigens In some embodiments, the first and second s are ent epitopes on the same antigen. in some embodiments, the T—eeli engaging antibody or nt thereof is attached the N—terminns of the heaVy chain of the target—specific antibody. In some embodiments, the T~cell engaging antibody or fragment thereofis attached the C—terminus of the heavy chain of the target—specific antibody. ln some embodiments, the T—cell engaging antibody or fragment thereof is attached the N— terminus of the light chain of the targetspecific antibody. in some embodiments, the T~cell engaging antibody or fragment thereof is attached the C-terminus of the light chain of the target—specific antibody. in some embodiments, the multispecilic activatable dy comprises T—cell engaging antibodies or fragments thereof attached to a combination of one or more N-terrnini and/or one or more (LT-termini of the pecific activatable antibody.

The disclosure also includes m'ultispecilic activatable antibodies that se another immune effector cell engaging antibody or fragment thereof, such as one that binds a surface antigen of a natural killer (NK) cell, a mononuclear cell, such as a myeloid mononuclear cell, a macrophage, and/or other immune ef‘ectctor cells.

Etllllll 633 in some embodiments, the pecific activatable antibody or fragment thereof of the disclosure includes at least ti) two T-cell engaging antibodies or antibody fragments f that engage one or more T cell activating receptors, such as, for example, T~cell engaging scFv fragments, including but not limited to, 0X4tl/GlTR, CDl3'7/ GITR, CIDlSWOXL‘lll, CD27/NKG2D, and additional combination of activating receptors, where the A31 of one of the T—cell engaging antibody nts is attached to a masking moiety (MM) such that coupling of the MM reduces the ability of that A81 to bind its respective T-- cell engaging target, and 4: ii) one target~binding antibody such that the T—cell engaging scFv fragments are linl Eiltltllnfil In some embodiments, the innltispeeilic activatable antibody or fragment thereol' ol the disclosure includes atleast (i) a first arm comprising an antigenbinding fragment of a il engaging dy that includes a first antibody or antigen~binding fragment f (AB if) that binds a first, 'l'-—cell engaging target, where the A81 is attached to a mashing moiety (MM) such that coupling of the MM reduces the y of the ABl to bind the first target and (ii) a second arm comprising an antigen—binding nt of a target binding antibody that includes a, second dy or antigen—binding fragment thereof (ABE) that binds a second target. in some ments, the first and second targets are the same antigen. in some embodiments, the first and second targets are different antigens in some embodiiIents, the first and second targets are different epitopes on the same antigen. In some embodiments, the Tucell engaging antibodies or fragments thereof engage one or more T cell inhibitory receptors instead of one or more T cell activating receptors. ll as} in some embodiments, mnltispecilic activatable antibodies or fragments thereof of tidisclosure include atl east (i) a lcell engaging antibody or nt thereof that includesa‘ first antibody or enbinding fragment thereof (r’iBl) that hindsa rs,t T— cellengaging target thatis a surface antigen on a T cell and (ii) a second antibody or fragment thereof that includes a s2cond antibody or antigenbinding fragment thereof (A34) that binds a second target, where the A32 is attached to a masking moiety l) such that coupling of the MM reduces the ability of the A132 to bind the second target. in some ments, the first and second targets are the same antigen. In some embodiments, the first and second targets are difterent antigens In some embodiments, the first and second targets are different epitopes on the same antigen. In some CDibOCiII’IISI’IISg the 'I'—eeii engaging antibody or fragment thereof is attached the N-terniinns of the heayy chain of the target—specific antibody. In some embodiments, the T~ceIi engaging antibody or fragment thereof is attached the C—terrninus of the heavy chain of the ~speeific antibody. In some ments, the 'f—ceii engaging antibody or fragment thereof is attached the N- terminns of the light chain of the target—specific antibody. In some embodiments, the T~ceii engaging antibody or fragment thereof is attached the C—terminns of the light chain of the tar et—specifie antibody: In some ments, the muitispeeitie activatabie dy comprises 'I'x-ceii engaging dies or fragments thereof attached to a combination of one or more N~termini and/or one or more C—termini of the pecifrc activatabie antibody.

The snre aiso inehtdes rnuitispecitic tabIe antibodies that comprise another immune ef ‘ector ceII engaging antibody or fragment thereof, such as one that binds a e antigen ofa natural kiiier (NK) ceii, a mononuciear ceii, such as a myeioid ciear ceii, a macrophage, and/or other immune effector eeIIs. {$883.67} In some embodiments, the niuitispecifie activatabie antibody or nt thereof of the disciosure inchides at Ieast (i) two 'i‘uceii engaging antibodies or antibody fragments thereof that engage one or more I ceiI activating receptors, such as, for examnie, T~ceii engaging scFV fragments, incinding but not limited to, ITR, CUISW GITR, CD} 37/OX4G, CI327/NKGZI), and additional combination of activating receptors and (ii) one target-binding antibody that includes a second dy or antigen-binding fragment thereof (ABE) that binds a second target, where the A82 is attached to a niaskin g moiety (MM) such that coupling of the MM reduces the abiiity of the ABE to bind the second target, Where the i engaging scfy' fragments are iinhed to both arms of the target g antibody. in some embodiments, the multisnecifrc antibody or fragment thereof of the diseiosure inehtdes two T—ceii engaging antibodies or fragments thereof that engage one or more 'I' ceii inhibitory receptors, and one target~binding antibody such that the Tweed engaging scFy fragments are iinked to both arms of the target binding antibody. In some embodiments, the two T—ceii engaging antibody fragments bind the same T-ceii engaging target. In some embodiments, the two "I‘vceii engaging antibody fragments bind different '1‘— ceII engaging targets. In some embodiments, the two 'f—ceii engaging antibody fragments bind different epitopes on the same I—ceii engaging target. In some embodiments, the T— ceii engaging antibodies or fragments thereof engage one or more T ceii inhibitory receptors instead of one or more T ceii activating receptors. {$883.68} In some embodiments, the ntuitispecific activatabie antibody or fragment thereof of the disciosnre inchides at ieast (i) a first arm comprising an antigen-binding fragment of a T—celi ng dy and (ii) a second arm comprising an antigen~binding fragment of a target binding antibody that inchides a, second antibody or antigenbinding fragment thereof (A32) that binds a. second , where the ABE. is attached to a mashing moiety (MM) such that counting of the MM reduces the ability of the A32 to bind the second target. in some embodiments, the first and second targets are the same antigen. in some embodiments, the first and second targets are different antigens. in some embodiments, the first and second targets are different epitopes on the same antigen. in some embodiments, the T—ceii engaging antibodies or fragments thereof engage one or more T cell inhibitory receptors instead of one or more T cell activating receptors, EddfildQ} in some embodiments, mohispecific activatabie antibodies or fragments thereof of the disciosure inchide at least (i) a T—ceii engaging antibody or fragment thereof that es a first antibody or antigen~binding fragment f (ABE) that binds a first, T— ceii ng target that is a surface antigen on a T ceii, where the ABi is attached to a mashing moiety (MMI) such that ng of the MM} reduces the abiiity of the A81 to bind the first target and (ii) a second antibody or fragment thereof that incindes a second antibody or antigen—binding fragment thereof (ABE) that binds a second , Where the A82 is attached to a masking moiety (MMZZ) such that conpiing of the MM2 reduces the abiiity of the ABE. to bind the second . in some embodiments, the first and second targets are the same antigen. In some embodiments, the first and second targets are diffe ent antigens. in some embodiments, the first and second s are different epitopes on the same n. in some embodiments, the feed engaging antibody or fragment thereof is attached the N—termintis of the heavy chain of the target—specific antibody. in some embodiments, the T—ceii engaging antibody or fragment thereof is ed the C— termimis of the heayy chain of the target—specific antibody. in some embodiments, the T— ceii engaging antibody or fragment thereofis attached the N~terminns of the tight chain of the target~specific antibody. In some embodiments, the T-ceii engaging antibody or fragment thereof is attached the C~terminns of the light chain of the target~specitic antibody. in some embodiments, the pecific activatabie antibody comprises Tnceii ng dies or nts thereof attached to a combination of one or more N—termini and/or 11: 1,49 one or more C—termini of the multispecific tahle antibody. The disclosure also includes multispecific activatahle antibodies that comprise anotherimmune effector cell engaging antibody or fragment thereof, such as one that binds a surface antigen of a natural killer (NK) cell, a mononuclear cell, such as a niyeloid mononuclear cell a macrophage, and/or other immune effector cells. 111111117111 In some embodiments, the 1n ultispecific activatahle antibody or fragment thereof of the disclosure includes at least (i) two T-cell engaging antibodies or antibody fragments thereof that engage one or more T cell activating receptors, such as, for example, TcellegnagingscFy fragments, ing but not limited to, Ode/GlTR, CDl R, (BUICK/ll) Cll327/\KGTD and additional ation of activating reteptors, where the ABl of one of the T-cell engaging antibody fragments is attached to a g moiety (MM) such that coupling of the MM s the ability of that ABl to bind its respective T~ cell ng target, and (ii) one target—binding antibody that includes a second dy or antigen-binding fragment thereof (ABE) that binds a second targe where the ABE is attached to a masking moiety (Mix/l2) such that coupling of the Mth reduces the ability of the A82 to bind the second target, where that the T—cell engaging scFy fragments are linked to both arms of the target binding antibody in some embodiments, the mnltispecific antibody or fragment f of the disclosure includes tt 7o Tucell engaging dies or fragments thereof that engage one or more T cell inhibitory receptors, and one target— binding antibody such that the T—cell engaging scFy' fragments are linked to both arms of the target binding antibody. in some embodiments, the two T~cell engaging antibody fragments bind the same T-cell engaging target. ln some embodiments, the two T-cell engaging antibody fragments bind different Tcell engaging targets in some embodiments, the two T—eell engaging antibody fragments hind different epitopes on the same T—cell engaging target. in some embodiments, the T—cell engaging dies or fragments thereof engage one or more T cell tory receptors instead of one or more T cell activating receptors. {$630171} In some embodiments, the 1n ultispecific activatahle dy or fragment thereof of the sure includes at least (i) two T—cell engaging antibodies or antibody fragments thereof that en gage one or more T cell activating receptors, such as, for example, T—cellLengaging 51.lo; nts, including but not limited to, 0X40GllR Clitl37/ OTTR, CDlBWGXélO CD‘Z'1/NKGZD, and additional combination of ting receptors, where each of Mill of the T—cell engaging antibody fragments is attached to its own mashing moiety (MMl) such that coupling of each h/lMl to its respective ABl reduces the ability of that ABl to bind its respective T—cell engaging , and (ii) one target—binding antibody that includes a second antibody or antigen—binding fragment f (A821) that binds a second target, Where the A52 is ed to a masking moiety (MMZ) such that coupling of the MMZ reduces the ability of the A82 to bind the second target, Where the T—cell engaging scFy fragments are linked to both arms of the target binding antibody, in some embodiments, the multispecific antibody or fragment thereof of the disclosure includes two T~cell engaging antibodies or fragments thereofthat engage one or more T cell inhibitory receptors, and one target-binding antibody such that the T~cell engaging scFV nts are linked to both arms of the target binding antibody, in some embodiments, the two 'i'~cell engaging antibody fragments bind the same 'f--cell engaging target. ln some embodiments, the two T—cell engaging antibody iragments bind different T—cell engaging s. In some embodiments, the two T—cell engaging antibody fragments bind different epitopes on the same Tncell engaging target. in some embodiments, the T—cell engaging antibodies or fragments thereof engage one or more T cell inhibitory receptors instead of one or more T cell activating receptors. 72} in some embodiments, the multispecific activatable antibody or nt thereof of the disclosure includes at least (i) a first arm comprising an antigen-binding fragment ofa T—cell engaging antibody that es a first dy or antigen—binding fragment thereof (ABl) that binds a first, T—cell ng target, where the ABl is attached to a masking moiety (Mb/ll) such that coupling of the MM reduces the ability of the ABl to bind the first target and (ii) a second arm comprising an antigen-binding fragment of a target binding antibody that includes a second dy or antigen—binding fragment thereof (A32) that binds a second target, where the ABS? is attached to a mashing moiety (Mix/l2) such that coupling of the MM reduces the ability of the A52 to bind the second target. in some embodiments, the first and second targets are the same antigen. in some embodiments, the first and second targets are different antigens. in some embodiments, the first and second targets are different epitopes on the same antigen, in some embodiments, the 'l‘—cell engaging antibodies or fragments f engage one or more T cell tory receptors instead of one or more T cell activating receptors. {$388173} in some embodiments, the target antigen is an antigen that is highly expressed on both normal, y tissue and on diseased tissue. in some embodiments, the target antigen is an antigen from Table l that is highly expressed on both normal, healthy tissue and on diseased tissue {$388174} in some embodiments, the target antigen is an antigen that is highly expressed on diseased , but is not highly expressed on normal, healthy tissue. In some embodiments, the target antigen is an antigen from Table l that is highly expressed on diseased tissue, but is not, highly expressed on normal, healthy tissue, The target antigen may be expressed on normal, healthy tissue, but it is not highly or otherwise overexpressed on the , healthy tissue.

Elllllll’FS} in some embodiments, the masking moiety (MM) is coupled to the antibody or anti en—binding fragment thereof (A l3) Via a ble moiety (Chit) that functions as a substrate for a protease. Suitable proteases for use in the multispeeifie aetiyatahle antibodies of the disclosure are determined based on the protease expression at the intended site of treatment and/or sis, in some embodiments, the protease is u—type plasminogen activator (11PA, also referred to as urol Sinica 26, 649—658 (2005); Chan and Carter, Nat. Rev. lmmunol. 20H); Fitzgerald and Lugovslty, MAbs. 3(3):299-3G9 (lel l); Riethmuller, (3., Cancer ty l2, l2~l8 (2012.)). The general concept for construction of bispecific antibodies is to linlt together protein~binding domains, usually based on multiple immunoglohulin domains, in order to construct a molecule that is capable of binding to two or more target antigens and demonstrates lgG—lilte physiological distribution, pharinacoltinetics, and effector function The latter may include antibody-dependent xicity tADCC), complement-dependent cytotoxicity (CDC), T~cell recruitment (Bi'fEsTM) (see eg, Baeuerle, PA. and Reinhardt, (3., Cancer Res. 69, 494l—4944 (2009,), and Tandui‘ibsTM (see Cochlovius et al., Cancer Res. (it), 433643341 (2000)), and/or delivery of a cytotoxic payload in the form of a chemically conjugated moiety such as a microtuhule inhibitor, a DNA all On the other hand, the DVD format (Wu, C, et al., Nature Biotechnol. 25, l29(3--1297 (2007)) provides for the engagement ottwo copies of antigen A in addition to two copies of antigen B. The spacing and relative Orientation of each of the binding domains may also be important for engagement of le antigens in such a way as to confer the intended activity—for exarnple, cross~linl Acad. Sci! USA lllTI’, l2605—l 26% (20mg). Thus, there remains a need for effective antibody—hased th erapeuties that, exhibit improved safety, ego reduced toxicity: {999182} lvlultispecitic activatable antibodies of the disclosure are safer than multispecific reg, hispecific) dies because pecil‘ie activatahle antibody activity/ [Annotation] CLGUS Aug 2021 is restricted to a localized disease environment. In some embodiments, a multispecific activatable antibody is an immune effector cell engaging multispecific activatable antibody.

In some embodiments, a pecific activatable antibody is a T-cell engaging multispecific activatable dy. In some embodiments, a multispecific activatable antibody recognizes two or more targets. In some embodiments, a multispecific activatable antibody comprises an IgG-scFv format confers the long-half-life properties of an IgG. In some embodiments, such a multispecific activatable antibody is r modulated through the use of Fc mutations in the FcRn binding site (Petkova, S. B. et al., Intl. Immunol. 18, 1759-1769 (2006)); Deng, R. et al., mAbs 4, 101-109 (2012); Olafson, T Methods Mol.

Biol. 907, 537-556 (2012). In some embodiments, such a multispecific activatable antibody includes mutations in the Fc domain, such as an N297A mutation (Lund, J. et al., Mol. l. 29, 53-39 (1992)) that reduces IgG effector functions (ADCC and CDC) in order to reduce off-target toxicities.

Multispecific activatable antibodies leverage the up-regulation of protease activity widely recognized as a hallmark of le disease states to achieve disease-tissuespecific targeting of such therapeutics. The activatable dy is based on the use of an IgG antibody, or fragment thereof, such as a scFv region, Fab region, single VH or VL domain that has been modified to include a g moiety (MM), linked to the antibody through a cleavable moiety (CM), such as a protease-cleavable moiety (see, e.g., PCT International Publication Number International Publication Number Alternatively, a non-antibody protein domain (see e.g., PCT International Publication Number WO 96838, published August 26, 2010; Boersma, Y.L. et al., J. Biol. Chem. 286, 41273-41285 (2011)) may be used to achieve one or more binding specificities. A multispecific antibody, like conventional IgG, can be used as the starting point to produce a multispecific activatable antibody. Such a multispecific activatable antibody would allow the high-affinity ing of all antigens recognized by the parental pecific dy, but with -specificity dictated by the selectively activated cleavable linker. Depending upon the multispecific format used, the MM and CM might be placed at the N- or C- terminus of the appropriate domain.

A multispecific activatable antibody ses at least one IgG-derived domain with icity towards a first antigen, linked synthetically or biosynthetically to another domain (which may be derived from an IgG or other protein) with specificity for [Annotation] CLGUS Aug 2021 binding to a second antigen. Additional specificities may be added through linking such a multispecific activatable dy to one or more additional domains conferring additional binding specificities for the first antigen, the second antigen, or additional antigens. In some embodiments, a multispecific activatable antibody has one or more of these s masked by an appropriate masking moiety (MM). Each of the multispecific formats described in Figure 1 can potentially be converted into a multispecific activatable antibody by masking one or more of the antigen binding es of one or more of the immunoglobulin domains. Examples of suitable multispecific activatable antibody s are shown in Figures 3A, and 5-9.

The use of a scFv domain to confer specificity to a specific antigen allows for a modular construction of multispecific antibodies and multispecific activatable antibodies. The use of scFv domain(s) fused to the terminus of IgG heavy or light chains for construction of bispecific antibodies has been previously described (see e.g., Orcutt, K.D. et al., Prot. Eng. Design Select. 23, 221-228 (2010)); Dong et al., (2011). This format ("IgG-scFv") allows a conventional IgG to be converted into a bispecific antibody wherein a first icity is encoded in the variable s of the IgG and a second specificity is encoded in the scFv domains attached through a flexible linker region. Variations of this format include fusing scFv domains at the N- or ini of the heavy or light chains; the scFvs may have the same or differing antigen-binding specificities (Spangler, J. B. et al., J.

Mol. Biol. 422, 532-544 (2012)). In addition, through the use of heavy-chain heterodimers (for example, using knob-hole or similar constructs), scFvs of differing specificities may be attached to the N- or C-terminus of each heavy chain.

In some embodiments, a multispecific activatable antibody has the IgG variable domains masked. In some embodiments, a pecific table dy has the scFv domains masked. In some embodiments, a multispecific activatable antibody has both the IgG variable domains and the scFv domains masked. In some embodiments, one antibody domain of a multispecific activatable antibody has specificity for a target n and another antibody domain has icity for a T-cell surface antigen. In some ments, one antibody domain of a multispecific activatable antibody has specificity for a target antigen and another antibody domain has specificity for another target n.

In some ments, one antibody domain of a multispecific activatable antibody has specificity for an epitope of a target antigen and another dy domain has specificity for another epitope of the target antigen.

Etititiihfl The disc1ostire provides examples of niuitispecitic activatah1e antibody structures which include, hut are not iii'nited to, the foiiowing: (Vi...—CL)2:(VPLCPH~CH‘2— CH3dA—VHi‘~13 —V1..r* —1.12~C1\It~11; 1 —MM); ; (Vie—CL); : (Vii—CH i UCHZUCHS —i.i4—'VI.J* —LS ~ ‘VH’k --L2~CM-L 1 --iv1t‘vt)2; (MM-L i i—L2—-VL--CL)2 :(VH-CHI CH3 ~L4--VH*-—L3 -- VB" )2; (MM~L1 —CM—L2—VL~CL)2:(Vi—i—CH1—Ci—12—Ci-13 —L4~VL*~L3 —Vi—i*)2; (VL— Cifigt’hdh/i—M —CM—L‘2—V11*:113—VH*—1_/1~VH—CH1 —CH2~CH3)2; (VL—CL);:(MMvL1 —CM— L2-VH* --L3 -- 4-VH--CH1--CH2-—CH3)2; (MM-Li "CM-12WL-CL)22(VL*~L3 --VH*-—L4-- Vii—C111 ~CHZ~CH3)3; (MM—L 1~CM~L2—VL—CL)2 *—L3—VL*~L4—VH~CH 1 ~CH’L CHE)2; (\714-6314"IJ4-‘\7E{*"143 —Vi_..* ~LZ—Ci‘y’hici ~Mh/i)2:(VH—CH1~Ci’12—Ci’13iz; (VL~Ci_..—L¢i— V1.1*~1..3 —VH* CM—Li,~h/ih1)2:(\/’H—CHI—CH2—CH3)2; (Mix/t~11; 1 —Ci\«i—LZ~VL*—i_/3 "VH2"— L4--VL--CL)2 : (Vii-CH i CH3)2; (MM-Li _- CM-va2--VH* ~L3 --VL* "144--VrL--CL)QI(‘V7H~ CH1 HS)2; (Vi...~CL—i_..4—V"H*-L3 2~C1\A—Li hiMh: (ix/{hill ~VL*- i433 wVHit—Lr-t—VH—CHE—CH2—CH3)3; (VL—CLJA—VHi‘~13—ViJ*—i..y2—CM—i_livMMh: (MM~ L 1 *’ --L4-- VH-CH1 --CH2--CH3)3 _- CM-vaZn \«’H* ~L3 --VL ; (Vic-CL-Léi-VL" ~L3 --VH* --L2--CM-- L1 ~MM)3 : (MM—L i —C1\/i—L2—VL*—L3 ~Vi-i*—L4~V1—i—Ci—i 1 {ii-124313 )2; (VL—CL—Lit—VL’RLZ — Vi>i*—L2—Ci‘vi~i_..i ~MM)2: (h’ih’hLi-Ch/i—EQ—VH "3-1.3"V14*~14~VH~CH 1 (312431392; (Vb Cier'i/i—VHKLS Sit/if); (MMwL 1 —C1\/1~1..2—VL*~L3 —VH*~1..4—VH~CH i ~CH2~CH3)2; (Vb CL--L4~VH*--L3-—\I’L*)gi (MM-L1"CM-12.W‘H‘i‘"LB~VL*-—L4--VH-—CHi--CH2-—CH3)2; (VL- CL—L4—VL*—L3~VH* )2 : (MM~L1—CM—L2~VL*—L3—Vi—i*—L4~VH—CHi —Ci-i2—Ci-i3)2; (VL— CL—EA—Vifidfi—VH*)2: (MMJJ~CiVi~L2~Vii>t{.3—VL*aL4-VH*CHi"CHZaCi’Bfi; (VL— CL~L4--VH*-—L3--VL*-vL2--CM--L1midis/1):: (VU‘--L3--VH*--L4-—VH--CHt--CH2--CH3)2; (Vic-- CL—Ld—Vi—H—LEfi—VL*~L2—CM—L 1 ~h/i1‘s/i)2 : (\71i*~L3 —VL*—L4—VH~CH 1—CHZ—Ci—i3h; (Vb Ci.;—ifi—VL*—L3—VH*—L‘Z—CNI—L1 $4M}: (VIBE~L3"Vii*-1,/4*Vii—CH i—t?i»i2-t:3i'i3)2; or (Vb Chi/13:71.1*~1..3 —VH*—1_/2wCM—1.11 ~MM)2: (VH* —i43 UV1* ~1..4—VH~CH i ~CH2~CH3 )29 wherein: VL and VH represent the 1ight and heavy vai‘iahie domains of the first specificity, contained in the igG; VL" and VH* represent the variahie domains of the second specificity, coinained in the scFv; 141 is a linker peptide connecting the masking moiety (MM) and the eieavahie moiety (CM); 1.2 is a tinker peptide connecting the cieavahie moiety (CM), and the antibody; L3 is a i" peptide connecting the ie domains of the scFv; L4 is a 1inker peptide connecting the antibody of the first icity to the antibody of the second specificity; CL is the chain constant domain; and CH1, CH2, CH3 are the heavy chain constant domains. The first and second specifieities may he toward any antigen or epitope. Additionei structures inchide, but are not iiinited to, the following: (\I’L—CL—Lll—Vl-ltk—L3~VL*—L2—CI\/l—Ll—l\«ilvl)g:(‘v’I-l—CI-li—Cl—lZ—Cl‘lfllz; (VL—CL— l..4—VL* ~13 -Vl»l*—l_42~CM—L l ~MM); : (VIi—CII l —CII2-Cli3 )2; (MM—L l -CM-I_.2~VL—CL—Lzl— Vli" —I,3 ~Vli*)3 : (VH~CH l ~CH2~CH3 )2; (MM—L l ~ClVi—L2—VL—CL~—i_/l~VI,*~L3—VH*T; :(VH~ CH1 CH3)2 ; (V'LnCL-Ld-N’Hl‘ x-L3 --VL* -vL2--CM--L l --MM)2 2 (Vll-Cll l --Cll2-—Cil3 --L4-- VI-l *—L3 —VL*—L2~Clvl~L l —MM)3; —Lél—VLPk—L?) ~Vl-l*—L2~CM~L l —lVIl\«i)g:(_'\/’H~CH l ~ CH2—CH3 ~i_/l-—Vif" ~13 —VH*JAE—CM—I, i ~MM)2; (bin/LL l —CM—I,2~VL—Cinli4—VH$41.3 — V’L*)2:(VH--CH1--CH2--Cil3lz; or (MM-Ll--(WI-L2--\/"L--CL----L4UVU‘--L3--Vll*)2:(‘y’ll--Clll-- Cl-lZl )2.

Ellllllllifi In some embodiments, a multispecii‘ie aetivatabie antibody comprising an igG ltas tlte igG variable domains masked, In some embodiments, a miiltispecific actiyatable antibody comprising a scFy has the scFy domains masked. In some embodiments, a moitispecii‘ic activatabie antibody has both igG variable domains and scFy doi'nains, where at least one oftlne lgG variable domains is coupled to a masking moiety, In some embodiments, a mnltispecii‘ic activatable antibody has both lgG variable domains and scFV domains, Where at least one oftbe scFy domains is coupled to a masking moiety. in some embodiments, a mnltispeeitic actiya‘table antibody has both lgG le domains and scFy domains, Where at least one of the lgG variable domains is eonpled to a masking moiety and at least one of the scE’y domains is coupled to a masking moiety. in some embodiments, a pecii‘ic activatabie antibody has both igG variable domains and scFy domains, where each of the IgG variable domains and the ser domains is coupled to its own masl H 1,49 llllllllg'll} in some embodiments, the targeting antihody can he in the form an activatahle antibody. ln sorne en'rhodin'rents, the scl?y(s) can be in the form of a Pro~scFV (see, e.g., WO LEW/025846, WC EOlO/(llll l73). {899193} in some embodiments, the schV is specific for binding CD38, e.g., oars. in some embodiments, the scFy is ic for binding CTLA—él (also ed to herein as ..A and C'l'l'..A-4). {tilllllgld} in some embodiments, the scFV is specific for binding one or more 'l‘ucells, one or more ls and/or one or more macrophages. in some ments, the scFV is specific for binding a target selected from the group consisting ot‘Billd, BTLA, CD3, (i134, C138, Cl'Jloa, CDZS, Cl) .7, CDZS, C332, €856, CDl37, Cl‘llAa-l, GlTR, H\/’El\/l, lCOS, LAG3, NléG‘ZD, OXdll, l’D-vl, 'l‘lGlT, Tilt/l3, or VlSTA, and combinations thereof.

Definitions {lllllll o5} Unless otherwise defined, scientific and technical terms used in connection with the present disclosure sh all have the meanings that are commonly understood by those of ordinary skill in the art. Further, unless otherwise required by t, singular terms shall include pluralities and plural terms shall include the singular. Generally, nomenclatures utilized in connection with, and techniques of, cell and tissue culture, rno ecular biology, and protein and v or polynucleotide chemistry and hybridization described herein are those well—known and commonly used in the art. Standard ques are used for recon'rhinant DNA, oligonucleotide synthesis, and tissue e and transformation (e. g., electroporation, lipofection). Enzymatic reactions and purification techniques are med according to manufacturer's specifications or as commonly accomplished in the art or as described herein. The foregoing techniques and procedures are generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed hout the present specification. See cg, Sambrook at of. Molecular Cloning: A Laboratory Manual (2d ed., Cold Spring Harbor l...ahoratory Press, Cold Spring l’larbor, NY ). The latures utilized in connection with, and the laboratory procedures and techniques of, analytical chemistry, synthetic organic chemistry, and medicinal and pharmaceutical chemistry described herein are those well—known and commonly used in the art. Standard ques are used for chemical syntheses, chemical analyses, pharmaceutical preparation, ation, and delivery, and treatment of patients.

[Annotation] CLGUS Aug 2021 [000196] As utilized in accordance with the present disclosure, the following terms, unless ise indicated, shall be understood to have the following gs.

As used , the term "antibody" refers to immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen. By 2020200981 "specifically bind" or oreacts with" or "immunospecifically bind" is meant that the antibody reacts with one or more antigenic determinants of the desired antigen and does not react with other polypeptides or binds at much lower affinity (Kd > 10-6). Antibodies include, but are not limited to, onal, monoclonal, chimeric, fully human, domain antibody, single chain, Fab, and F(ab')2 fragments, scFvs, and an Fab expression library.

The basic antibody structural unit is known to comprise a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light" (about 25 kDa) and one "heavy" chain (about 50-70 kDa). The terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids ily responsible for antigen recognition. The carboxy-terminal portion of each chain defines a constant region primarily responsible for effector on. In general, antibody molecules obtained from humans relate to any of the classes IgG, IgM, IgA, IgE and IgD, which differ from one another by the nature of the heavy chain present in the molecule.

Certain classes have subclasses as well, such as IgG1, IgG2, IgG3, IgG4, and others.

Furthermore, in humans, the light chain may be a kappa chain or a lambda chain.

The term "monoclonal antibody" (mAb) or "monoclonal dy composition", as used herein, refers to a population of antibody molecules that n only one molecular species of antibody molecule consisting of a unique light chain gene product and a unique heavy chain gene product. In particular, the complementarity determining regions (CDRs) of the monoclonal antibody are identical in all the molecules of the population. MAbs contain an antigen binding site capable of immunoreacting with a ular epitope of the antigen characterized by a unique binding affinity for it.

The term en-binding site" or "binding portion" refers to the part of the immunoglobulin molecule that ipates in antigen binding. The antigen binding site is formed by amino acid residues of the N-terminal variable ("V") regions of the heavy ("H") and light ("L") . Three highly divergent hes within the V regions of the heavy and light chains, ed to as "hypervariable regions," are interposed between more conserved flanking stretches known as "framework regions," or "FRs". Thus, the term "FR" refers to amino acid sequences that are naturally found between, and adjacent to, hypeiyariahle regions in irnmunoglobulins. in an antibody molecule, the three hypervariahle regions of a light chain and the three hypervariahle regions of a heavy chain are disposed relative to each other in three dimensional space to form an antigen-binding surface. The antigen~hinding e is complementary to the three—dimensional surface of a hound antigen, and the three hypetvariahle s of each of the heavy and light chains are re ‘erred to as "complementarity--deterniining s," or "CDRs." The assignment of amino acids to each domain is in accordance with the ions of Rabat Sequences of Proteins nological interest (National lnstitutes of Health, Bethesda, Md U98? and l99l)), or Chothia 84: {KESR J. Mol, Biol, l96:9tll—9l7 (l 987), Chothia er al. Nature 342:878— 883 {1989). lilillllell As used , the term "epitope" includes any protein determinant e of specific binding to an irnrnunoglohulin, an scFv, or a T—cell receptor. The term "epitope" includes any protein determinant capable of specific binding to an immunoglohulin or 'l'x- cell receptor. Epitopic determinants y consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three ional structural characteristics, as well as specific charge characteristics. For example, antibodies may be raised against N-terminal or C-terminal peptides of a ptide. An antibody is said to specifically hind an antigen when the dissociation constant is _<_ l old; for example, in some embodiments _<_ lth anl and in some enihodirnents i: it} nh'l, ifiiiiiltlll As used herein, the terms "specific binding," ological binding," and "immunological g properties" refer to the non-covalent interactions of the tyre that occur hetv'een an immunoglohulin molecule and an anti en for which the immunoglohulin is ic. The strength, or affinity of immunological binding interactions can he expressed in terms of the dissociation constant (Kd) of the interaction, wherein a smaller Kit ents a greater affinity. lnimunologieal binding ties of selected polypeptides can be quantified using methods well known in the art. One such method entails measuring the rates of antigen—binding site/antigen complex formation and dissociation, wherein those rates depend on the concentrations of the complex partners, the affinity of the interaction, and geometric parameters that equally influence the rate in both directions, Thus, both the "on rate constant" (Ken) and the "off rate constant" (Km?) can be determined by calculation of the concentrations and the actual rates of association and dissociation. (See Nature 36l : l 86—87 (l 993)). The ratio of lief/Km enables the cancellation of all parameters not related to allinity, and is equal to the dissociation nt Kd, (See, grazemfiy, Davies et al. 0990) Annual Rev Biochem 59:459—473), An antibody of the t disclosure is said to cally bind to EGFR, when the equilibrium binding constant (Ks) is El old, for example in some embodiments _<. lot) his/l, in some embodiments < l0 anl, and in some embodiments S ltltl pM to about l phi, as ed by assays such as radioligand binding assays or similar assays known to those slrilled in the art.

{Milli-2%} The term "isolated polynucleotide" as used herein shall mean a polynucleotide of genomic, cDNA, or tic origin or some combination thereof, which by virtue of its origin the "isolated polynucleotide" (l) is not associated with all or a portion of a polynucleotide in which the "isolated polynucleotide" is found in nature, (‘2) is operably linked to a polynucleotide that it is not linlted to in nature, or (3) does not occur in nature as part of a larger sequence. Polynucleotides in accordance with the disclosure include the nucleic acid molecules encoding the heavy chain immunoglobulin molecules shown herein, and nucleic acid molecules encoding the light chain globulin les shown herein. {$3thle The term "isolated protein" referred to herein 1 cans a protein of eBNA, recombinant RNA, or synthetic origin or some combination f, which by virtue of its , or source of derivation, the "isolated protein" (l) is not ated with proteins found in nature, (2,") is free of other proteins from the same source, cg, tree of rnurine proteins, (3) is expressed by a cell from a different s ecies, or (ll) does not occur in nature {Milli-2%} The term "polypeptide" is used herein as a generic term to refer to native protein, fragments, or analogs of a polypeptide sequence. Hence, native protein fragments, and analogs are species of the polypeptide genus. Polypeptides in accordance with the sure comprise the heavy chain immunoglobulin molecules shown , and the light chain immunoglobulin molecules shown , as well as antibody molecules formed by combinations comprising the heavy chain imrnunoglobulin molecules with light chain immunoglohulin molecules, such as kappa light chain imrnunoglohulin molecules, and Vice versa, as well as fragments and analogs thereof. {snares} The term "naturally—occurring" as used herein as applied to an object refers to the fact that an object can be found in nature, For example, a poly eptide or polynucleotide sequence that is present in an organism (including viruses) that can he ed from a source in nature and that has not been intentionally modified by man in the laboratory or otherwise is lly—occurring. {tlllllZil’i’} The term bly linked" as used herein refers to positions of compmrents so described are in a onship permitting them to function in their intended manner. A control sequence "onerably linked" to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under conditions compatible with the control sequences.

Eiltltllltl8} The term "control sequence" as used herein refers to polynucleotide sequences that are necessary to effect the expression and processing ofcoding sequences to which they are ligated. The nature of such control sequences differs epending upon the host organism in prolraryotes, such control sequences generally include er, ribosomal binding site, and transcription termination sequence in eukaryotes, generally, such control sequences include promoters and transcription termination sequence. The term "control sequences" is intended to include, at a minimum, all ents whose presence is essential for expression and processing, and can also include onal components whose presence is ageous, for example, leader sequences and fusion partner sequences The term "polynucleotide" as referred to herein means nucleotides of at least ll) bases in length, either rihonucleotides or deoxynucleotides or a modified form of either type of nucleotide.

The term includes single and double stranded forms of DNA. {filltthWl The term oligonucleotide referred to herein includes lly occurring, and modified tides linked together by lly occurrin i, and nmi—naturally occurring oligonucleotide linkages. ucleotides are a polynucleotide subset generally comprising a length of200 bases or fewer! in some embodiments, oligonucleotides are ll) to fit) bases in length, for example in some embodii ents l2, l3, l4, l5, l6, l7, l8, l9, or 29 to 40 bases in length. Oligonucleotides are usually single stranded, cg, for probes, although oligonucleotides may be double ed, eg, for use in the construction ofa gene mutant. Oligonucleotides of the sure are either sense or an tisense oligonucleotides. ltltlllzlfl} The term "naturally occurring nucleotides" referred to herein includes deoxyrihonucleotides and ribonucleotides. The term "modified nucleotides" referred to herein includes nucleotides with modified or substituted sugar groups and the like. The term "oligonucleotide linkages" referred to herein includes oligonueleotide linkages such as phosphorothioate, phosphorodithioate, phosphoroselerloate, phosphorodiselenoate, phosphoroanilothioate, pl'toshoraniladate, phtisnhoroitniiclate, and the like. Sec 6.3:, LaPlanche at a]. Nuci. Acids Res. 14291181 (1986); Stec e: of. 1. Am. Chem. Soc. 106261177 (1984), Stein et ai. Nuci. Acids Res. 16:3209 0988,), Zon at til. Anti Cancer Drug Design 6:539 (1991); Zen er HZ, Oligonucieotides and Anaiogues: A Practicai Approach, pp. 877—108 (F. Echstein, Ed, Oxford University Press, Oxford Engiand (1991),); Stec er 622’. US. Patent No. 5,151,510; Uhlmann and Peyrnan Chernicai Reviews 90:543 (1990). An oiigonucleotide can e a label for detection, if desired. restrain As used herein, the twenty conventionai amino acids and their abhre ns t‘oiiow conventional usage. See immunology — A Synthesis (an Edition, ES. o and DR. Gren, Eds, Sinauer Associates, Sunderiand?’ Mass. (19% ,1). Stereoisomers (eg. 1)— amino acids) of the twenty conventional amino acids, unnaturai amino acids such as d—, d— disuhstituted amino acids, Nt-ailqu amino acids, 1actic acid, and other unconventionai amino acids may aiso be suitable components for polypeptides of the present sure. Examples of unconventional amino acids include: 4 hydroxyproiine, y-carhoxygiutamate, N— triniethyilysine, i: ~N-acetyiiysine, O-phosphoserine, N- acetyiserine, N-forrnyimethionine, 3K-niethyihistidine, 5--hydroxylysine, o-N--methyiarginine, and other simiiar amino acids and imino acids (eg 4— hydroxvproiine). in the poiypeptide notation used herein, the 1eft—hand direction is the amino terminal direction and the right-hand direction is the carhoxy-terntinai ion, in accordance with standard usage and tion.

{WHERE} Simiiariy, unless specified oti'ierwise, the 1eft—hand end ot‘singie— stranded poiynucleotide ces is the 5' end the left-hand direction of double-stranded poiynucleotide sequences is referred to as the 5' direction. The direction of 5‘ t"; . \1.) w addition of nascent RNA transcripts is referred to as the transcription ion sequence regions on the DNA strand having the same sequence as the RNA and that are 5' to the 5’ end of the RNA transcript are referred to as ‘aipstreani sequences", sequence regions on the DNA strand having the same sequence as the RNA and that are 3‘ to the 3‘ end of the RNA transcript are referred to as "downstream sequences". {913132131 As appiied to polypeptides, the term "substantial identity" means that two peptide sequences, when optirnaiiy d, such as by the programs GAP or BESTFiT using defauit gap weights, share at 1east 80 percent sequence identity, for exampie in some embodiments, at least 90 percent sequence identity, in some embodiments at least 95 percent sequence identity, and in some ments at least 99 t ce identity.

Eiiiiiils': 14} in some embodiments, residue positions that are not identicai differ by conservative amino acid substitutions.

Eilllllil 15} As discussed herein, minor variations in the amino acid ces of antibodies or irnm unoglohulin rnolectrl es are contemplated as being encompassed by the present sure, providing that the variations in the amino acid sequence maintain at least 75%, for e in some embodiments at least 80%, 90%, 95%, and in some embodimentsi 99%. In particular, conservative amino acid replacements are contemplated. Conservative replacements are those that take place within a family of amino acids that are related in their side chains. Genetically encoded amino acids are generally divided into families: (l) acidic amino acids are aspartate, glutamate; (2) basic amino acids are lysine, arginine, histidine; (3) non~polar amino acids are e, valine, leucine, isoletrcine, proline, phenylalanine, methionine, tryptophan, and (-4) unchar ed polar amino acids are glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine. The hydrophilic amino acids e arginine, asparagine, aspartate, gltrtamine, glutamate, histidine, lysine, serine, and threonine.

The hydrophobic amino acids include alanine, cysteine, cine, leucine, methionine, phenylalanine, proline, tryptophan, tyrosine and valine. Gther families of amino acids include (i) serine and threonine, which are the aliphatic~hydroxy family; (ii) asparagine and glutarnine, which are the amide containing family; (iii) alanine, valine, e and isoleucine, which are the aliphatic family; and (iv) phenylalanine, phan, and tyrosine, which are the aromatic family. For example, it is reasonable to expect that an isolated replacement of a leucine with an isoleucine or valine, an aspartate with a glutamate, a threonine with a serine, or a similar ement of an amino acid with a structurally related amino acid will not have a major effect on the g or properties of the resulting molecule, especially if the replacement does not e an amino acid within a, ork site. ‘Nhe‘ther an amino acid change results in a functional peptide can readily be determined by assaying the specific activity of the polypeptir e r erivative. Assays are described in detail herein. fragments or s of antibodies or glohulin molecules can be readily prepared by those of ordinary skill in the art. ln some embodiments, arnino— and carhoxy~termini of fragments or analogs occur near boundaries of onal domains ural and functional domains can be identified by comparison of the tide and/or amino acid sequence data to public or proprietary sequence databases.

Computerized comparison methods are used to identify sequence motifs or predicted protein conformation domains that occur in other proteins of known structure and/or function.

Methods to identify protein sequences that fold into a known three-dimensional structure are known. Bowie at a]. Science 253:164 (l99l). Thus, the ing examples demonstrate that those of slrill in the art can recognize sequence motifs and structural conformations that may be used to define structural and timctional domains in ance with the disclosure. {899216} ln some embodiments, amino acid substitutions are those that: (_ 1) reduce susceptibility to proteolysis, (:2) reduce susceptibility to oxidation, (3) alter binding affinity for forming protein complexes, (4) alter binding affinities, and (4) confer or modify othe physicochemical or functional properties of such s. Analogs can include various nruteins of a sequence other than the naturally—occurring peptide sequence. For example, single or multiple amino acid substitutions (for example, conservative amino acid substitutions) may be made in the natural ly~ occurring sequence (for example, in the portion of the polypeptide outside the domainiis) ‘orming intermolecular contacts. A conservative amino acid substitution should not substantially change the structural characteristics of the parent sequence (tag, a replacement amino acid should not tend to break a helix that occurs in the parent sequence, or disrupt other types of secondary structure that terizes the parent sequence). es of art—recognized polypeptide secondary and tertiary structures are described in Proteins, Structures and Molecular Principles hton, Ed, W. ll.

Freeman and Company, New Y'orl'x' 098-4)); uction to Protein Structure (C. Branden and .l. 'l‘ooze, eds, d Publishing, New York, NY @991»; and Thornton et at.

Nature 3541ltl5 (l99l).

{GWEN} The term eptide nt" as used herein refers to a polypeptide that has an amino terminal and/or carboxy—terminal deletion and/or one or more internal deletionts), but Where the remaining amino acid sequence is identical to the corresponding positions in the naturally—occurring sequence deduced, for example, from a full length cl)NA sequence. Fragments typically are at least 5, 6, 8 or l0 amino acids long, for example in some embodiments at least l4 amino acids long, in some embodiments at least amino acids long, usually at least 50 amino acids long, and in some embodiments at least 70 amino acids long. The term "analog" as used herein reters to polypeptides that are sed of a segment of at least 215 amino acids that has substantial identity to a portion ot‘a deduced amino acid sequence and that has specific binding to EGFR, under suitable binding conditions. Typically, polypeptide s comprise a vative amino acid substitution (or addition or deletion) with respect to the naturally— occurring sequence.

Analogs typically are at least 2% amino acids long, for e in some embodiments at least 50 amino acids long or longer, and can often be as long as a full~length naturally~ occurring polypeptide, {$388218} The term "agent" is used herein to denote a chernical nd, a mixture of chemical compounds, a biological macromolecule, or an extract made from biological materials. {$630219} As used herein, the terms "label" or "labeled" refers to incorporation of a detectable marker, egg, by oration of a radiolabeled amino acid or attachment to a polypeptide ot‘biotinyl es that can be detected by marked avidin (cg, streptayidin containing a fluorescent marker or enzymatic activity that can be detected by optical or calorimetric methods), ln "ertain situations, the label or marker can also be therapeutic.

Various methods of ng ptides and glycoproteins are known in the art and may be used. Examples of labels for polypeptides include, but are not limited to, the tollowing: sotopes or radionuclides (9.3, 3H, 14C, 15N, 358, 903/ 99"l7c, min, 125l, Bil), scent labels , a fluorophore, rhodamine, lanthanide phosphors), enzymatic labels (rag, horseradish peroxidase, p—galactosidase, rase, alkaline phosphatase), chemiluminescent, biotinyl groups, predetermined polypeptide epitopes ized by a secondary reporter (cg, leucine zipper pair sequences, binding sites for ary antibodies, metal binding domains, epitope tags). ln some embodiments, labels are attached by spacer arms of various lengths to reduce potential steric hindrance. The term "pharmaceutical agent or drug" as used herein refers to a chemical compound or composition capable of inducing a desired thera eutic effect wh en properly administered to a patient. {tillllZle} As used , "substantially pure" means an object species is the predominant species present (126., on a molar basis it is more abundant than any other individual s in the composition), and a substantially purified fraction is a composition wherein the object species comprises at least about 50 percent (on a molar basis) of all rnacromolec ular s present. {$630221} Generally, a substantially pure composition will comprise more than about lit) percent of all macromolecular s present in the composition, for example, in some embodiments, more than about 85%, 90%, 95945, and 99%. In some embodiments, the object species is purified to essential homogeneity (contaminant species cannot be de ,ecte' in the composition by conventional detection methods) wherein the composition consists essentially ofa single macromolecular species.

EiititiZZZ} The term patient includes human and veterinary subj ects.

HERMES} Other chemistry terms herein are used according to conventional usage in the art, as exemplified by The McGraw—Hili Dictionary of Citemicai Terms r, Sq Ed McGraW’x-Hiii, San sco (1985)).

Mtiitig _ ecific Antibttdies and Muitig ecific /table Antibodies {999224} Exemplary multispecifie antibodies and/or multispeeitic aetivetabie antibodies of the disciosure ineiudefi for example, those shown in the Examples provided herein, and variants thereofi EiititiZZS} in some non—limiting embodiments, at least one ofthe AB in the multispecifie antibody is a binding partner for any target listed in Table i.

Tabie i: Exempiary Targets Alpha—4 inteOi‘in alphaltbeta i aiphadbeta’i "integer: Apeiin 3 Endot‘neiin B igE Receptor receptor receptor {FeeRl} is CAM EPHA2 Mucin— 1 6 (MUCI e, CA~ t 25 " C3117 Net/K A’I‘i’ase Keutrophi} coin lenient eiastese CD132 F n of (iL—ZRG‘) RSV CD} 3 3 CA 1 9—9 CD} 3 7 1L 121349 Lewis a Rece )tors Carbonic C3138 FGF8 , Notch 1 TNFRSiZ anhydrase 9 Rbetai A [ CD: CD 166 FGFRJ 1711,13 Notch 21 TRAii..—R1 ODS CD172A FGFRE II..13‘R. Notch 3 TRAH..—R21 FGFR3 I , Notch 4 1ransfenin 196111114 , 1 1aansfenin reee tor mm811 1L27,I’1L27R PDGE~B13 VCAM—1 {wsx1} Co11agen ‘ 11129 1313613111me VEGF Cripto GLU’1‘1 1L-"11{ PDGE‘Rbeta VEGE—A CSFR (3131114 1L31’1L31R 1311-1 VEGF-B (38111-1 GM-CSF -- , VEGE-C CTLA--4 GM-CSFR ' -- L- VEGET-D CTGF GP 1113/1113 ' " Phosphatidfln VEGER1 > "n ' serine 1’ SMA RAGF‘ m ne 1 Phosfihate {1111112261 111 some -1imiting embednnents, at 1:22:51 one of the AB 0111163 multispecifie antibody is: at is derived from a sequence set forth in TabEe 7 in the Exammes provided herein. 1111111227} In some non~11rniting embodiments, at 16:21:11 one Of the AB of the eeifie dy is or is derived from an antibedy fisted in 131316 ‘2 Tank: 2: Exempmr‘y sources 101' ABS Antibody Trade Name 11111113; name) Target Avastinm fbevaeizumab" VEGF 1.,ueentisTM 1’ran ibizumab‘) VEGF Erbituxm ximam EGFR Vectibixm 1’ animmuxnab‘) EGFR Remicadem "inflixinnapr "1111511 Humiram (311111 1113umab) "1111511 ’1‘153131'1111 (n atafizumab) 1me n‘inwi- Simuiectm ’basifiximab" 11.12111, [Annotation] CLGUS Aug 2021 Soliris™ (eculizumab) Complement C5 Raptiva™ (efalizumab) CD11a Bexxar™ (tositumomab) CD20 Zevalin™ (ibritumomab tiuxetan) CD20 Rituxan™ (rituximab) CD20 Ocrelizumab CD20 Arzerra™ (ofatumumab) CD20 2020200981 Obinutuzumab CD20 Zenapax™ (daclizumab) CD25 Adcentris™ (brentuximab vedotin) CD30 Mylotarg™ (gemtuzumab) CD33 Mylotarg™ (gemtuzumab ozogamicin) CD33 h™ (alemtuzumab) CD52 ReoPro™ (abciximab) Glycoprotein receptor IIb/IIIa Xolair™ zumab) IgE Herceptin™ (trastuzumab) Her2 Kadcyla™ (trastuzumab emtansine) Her2 Synagis™ (palivizumab) F protein of RSV mumab) CTLA-4 (tremelimumab) CTLA-4 Hu5c8 CD40L (pertuzumab) Her2-neu (ertumaxomab) r2-neu Orencia™ (abatacept) CTLA-4 (tanezumab) NGF (bavituximab) Phosphatidylserine (zalutumumab) EGFR umumab) EGFR (matuzumab) EGFR (nimotuzumab) EGFR ICR62 EGFR mAb 528 EGFR CH806 EGFR MDX-447 EGFR/CD64 (edrecolomab) EpCAM RAV12 RAAG12 huJ591 PSMA Enbrel™ (etanercept) TNF-R Amevive™ cept) 1LFA-3 Antril™, Kineret™ (anakinra) IL-1Ra GC1008 TGFbeta Notch, e.g., Notch 1 Jagged 1 or Jagged 2 (adecatumumab) EpCAM (figitumumab) IGF1R (tocilizumab) IL-6 or Stelara™ (ustekinumab) IL-12/IL-23 ™ (denosumab) RANKL Etltltlfld} Also included in the disclosure are niultispecii'ic antibodies and/or niuitispecitie actiyatable antibodies that bind to the same epitope as the niuitispecilie antibodies and/or rnultispeeific aetivatabie antibodies bed herein. {8639229} Those skilled in the art will recognize that it is possible to determine, without undue experimentation, if a rnultispecilic antibody and/or a rnultispecitic activatable antibody has the same or similar specificity as a niultispecitic antibody and/or inultispecitie activatable antibody of the disclosure by ascertaining whether the forrner prevents the latter from binding to a target. it the rnultispecilic antibody and/or a niultispecii‘ic activatable antibody being tested competes with the tn ecil'ic antibody and/or a niultispeeifie actiyatable antibody of the disclosure, as shown by a se in binding by the specific antibody and/or a niultispecific activatable dy of the sure, then the two specilic antibodies and/or ntultispecilic activatable antibodies bind to the same, or a closely related, epitopei {Milli-2’38} One ment for determining r a, inultispeciflc antibody and/or a niultispecitie activatable antibody has the same or sirnilar specificity as a niultispecilic antibody and/or a inultispeeitic actiyatable antibody of the disclosure is to pro—incubate the specitic antibody and/or a niultispecitic actiyatable antibody of the disclosure with soluble target with which it is ly reactive, and then add the niultispecitic antibody and/or a ntultispecitie table antibody being tested to determine if the inultispeeitic antibody and/or a rnultispecitic aetivatabie antibody being tested is inhibited in its ability to bind the target. If the niultispecifie antibody and/or a niultispeeitic aetiyatable antibody being tested is inhibited then, in all likelihood, it has the same, or functionally equivalent, epitopic specificity as the rnnltispecitic antibody and/or a tnultispecitic aetivatabie antibody of the disclosure {999231} A niultispecitic antibody and/or a niultispecilic activatable antibody is generated, for example, using the ures bed in the Exarnples provided below. A rnultispecitic antibody and/or a tnultispecitic aetivatable antibody can also be generated using any of a number of art—recognized techniques "or dy production and/or purification.

Eiltltl232} Antibody fragments, such as by, F(ab’)g and Fab, for use in a niultispeeitic antibody and/or a niultispeeitic aetiyatable antibody may be prepared by cleavage of the intact protein, eg by se or chemical cleavage. atively, a truncated gene is designed. For example, a chimeric gene encoding a portion of the Ftab’)2 fragment would include DNA sequences ng the (fl-ll domain and hinge region of the El chain, follmved by a translational stop codon to yield the ted n'iolecule. {$388233} Expression vectors include plasmids, retroviruses, YACs, EBV derived episomes, and the like. A convenient vector is one that encodes a fitnctionally complete human (fl-l, or CL irnmunoglohulin sequence, with appropriate restriction sites ered so that any VH or VL sequence can be easily inserted and expressed. in such vectors, splicing usually occurs between the splice donor site in the inserted l region and the splice acceptor site preceding the human C region, and also at the splice regions that occur Within the human CH exons. Polyadenylation and transcription ation occur at native chromosomal sites downstream of the coding regions. The resulting antibody may be joined to any strong promoter, including retroviral L'l‘lis, cg, SV-dl) early promoter, (Okayama er a]. l‘v‘lol. Cell. Bio. 3:280 6983):), Rous sarcoma virus LTR n er (2!.

PNAS. 79:6??? (l 982)), and moloney rnurine leukemia virus LTR (Grosschedl er a]. Cell 4l2885 (1985)). Also, as will be appreciated, native lg promoters and the like may he used. liltlllllllél} Further, pecilic antibodies and/or inultispecific activatable antibodies can be generated through display type technologies, including, without limitation, phage display, retroviral display, rnal display, and other techniques, using techniques well known in the art and the resulting molecules can he subjected to additional maturation, such as allinity maturation, as such techniques are well known in the art. Wright of a]. Crit, Reviews in lmrnunol. l2l2S—l 68 (l 992), llanes and thun PNAS USA 94:4937-4942 (l 99?) (rihosornal display), Parmley and Smith Gene 73:305—3 l8 (l 988) (phage display), Scott, 'l‘lBS, vol. 17:24lK-245 (1992), Cwirla er a1. l’NAS USA 86382 (1993), Russel er a]. Nucl. Acids Research 2i :ltllll—ltlgfi (1993), l’loganhoorn er a]. lmmunol. Reviews l30:43—68 0992), Chiswell and h'lcCafferty "l‘llfi’l‘ECH; l0:8l)~SA 0992), and US. Patent No. 5,733,743.

EllllllZflSl it can be ble to modify the rnultispecitic antibody and/or multispecilic activatahle antibody of the disclosure with respect to effector function, so as to e or reduce such function to improve the effectiveness of the antibody in treating es and ers. For example, cysteine residue(s) can be introduced into the Fc region, thereby allowing interchain disullide bond formation in this region. The homodimeric antibody thus generated can have improved internalization capability and/or increased complement— mediated cell killing and antibody-dependent ar cytotoxicity (ADCC). {See Caron et al., J. Exp Med, l7o: llSll—ll95 (1992) and Shopes, J. l, l48: Elli—2922 0992)). ’7mII Alternatively, an antibody can be engineered that has dual Ec regions and can thereby have enhanced cornp1ement lysis and ADCC capabilities, (See Stevenson et at, ancer Urn0 Design, 3: 219230 (1989)), In some embodiments Fe mutations are made to remove’V {:3 Ly 9 , , , ‘lycosyiation sites thereby reducing E'c function. 4 .. ) , U Mnltis eeit’ic Aetivatable Antibodies {000236} The inultispecitic activatab1e antibodies and rna1tispeci1ic aetivatable antibody compositions provided herein n at least a first antibody or dy fragment thereof (collectively referred to as ABl throughout the disclosure) that specifically binds a first target and/or a first epitope and a second antibody or antibody fragment thereof (collectively ed to as A132 throughout the sure) that specifically binds a. second target and/or a, second epitope, wherein at least one of the AB is modified by a masking moiety (MM). in some embodiments, each AB in a mnltispecitic activatabie antibody is tnoditied by its own masking moiety. {000237} When at least one of the AB in a multispecilie actiyatahle antibody is modified with a MM and is in the presence of its target, specific binding of the AB to its target is reduced or inhibited, as compared to the specific binding of the AB not modified with an MM or the specific binding of the parental AB to the target. {000238} '1'heK.d of the AB d with a MM towards the target is at least 5, 10, , 25, 40, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 50,000, 100,000, 500,000, 1,000,000, 5,000,000, 10,000,000, 50,000,000 or greater, or between 510, 10—100, 10— 1,000, 00, 10100000, 101,000,000, 1,000,000,000, 100—1000, l00~l0,000, l00~ 100,000, 100--1,000,000, 100--10,000,000, l,000--10,000, 1,000--100,000, 1,000--1,000,000, 1000~10,000,000, 10,000—100,000, 10,000—l,000,000, 10,000—10,000,000, 100,000 000, or l00,000—l0,000,000 times r than the Rid of the AB not d with an MM or of the parental AB towards the target. Conversely, the binding affinity of the AB modified with a MM towards the target is at least 5, 10, 2.0, ‘25, 40, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, , 100,000, 0, 000, 5,000,000, ,000, 50,000,000 or greater, or between 5—10, , 101,000, 10—10000, 10—100,000, 10— 1,000,000, l0--10,000,000, 1001,000, 100-10,000, 100~100,000, l00-—1,000,000, 100- ,000,000, l,000~10,000, 1,001.1—100,000, 1,000—1,000,000, 1000—10,000,000, 10,000— l00,000, 10,000~1,000,000, 10,000-10,000,000, 100,000~l,000,000, or 10000040000000 times lower than the binding affinity of the AB not modified with an MM or of the parental AB towards the target. {000239} The dissociation constant (Kd) of the MM towards at least one the AB in the niuitispecifie actiyatabie antibody is generaily greater than the Kid of the AB towards the target. The Kd of the MM towards the AB can be at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 100,000, 1,000,000 or even 10,000,000 tirnes greater than the Kd of the AB towards the target. Converseiy, the binding affinity of the MM towards the AB is gene "ally lower than the binding affinity of the AB towards the target, The binding affinity ofMM s the AB can be at least 5, 10, 2.5, 50, 100, 250, 500, 1,000, 2,500, ,000, 10,000, 100,000, 1,000,000 or even 10,000,000 tirnes‘ lower than the binding affinity of the AB towards the target. {000240} When at 1east one of the AB in the ninitispeeific aetiyatabie antibody is modified with a MM and is in the presence of the , specific binding of the AB to its target is reduced or inhibited, as compared to the specific binding of the AB not ied with an MM or the specific binding of the patented AB to the target, ‘Wnen compared to the binding of the AB not modified with an MM or the binding of the parental AB to the target, the ABS ability to bind the target when d with an MM can be reduced by at least 50%, 60%, 70%, 8 %, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% and even 101 % for at ieast 2, 41-, 6, 8, 12, 28, 24, 30, 36, 48, 60, 72, 84, or 96 hours, or 5, 10, 15, 30, 45, 60, 90, 120, 150, or 180 days, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months or more when measured in viva or in an in vitro assay. {000241} The MM inhibits the binding of at ieas‘t one of the AB in the rnnltispeoitic activatabie antibody to its target, The MM binds the antigen binding domain of the AB and ts binding of the AB to its target. The MM can stericaiiy inhibit the binding of the AB to the . The MM can aiiostericaliy inhibit the g of the AB to its target. in these embodiments when the AB is ed or conpied to a Mix/1 and in the presence of target, there is no binding or substantialiy no binding of the AB to the target, or no more than 0.001%, 0.01%, 0.1%, 1%, 29/21, 3%, 4%, 5%, 69433, 7%, 8%, 9%, 10%, 150/5, 20%, 25%, %, 35%, 40%, or 50% binding of the AB to the , as compared to the binding of the AB not modified with an MM, the ai AB, or the AB not eoupled to an MM to the target, for at least 2, 4, 6, 8,12, 28, 24, 30, 36, 48, 60, 72, 84, or 96 hours, or S, 10, 15, 30, 45, 60, 90, 120, 150, or 180 days, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 rnonths or ionger when measured in vivo or in an in vitro assay. {000242} When at 1east one of the AB in a inuitispecitic activatable antibody is coupled to or modified by a MM, the MM ‘ntasks’ or reduces or otherwise inhibits the specific binding of the AB to its target. When at least one of the AB in a multispeeilie activatable antibody is coupled to or ri'toditied by a MM, such coupling or modification can effect a structural change that reduces oi inhibits the y of the A8 to specifically bind its targe 33 in a multispecil‘ie aetivatable antibody, when at least one AB is coupled to or modified with an MM, at least a portion of the multispeeilie aetiyatable antibody can be represented by the following formulae (in order from an amino (N )1 terminal region to earboxyl (C) al region: (MMl—(AB) (AB)~(h When compared to the binding cf the al A8 or the binding of an AB not modified with an MM and a CM to its target, the AB’S ability to bind the target, when modified with ’0%, 94° an MM and a CM can be reduced bv at least 50%, 60%, 700//,0 80/0, 90%, 92% 93 ,0, 95""/c 96%, 97%, 98%, 99/o and even l00% fer at least",4 0, 8 12,28, 24, 30, >048, 60, 72, 84, or 96 hours or 5, ll}, 15, 30, 45, 6t), 90, thi, 150, or 180 days, or 1, 2, 3, 4, 5, 6, '7, 8, 9, it), l l, or 12 months or longer when measured in vivo or in an in vitro assay. {@82le As used herein, the term cleaved state refers to the condition of the specific activatahle antibodies following modification of the CM by a se. The term ved state, as used herein, refers to the condition of the specil‘ic activatable antibodies in the absence of cleavage of the CM by a protease, As discussed above, the term "inultispecitic activatable dies" is used herein to refer to a. specitic activatable antibody in both its uncleaved (native) state, as well as in its cleaved state. it will be apparent to the ordinarily skilled artisan that in some en'ibodin'ients, a cleaved niultispecilie activatable antibody may lack an MM due to cleavage of the CM by protease, resulting in release of at least the MM (cg, where the MM is not joined to the rnultispecilic activatable antibodies by a covalent bond tag, a disultide bond between cysteine residues). {999251} By activatable or switchable is meant that the m ultispecilic aetivatable antibody exhibits a first le *el of binding to a target when in a inhibited, masked or uncleaved state (to, a first conformation), and a second level of g to the , in the uninhibited, unrnaslred and/or cleaved state (126., a second conformation), where the second level of target binding is greater than the first level of binding. in general, the access of target to the corresponding AB of the inultispecitic activatahle antibody is greater in the presence of a cleaving agent capable ol‘cleaving the CM than in the absence of such a cleaving agent. Thus, when the nniltispecitic activatable antibody is in the uncleaved state, at least one AB is inhibited front target binding and can be masked from target binding (to, the first mation is such the AB cannot bind the target), and in the cleaved state the AB is not inhibited or is unmasked to target binding. $th52} The CM and AB of the multispeciiic aetivatable antibodies are selected so that the first AB represents a binding moiety for a first target and/or epitope, and the CM represents a substrate for a se that is ctr—localized with the target at a ent site or diagnostic site in a subject. The nniltispecitic activatable antibodies disclosed herein tind particular use where, for example, a protease capable of cleaving a site in the CM is present at relatively higher levels in target—containing tissue of a ent site or diagnostic site than in tissue of non—treatment sites (for example in healthy tissue). $th53} ln some embodiments, multispecific aetivatable antibodies provide for reduced toxicity and/or adverse side effects that could otherwise result from binding of the first AB at non—treatment sites if the AB were not masked or otherwise inhibited from binding its target. {$388254} ln general, a multispecific activatable antibody can be designed by selecting at first AB of interest and constructing the remainder of the activatable antibody so that, when conformationally constrained, the MM provides for masking of the AB or reduction of binding of the AB to its target. Structural design criteria, can be to be taken into account to provide for this functional feature, EtltltBZSS} Mnltispecitic activatable antibodies exhibiting a switchable phenotype of a desired dynamic range for target g in an inhibited versus an uninhibited contbrmation are ed. c range generally refers to a ratio of (a) a maximum de ,ected level of a parameter under a first set of conditions to (b) a minimum detected value of that parameter under a second set ot‘conditions. For e, in the context of a multispecific activatable antibr’ldy, the dynamic range refers to the ratio otta) a maximum detected level of target protein, binding to a multispecific table antibody in the presence of protease capable ofcleaving the CM of the activatable antibodies to (b) a minimum detected level of target n, binding to a multispecil'ic activatable antibody in the absence ofthe se. The dynamic range of a mnltispecilic activatable antibody can be calculated as the ratio of the equilibrium dissociation nt of a multispecific table antibody cleaving agent (rag, enzyme) treatment to the equilibrium dissociation constant of the activatable antibodies cleaving agent treatment. The r the dynamic range of a multispecilic activatable antibody, the better the switchable phenotype of the activatable dy.

Activatable antibodies having relatively higher dynamic range values (cg, greater than l) exhibit more ble switching phenotypes such that target protein binding by the activatable antibodies occurs to a r extent (egg, predominantly occurs) in the presence of a cleaving agent (c.g, ) capable of cleaving the CM of the activatable antibodies than in the absence of a cleaving agent. {999256} Multispecitic activa‘table antibodies can be provided in a variety of structural configurations. ary ae for at least a portion of a multispecific aetivatable antibody are provided below. it is specifically contemplated that the N— to C~terininal order of the first AB, the corresponding MM and CM may be reversed within an activatable antibody. it is also specifically contemplated that the CM and MM may overlap in amino acid sequence, cg, such that the CM is contained within the MM. 09‘1,..9 EiltltBZS’Z’} For example, at least a portion of the multispecitic activatable antibodies can be represented by the following formula (in order from an amino (N) terminal region to earboxyl (C) terminal region: (Mil/iiutjcirt/igiutjani (AB)~(Ch/l)~(h/ll\/ll {$90258} Where h'lM is a maskin g moiety, CM is a cleayable moiety, and AB is a first antibody or fragment f. lt should be noted that although MM and CM are ted as distinct components in the formulae above, in all exemplary embodiments ding formulae) disclosed herein it is plated that the amino acid sequences of the MM and the CM could overlap, nag, such that the CM is completely or partially contained within the MM. ln addition, the formulae aboye provide for additional amino acid sequences that may be positioned N~terminal or C—terminal to the activatable antibodies elements. {99925‘93 in certain embodiments, the MM is not a natural binding partner of the AB. in some embodiments, the MM contains no or substantially no gy to any natural binding partner of the AB. ln other embodiments the MM is no more than 55%;, l0%, l5%, %, 259/5, 30%, 35%, 409-43, 45%, 50%, 55%, 60945, 650/6, 70%, 75%, or "(3% similar to any natural binding partner of the AB. ln some ments, the MM is no more than 5%, l0%, 15%, 20%, 2.5%, 30%, 35%, 40%, 45%, 5(l%, 55%, 60%, 65%, 73%, 75%, or 80% identical to any natural binding partner of the AB. ln some ments, the MM is no more than 509/6 identical to any natural binding partner of the AB. in some embodiments, the MM is no more than 25% identical to any natural binding r of the AB. ln some embodiments, the MM is no more than 2t)% identical to any natural binding partner of the AB. in some embodiments, the MM is no more than l0% identical to any natural binding partner of the AB ltlllllzntll in many embodiments it may be desirable to insert one or more linkers, rag, flexible linkers, into the multispecil‘ic table antibody construct so as to provide for flexibility at one or more of the lVlM—ClVljunction, the (TM-AB junction, or both. For example, the AB, MM, and/or CM may not contain a sufficient number of residues (egg, Gly, Ser, Asp, Asn, especially Gly and Set, ularly Gly) to provide the desired tlexibility. As such, the switchable phenotype of such rnultispecilic table antibody eonstiucts may t from introduction of one or more amino acids to provide for a flexible linlrer. in addition, as described below, Where the pecific activatable antibody is provided as a conformationally constrained construct, a flexible linker can be [Annotation] CLGUS Aug 2021 operably inserted to facilitate formation and nance of a cyclic structure in the uncleaved multispecific activatable antibody.

For example, in certain embodiments a multispecific activatable antibody comprises one of the following formulae (where the formula below represent an amino acid sequence in either N- to C-terminal direction or C- to N-terminal ion): 2020200981 (MM)-L1-(CM)-(AB) (MM)-(CM)-L2-(AB) (MM)-L1-(CM)-L2-(AB) wherein MM, CM, and AB are as defined above; n L1 and L2 are each independently and optionally present or absent, are the same or different flexible linkers that include at least 1 flexible amino acid (e.g., Gly). In addition, the formulae above provide for additional amino acid sequences that may be positioned N-terminal or C- terminal to the multispecific activatable antibodies elements. Examples include, but are not limited to, targeting moieties (e.g., a ligand for a receptor of a cell present in a target tissue) and serum half-life extending moieties (e.g., polypeptides that bind serum proteins, such as immunoglobulin (e.g., IgG) or serum albumin (e.g., human serum albumin (HSA)). 3] In some non-limiting embodiments, at least one of the AB in the multispecific activatable antibody is a binding r for any target listed in Table 1.

In some non-limiting embodiments, at least one of the AB in the pecific table antibody comprises, is or is derived from a ce set forth in Table 7 in the Examples provided herein.

In some miting embodiments, at least one of the AB in the multispecific activatable antibody comprises, is or is derived from a sequence set forth in Example 5 in the Examples provided herein. In some non-limiting embodiments, at least one of the AB in the multispecific activatable antibody comprises, is or is derived from a sequence set forth in Table 11 in the Examples provided herein.

In some non-limiting embodiments, at least one of the AB in the multispecific table antibody is or is derived from an antibody listed in Table 2.

In some embodiments, the g moiety is selected for use with a specific antibody or antibody fragment. For example, le masking moieties for use with dies that bind EGFR include MMs that include the sequence CISPRG (SEQ ID NO: 75). By way of non-limiting examples, the MM can include a sequence such as CISPRGC (SEQ ID NO: 339), CISPRGCG (SEQ ID NO: 76); CISPRGCPDGPYVMY (SEQ ID NO: 77); CISPRGCEDGPYVM (SEQ ED NO: 78), CESERGCEPGTYVPT (SEQ 110 NO: 79) Mid CISERGCPGQENPWE (SEQ ID NO: 80). Other suitable masking moieties ineiw’ie any ofthe speeific masks disdesed in PCT i’ublieatim N0. by way if non-iimiting cxampia GSHCLIHNMGAESC (SEQ 113 NO: 81); CISERGCGGSSASQSGQGSE—KILIPENMGAPSC (SEQ ID NO: 82); YTCGCISPRGCEG (SEQ ID NO: 83); ADHVEW’GSYGCISPRGCPG (SEQ 11) NO: 84); CHHVYWGHCGCISPRGCEG (SEQ ID NO: 85); CPHETTTSCGCISPRGCPG (SEQ ID NO: 86); CNHE-iYE-IYYCG(ESPRGCPG (SEQ ID NO: 87); CPHV’SEGSCGCISERGCEG (SEQ if) NO: 88); CEYYTESYCQCISPRGCPQ (SEQ ID NO: 89); CNHVYEGTCQCISPRGCEQ (SEQ 11') NO: 91)); CNHE"€111"?CGCISPRQCPG (SEQ 11) NO: 91); CHHEI‘LT'E'CGCISERGCPG (SEQ 1D NO: 92.); YNPCATPMCCISERGCPG (SEQ ID NO: 93); CNHE-i‘x’EYTCGflSPRGCG (SEQ ID NO: 94); CNHH‘YHYYCGCESPRQCG (SEQ if) N0: 95); CNHVYEGTCGUSPRGCG (SEQ if) NO: 96); CHEVY WGHCGQSERGCG (SEQ 11) NO: 97); CPHETTTSCGCiSPRGCG (SEQ ID NO: 98); TLTTCGCISPRGCG (SEQ 113 NO: 99); CHHETLTTCGCESERQCG (SEQ 11) NO: 100); CP‘YYTLSYCQCISPRGCG (SEQ 11?) NO: 1111); CPHVSEGSCQCISERGCG (SEQ 11) NO: 102); ADHVEWQSYGCISPRGCG (SEQ 1D NO: 103); YNPCATPMCCISPRGCG (SEQ ID NO: 104); CHE-1VYWGHCGCISPRGCG (SEQ ID NO: 105); C(N/P)H(1>i/V/E)(Y/T)(E/VV/T/L)(Y/G,I’T/l )(T/S/V/H)CGCISPRGCG (SEQ 11) NO: 106); C1Si’RGCGQE’11)SVK (SEQ 11') NO: 107'); GC'1‘QEYHVSR (SEQ 11) N0: 198); and/er CISERGCNAVSGLGS ( SEQ ID NO: 109).

HERMES} Suitab1e masking moieties for use with antibodies that bind a. Jagged ; eg" Jagged 1 and/or Jagged 2; include, by way of non—limiting exampiefl masking moieties that inciude a sequence such as CNiWEVGGDCRGWQG (SEQ 113 NC): 338); QC:QSGQGQQQWCNHV1NGGDCRGWNG (SEQ ID NO: 1 1(1); PWCMQRQDELRCPQE (SEQ 11) N0: 1 1 1); QEQLPAYMCTFECLR (SEQ 11) NO: 1 12); CNLWVSGGDCGGLQG (SEQ 11) NO; 113); SCSLW'1'SGSCI.PHSE (SEQ 11) NO: 1 14); YCLQLH—WMQAMCGR (SEQ ID NO: 115); CELYSCTDVSYWENT (SEQ ID N0: 116); PEVCMQRQDYLRCEQP (SEQ 11) NO: 117); CNL‘WISGGDCRGLAG (SEQ ID NO: 118); CNLWVSGGDCRGVQG (SEQ 11) NO: 1 19); CNLWVSGQDCRGLRG (SEQ ID NO: 12(1); CNLW1SGGDCRGLPG (SEQ 1D NO: 121); CNLWVSGGDCRDAEW (SEQ ID NO: 122); CNLWVSGGDCRDLLG (SEQ 110 NO: 123); CNLWVSGGDCRGLQG (SEQ 113 NO: 124); CNLWLHGGDCRGWQG (SEQ ID NO: 125); CN1WLVGGDCRGWQG (SEQ 1121 NO: 126); CTTWECGGDCGVMRG (SEQ 11) NO: 127); CN1V’V"G1)SVQCGALLQ (SEQ 11) NO: 128); CNIWVNGGDCRSEEG (SEQ 11') NO: 129); YCLNLPR‘YMQDMCWA (SEQ 1131 NO: 13(1); ‘YCLALPHYl‘AQADCAR (SEQ ID NO: 131); GDVSYWQSA (SEQ ID NO: 132); CYLYSCTDSAEWNNR (SEQ ID NO: 133); CYLYSCNDVSYWSNT (SEQ 11.) N0: 134-); CELYSCTDVSYW (SEQ 11) NO; 135); CPL/YSC'I‘DVAYW’NSA (SEQ 11) NO: 136); CELY YWGDT (SEQ 111 NO: 137); CELYSCTDVSYWGNS (SEQ 11) NO: 131%); CELYSCTDVAYWNNT (SEQ 113 NO: 139); CELYSCGQVSYWGNEGLS (SEQ ID NO: 141)); CELYSCTDV’AYWSQ1., (SEQ 112) NO: 141); CYLYSC’1‘DQSYWNS'1' (SEQ 11') NO: 1112); CELYSCSDVSYWGN1 (SEQ 11) NO: 143); CELYSCTDVAYW (SEQ ID NO: 144); CELYSCTDVS‘YWGST (SEQ 1131 NO: 145); CELYSCTDVAYWGDT (SEQ 11) NO: 146); {1'CN1WLNGGDCRGWVDPLQG (SEQ 11) N0: 147); GCNENLVGGDCRQW18111118 (SEQ 11) NO: 148); GCN1WLVGGDCRGW1EDSNG (SEQ 11) NO: 149); GCN'1WANGGDCRGW1DN11316 (SEQ 113 NO: 150); GCN1WLVGGDCRGWLGEAVG (SEQ 1L1 NQ: 151); GCN1W1...VGGDCRGWEEEAVCs (SEQ 11) NO: 152); GGPALCN1WLNGGQCRGWSG (SEQ 11) NO: 153); N1W1JNGGDCEGWMG (SEQ 11) NO: 154); GQQQWCNENINGGDCRGWNG (SEQ ID NO: 155); GKSEECN1WLNGGDCRGWIG (SEQ 1D NQ: 156); GTPGGCNEWANGGDCRGWE13 (SEQ 113‘ NO: 157); GASQYCNI..W1NGGDCRGWRG (SEQ ID NO: 158); GCN1WLVGGDCREWW’EGG (SEQ 11') N0: 159); GCN1WAVGGDCREEVDGQ (SEQ 11) NO: 160); GCNENLNGGBCEAW (DIG (SEQ : 161); GEN1W1VGGDCREE1NDG (SEQ 11) NO: 162); CsCN1WLNGGDCRPVVEGG (SEQ 112) NO: 163); GCN1W1;SGGDCRMEMNEG (SEQ 11.) NO: 1134); GCNIWVNGGDCRSEVYSQ (SEQ 11') NO: 165); GCNIWLNGGDCRGWEASG (SEQ 111 NO: 166); A11GGDCRGEEEPG (SEQ 1D NQ: 167); GCN1WLNéli'iiiflCRTEVASG (SEQ ID NO: 168); 1’1GGDCRGE1EEG (SEQ 11") NO: 169); GELENCNHVLNGQDCRTG (SEQ 11') N0: 170); G1YENCN1W15NGGDCRMG (SEQ 11') N0: 171); and/or QIEDNCN1W1NGGDCRYG (SEQ 11) N0: 172).

ESMZES} Suita131e masking 1110163116311 1131113162 with antibmiies 1112111311111 an 1n1€2r1euk1n 6 target, 6%.; interbukin 6 recaptm' (115—611.), inc1m1e, by way of 1103—1117011,ng example; 11191311:ng moieties that 1nc1ude a ce such as QGQSGQYGSCSWNYVH1E1VEDC (SEQ 113 NO: 174); QGQSGQGDED1,1’ERA1—1W‘v’1’11‘ (SEQ 11) NQ: 175); QQQSGQMGVEAGCVWNYAIIIEIVIDC (SEQ ID NO: 176); YRSCNWNYVSIELDC (SEQ ID NO: 177); PGAEDIFEFAI‘IW‘VFNT (SEQ II) N0: 178); FSSCVWNYVIIIYIVIDC (SEQ II) NQ: I79); YEGCKWNYDRIEIIDC (SEQ II) NO: 180); YR'I’CSWNYVGIELDC (SEQ ID NO: 181); ‘YGSCSWNY VIIIFMDC (SEQ II) NO: 182); YGSCSV‘MNYVI—IIELDC (SEQ ID NI): 183); YGSCNWNYVIIIFLDC (SEQ ID NO: 184); YTSCNWNYVIIIFMIXi (SEQ II) NO: 185); YEQCKW‘NYIJEIFLIJC (SFQ II) N0: 186); WRSCNWNYAIIIELDC (SEQ II) NO: 187); WSNCHWNYVHIELDC (SEQ II) NO: 188); DRSCTWNYVRISYDC (SEQ ID NO: 189); SGSCKWDYVI—IIELDC (SEQ ID NO: 190); SRSCIWNYAHIIIIDC (SEQ ID NO: 191); SMSCYWQYERIEIJDC (SEQ II) NO: 192); YRSCNWNYVSIFLI)C (SEQ II) NO: I93); YGSCSVVNYVIIIEE/IIJC (SFQ II) NO: 194); SGSCSWDYVHIELDC (SEQ II) NO: 195); YESCHWDYVIIIFLDC (SEQ ID NI): 1%); YQSCTVII’NYVI-IIFIVIEC (SEQ ID N0: 197:); ESSCNWNYVHIELDC (SEQ ID NO: I98); WRSCN‘IVN‘YAIIIFEDC (SEQ II) NO: 199); NYV’IIIELDC (SEQ ID NO: 2&0); YRSCNWNYVHIELDC (SEQ ID NO: 291,); NMSCHWDYVIIIFLDC (SEQ ID NO: 202); NYARISWDC (SEQ ID NO: 203); XXSCXWXYVIIIEXCIC (SEQ II) NO: 204); MGVPAGCVWNYAIIIFMDC (SEQ ID NO: 205); RDTQGQCRWDYVHIFMDC (SEQ II) NO: 206); C'I‘WNYVIIIFMEC (SFQ II) NO: 207); VGVI’NGCVWNYAHIEMEC (SEQ II) NO: 2&8); DGGFAGCSWINYVIIIEMEC (SEQ II) NO: 209); AVGPAGCWWNYVI—IIEIVIEC (SEQ II) NO: 210); CTVVNYVIIIEIVIDCGEGEGF (SEQ II) NO: 21 I); CsGVEEGCTWNYAIIIEMEC (SEQ II) NO: 212); AEVFAQCWWNYVIIIEMEC (SEQ II) NO: 213); AGVI’AGC’IWNY VIIIFMEC (SEQ ID NO: 214); SGASGGCI‘QWNYVIIIEIVII)C (SEQ II) NO: 215); MGVEAGCVWNYAHIFMDC (SEQ ID NO: 216); TEGCRWNYVHIEIVIECEAL (SEQ II) NO: 217); VGVPNGCVWNYAIIIFMEC (SEQ II) NO: 218); PGAEDII’FEAIIW ' (SEQ II) NI): 2.19); I’EIELXIIWIPN’I (SEQ ID NO: 220); QGDEDIEEI’AI—IV‘IWEIT (SEQ ID N0: 221:); XGaIDIEEPAHWVEnT (SEQ ID NO: 222); RGDQNDSIJIEFFAIIVRWERI (SEQ II) NO: 223); SGVGEDRDII)FEAIIW'VPETI‘ (SEQ ID NO: 224); WAQGNI)CHIPFI’AIIWIPN’I‘ (SEQ ID N0: 225); WC:DGIX/IDVDIPFPAIIWVEVT (SEQ ID NO: 226); AGSGNDSDIPEPAI‘IWVFRT (SEQ II) NO: 227); ESRSGYADIFEPAIIWVFRT (SEQ II) NO: 228); and/or RFCGRCGIHFFPAIIWVFR’I’ (SEQ II) NO: 173)" RENEE); In some embodiments, the eieavable moiety (CM) of the muitispecific aeiivatabie antibedy ineiudes an amino acid sequence that can serve as a subsirate for a [Annotation] CLGUS Aug 2021 protease, usually an ellular protease. The CM may be selected based on a se that is co-localized in tissue with the desired target of at least one AB of the multispecific activatable antibody. A y of different conditions are known in which a target of interest is co-localized with a protease, where the substrate of the protease is known in the art. In the example of cancer, the target tissue can be a cancerous tissue, particularly 2020200981 cancerous tissue of a solid tumor. There are reports in the literature of increased levels of ses having known substrates in a number of cancers, e.g., solid tumors. See, e.g., La Rocca et al, (2004) British J. of Cancer 90(7): 1414-1421. Non-liming es of disease include: all types of cancers t, lung, colorectal, prostate, melanomas, head and neck, pancreatic, etc.), rheumatoid arthritis, Crohn’s disease, SLE, cardiovascular damage, ischemia, etc. For example, indications would include leukemias, including T-cell acute lymphoblastic leukemia (T-ALL), lymphoblastic diseases ing multiple myeloma, and solid tumors, including lung, colorectal, prostate, pancreatic and breast, including triple negative breast cancer. For example, indications include bone disease or asis in cancer, regardless of primary tumor origin; breast cancer, including by way of miting example, ER/PR+ breast cancer, Her2+ breast cancer, triple-negative breast cancer; colorectal cancer; endometrial ; gastric cancer; glioblastoma; head and neck cancer, such as esophageal cancer; lung cancer, such as by way of non-limiting example, all cell lung cancer; multiple myeloma ovarian cancer; pancreatic cancer; prostate cancer; sarcoma, such as osteosarcoma; renal cancer, such as by way of iting example, renal cell carcinoma; and/or skin cancer, such as by way of nonlimiting example, us cell cancer, basal cell carcinoma, or melanoma. In some ments, the cancer is a squamous cell cancer. In some embodiments, the cancer is a skin us cell carcinoma.

In some embodiments, the cancer is an esophageal squamous cell carcinoma. In some embodiments, the cancer is a head and neck squamous cell carcinoma. In some embodiments, the cancer is a lung squamous cell carcinoma.

The CM is specifically cleaved by an enzyme at a rate of about 0.001-1500 x 104 M-1S-1 or at least 0.001, 0.005, 0.01, 0.05, 0.1, 0.5, 1, 2.5, 5, 7.5, 10, 15, 20, 25, 50, 75, 100, 125, 150, 200, 250, 500, 750, 1000, 1250, or 1500 x 104 .

For specific cleavage by an enzyme, contact between the enzyme and CM is made. When the multispecific activatable antibody comprising at least a first AB coupled to a MM and a CM is in the presence of target and sufficient enzyme activity, the CM can be cleaved. Sufficient enzyme activity can refer to the ability of the enzyme to make contact with the CM and effect cleavage. it can readily be envisioned that an enzyme may be in the ty of the CM but nnsbie to Cleave because of other ar factors or protein modification of the " {8639273} laiy substrates ineiude but are not limited to substrates eieavabie by one or more of the following enzymes or proteases in Table 3: Table 3: Exempiary Broteases andI’or Enzym es ADAMS, ADAMTS, 9.1g. Cysteine proteinases, age, Sei'ine ses, eg, ADAMS szipain aetivaed protein C ADAM?) Legumain Cathepsin A ADAMEG Gotham—2 Cathepsin G ADAM i 2 Cnyniase ADAME 5 KLKS, ag ation factor proteases ADAM '7/TACE KLKA’E (egg F‘V’Ha, FIXa, FXa, FXIa, ADAMDEC} KLKS "Eggngg____________________________________________________________ ADAMTSI KLKn "Eggstgse ADAMTSA KLK? Gran/1, ' ADAMTSS KIKS KLKie Asparta’te pretenses, eg, KLKH BACE KLKis "R; ‘n i .JKM Marapsin NEE/AA ______________________________________________________________________________________________________________________________________ Aspartie esthepsins, e.g., ; Metalh’) protein-ages, egg, PACE4 Cathepsin D Meprin Plasmin "1meNspriiysin PSA PSMA tPA Caspases, egg, i BEE} Throni‘nin _________________________________________________________ Caspase 1 Tryptase _____ Caspase 2 1 ‘yips, erg, uPA Caspase 3 MMPI Caspase 4 MVH’Z '1"pr fl Transmmnbrane Caspase 5 MMPE Sei'ine Proteases (TTSPS), 6.53., Caspase 6 MM’P?’ onset Caspase 7 8 Dee—4 Caspase 8 MVP?) FA? Caspase 9 EVER/{PEG i-iepsin Caspase it) MMPM Matripmsefl Cas Base 14 M‘viPtZ MT—SPUManiptase M‘viPtES TMPRSSZ Cysteine eatnepsins, ag, M‘s/1PM TMPRSS3 Cathepsin B MM?! 5 'I'MPRSS4 sin C MMPio sin K MMPE'Z Cathepsin i... MVP??? Cathepsin S i iMPZG sin V/LZ MMFB Cathe sin X/Z/i) MMI’ZI—‘I MMP26 strum? {3%,274} For exampIe, in some ments, the ate is cieavabie by one or more of the toiiowing enzymes or ses: uFA, iegumain, MT—SPI, ADAMIZ BMP—I, TMPRSS3, TMPRSSd, MMP~9, MMP~IZ, MMRI 3, and/or MMP~I 4. In some embodiments, the protease is seieeted from the group of uFA, Iegumain, and MT-SPI. In some embodiments, the protease is: a matrix metaIioproteinase. In some embodiments, the protease comprises uPA. In some ernbi‘idirnents, the protease comprises Iegumain. In some ments, the protease comprises M'I'—SI’I. genitive} In some embodiments, the CM is selected for use with a, specific protease. In some embodiments, the CM is a substrate for at ieast one protease selected from the group consisting of an ADAM 17, a EMF—I, a cysteine protease such as a eathepsin, a I’ItrAi, a Iegumain, a matriptase (MI-SIN), a matrix metaiioprotease (Mb/IF), a neutrophii eiastase, a TMPRSS, such as ZI or TMP RSS4, a thrombin, and a n—type piasminogen activator (uPA, also referred to as urokinase). {$630276} In some embodiments, the CM is a substrate for an ADAMN, In some embodiments, the CM is a substrate fora EMF-I. In some embodiments, the CM is a, substrate for a cathepsin. In some embodiments, the CM is a substrate for a ne protease. In some embodiments, the CM is a substrate for a I’ItrAI. In some embodiments, the CM is a substra ,e for a iegumain. In some embodiments, the CM is a substrate fora MT! SI’I. In some ments, the CM is a substrate for a MMP. In some embodiments, the CM is a substrate for a neutrophii etastase. In some embodiments, the CM is a substrate for a thrombin, In some embodiments, the CM is a substrate for a "i‘MPRSS. In some embodiments, the CM is a substrate for "I‘MPRSSB. In some embodiments, the CM is a substrate for TMPRSSL‘t. in some embodiments, the CM is a substrate for uPA.

IdhttZ’F’f} In some embodiments, the eieavabie moiety is ed for use with a specific protease, for exampie a protease that is known to be (so—hteaiized with the target of the activatabie antibody. For example, suitabie cieavabie moieties for use in the activatabie antibodies of the disetosure e the sequence TGRGPSWV (SEQ ID NO: 27); SARGFSRW (SFQ II.) N0: 218); 'I'AIIGPSFK (SEQ. ID NO: 29); IJSGRSIJNH (SEQ ID NO: ‘26); GGWHI'GI‘LN (SEQ ID NO: 33); HTGRSGAL (SEQ III NO: 3 i); FLTGRSGG (SEQ ID NO: 32); AARGPAii-i (SEQ 153‘ NO: 33); RGPAENEM (SEQ 11) N0: 34); SSRGPAYL (SEQ 1):? NO: 35); RGPATPEM (SEQ ii) N0: 36); RGPA (SEQ H) NO: 37); GGQPSGNWVGW (SEQ 11') N0: 38); EPRPLGITGL (SEQ 11) NO: 39); VHMEEGEEGP (SEQ 1E? NO: 4%); SEL’i‘GRSG (SEQ 1D NO: 41); SAGESLPA (SEQ 11) NO: 42); LAPLGLQRR (SEQ 13 NO: 43); SGGPLGVR (SEQ 11) NO: 44); and/or PLGL (SEQ ID NO: 45), {WEBER} in some embodiments, the CM is a, substrate for at 1east one matrix metaiioprotease (MME). Examines of MMPs include MMEI; MMP2; MMP3; Nib/1P7; MMPS; MMPQ; MM? 1 0; MM? 1 i; MMPE 2; MM? 1 3; MM? 1 4; MMP1 5; MM? i 6; MMPi 7; MM?) 9; Mitt/EEK); MMP23; MMPZ4; Mix/{1326; and MMP27, In some embodiments, the CM is a, substrate for MMP9, MMEM, MMi’i, MMP3, Mix/£1313, MME17, MMPi 1, and Mix/1H9. in some embodiments, the CM is a substrate for MMPT in some embodiments, the CM is a substrate for MMEE). in some en'ibodin'ients, the CM is a substrate for MMPM, 1n some embodiments, the CM is a substrate for two or more MMi’s. in some embodiments, the CM is a substrate for at ieast MMP‘) and MMPM. in some ments, the CM comprises two or more substrates for the same MME. in some embodiments, the CM comprises at least two or more MMEQ substrates in some embodiments, the CM ses at least two or more Mix/11314 ates.

EGWZWE in some embodiments, the CM is a substrate for an MM? and includes the sequence iSSGLESS (SEQ ii) NO: 316); QNQALRMA (SEQ 1):? N0: 317); AQNMCMV (SEQ 11') N0: 318); S'1‘E1’EGME (SEQ 1E) NO: 319); 1))!GYTSSL (SEQ 11) N0: 329); DWLY V’i’GI (SEQ H) NO: 321); MiAi’VAYR (SEQ 1E3 NC): 322); Ri’SPh/ft‘y’VAY (SEQ it) NO: 21); WATEREMR (SEQ 11") NO: 323); ERLLDWQW (SEQ ID NO: 324); i..i EtititiZSfi} in some embodiments, muitispeeitie dies and/or specitie aetivatabie antibodies of the diseiosure may be made biosyi'ithetieaiiy using inant DNA teebno1ogy and expression in eukaiyotie or yotie species. For the muitispeeifie aetivatabie antibodies, the eDNAs encoding the masking moiety, tinker sequence (that may ineiude a eieavabie moiety (CM), and antibody chain (heavy or iight)) can be linked in an 5’ to 3’ (N~ to (If—terminal in the translated product) sequence to create the nucleic acid construct, which is expressed as the multispecitic activatahle antibody protein following a conventional antibody expression process. in some embodiments, the inultispecitic actiyatable antibody could he semi-synthetically produced by expressing a Chit-antibody and then coupling the mask chemically at or near the N—terininus of the protein. in some embodiments, the niultispeciiic activatable dy could he produced by expressing an antibody and then coupling the mask and the CM chemically at or near the ninus of the protein such that the ni'ultispecitic table antibody in the uncleayed state has the structural arrangement from Til—terminus to C—ternlinus as follows: MM—CM—AB or AB—CM— 1} Linkers suitable for use in compositions described herein are generally ones that provide flexibility of the modified AB or the rnultispecitic activatable antibodies to facilitate the inhibition of the g of at least the lirst AB to the target. Such linkers are generally referred to as flexible linkers. Suitable linkers can be readily selected and can be of any of a suitable of different lengths, such as from l amino acid (eg, Gly) to 20 amino acids, from 2 amino acids to l5 amino acids, from 3 amino acids to l2 amino acids, including 4 arnino acids to it? arnino acids, 5 amino acids to 9 amino acids, 6 amino acids to 8 amino acids, or '7 arnino acids to 8 amino acids, and may be i, ‘2 3, 4, 5, n, 7, 8, 9, 10, ll, l2, l3, l4, 15, l6, l7, l8, l9, 01'le amino acids in . {999282} Exen'iplary llexible linkers include e polymers (Gin, glycine—serine polymers (including, for e, (GS/in, (GSGGS)n (SEQ ll) NO: 18) and (GGGSln (SEQ ll) NO: l9), where n is an r of at least one), glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art. Glycine and glycine—serine rs are relatively unstructured, and therefore may be able to serve as a neutral tether between components. Glycine accesses significantly more phi-psi space than even alanine, and is much less restricted than residues with longer side chains (see Scheraga, Rev.

Computational Chem, lll73—l42 (1992)). Exemplary tlexihle linkers include, but are not limited to Gly—Gly—Ser—Gly (SEQ ll) NO: 29), Gly~Gly—Ser—Gly—Gly (SEQ ll) NO: 2i), er~Gly—Ser—Gly (SEQ lD NO: 22), GlynSer‘~Gly—Gly—Gly (SEQ lD N0: 23), (Ely—Glyn r—Gly (SEQ if) NO: 24), Gly—Ser~$er-Ser—Gly (SEQ ll") NO: 25), and the like, The ordinarily skilled artisan will ize that design of an activatahie antibodies can include linkers that are all or partially flexible, such that the linker can include a flexible linker as well as one or more portions that confer less llexible structure to e for a desired multispecilic activatable antibodies ure. $be83} in addition to the elements described above, the multispecit‘ic aetivatable antibodies can contain additional elements such as, for e, amino acid sequence N-- or C—terrninal of the multisnecitic activatable antibodies. l:or example, pecilic activatable antibodies can include a targeting moiety to facilitate delivery to a cell or tissue of interest. pecitic activatable antibodies can be conjugated to an agent, such as a therapeutic agent, an antineoplastic agent, a toxin or liragrnent thereof, a detectable moiety or a diagnostic agent. Examples of agents are sed herein. {b88284} The multispecifie activatable antibodies can also include any of the conjugated agents, s and other components described herein in conjunction with a multisnecitic antibody ol’tlie disclosure, including by way ofnon—limiting example, any of the agents listed in Table 4 and/or any of the linlters listed in Table 5 and/or Table 6.

Con d Multiso ecitic Antibodies and Con .u rated Multis ecifie Afiiva’table Antibodies liltitlleS} The disclosure also pertains to oconjugates sing a nniltispecitic antibody and/or a multispeciiic activatable antibody conjugated to a cytotoxic agent such as a toxin (9.33., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (Le, a radioconiugate). Suitable cytotoxic agents include, for example, dolastatins and derivatives thereoltag. auristatin E, APP, Mix/EAT), b/lh/lAF, MMAE). For example, the cytotoxic agent is thyl auristatin l? (MMAE). in some embodiments, the agent is monometliyl auristatin D (MMAD). in some embodiments, the agent is an agent selected from the group listed in Table 4. in some embodiments, the agent is a dolastatin. in some embodiments, the agent is an auristatin or derivative the eof. in some embodiments, the agent is auristatin if or a derivative thereof. in some embodiments, the agent is rnonometliyl auristatin E (MMAE). in some ments, the agent is a tnaytansinoid or maytansinoid derivative. in some embodiments, the agent is DM l or Div/T4, in some embodiments, the agent is a duocarmycin or derivative thereof. in some embodiments, the agent is a eanticin or derivative thereof. in some embodiments, the agent is a nyrrolobenzodiazepine. liltillletl} Enzyrna'tically active toxins and fragments thereof that can be used include diphtheria A chain, ding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alnha~sarcin, [Annotation] CLGUS Aug 2021 Aleurites fordii proteins, dianthin proteins, Phytolacca americana proteins (PAPI, PAPII, and , momordica charantia inhibitor, curcin, crotin, saponaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the hecenes. A variety of radionuclides are available for the production of radioconjugated antibodies. Examples include 212Bi, 64Cu, 125I, 131I, 131In, 99mTc, 90Y, 186Re, and 89Zr. 2020200981 ates of the antibody and cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as inimidyl(2-pyridyldithiol) propionate (SPDP), hiolane (IT), tional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), des (such as glutaraldehyde), bis-azido compounds (such as bis dobenzoyl) hexanediamine), bisdiazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as tolyene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro- 2,4-dinitrobenzene). For example, a ricin immunotoxin can be prepared as described in Vitetta et al., e 238: 1098 (1987). Carbonlabeled hiocyanatobenzyl methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. (See WO94/11026).

Table 4 lists some of the exemplary pharmaceutical agents that may be employed in the herein bed disclosure but in no way is meant to be an exhaustive list.

Table 4: Exemplary Pharmaceutical Agents for Conjugation CYTOTOXIC AGENTS Auristatins Turbostatin Auristatin E Phenstatins thyl auristatin D (MMAD) Hydroxyphenstatin Monomethyl auristatin E (MMAE) Spongistatin 5 Desmethyl auristatin E (DMAE) Spongistatin 7 Auristatin F Halistatin 1 Monomethyl auristatin F (MMAF) Halistatin 2 Desmethyl auristatin F (DMAF) Halistatin 3 Auristatin derivatives, e.g., amides thereof Modified Bryostatins Auristatin tyramine Halocomstatins Auristatin quinoline Pyrrolobenzimidazoles (PBI) Dolastatins Cibrostatin6 Dolastatin tives Doxaliform Dolastatin 16 DmJ Anthracycline analogues Dolastatin 16 Dpv Maytansinoids, e.g. DM-1; DM-4 Maytansinoid derivatives Cemadotin analogue (CemCH2-SH) Duocarmycin Pseudomonas toxin A (PE38) variant mycin derivatives Pseudomonas toxin A (ZZ-PE38) variant Alpha-amanitin ZJ-101 [Annotation] CLGUS Aug 2021 Anthracyclines OSW-1 Doxorubicin 4-Nitrobenzyloxycarbonyl Derivatives of O6-Benzylguanine Daunorubicin Topoisomerase inhibitors Bryostatins Hemiasterlin Camptothecin Cephalotaxine Camptothecin derivatives Homoharringtonine 2020200981 7-substituted Camptothecin Pyrrolobenzodiazepine dimers (PBDs) , 11- Functionalized pyrrolobenzodiazepine Difluoromethylenedioxycamptothecin Combretastatins Calicheamicins Debromoaplysiatoxin Podophyllotoxins Kahalalide-F Taxanes ermolide Vinca alkaloids ascidins CONJUGATABLE DETECTION REAGENTS ANTIVIRALS Fluorescein and derivatives thereof vir scein isothiocyanate (FITC) Vira A Symmetrel RADIOPHARMACEUTICALS ANTIFUNGALS 131I Nystatin 89Zr 111In ADDITIONAL ANTI-NEOPLASTICS 123I Adriamycin 131I Cerubidine 99mTc Bleomycin 201Tl Alkeran 133Xe Velban 11C Oncovin 62Cu Fluorouracil 18F Methotrexate 68Ga pa 13N Bisantrene 15O Novantrone 38K Thioguanine 82Rb Procarbazine 99mTc (Technetium) Cytarabine HEAVY METALS ANTI-BACTERIALS Barium Aminoglycosides Gold Streptomycin Platinum Neomycin Kanamycin ANTI-MYCOPLASMALS Amikacin n Gentamicin nomycin Tobramycin [Annotation] CLGUS Aug 2021 Streptomycin B Spectinomycin Sulfanilamide Polymyxin Chloramphenicol 2020200981 Those of ordinary skill in the art will ize that a large variety of possible es can be coupled to the resultant multispecific antibodies and/or multispecific activatable antibodies of the disclosure. (See, for example, "Conjugate Vaccines", Contributions to Microbiology and Immunology, J. M. Cruse and R. E. Lewis, Jr (eds), Carger Press, New York, (1989)), the entire contents of which are incorporated herein by reference). 0] Coupling may be lished by any chemical reaction that will bind the two molecules so long as the antibody and the other moiety retain their respective activities.

This linkage can include many chemical mechanisms, for instance covalent binding, affinity binding, intercalation, coordinate binding and complexation. In some ments, the preferred binding is, however, covalent binding. Covalent binding can be achieved either by direct condensation of existing side chains or by the incorporation of external bridging molecules. Many bivalent or polyvalent linking agents are useful in coupling protein molecules, such as the antibodies of the present disclosure, to other molecules. For example, representative coupling agents can include organic compounds such as thioesters, iimides, succinimide esters, yanates, glutaraldehyde, diazobenzenes and hexamethylene diamines. This listing is not intended to be exhaustive of the various classes of coupling agents known in the art but, rather, is exemplary of the more common coupling agents. (See Killen and Lindstrom, Jour. Immun. 133:1335-2549 (1984); Jansen et al., Immunological s 62:185-216 (1982); and Vitetta et al., Science 238:1098 ). 1] In some embodiments, in addition to the compositions and methods provided herein, the conjugated table antibody can also be modified for site-specific conjugation through ed amino acid sequences inserted or otherwise included in the activatable antibody sequence. These modified amino acid sequences are designed to allow for controlled placement and/or dosage of the conjugated agent within a conjugated activatable antibody. For e, the activatable antibody can be engineered to include cysteine substitutions at positions on light and heavy chains that provide reactive thiol groups and do not negatively impact n folding and assembly, nor alter antigen [Annotation] CLGUS Aug 2021 binding. In some embodiments, the activatable antibody can be engineered to include or otherwise introduce one or more non-natural amino acid residues within the activatable antibody to provide suitable sites for conjugation. In some ments, the activatable antibody can be engineered to include or otherwise introduce enzymatically activatable e sequences within the activatable antibody sequence. 2020200981 Suitable linkers are described in the literature. (See, for example, Ramakrishnan, S. et al., Cancer Res. 44:201-208 (1984) bing use of MBS (M- maleimidobenzoyl-N-hydroxysuccinimide ester). See also, U.S. Patent No. 5,030,719, describing use of nated acetyl hydrazide derivative coupled to an antibody by way of an oligopeptide . Particularly suitable linkers include: (i) SMPT (4- succinimidyloxycarbonyl-alpha-methyl-alpha-(2-pridyl-dithio)-toluene (Pierce Chem. Co., Cat. (21558G); (ii) SPDP nimidyl-6 [3-(2-pyridyldithio) propionamido]hexanoate (Pierce Chem. Co., Cat #21651G); and (iii) LC-SPDP (sulfosuccinimidyl 6 [3-(2- pyridyldithio)-propianamide] hexanoate e Chem. Co. Cat. #2165-G. Additional linkers include, but are not limited to, SMCC, sulfo-SMCC, SPDB, or SPDB.

The linkers described above contain components that have different attributes, thus leading to conjugates with differing physio-chemical properties. For example, the linker SMPT contains a sterically hindered disulfide bond, and can form conjugates with increased stability. Disulfide linkages, are in general, less stable than other linkages because the disulfide linkage is cleaved in vitro, resulting in less conjugate available. 4] The reagent EDC (1-ethyl(3-dimethylaminopropyl))carbodiimide hydrochloride is useful to create a carboxamide starting with a carboxylic acid and a primary or secondary amine. Thus, EDC may be used to link lysine residues in an antibody with a carboxylic acid in a linker or toxin, or to link aspartate or glutamate residues in an antibody with an amine in a linker or toxin. Such conjugation ons utilizing EDC may be enhanced by addition of NHS (N-hydroxysuccinimide) or sulfo-NHS roxy oxysulfonylsuccinimide). on of NHS or sulfo-NHS to such conjugation reactions may enhance the rate, completeness, selectivity, and/or reproducibility of the ation reactions.

In some embodiments, the linkers are cleavable. In some embodiments, the linkers are non-cleavable. In some embodiments, two or more linkers are present. The two or more linhers are all the same, 6g, cleavable or non—cleavable, or the two or more linlrers are different, eg, at least one cleavable and at least one eavable. {$388296} The present disclosure utilizes several methods for attaching agents to Abs of the multispecific antibodies and/or multispecific activatable antibodies: (a) attachment to the carbohydrate moieties of the AB, or (b) attachment to sullhydryl groups of the AB, or (c) ment to amino groups of the AB, or (d) attachment to carboxylate groups of the AB. ing to the disclosure, ABs may be covalently attached to an agent through an intermediate linlrer having at least two reactive groups, one to react with AB and one to react with the agent. The linlrer, which may include any ible organic compound, can be chosen such that the eaction with AB (or a cut) does not adversely affect AB reactivity and selectivity. Furthermore, the attachment of linker to agent might not destroy the activity of the agent. Suitable linkers for reaction with oxidized dies or oxidized antibody fragments include those containing an amine selected item the group consisting ol’priinary amine, secondary aniine, hydrazine, hydrazide, hydroxylamine, phenylhydrazine, semicarbazide and thiosemicarbazide groups. Such reactive functional groups may exist as part of the structure of the linlrer, or may be introduced by suitable chemical inodil'ication of linkers not containing such groups. {899297} According to the t disclosure, suitable linkers for attachment to reduced ABS of the pecitic antibodies and/or rnultispecific activatable dies include those having certain reactive groups capable of on with a sull'hydiyl group of a d antibody or fragment. Such reactive groups include, but are not limited to: reactive haloalkyl groups 6 including, for example, haloacetyl groups), curibenzoate groups and groups capable ofMichael—type addition reactions (including, for e, maleimides and groups of the type described by Mitra and lawton, l979, J. Amer. Chem. Soc. lGl : 3697’— 3 l l0).

{Gllllzglll According to the present disclosure, suitable linlrers for attachment to neither oxidized nor reduced ABs of the mtdtispecitic dies and/or n'iultispecific activatable antibodies include those having certain firnctional groups capable of reaction with the primary amino groups present in fied lysine residues in the AB. Such reactive groups include, but are not limited to, Nl’lS car‘boxylic or carbonic esters, sulto—NHS carboxylic or carbonic esters, 4—nitrophenyl cai'boxylic or carbonic esters, pentatluorophenyl carboxylic or carbonic , acyl imidazoles, isocyanates. and isothiocyanates.

Etltlt3299} According to the present disclosure, suitable s for attachment to r oxidized not reduced ABs include those having certain functional groups capable of on with the earboxylic acid groups present in aspartate or glutamate residues in the AB, which have been activated with suitable reagents. Suitable activating reagents include EDC, with or without added Nl-lS or sulfo—Nl-lS, and other dehydrating agents utilized for carhoxamide formation. In these instances, the functional groups present in the le linkers would include primary and secondary amines, hydrazines, hydroxylamines, and hydrazides. lllllllilllli} The agent may be attached to the linker before or after the linker is attached to the AB. in certain applications it may be desirable to first produce an AB—linker intermediate in which the linker is free of an associated agent. Depending upon the particular application, a specific agent may then be covalently attached to the . ln other embodiments the AB is first attached to the MM, CM and associated linkers and then attached to the linker for conjugation es. llltll} Branched Linkers: in ic embodiments, branched linkers that have multiple sites for attael'nnent of agents are utilized. For multiple site linkers, a sing e covalent attachment to an AB would result in an AB—linker intermediate capable of binding an agent at a number of sites. The sites may be aldehyde or sullhydryl groups or any chemical site to which agents can be attached. {999MB} Alternatively, higher specific activity (or higher ratio of agents to AB) can be achieved by attachment of a single site linker at a plurality of sites on the AB. This ity of sites may be introduced into the AB by either of two methods. first, one may generate multiple aldehyde groups and/or sullhydryl groups in the same AB. Second, one may attach to an aldehyde or sulthydryl of the A8 a "branched linker" having multiple functional sites for subsequent attachment to linkers. The functional sites of the branched linker or le site linker maybe de or sulthydryl , or may be any al site to which linkers may be ed. Still higher speeilic activities may be obtained by ing these two approaches, that is, attaching multiple site linkers at several sites on the AB.

EtitltlStB} Clem/able Linkers: Peptide linkers that are susceptible to cleavage by enzymes of the complement system, such as but not limited to urokinase, tissue plasminogen activator. tiypsin, plasrnin, or another enzyme haying proteolytic activity may be used in one embodiment of the present disclosure. According to one method of the present disclosure, an agent is attached via a linker susceptible to cleavage by complement.

The antibody is selected from a Class that can te complement. The dy—agent eonji,tgate, thus, tes the complement cascade and es the agent at the target site: Ace(_n' Etititi3tl4} Non—liming examples ofeleavahle linker sequences are provided in Table 5.

Table 57: Exemplary Linker Sequence-s for Conjugation Tvaes of Cieavahle Se uenees Amino Acid Se uenee Plasmin eleavahle set uences Pto-uroltinase PREnnoo (SEQ no no: 47) o (SEQ in no: as) TGFB ssnninmto (SEQ in no: 49) Piasntinogen RKSSHIRMRBVVL (SEQ lD no: 50) Staphyloltinase SSSEDnonYnnGDoA (SEQ in no: 51 l SSSFDKGKYKRGDDA (SEQ in no; 52) Factor Xa hle se uenees llEGR (SEQ in no: 53) IDGR (SEQ in no: 54) Gosmon (SEQ in no: 55) MM? cleavahle setuences Gelatinase A PLGLWA (SEQ to no: 56) Collaoenase eleavabie se uenees Calf shin collagen (til ('1) chain) GPQGIAGQ (SEQ ID no: 57) Calfskin collagen (0.24:1) chain) GPQGLLGA (SEQ in no: 58) Bovine eaitilage collagen (nl (ll) chain) GIAGQ (SEQ in no; 59) l-ltinian liver eoliagen (oi (ill) chain) oPLoiAGi (SEQ in no: 60) Human nigh/l GPEGLRVG (SEQ to no; 6}) Human PZP YGAGLGVV (SEQ in no: 62) AoLoWEn (SEQ to no: 63) ST (SEQ to no: (341) Rat a1M EEQAEAMS (SEQ ID no: 65) QALAMSAi (SEQ to no: (56) Rat nigh/l AAYHLVSQ (SEQ to no: 67) ninAEEEss (SEQ in no: 68) Rat 011125) ESLPVVAV (SEQ in no: 69) Rat (1113(27J} SAPAVESE (SEQ in no: 70) Human fibroblast eollagenase DVAQEVLT (SEQ in no: 71‘) tantoivtie eleava tes VAQFVLTE (SEQ in no: 72) AQE‘VL’l‘EG (SEQ no no: 73) EVQEIGPQ ’SEQ in no: 74) liltitlStPS} in addition, agents may be attached Via disuliide bonds (for example, the disult‘ide bonds on a ne molecule) to the AB. Since many tumors naturally release high levels of glutathione (a reducing agent) this can reduce the ide bonds with subsequent release of the agent at the site of delivery. in certain specific embodiments the reducing agent that would modify a CM would also modily the linlter of the conjugated activatahle antibody, {fililBllti} Spacers and ble Elements: in still another embodiment, it may he necessary to construct the linker in such away as to optimize the spacing between the agent and the AB of the activatable antibody, This may be accomplished by use ofa linker of the general structure: W (CHfin Q wherein W is either ~~NH——CHg—— or "Clip; Q is an amino acid, peptide; and n is an integer from t) to 20. lilillliiil’fl in still other ments, the linlrer may comprise a spacer element and a cleavable element. The spacer element serves to position the cleavahle element away from the core of the AB such that the cleavable element is more accessible to the enzyme responsible for cleavage. Certain of the branched s described above may serve as spacer elements, 8} Throughout this discussion, it should be understood that the attachment of linker to agent (or of spacer element to cleavable element, or ble element to agent) need not he particular rnode of attachment or reaction Any reaction providing a product of le stability and biological ibility is acceptable. {999399} Serum l’emenr and Selection nfLinkers: According to one method of the t disclosure, when release of an agent is desired, an AB that is an antibody of a class that can activate complement is used. The resulting conjugate retains both the ability to hind antigen and activate the complement cascade. Thus, according to this embodiment of the present disclosure, an agent is joined to one end of the cleayalile linlter or cleavahle element and the other end of the linker group is attached to a specch site on the AB, For example, if the agent has an hydroxy group or an amino group, it may be attach ed to the carboxy terminus of a peptide, amino acid or other suitably chosen linker Via an ester or amide bond, respectively. For example, such agents may be ed to the linker peptide [Annotation] CLGUS Aug 2021 via a Carbodiimide reaction. If the agent contains functional groups that would interfere with attachment to the linker, these interfering functional groups can be blocked before attachment and deblocked once the product conjugate or intermediate is made. The opposite or amino terminus of the linker is then used either directly or after further modification for binding to an AB that is capable of activating complement. 2020200981 Linkers (or spacer elements of linkers) may be of any desired length, one end of which can be covalently attached to ic sites on the AB of the activatable antibody.

The other end of the linker or spacer element may be attached to an amino acid or peptide linker. 1] Thus when these conjugates bind to antigen in the ce of complement the amide or ester bond that attaches the agent to the linker will be cleaved, resulting in release of the agent in its active form. These conjugates, when administered to a subject, will accomplish delivery and release of the agent at the target site, and are particularly effective for the in vivo delivery of pharmaceutical agents, antibiotics, antimetabolites, antiproliferative agents and the like as presented in but not limited to those in Table 4.

Linkers for Release without ment Activation: In yet another application of targeted delivery, release of the agent without complement activation is d since activation of the complement cascade will ultimately lyse the target cell.

Hence, this approach is useful when delivery and release of the agent should be accomplished without g the target cell. Such is the goal when ry of cell ors such as hormones, enzymes, corticosteroids, neurotransmitters, genes or enzymes to target cells is desired. These ates may be ed by attaching the agent to an AB that is not capable of activating complement via a linker that is mildly susceptible to cleavage by serum ses. When this conjugate is administered to an individual, antigenantibody complexes will form y whereas cleavage of the agent will occur slowly, thus resulting in release of the compound at the target site.

Biochemical Cross Linkers: In other embodiments, the activatable antibody may be ated to one or more therapeutic agents using certain biochemical inkers.

Cross-linking reagents form molecular bridges that tie together functional groups of two different molecules. To link two different proteins in a step-wise manner, heterobifunctional cross-linkers can be used that eliminate unwanted homopolymer formation.

Peptidyl s cleavable by lysosomal proteases are also useful, for example, Val-Cit, Val-Ala or other dipeptides. In on, acid-labile linkers cleavable in the low—pH envirenment ol‘the lysesome may be used, for example: bis~siaiyi ether. Either suitabie linkers include sin—la‘niie substrates, particularly those that Show optimal function at an acidic pH. tenants; Exemplary hetero--bifunetinnai crass-linkers are referenced in Table 6.

Table 6: Exemplary itletem—Bifunetional Cross Linkers HETERG—BIFBNC'E‘KQNAL CRO§$—LlNKERS Spacer Arm Length after cross-l ink ing Linker ve rd Advantages and Applications (Angstroi’ns) Primary amines Greater stab il ity Sulfhydryls SPDP Primary amines Tliiolation Sulfhydiyls Cleayable eross~lmkmg LC~SPDP y amines Extended spacer arm Sult‘hydryls Sulfe—LC-SPDP Prii’nary amines Extender spacer aim Sulf‘tiydryls Water-soluble SMCC Primary amines Stable inaleiinide reactive group Sult‘hydryls Enzyme-antibody atien Hapten-eairier protein conjugation Suifo-SMCC Primary amines Stable inaleiinide reactive 11.6 A group Sult‘hydryls Water-soluble Enzyi’ne—antibedy conj Ligation MBS Primary amines Enzyme~anti body ation Sulfhydiyls —earrier protein eunjugation Sulfa-MB S Primary amines Water-soluble Sulihydryls SEAR Primary amines anti kindly conjugation Sulfhydiyls SIAB Primary amines Watensoluble Sult‘hydryls SMPB Prii’nary amines Extended spacer arm Sulitiyrlryla Enzyme~antibody conjugation Suife-SMPB Primary amines Extended spacer arm Sulfhydryls water—soluble EDE/Sulfo-NHS Primary amines Hapten-Carrier conjugation Carboxyl groups ABH Carbohydrates Reacts with sugar groups ' 'enselective lllllllli 16} Non—Cieavuble Linkers or Direct minister/tent: in still other embodiments of the disclosure, the conjugate may he designed so that the agent is delivered to the target but not ed. This may be accomplished by attaching an agent to an AB either directly or via a non-cleavable linker. ltlllllfil‘l’l These non—cleavahle linkers may include amino acids, es, D~amino acids or other organic compounds that may he modified to include functional groups that can subsequently be utilized in attachment to ABS hy the methods described . A- general formula for such an organic linker could be W — (Cllfin — Q wherein W is either ----Nll-—-—Cllg-—-— or (ii, Q is an amino acid, peptide; and n is an integer from t) to 29. {filllB 18} r‘v’0r2--Cieamble Conjugates: Alternatively, a compound may be ed to ABs that do not activate ment. When using ABs that are incapable ofcomplement activation, this attachment may be accomplished using linkers that are susceptible to cleavage by activated complement or using linkers that are not tihle to cleavage by activated complement. {9993193 The antibodies disclosed herein can also he formulated as irnnrunoliposomes.

Liposomes containing the antihody are prepared hy methods known in the art, such as described in n et al,, Proci Natl, Acad. Sci, USA, 821: 3688 0985); llwang et al, l’roc.

Natl Acad. Sci. USA, 77: 4tl3t) 0980); and US. Pat. Nos. 4,485,045 and 4,544,545.

Liposomes with enhanced circulation time are disclosed in US. Patent Ne 5,tll3,556. {$33328} l’articularly useful liposomes can be generated by the reverse—phase ation method with a lipid composition comprising phosphatidylcholine, cholesterol, and rivatized phosp’ha‘tidylethanolarnine (PEG—PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter. Fah’ fragments of the dy of the present disclosure can he conjugated to the liposomes as described in Martin et al., J. Biol. Chem, 257: 286—288 ( l 982) via a disultide—interchange reaction.

[Annotation] CLGUS Aug 2021 Multispecific Activatable Antibodies Having Non-Binding Steric Moieties or Binding Partners for nding Steric Moieties The disclosure also provides multispecific activatable antibodies that include non-binding steric moieties (NB) or binding partners (NB) for non-binding steric es, where the BP recruits or otherwise ts the NB to the multispecific activatable antibody. 2020200981 The pecific activatable antibodies provided herein include, for example, a multispecific activatable antibody that includes a non-binding steric moiety (NB), a ble linker (CL) and at least a first antibody or antibody fragment (AB1) that binds a first target or epitope; a multispecific activatable antibody that includes a binding partner for a non-binding steric moiety (NB), a CL and an AB1; and a multispecific activatable antibody that includes a BP to which an NB has been recruited, a CL and AB1 that binds a first target or epitope. pecific activatable antibodies in which the NB is covalently linked to the CL and AB1 or is associated by interaction with a BP that is covalently linked to the CL and AB1 are referred to herein as "NB-containing multispecific activatable antibodies." By activatable or switchable is meant that the activatable antibody exhibits a first level of g to a target when the table antibody is in an inhibited, masked or uncleaved state (i.e., a first conformation), and a second level of binding to the target when the activatable antibody is in an uninhibited, unmasked and/or cleaved state (i.e., a second conformation, i.e., activated antibody), where the second level of target binding is greater than the first level of target binding. The multispecific activatable antibody compositions can exhibit increased bioavailability and more favorable biodistribution compared to conventional antibody therapeutics.

In some ments, multispecific table antibodies e for reduced toxicity and/or adverse side effects that could otherwise result from binding of the multispecific activatable antibody at non-treatment sites and/or non-diagnostic sites if the multispecific activatable antibody were not masked or otherwise inhibited from binding to such a site.

In one embodiment, the multispecific activatable antibody includes a nonbinding steric moiety (NB); a ble linker (CL); and at least a first dy or antibody nt (AB1) that binds specifically to a first target or epitope, wherein the NB is a polypeptide that does not bind specifically to the AB1; the CL is a polypeptide that includes a substrate (S) for an enzyme; the CL is positioned such that in an uncleaved state, the NB eres with binding of the AB1 to its target and in a cleaved state, the NB does not interfere with binding of the ABl to its target; and the NB does not inhibit ge of the Cl... by the enzyme. As used herein and throughout, the term polypeptide refers to any polypeptide that includes at least two amino acid residues, including larger polypeptides, full-length ns and fragments thereof, and the term polypeptide is not limited to single- chain polypeptides and can include multi—unit, 6g, multi—chain, ptides. ln cases Where the polypeptide is of a shorter length, for example, less than 5t) amino acids total, the terms e and polypeptide are used interchangeably , and in cases Where the ptide is ofa longer , for example, 50 amino acids or greater, the terms polypeptide and protein are used interchangeably herein, {$388324} ln one embodiment, the multispecific activatable antibody includes a non binding steric moiety (NB); a ble linker (CL); and at least a first antibody or antibody nt (ABl) that binds specifically to a tirst target or epitope, wherein (i) the NB includes a polypeptide that does not bind specifically to the A31; (ii) CL is a polypeptide of up to 50 amino acids in length that includes a substrate (S) for an enzyme; (iii) the CL is positioned such that in an nncleaved state, the NB interferes with binding of the ABl to its target and in a cleaved state, the NB does not interfere with binding of the ABl to its target; and (iv) the NB does not inhibit cleavage of the CL by the enzyme. For example, the Cl, has a, length of up to 15 amino acids, at length of up to 20 amino acids, a, length of up to 25 amino acids, a length of up to 30 amino acids, a length of up to 35 amino acids, a length of up to 40 arnino acids, at length of up to 45 amino acids, a length of up to 50 amino acids, at length in the range of lO—St) amino acids, a length in the range of lS—SO amino acids, a length in the range of 20-50 amino acids, a length in the range of 25-50 amino acids, a length in the range of 30—50 amino acids, a length in the range of 35—50 arnino acids, at length in the range of 4069 amino acids, a length in the range of 45—50 amino acids, a length in the range of Hindi} amino acids, a. length in the range of l5~40 amino acids, a, length in the range {dill—40 amino acids, a length in the range onS—L‘ltl arnino acids, a length in the range ofSG—élll amino acids, a length in the range of 35—40 amino acids, a length in the range of lO—St) amino acids, a length in the range of l5—3O amino acids, a length in the range of 20~30 amino acids, a length in the range of25—3G amino acids, a length in the range of l 0—20 amino acids, or a length in the range of lQ—lS amino acids! {$388325} ln one embodiment, the multispecific activatable antibody includes a non binding steric moiety (NB); a cleavable linker (CL); and at least a first antibody or antibody fragment (ABl) that binds specifically to a tirst target or epitope, wherein (i) the NB includes a pnlypeptide that does not bind specifically to the ABl; (ii) the CL is a polypeptide that includes a substrate (S) for an enzyme; (iii) the CL is positioned such that in an nneleayed state, the NB eres with binding of the ABl to its target and in a cleaved state, the NB does not interfere with binding of the ABl to its target; (iv) the NB does not inhibit cleavage of the CL by the enzyme; and (y) at least a portion of the peeitie activatable dy has the structural arrangement from N—terminus to C— terminus as follows in the nneleayed state: NB—CL-ABl or ABl--CL,x-NB. liltitlllild} in one embodiment, the multispecil’ic actiyatable antibody es a non~ binding steric moiety (NB); a cleavable linker (CL); and at least a lirst antibody or dy fragment (AB l) that binds specifically to a first target or epitcpe, wherein (i) the NB includes a polypeptide that does not bind specifically to the A81; (ii) the CL is a polypeptide that es a substrate (S) i‘nr an enzyme; (iii) the CL is positioned such that in an uncleaved state, the NB interferes with binding of the ABl to its target and in a cleaved state, the NB does not interfere with binding of the ABl to its target, and wherein the NB in the uncleayed activatable dy reduces the ability of the ABl to bind its target by at least 50%, for example, by at least 60%, by at least 70%, by at least 75%, by at least 80%, by at least 85%, by at least 90%, by at least 95%, by at least 96%, by at least 97%, by at least 98%, by at least 99%, by at least 100% as ed to the ability at the cleaved ABl to bind its target; and (iv) the NB does not inhibit cleavage of the CL by the enzyme. The reduction in the ability of the AB to bind its target is deteri'nined, for example, using an assay as described herein or an m vitm target displacement assay such as, for example, the assay described in PCT Publication Nos. W0 2t)(39/'025846 and W0 zeta/ear l73. {b88327} in one embodiment, the innltispeeitie activatable antibody includes a binding partner (BP) for a non-binding steric moiety (NB); a cleavable linlrer (CL); and at least a first antibody or antibody ti'agrnent (ABl) that binds specifically to a lirst target and/or epitcpe, wherein the BP is a polypeptide that binds to the NB when exposed thereto; the NB does not bind specifically to the AB 1; the CL is a pclypeptide that includes a substrate (S) for an enzyme; the CL is positioned such that in an nncleayed state in the ce of the NB, the NB interferes with binding of the AB to the target and in a cleaved state, the NB does not interfere with binding of the AB to the target and the Bl) does not interfere with binding of the AB to the ; and the NB and the Bl?l do not t ge of the CL by the enzyme. in some examples of this einbndiinent, the B? of the actiyatable antibody is optionally bound to the NB. in one embodiment, the NB is recruited by the BF ol',‘ the actiyatable antibody in viva, {$388328} in some examples of any of these moltispecitie activatable antibody embodiments, the mnltispecitic activatable antibody is formulated as a composition. ln some of these embodiments, the composition also includes the NB, where the NB is co— formulated with the moltispecifie table antibody that includes the 8?, the CL, and the AB. ln some examples of this embodiment, the BP is selected from the group consisting of an albumin binding peptide, a librinogen binding peptide, a libronectin binding peptide, a hemoglobin binding peptide, a trai'isl'errin binding peptide, an imm unoglohulin domain binding e, and other serum protein binding peptides. {999329} in some examples of any of these multispecitic activatable antibody embodiments, the NB is a soluble, globular protein. in some examples of any of these specitic activatable dy embodiments, the NB is a protein that ates in the bloodstream. ln some examples of any of these mnltispecitic activatahle dy embodiments, the NB is selected from the group consisting of albumin, tibrinogen, tihroi'iectin, hemoglobin, errin, an iminnnoglobulin domain, and other serum proteins, {llhllBStl} in some examples of any of these moltispecitie activatable dy embodiments, the CL is a polypeptide that includes a substrate (S) for a protease. ln some examples of any of these pecitic activatable antibody embodiments, the protease is cr‘rlocalized with its target in a tissue, and the protease cleaves the CL in the multispecitic activatable antibody when the tnttltispecitie activatable antibody is exposed to the protease, in some examples of any of these pecific actiyatable dy embodiments, the CL is a polypeptide of up to 50 amino acids in length in some es of any of these mnltispeeilic activatahle antibody embodiments, the CL is a polypeptide that includes a substrate (S) having a length of up to l5 amino acids, eg, 3 amino acids long, 4 amino acids long, 5 amino acids long, 6 amino acids long, '7 amino acids long, 8 amino acids long, 9 amino acids long, ll) amino acids long, l l amino acids long, l2 amino acids long, l3 amino acids long, l4 amino acids long, or l5 amino acids long, liltillSSl} In some es of any of these mnltispecitic activatable antibody embodiments, at least a portion of the multispecilic activatahle antibody has the ural arrangement from N—terniinus to C—terniinus as follows in the ved state: NB—CLUAB, ABEL-NB, Bil-CL-AB or ABuCLK-Bl). ln embodiments Where the mnltispecilic activatable antibody includes a Bl" and the mnltispecilie activatable antibody is in the presence of the corresponding NB, at Ieast a portion of the muitispecitic activatabie antibody has a structurai arrangen'ient from N~terminns to C~terrninus as foiiows in the nncieaved state: NB:BI’~Ch EGIIIIBBeZE In some exampies of any of these mnitispecifie tabie antibody embodiments, the muitispeeiiic activatabte antibody inciudes an antibody or antigen binding fragment thereof that specificaiiy binds Its target and is a monocIonai antibody, domain antibody, single chain, Fab fragment, a Rabi); fragment, a scFv, a scab, a dAb, a single domain heavy chain antibody, and a singie domain hght ehain antibody. In some i ents, such an antibody or immunologieaiiy active fragment f that binds its target is a. mouse, ic, zed or fuiiy human monoclonal antibody.

{GWESE In some exampies of any of these mnitispecifie activatabie antibody embodiments, the innitispeeitic activatabie antibody aiso inciudes an agent conjugated to the AB. In some embodiments, the agent is a therapeutic agent. In some embodiments, the agent is an antineopiastic agent. In some embodiments, the agent is a toxin or fragment thereof. In some en'ibodin'ients, the agent is conjugated to the AB via a iinher. In some embodiments, the iinker is a eieavabie tinker. In some embodiments, the agent is an agent selected from the group Iisted in 'I'abIe 4. in some embodiments, the agent is a doiastatin.

In some embodiments, the agent is an attristatin or derivative thereof. In some embodiments, the agent is anristatin E or a derivative thereof. In some embodiments, the agent is thyi atin E (It/IMAIEL), In some embodiments, the agent is monomethyi auristatin D (IVIMAD). In some embodiments, the agent is a. maytansinoid or maytansinoid derivative. In some embodiments, the agent is ITEM} or DIX/I4. In some embodii ents, the agent is a duocarmycin or derivative thereof. In some ments, the agent is a eamicin or derivative f. In some embodiments, the agent is a pyrroiobenzodiazenine. {999334} In some exampies of any of these pecifie activatabie antibody embodiments, the muitispeeiiic activatabte antibody aiso inctudes a detectabie moiety. In some embodiments, the detectabie moiety is a diagnostic agent.

} In some ies of any of these mnItispecitic activatabie antibody embodiments, the muitispecit‘ie aetivatabie antibody aiso ineiudes a spacer. In some exampies of any of these muItispecitic activatabie antibody embodiments, the pecific activatabie antibody aiso includes a signed peptide. In some embodiments, the signai peptide is conjugated to the mnitispeeitie activatabie antibody Via a spacer. in some examples of any of these multispeeifie aetiyatable antibody embodiments, the spacer is joined direetiy to the MM of the ispeeitie aetivatabie antibody. {8639336} in some embodiments, the serum half-dire of the mttitispeeit‘ic aetiyatahie antibody is longer than that of the corresponding innitispecitie antibody; e. g, the pit: of the iniiltispeeifie aetivatable antibody is longer than that of the corresponding muttispeeitie dy. in some embodiments, the serum half-life of the mnltispeeifie aetivatable antibody is sirniiar to that of the corresponding innltispeeiiic antibody. in some embodiments, the serum haif—iife of the mtdtispeeitie aetiyatahle antibody is at least 15 days when administered to an organism. in some embodiments, the serum half—life of the mnitispeeifie aetiyatahle antibody is at least 12 days when administered to an sm. in some embodiments, the serum hail‘liii‘e of the multisbeeiiie activatable antibody is at least i i days when administered to an organism. in some embodiments, the serum l'ialf—iite of the moitispeeifie table antibody is at ieast 10 days when administered to an sm. in some embodiments, the serum haif—iife of the innitispecitie aetivatabie antibody is at ieast 9 days when administered to an organism. in some embodiments, the serum hail'liite of the ninitispeeitie table antibody is at least 8 days when administered to an organism. in some embodiments, the serum haif—iife of the mnltispeeitie activatabie antibody is at toast 7 days when administered to an organism. in some embodiments, the serum half—Eife of the inidtispecitie tahle dy is at least 6 days when administered to an organism. in some es of any of these mnltispeeitie aetivatable antibody embodiments, the serum haif—iife of the nmitispecifle aetiyatahle antibody is at least 5 days when administered to an organism. in some embodiments, the serum haitliit‘e of the peeitie aetivatabie antibody is at least 4 days when administered to an organism. in some embodiments, the serum ife of the mnltispeeitie aetiyatabie antibody is at ieast 3 days when administered to an organism. in some embodiments, the serum half—life of the mnitispeeiiic aetiyatabie antibody is at ieast 2 days when administered to an organism. in some en'lbodin'ients, the serum half—iife of the peeifie aetiyatable antibody is at ieast 214- hours when administered to an organism. in some embodiments, the serum hail‘liii‘e of the multisbeeifie tabie antibody is at ieast 20 hours when administered to an organism. in some embodiments, the serum bait—life of the ispeeifie aetiyatabie antibody is at least i8 hours when administered to an organism. in some embodiments, the serum half-life of the innitisnecitie aetiyatabie dy is at least in hours when administered to an organism. in some embodiments, the serum ife of the multispecitic activatable antibody is at least l4 hours when administered to an organism, In some embodiments, the serum haltllit‘e of the mnltispeeific activatahle antibody is at least l2 hours when stered to an organism, in some embodiments, the serum half-life of the multispecific activatable antibody is at least l0 hours when stered to an organism. in some embodiments, the serum half—life of the inultispecific activatahle antibody is at least 8 hours when administered to an organism. ln some embodiments, the serum ife of the multispecific activatable antibody is at least 6 hours when administered to an organism. in some embodiments, the serum half—life of the rnultispecil'ic activatable dy is at least 4 hours when administered to an organism, in some embodiments, the serum half~life of the multispecilic activatable antibody is at least 3 hours when stered to an organism. {0003373 The disclosure also provides an isolated nucleic acid molecule encoding any of these moltispecitic tahle antibodies, as well as vectors that include these ed nucleic acid sequences. The disclosure provides methods of producing a innltispecitic tahle antibody by culturing a cell under conditions that lead to expression of the nialtispecilie aetivatahle antibody, wherein the cell comprises such a nucleic acid sequence. in some ments, the cell comprises such a vector, {000338} The dissociation constant (Kid) of the NEE-containing mnltispecitic activatable antibody toward the target is greater than the lid of the AB towards the target when it is not associated with the NB or NBBF. The dissociation constant (K4) of the taining mnltispeciflc activatable antibody toward the target is greater than the Kd of the parental AB towards the . For example, the Kd of the NB~containing innltispecific activatahle antibody toward the target is at least 5, l0, 25, 50, l00, 250, 500, l,000, 2,500, 5,000, l0,000, 50,000, 100,000, 500,000, 1,000,000, 5,000,000, 10,000,000, 50,000,000 or greater, or between 5--l0, l0-vl00, l0--l,000, l0--l0,000, l0--l00,000, 000,000, l0-—l0,000,000, l00—l,000, l00—l0,000, l00—l00,000, l00—l,000,000, l00—l0,000,000, l,000—l0,000, L000— l00,000, l,000-l,000,000, l000—l0,000,000, l0,000—l00,000, l0,000—l,000,000, l0,000e l0,000,000, l00,000—l,000,000, or l00,000~l0,000,000 times greater than the lid of the AB when it is not associated with the NB or N828? or the Kd of the parental AB towards the target. Conversely, the binding, affinity of the NB—containing n'iultispecific tahle antibody towards the target is lower than the binding affinity of the AB when it is not associated with the NB or NBBP or lower than the binding affinity of the parental AB towards the target. For example, the binding affinity of the NB~containing nrultispecilio activatabie antibody toward the target is at 1east S, 10, 25, 50, 100, 250, 500, 1,000, 2,500, ,000, 10,000, 50,000, 100,000, 500,000, 1,000,000, 5,000,000, 10,000,000, 50,000,000 or greater, een 5—10, 10—100, 10—1,,000, 011, 10~100,000, 100,000,000, 10- ,000,000, 100--1,000, 100--10,000, 100-v100,000, 100-1,000,000, 100--10,000,000, 1,000- ,000, 1,01,11,1—100,000, 1,000—1,000,000, 1000—10,000,1.100, 10000—100000, 10,000— 1,000,000, 10,000v10,000,000, 100,000—1,000,000, or 100,000—10,000,000 tinies iower than the binding affinity of the AB when it is not associated with the NB or N528? or iower than the binding affinity of the parentai AB s the target. {000339} When the NB~containing n'in1tispecifie actiyatabie antibody is in the presence of1ts target, specific binding of the A13 to its tar et is reduced or inhibited, as compared to the specific binding of the AB when it is not associated with the NB or N831). When the NB~containing mn1tispeci1ic activatab1e antibody is in the presence of its target, specific binding of the AB to 1ts target is reduced or inhibited, as compared tn the specific binding of the parenta1 AB to 1ts target. When compared to the binding of the AB not associated with an NB or NB:BP or the g of the parentai AB to its target, the abi1ity of the NB— containing rnuhispecitic tab1e antibody to bind its target is reduced, for examp1e, by at 1east 50%, 60%, 70%, 80%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or even 100% for at 1east 2, 4, 6, 8, 12, 28, 24, 30, 36, 48, 60, 72, 84, or 96 hours, or 5, 10, 15, 30, 45, 00, 90, 120, 150, or 180 days, or 1, 2, 3, 4, 5, ti, '7, 8, 9, 10, 11, or 12 months or 1onger when meas tired in viiro and/or in viva. 1000340} When the Nchontaining in ii1tispecific activatab1c antibody is in the presence of Its target but not in the ce of a. modifying agent (for exampie a protease or other enzyme), specific binding of the AB to 1ts target is reduced or inhibited, as compared to the c binding of the AB when it is not associated with the NB or NB:BP. When the NB" ning nnthispecitic activatah1e dy is in the presence of Its target but not in the presence of a modifying agent (for exarnpie a protease, other enzyme, reduction agent, or 1igh‘t), specific binding of the AB to its target is reduced or inhibited, as compared to the specific binding of the parental A13 to Its target. When compared to the binding of the AB not associated with an NB or N828? or the binding of the parentai AB to its target, the abiiity of the NB—cr’intaining muhispeciiic tah1e antibody to bind its target is reduced, for exainp1e, by at 1east 50%, 60%, 70%, 80%, 90%, 92%, 93%, 94%, 95%, 96%, 970/8, 98%, 9 %, or even 100%.» for at 1east 2, 4, 6, 8, 12, 28, 24, 30, 36, 48, 60, 72, 84, or 96 hours, or 5, it}, 15, 3t), 45, 6t), 90, 120, 150, or Hit) days, or i, 2, 3, it, 5, 6, 7, 8, 9, it), it, or t2 months or longer when measured in vitro and/or in Vii/0. {$388341} in some exampies of any of these mnitispeoitie aetivatabie antibody embodiments, the mnitispecitic aotivatabie antibody incindes an agent conjugated to the AB to produce a mnitispeeifie activatabie antibody conjugate. in some embodiments of the mnitispeoifie aetivatabie antibody conjugate, the agent is a therapeutic agent. in some embodiments, the agent is a diagnostic agent. in some embodiments, the agent is a detectable marker. in some embodiments of the mnitispeeifie activatabie antibody conjugate, the agent is an antineopiastie agent. in some embodiments of the n'niitispeeii‘ie aetivatabie antibody eonjngate, the a ent is a toxin or fragment thereof. in some embodiments of the mnitispecific aetivatabie dy conjugate, the agent is conjugated to the AB via a linker. in some ments of the mahispeeitie activatabie antibody oonj agate, the linker is a eieavahie tinker. in some embodiments, the agent is an agent selected from the group iisted in 'i‘abie 4. in some embodiments, the agent is a doiastatin. in some embodiments, the agent is an auristatin or derivative thereof. in some embodiments, the agent is auristatin E or a derivative thereof. in some embodiments, the agent is thyi aui‘istatin E (MMAE). In some embodiments, the agent is monomethyt antistatin D (MMAD). in some embodiments, the agent is a maytansinoid or maytansinoid derivative. in some embodiments, the agent is DMi or DMd. in some embodiments, the agent is a dnoeari'nyein or derivative thereof. in some dinients, the agent is a caiioheamioin or derivative thereof in some embodiments, the agent is a pyrroiobenzodiazepine. {titBtB'n’iE} in some exainpies ot‘any of these muttispecitio aetivatabie dy i ents, the maitispeeifie aetivatabie antibodies are dnai~target binding maitispeeifie aetivatabie antibodies. Such dnai target binding mnitispeoifie activatabte antibodies contain two Abs that may bind the same or different targets. in specific embodiments, d’nai— targeting niuitispeeifie tabie dies contain hispeeitie antibodies or dy fragments.

Etititi343} Dnai target binding multisbecitio aetivatabie antibodies are ed so as to have a CL eieavahte by a cleaving agent that is eo~ioeaiized in a target tissue with one or both of the targets e of binding to the ABs of the peeifie aotivatabie antibodies.

Dual target binding pecific aotivatabie antibodies with more than one AB to the same or ent targets can be designed so as to have more than one CL, wherein the first CL is cleayable by a cleaving agent in a first target tissue and wherein the second CL is cleayable by a cleaving agent in a second target tissue, with one or more of the targets binding to the ABs of the niultisieeiiie activatable antibodies. in one embodiment, the first and second target tissues are lly separated, for example, at different sites in the organism. ln one embodiment, the first and second target tissues are the same tissue temporally separated, for example the same tissue at two different points in time, for example the first time point is when the tissue is an early stage tumor, and the second time point is when the tissue is a late stage tumor.

{Milli-44} The disclosure also provides nucleic acid molecules encoding the niultispeeitic activatable antibodies described herein. The disclosure also provides vectors that include these nucleic acids. The pecific activatable antibodies described herein are produced by culturing a cell under conditions that lead to sion of the multispecific activatahle antibody, wherein the cell includes these nucleic acid molecules or vectors. liltltl345} The disclosure also provides methods of manufacturing multispecific activatable antibodies. in one embodiment, the method includes the steps of (a) culturing a cell that includes a c acid construct that encodes the rnultispecitic activatable antibody under conditions that lead to expression of the multispecilic table antibody, wherein the multispecific activatable antibody includes (i) a non-binding steric moiety (NB); (ii) a cleavable linl See also Baldrick l3. "Pharmaceutical excipient development: the need for nical guidance." Regul. 'l'oxicol Pharmacol. 32(2):.2lO-8 (letltl), Wang W. ilization and development of solid protein pharmaceuticals." lnt. J. Pharm. 203(12): l—ot) (2000), Charrnan \«VN "Lipids, lipophilic drugs, and oral drug delivery~some ng concepts." J Pharm Sci.89(8):967—78 (2090), Powell et a]. "Compendium of exeipients for parenteral formulations" FDA J Pharm Sci ’l‘echnol. 52:23 8-3 ll G998) and the citations therein for additional information related to formulations, excipients and carriers well known to pharmaceutical chemists. dl ln one embodiment, a multispeciflc antihody and/or a. multispecilic activatahle antibody of the disclosure may he used as therapeutic agents. Such agents will generally he employed to diagnose, prognose, r, treat, ate, and/or prevent a disease or pathology in a subject. A therapeutic regimen is carried out by identifying a subject, 9.33.. a human t or other mammal suffering from (or at rislr of developing) a l l 6 disorder using standard methods. A multispecitic antibody and/or a multispecil‘ic activatable antibody preparation, for example in some ments, one having high icity and high affinity for its two or more target antigens, is administered to the subject and Will lly ha 7e an effect due to its binding with the s. Administration of the multispecitic dy and/or a multispecilic aetivatable antibody may abrogate or inhibit or interfere with the signaling function of one or more of the targets. Administration of the multispecific antibody and/or a. multispecitic activatable antibody may abrogate or inhibit or interfere with the binding of one or more of the targets with an endogenous ligand to which it naturally binds. {$388349} Generally, alleviation or treatment of a disease or disorder involves the lessening of one or more symptoms or medical problems associated with the disease or disorder. For example, in the case ofcancer, the therapeutically effective amount of the drug can accomplish one or a combination of the following: reduce the number ofcancer cells; reduce the tumor size; inhibit (216* to se to some extent and/or stop) cancer cell ration into peripheral organs; inhibit tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms ated with the cancer. in some embodiments, a composition of this disclosure can be used to prevent the onset or reoccurrence of the disease or disorder in a subject, eg, a human or other mammal, such as a non—human primate, companion animal (6g, cat, dog, horse), farm animal, work , or zoo animal. The terms subject and patient are used interchangeably herein. lblllliififll A therapeutically ive amount of a inultispeeitie antibody and/or a, multispeeifie activatable antibody of the disclosure relates generally to the amount needed to e a therapeutic objective. As noted above, this maybe a binding interaction betw’ en the multispecific antibody and/or a, mu ltis eeifie table antibody and its target antigens that, in certain cases, interferes with the functioning of the targets. The amount required to be administered will furthermore depend on the binding ty of the tnultispecitic antibody and/or a specil'ic aetivatable antibody for its specific antigen, and will also depend on the rate at which an administered multispeeific antibody an d/or a multispecil‘le activatable antibody is depleted from the free volume other subject to which it is stered. Common ranges for therapeutically effective dosing ofa multispeeific antibody and/or antibody fragment and/or a multispeeifie aetivatable antibody of the disclosure may be, by way of nonlimiting example, from about (ll mg/lrg body weight to about 50 mg/hg body weight. Common dosing frequencies may range, for example, from twice daily to once a week. {$88351} Efticaciousness of treatment is determined in association with any known method for diagnosing or treating the particular disorder. Methods for the screening of pecitic antibodies and/or rnultispecitic activatable antibodies that possess the desired specificity include, but are not limited to, enzyme linked immunosorbent assay (ELlSA) and other immunologically mediated techniques known Within the art. ltlllll352} in another embodiment, a multispecific antibody and/or a multispecilic actiyatable antibody directed two or more targets are used in methods leiown within the art reiating to the localization and/or ouantitation of the targets (e. g, for use in measuring levels of one or more of the targets Within appropriate physiological samples, for use in diagnostic methods, for use in imaging the protein, and the like). in a given embodiment, a multispecitic antibody and/or a multispecilic activatable antibody directed two or more targets, or a derivative, fragment, analog or homolog f, that contain the antibody derived antigen binding domain, are utilized as pharinacologically active compounds (referred to hereinafter as "‘Tlierapeutics"), {$88353} in another embodiment, a multispecific antibody and/or a multispecifie table antibody directed two or more s is used to isolate one or more of the targets by standard techniques, such as oaftinity, tatography or immunoprecipitationi A multispecific antibody and/or a multispecitic actiyatable dy directed two or more targets (or a fragment thereof) are used stically to monitor protein levels in tissue as part of a al testing procedure, 8.33., to determine the efficacy ot‘a given treatment regimen ction can be facilitated by coupling (£12., physically linking) the antibody to a de cctable substance Examples of detectable substan "es include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluininescent materials, and radioactive materials. Examples of suitable s include horseradish peroxidase, alkaline pl'rosphatase, li—galactosidase, or cholinesterase; examples of suitable etic group xes include streptayidin/biotin and avidin/biotin; examples of suitable tluorescent materials include umbelliferone, lluorescein, tluorescein ocyanate, rliodamine, dichlorotriazinylamine fhn’lrescein, dansyl de or phycoerythrin; an example of a scent material includes luminol; examples of bioluminescent materials include luciferase, luciferin, and aequorin, and examples of " ~ suitable radioactive material include 1"l, Li i . . . 7r , ll ~ , l, "E; or ’l-l. lllfidl In yet another embodiment, a inultispecitic antibody and/or a multispeciiic actiyatable antibody directed two or more targets can be used as an agent for ing the presence of one or more of the s (or a fragment thereof) in a sample. In some embodiments, the antibody contains a detectable label. Antibodies are polyclonal, or in some embodiments, monoclonal. An intact antibody, or a fragment thereof (eg, Fab, scFy, or Franz} is used The term "labeled", with regard to the probe or antibody, is intended to encompass direct labeling of the probe or antibody by coupling , physically g) a, detectable substance to the probe or dy, as well as indirect labeling ot‘the probe or antibody by vity with another reagent that is directly labeled, Examples of indirect ng include detection of a primary antibody using a lluorescently~labeled ary antibody and end-labeling of an antibody with biotin such that it can be detected with lluorescently—labeled streptayidin. The term "biological sample" is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present Within a subject. included within the usage of the term "biological sample", ore, is blood and a fraction or component of blood including blood serum, blood plasma, or lymph, That is, the detection method of the disclosure can be used to detect a protein in a biological sample in vitro as well as in vii-'0, For example, in Vitro techniques for detection of an analyte protein include enzyme linked immunosorbent assays (ELTSAs), Western blots, immunoprecipitations, and iminunoiluorescence. Procedures for conducting immunoassays are bed, for example in "ELTSA: Theory and Practice: Methods in Molecular Biology", Vol. 421, l. R. Crowtber (Ed) Human Press, "l‘otowa, NJ, l995; "immunoassay", E, Diainandis and T. Christopoulus, Academic Press, inc, San Diego, CA, D996; and "Practice and Theory of Enzyme lrnniunoassays", P. Tijssen, Elseyier Science Publishers, Amsterdam l985. Furthermore, in viva techniques for detection of an analytc protein e introducing into a t a d anti-analyte protein antibody For example, the dy can be labeled with a radioactive inarlt'er Whose presence and location in a subject can be detected by standard imaging techniques. {$630355} The multispeeitic antibodies and/or pecilic actiyatable antibodies of the disclosure are also useful in a variety of diagnostic and prophylactic formulations. in one embodiment, a inultispecii‘ic dy and/or multispecilic activatable antibody is administered to patients that are at rislr of d eyeloping one or more of the aforementione disorders. A patient’s or organ’s predisposition to one or more of the disorders can be determined using genotypic, serological or biochemical markers.

Etltltlllfiti} in another embodiment of the disclosure, a rnultispecitic antibody and/or multispecilic activatable antibody is administered to human individuals diagnosed with a clinical indication associated with one or more of the aforementioned disorders. Upon diagnosis, a multispecitic antibody and/or multispecilic activatahle antibody is administered to mitigate or reverse the effects of the clinical tion. {$630357} Multispeciiie antibodies and/or multispecific aetivatahle antibodies are also useful in the ion of one or more targets in t samples and ingly are useful as diagnostics. l:or example, the multispecilic antibodies and/or rnultispecitic actiyatable antibodies of the disclosure are used in in vitro assays, rag, ElJlSA, to detect one or more tar et levels in a patient sainple. {999358} in one embodiment, a multispecific antibody and/or multispecific activatahle antibody is immobilized on a solid support (eg, the welds) of a microtiter plate). The immobilized antibody and/or activatable antibody serves as a capture antibody for any target(s) that may be present in a test sample. Prior to ting the immobilized multispecilic antibody and/or immobilized m'ultispecilic activatable antibody with a patient sample, the solid support is rinsed and treated with a blocking agent such as milk protein or albumin to prevent nonspecific adsorption of the analyte. {899359} Subsequently the wells are treated with a test sample suspected of containing the antigen, or with a solution containing a standard amount of the antigen. Such a sample is, eg, a serum sample from a subject suspected of having levels of circulating n considered to be diagnostic of a pathology. After rinsing away the test sample or standard, the solid support is treated with a second dy that is detectably labeled. The labeled second antibody serves as at detecting antibody. The level of detectable label is measured, and the concentration of target anti en(s) in the test sample is determi ed by comparison with a standard curve developed from the standard s. lfit’illl It will be appreciated that based on the results obtained using the inultispecitic antibody and/or specilic activatable antibody in an in vitro stic assay, it is possible to stage a disease in a subject based on expression levels of the target antigen(s). For a given e, samples of blood are taken from subjects diagnosed as being at s stages in the progression of the disease, and/or at various points in the therapeutic treatment of the disease. Using a population of samples that provides statistically significant results for each stage of ssion or therapy, a range of concentrations of the n that may be considered characteristic of each stage is designated. {dllllel} Multisiecific antibodies and/or multispecitic table antibodies can also be used in diagnostic and/or imaging methods. in some embodiments, such methods are in vitro methods, in some embodiments, such methods are in viva methods. ln some embodiments, such methods are in site methods. in some embodiments, such methods are ex vivo methods. for example, multispecitic antibodies and/or multispecific activatable antibodies having an enzymatically cleavable CM can be used to detect the presence or absence of an enzyme that is capable of cleaving the CM, Such multispecitic antibodies and/or specitic activatable antibodies can be used in diagnostics, which can include in viva detection tag, qualitative or quantitative) of enzyme activity (or, in some embodiments, an environment of increased ion potential such as that which can provide for reduction of a disullide bond) through measured accumulation of multispecitic activated antibodies (i.e., antibodies resulting from cleavage of a multispecific activatable antibody) in a given cell or tissue of a given host organism. Such accumulation of ted pecilic antibodies indicates not only that the tissue expresses enzymatic activity (or an increased reduction ial depending on the nature of the CM) but also that the tissue expresses at least one target to which the ted antibody binds. {(3993th For example, the CM can be selected to be a protease substrate for a protease found at the site of a tumor, at the site ol‘a viral or bacterial infection at a biologically confined site (egg, such as in an abscessfl in an organ, and the like), and the like, At least, one of the AB can be one that binds a target n. Using s familiar to one skilled in the art, a able label tag, a lhiorescent label or radioactive label or radiotracer) can be conjugated to an AB or other region of a multispecific antibody and/or multispecitic aetivatable antibody. Suitable detectable labels are discussed in the context of the above screening methods and additional specitic examples are provided below. Using at least one AB ic to a protein or peptide of the disease state, along with a protease whose activity is elevated in the disease tissue of interest, activatable antibodies will exhibit an increased rate ol‘binding to disease tissue relative to tissues where the CM specitic enzyme is not present at a detectable level or is t at a lower level than in disease tissue or is inactive (egi, in zymogen form or in complex with an inhibitor), Since small proteins and peptides are rapidly cleared from the blood by the renal filtration system, and because the enzyme specific for the CM is not present at a detectable level (or is present at lower levels in non— disease tissues or is present in inactive conformation), accumulation of activated niultispeeillc antibodies in the disease tissue is enhanced relative to non-disease tissues {@8363} in another example, activatable inultispecitic antibodies can be used to detect the presence or absence of a, ng agent in a sample. For example, where the tnultispecilic activatable antibodies n a CM tible to cleavage by an enzyme, the multi specific activatable antibodies can be used to detect (either qualitatively or quantitatively) the presence of an enzyme in the . in another example, where the niultispecilic table antibodies contain a CM susceptible to ge by reducing agent, the inultispecilic activatable antibodies can be used to detect (either qualitatively or quantitatively) the ce of ng conditions in a sample. To facilitate analysis in these methods, the multispecific activatable antibodies can be detectably labeled, and can be bound to a support (eg, a solid support, such as a slide or bead). The detectable label can be positioned on a portion of the activatable antibody that is not released ing cleavage, for example, the de ectable label can be a quenched fluorescent label or other label that is not detectable until cleavage has occurred. The assay can be conducted by, for example, contacting the immobilized, detectably labeled rnultispecil'ic activatable antibodies with a sample suspected of containing an enzyme and/or reducing agent for a time sufficient for cleavage to occur, then washing to remove excess sample and contaminants. The presence or absence of the cleaving agent (cg, enzyme or reducing agent) in the sample is then ed by a change in detectable signal of the niultispecil‘ic activatable antibodies prior to contacting with the sample (g, the presence of and/or an increase in de ,ectable signal due to cleavage of the inultispecil‘ic activatahle dy by the cleaving agent in the sample. {lllllle-tt} Such detection 1 ethods can be adapted to also provide for detection of the presence or absence of a target that is capable of binding at least one AB of the specilfiic activatable antibodies when d. Thus, the assays can be d to assess the presence or absence of a cleaving agent and the presence or absence of a target of interest, The presence or absence of the cleaving agent can be detected by the presence of and/or an increase in detectable label of the tnultispecitic activatable antibodies as described above, and the presence or absence of the target can be ed by detection of a —AB x eg by use of a detectably labeled anti "target antibody. {899365} lvlultispecific activatable antibodies are also useful in in, size; imaging for the validation of activatable antibody activation, cg, by protease cleavage, and binding to a particular target. In Sim imaging is a technique that s localization ot‘proteolytic ty and target in biological samples such as cell cultures or tissue sections. Using this technique it is possible to confirm both binding to a given target and proteolytic activity based on the presence of a able label (eg a scent label). lililllBt’itil These ques are useful with any frozen cells or tissue derived from a disease site (erg tumor tissue) or healthy tissues: These techniques are also useful with fresh cell or tissue samples Etltltllldfl ln these techniques, an activatahle antibody is labeled with a detectable label.

The detectable label maybe a lluorescent dye, (eg. a lluorophore, Fluorescein lsothiocyanate (E'l’l‘C), Rliodamine lsothiocyanate l'l'CL an Alexa Fluor® label), a near infrared (NIR) dye (eg Qdot® nanocrystals), a colloidal metal, a hapten, a radioactive marker, biotin and an amplification reagent such as ayidin, or an enzyme (cg. horseradish peroxidase or alkaline pl’iospliatase,. ltlllll368} Detection of the label in a sample that has been incubated with the labeled, multispecillc activatable antibody indicates that the sample contains the target and contains a protease that is specific for the CM ol‘ the rnultispecil'ic activatable an tibody. in some embodiments, the presence of the protease can be confirmed using broad spectrum protease inhibitors such as those described herein, and/or by using an agent that is specific for the protease, for example, an antibody such as Al l, which is specific for the protease rnatriptase (MT—SH) and inhibits the proteolytic activity ol’MTSPl; see eg international Publication Number W0 2tll (ll/l29609, published ll November 2G"). The same approach of using broad um protease inhibitors such as those described herein, and/or by using a more ive tory agent can be used to identity a protease or class of proteases specific for the CM of the activatable antibody: in some embodiments, the pr 2sence of the target can be confirmed using an agent that is specific for the target or the detectable label can be competed with unlabeled target. in some embodiments, unlabeled activatable antibody could be used, with ion by a labeled secondary antibody or more complex detection system Etltltllldéll Similar techniques are also useful for in viva imaging where detection of the fluorescent signal in a subject, eg, a mammal, including a human, indicates that the e site contains the target and contains a protease that is specific for the CM of the pecific activatable antibody. lfi’l’ll} These ques are also useful in ltits and/or as reagents for the detection, identification or characterization of protease activity in a variety ot’cells, tissues, and organisms hased on the proteasevspecilic CM in the multispecific aetiyatahle antibody, Therapeutic Administration and Formulations of Multispecifie Antibodies and/or ispeeil‘ic Activatahle Antibodies {999371} it will he appreciated that administration of therapeutic entities in accordance with the disclosure will be administered with suitable carriers, excipients, and other agents that are incorporated into ations to e improved transfer, delivery, tolerance, and the lilte. A multitude of appropriate formulations can he found in the formulary known to all pharmaceutical chemists: Remington’s Pharmaceutical Sciences (lSth ed, Mach Publishing Company, Easton, PA 0975)), particularly Chapter 87 by Blaug, Seymour, n. 'l‘hese formulations e, for e, powders, pastes, ointments, jellies, waxes, oils, , lipid (cationic or anionic) containing vesicles (such as Lipol’fectinTM), DNA conjugates, anhydrous ahsorption pastes, oil—invwater and water~in—oil emulsimis, emulsions ax (polyethylene glycols of various molecular weights), semi-solid gels and semi—solid mixtures containing cathowax. Any of the foregoing mixtures ma§l be appropriate in treatments and ies in accordance with the present disclosure, provided that the active ingredient in the formulation is not inactivated hy the formulation and the formulation is physiologically compatible and tolerable with the ‘oute of administration.

See also Baldrick P. "Pharmaceutical excipient development: the need for preclinical guidance," Regul. 'l'oxicol Pharmacol. 32(2):}3lO—8 (2900), Vang W. "Lyophilization and pment of solid n pharmaceuticals." lnt. J. Pharm. 2t)3€_ 1-2.): lot) (2099), Charman WN "Lipids, lipophilic drugs, and oral drug delivery—some emerging concepts." J Pharm Sci.89(8):967—78 (2000), Powell at oi, "Compendium of excipients for parenteral formulations" FDA l Pharm Sci Technol, 52:23 8—3 ll (l 998) and the citations therein for onal information related to formulations, excipients and carriers well known to pl’iarmaceutical chemists. 72} in some embodiments, the multispecitic antibodies, the multispecific activatahle antibodies and/or the conjugated multispeciiic activatahle antibody compositions are administered in ction with one or more additional agents, or a combination of additional agents, Suitable additional agents include current pharmaceutical and/or surgical ies for an intended application, For example, the multispecitic antibodies, the pecific activatahle antibodies and/or the conjugated multispecitic activatahle antibody [Annotation] CLGUS Aug 2021 itions can be used in conjunction with an additional chemotherapeutic or antineoplastic agent. For example, the multispecific antibodies, the multispecific activatable antibodies and/or the conjugated pecific activatable antibody compositions and additional agent are formulated into a single therapeutic composition, and the multispecific antibodies, the multispecific activatable antibodies and/or the ated multispecific 2020200981 activatable antibody compositions and additional agent are administered simultaneously.

Alternatively, the multispecific antibodies, the multispecific activatable antibodies and/or the conjugated multispecific activatable antibody compositions and additional agent are separate from each other, e.g., each is formulated into a separate therapeutic composition, and the pecific antibodies, the multispecific activatable antibodies and/or the conjugated multispecific activatable antibody compositions and the additional agent are administered simultaneously, or the multispecific antibodies, the multispecific activatable antibodies and/or the ated multispecific activatable antibody compositions and the additional agent are stered at different times during a treatment regimen. For example, the multispecific antibodies, the multispecific activatable antibodies and/or the conjugated multispecific activatable antibody compositions is stered prior to the administration of the additional agent, the multispecific antibodies, the pecific activatable antibodies and/or the conjugated multispecific activatable antibody compositions is administered subsequent to the administration of the additional agent, or the multispecific antibodies, the multispecific activatable antibodies and/or the conjugated multispecific activatable antibody compositions and the additional agent are administered in an alternating fashion. As described herein, the pecific antibodies, the multispecific activatable antibodies and/or the conjugated multispecific activatable antibody compositions and additional agent are administered in single doses or in multiple doses.

In some embodiments, the additional agent is coupled or otherwise ed to the multispecific antibodies, the multispecific activatable antibodies and/or the conjugated multispecific table antibody compositions.

Suitable additional agents are ed ing to the purpose of the intended application (i.e., g, prevention of cell proliferation, hormone y or gene therapy). Such agents may include but is not limited to, for example, pharmaceutical agents, toxins, fragments of toxins, alkylating agents, enzymes, antibiotics, tabolites, antiproliferative agents, es, neurotransmitters, DNA, RNA, siRNA, oligonucleotides, antisense RNA, aptamers, stics, radiopaque dyes, radioactive isotopes, genic compounds, magnetic labels, nanoparticles, marlrer compounds, lectins, compounds that alter cell membrane pern'reability, photochemical compounds, small molecules, liposomes, micelles, gene therapy vectors, viral vectors, and the like. Finally, combinations of agents or combinations ‘ferent classes of agents may be used. lB‘ll'Sl The multispecilic antibodies, the rnultispecitic activatable dies and/or the conjugated multispecitic activatable antibody compositions of the disclosure (also referred to herein as "active compounds"), and derivatives, fragments, analogs and homologs thereof, can be incorporated into pharmaceutical compositions suitable for adininis'tratit‘in. Principles and considerations involved in preparing such itions, as well as guidance in the choice of components are provided, for example, in Remington’s Pharmaceutical Sciences: The Science And ce Of Pharmacy l‘9th ed. so R.

Gennaro, et al., editors) Maclr Pub. Co, Easton, Pa. : l995; Drug Absorption Enhancement : Concepts, Possibilities, Limitations, And , llarwood ic Publishers, Langhorne, Pa, 1994; and Peptide And l’rotein Drug Delivery ces ln Parenteral Sciences, Vol. 4), l99l, i‘vl. Deldrer, New Yorlr. ldllllii’ltl} Such compositions typically comprise the multispecilic antibody and/or the multispecilic activatable antibody and a pharmaceutically acceptable carrier, Where a multispecific antibody and/or a multispecific activatable antibody includes a fragment of the AB domain, the smallest tragment of the AB that specifically binds to the binding domain of the target protein can be used. For example, based upon the variable—region sequences of an antibody, peptide molecules can be designed that retain the ability of the AB to bind the target protein sequence. Such peptides can be synthesized chemically and/or produced by recombinant DNA technology. (See, rag, Marasco et al., Proc. Natl. Acad. Sci. USA, 90: 7889~7893 0993)). {999377} As used herein, the term "pharmaceutically able carrier" is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, ic and absorption ng agents, and the like, ible with ceutical administration. Suitable carriers are described in the most recent edition of Remingtonls Pharmaceutical Sciences, a standard reference text in the field, which is incorporated herein by reference. Suitable examples of such rs or diluents include, but are not limited to, water, saline, ringer’s solutions, dextrose solution, and 5% human serum albumin.

Liposomes and non-aqueous vehicles such as fixed oils may also he used. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereol’in the itions is contemplated. {$388378} 'l'he formulations to he used to ' in Viva administration must be sterile, This is y accomplished by filtration through sterile filtration membranes. {(399379} A pharmaceutical composition of the disclosure is formulated to be compatible with its intended route of administration. Examples of routes of administration include parenteral, cg, intravenous, errnal, subcutaneous, oral (cg, inhalation), transdermal (La, topical), transmucosal, and rectal administration. Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, ine, propylene glycol or other synthetic ts; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium hisull‘ite; ing agents such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or ates, and agents for the adjustment of tonicity such as sodium chloride or dextrose. The pl-l can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide. The parenteral preparation can be ed in ampoules, disposable syringes or multiple dose Vials made of glass or plastic. lllllllillllll Pharmaceutical compositions suitable for injectahle use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the externporaneous ation of sterile inj e solutions or dispersion. For intravenous administration, suitable carriers include logical saline, bacteriostatic water, Cremophor ELTM (BASF, Parsippany, NJ.) or phosphate buffered saline (PBS). in all cases, the composition must be sterile and should be fluid to the extent that easy syringeability exists, it must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi.

The carrier can be a t or dispersion medium containing, for e, water, l, polyol (for example, ol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of sion and by the use of surfactants. Prevention of the action of microorganisms can be achieved by various antibacterial and ngal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. ln many cases, it will be suitable to include isotonic agents, for example, sugars, polyalcohols such as manitol, l2',7 sorhitol, sodium chloride in the composition. Prolonged absorption of the injectahle compositions can he brought about by ing in the composition an agent, that delays absorption, for example, aluminum monostearate and gelatin. {899381} Sterile iniectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by lilte ed sterilization. Ge erally, sions are prepared by incorporating the active compound into a sterile vehicle that ns a basic sion medium and the required other ingredients from those enumerated above. in the case of sterile powders for the preparation of sterile inj ectable solutions, methods of preparation are vacuum drying and freeze—drying that yields a powder of the active ient plus any additional desired ingredient from a previously sterile-- tiltered solution f. {999382} Oral itions generally include an inert diluent or an edible carrier.

They can be enclosed in gelatin capsules or compressed into tablets. for the purpose of oral therapeutic administration, the active nd can be incorporated with excipients and used in the form of tablets, troches, or capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the cmnpound in the flui d carrier is applied orally and swislied and expectorated or swallowed. l’harmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition. The tablets, pills, capsules, troches and the lilte can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacantli or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Prirnogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a ing agent such as peppermint, methyl salicylate, or orange ing, {llllllfiilill For administration by tion, the compounds are delivered in the form of an aerosol spray from red ner or dispenser that contains a suitable propellant, ag, a gas such as carbon dioxide, or a nebulizer. lllllllliéld} Systemic administration can also be by transmucosal or transderinal means.

For transmucosal or transderrnal administration, penetran ts riate to the barrier to he permeated are used in the ftn‘rnulation. Such penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives. Transmucosal administration can be accomplished through the use of nasal sprays or suppositories. l: or transdermal administration, the active compounds are t‘orn'rulated into ointments, salyes, gels, or creams as generally ltnotvn in the art. {$33385} The compounds can also be ed in the form of suppositories tag with conventional suppository bases such as cocoa butter and other glycerides) or retention eneinas for rectal delivery. {$90386} in one embodiment, the active compounds are prepared with carriers that will protect the nd t rapid elimination from the body, such as sustained/controlled release ations, including ts and microencapsulated delivery systems. Biodegradable, hioci‘impatihle polymers can he used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and ctic acid. Methods for preparation of such formulations will be apparent to those skilled in the 7} For example, the active ingredients can he entrapped in rnicrocaps ales prepared, for example, by coacervation techniques or by interfacial polymerization, for example, yrnethylcellulose or gelatinnnicrocapsules and poly—t:methylmethacrylate) niicrocapstiles, respectively, in colloidal drug delivery systems (for example, liposomes, albumin niicrosphcres, microemulsions, nano—particles, and nanocapsules) or in macroemnlsions. {9993883 ned~r‘elease preparations can he prepared. Suitable examples of sustained—release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, rag, films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, ~hydroxyethyl—rnethaeiylate), or pi‘ily(yinylalcohol», ctides (US Pat. No 3,773,9l9), copolymers of let—glutamic acid and y ethyl~L~ glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT TM (injectahle inicrospheres composed of lactic acid—glyeolic acid copolymer and leuprolide acetate), and poly—D—(—)—3~l'1ydroxyhutyric acid, While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over lllll days, certain hydrogels release proteins for r time periods. lilllllillllll The materials can also he obtained commercially from Alza Corporation and Nova Pharmaceuticals, lnc, omal sions (including liposomes targeted to infected cells with onal antibodies to viral antigens) and can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in US. Patent No 4,522,8l l. {$3thth it is estecially advantageous to formulate oral or parenteral itions in dosage unit form for ease of stration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the disclosure are dictated by and directly dependent on the unique characteristics of the active con'ipound and the ular therapeutic e feet to he achieved, and the limitations inherent in the art of compounding such an active nd for the treatment of individuals.

Etlllllfigll The pharmaceutical compositions can be included in a container, paclr, or dispenser together with instructions for administration. ltltltlBQ’Z} The formulation can also n more than one active compound as necessary for the particular indication being treated, for example, those with complementary activities that do not adversely affect each other. Alternatively, or in addition, the composition can se an agent that enhances its function, such as, for example, a cytotoxic agent, cytolrine, chemotherapeutic agent, or growth-inhibitory agent. Such molecules are suitably present in combination in amounts that are effective for the purp "ise intended. {$90393} In one embodiment, the active compounds are administered in combination therapy, i.€., combined with other agents, eg, therapeutic agents, that are useful for treating pathological conditions or disorders, such as autoin‘imune ers and inll ammatory diseases. The term "in combination" in this t means that the agents are given ntially contemporaneously, either simultaneously or sequentially, lf given sequentially, at the onset of administration of the second compound, the first of the two compounds is still detectable at effective concentrations at the site of treatment. {$90394} For example, the cmnbination therapy can include one or more antibodies of the disclosure coformulated with, and/or coadministered with, one or more additional eutic , rag, one or more cytolrine and growth factor inl'iihitors, imrnunosuppressants, antiwinfianimatory , metabolic inhibitors, enzyme inhibitors, and/or cytotoxic or atic , as described in more detail below. rmore, one or more antibodies described herein may he used in combination with two or more of the therapeutic agents described herein. Such combination therapies rnay advantageously utilize lower dosages of the administered tl'ierapeutic agen ts, thus avoiding possible toxicities or complications associated with the s ntonotherapies. } hi other ments, one or more antibodies of the disclosure can be coli‘orniulated with, and/or coadniinistered with, one or rnore anti~inilarnniatory drugs, irnniunosuppressants, or metabolic or enzymatic inhibitors. Nonlirniting examples of the drugs or inhibitors that can be used in combination with the dies described herein, include, but are not limited to, one or more of: nonsteroidal anti—inflammatory drugts) (NSAle), 6.5;, ibuprofen, tenidap, naproxen, rneloxicani, piroxicarn, dich‘il‘enac, and indmnethacin; sulfasalazine; corticosteroids such. as prednisolone; ine suppressive anti-inflammatory drug(s) (CSAle); inhibitors of nucleotide biosynthesis, egg, inhibitors of purine biosynthesis, folate antagonists tag, rnethotrexate (N—H—[fiZfi—diamino—o— pteridinylfi'nethyl] rnethylaniinol benzoyil~L—giutarnic acid); and inhibitors of pyrimidine biosynthesis, rag, dibydroorotate dehydrogenase (DHODH) tors. Suitable eutic agents for use in combination with the antibodies of the disclosure include NSAle, (ISAIDS, (Di‘lODl‘l) inhibitors (tag, lellunornide), and lolate antagonists tag, niethotrexate). {@9396} Examples of additional tors include one or more of: corticosteroids (oral, inhaled and local injection); irnniunosuppressants, 6.53., cyclosporin, tacrolinius (EK~ 506,"); and rnTOR inhibitors, 6,51, sirolirnus (raparnycin — EUNETM or rapaniycin derivatives, tag, soluble rapainycin derivatives (eg ester rapaniycin derivatives, eg (ECL- 779); agents that interfere with signaling by proinllanunatory cytoltines such as TNEa or ll_..—l tag. lRAK, NIK, lKK, p38 or MAP ltinase inhibitors); COX? inhibitors, 6.2g, celecoxib, rofeeoxib, and variants the eof; phosphodiesterase inhibitors, cg, R97340l (phosphodiesterase Type l‘v’ inhibitor); phospholipase inhibitors, 6.33., inhibitors of cytosolic phospholipase 2 ) (6.53., trilluoroniethyl ltetone analogs); inhibitors ot‘vascular endothelial cell growth factor or growth factor or, sag, VEGF inhibitor and/or VEGR R inhibitor; and inhibitors of angiogenesis, Suitable therapeutic agents for use in cornbination with the antibodies of the disclosure are nosuppressants, cg, porin, tacrolirnus (FK~506); rnTOR inhibitors, sag, sirolirnus trapanrycin) or vcin derivatives, egL, soluble rapaniycin derivatives (age ester yein derivatives, tag, 031-mmI I I I 9); COKE. inhibitors, cg, celecoXib and variants thereof; and [Annotation] CLGUS Aug 2021 phospholipase inhibitors, e.g., inhibitors of lic olipase 2 (cPLA2), e.g., trifluoromethyl ketone analogs.

Additional examples of therapeutic agents that can be combined with an antibody of the disclosure include one or more of: aptopurines (6-MP); azathioprine sulphasalazine; mesalazine; olsalazine; chloroquine/ ychloroquine (PLAQUENIL®); 2020200981 penicillamine (intramuscular and oral); oprine; colchicine; beta-2 adrenoreceptor agonists (salbutamol, terbutaline, salmeterol); xanthines (theophylline, aminophylline); cromoglycate; nedocromil; ketotifen; ipratropium and oxitropium; mycophenolate mofetil; adenosine agonists; antithrombotic agents; complement tors; and adrenergic agents.

All publications and patent documents cited herein are incorporated herein by reference as if each such publication or document was ically and individually indicated to be incorporated herein by reference. Citation of publications and patent documents is not intended as an admission that any is pertinent prior art, nor does it constitute any admission as to the contents or date of the same. The invention having now been described by way of written description, those of skill in the art will recognize that the invention can be practiced in a y of embodiments and that the foregoing ption and examples below are for purposes of illustration and not limitation of the claims that follow.

EXAMPLES The following sequences shown in Table 7 include sequences that were used throughout the Examples ed herein: Table 7: Exemplary Sequences Anti—human CTLA-4 scFv Antibody: GGAGGTGGATCTGGAGGTGGCGGTTCAGGCTCTGGCGGAGGCTCAGGTGGTGGAGGATCAG GCGGAGGTGAAATTGTGTTGACACAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAG AGCCACCCTCTCCTGCAGGGCCAGTCAGAGTGTTAGCAGCAGCTACTTAGCCTGGTACCAG CAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCAGCAGGGCCACTGGCA TCCCAGACAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCAGACT GGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCAGTATGGTAGCTCACCGCTCACTTTC GGCGGAGGGACCAAGGTGGAAATCAAACGTTCCGGAGGGTCGACCATAACTTCGTATAATG TATAC-iACJAAJTTATCC CGAHC3CTTCC JCTCCACCTGGTGCAGCTGGGGGLGGp[:3 CGTGC' C'CA"CTGCGACCCC'G-1ACTCTCCTCTCCACCCTCTjGATCCACCTTTAGC 71. mC 7 mflfifl fifinfiflLJ'LJQ'LJ‘V-AGEI fl 7 LTLJCKJA LJAGJLJ'i'LJLJ'LJ -iL.CAGLJGAH -LJ'LJLJ‘JLJmm mfiflfinfi. LJGA TGGLJiL.nmm. m n LJ -LJLJT_ TTTG'GGTAJTGGLGGTACC/CATACTACGCAJACTCCC '3A-CCJGCCG-TTC-VCAT CAGAGAC*1 («fir-13,11 A;m LC-AALJAJC‘CLm"(C 7‘ 1,"meGTAiC GCAAATJAJCAHCCTGAGAGCCJAGC/ACGmr‘ (77‘ 7\,/FTI"‘ 7/7 ner—w vm 2* m CCCGTATATTACTGTGCCCAAAC' CCCTTTACTGGTTTCCATCTCTGCGCCVC'CCCA CCCTCGTCACTGTCTCTTCACCTAGL (SEQ ID N3: 229) V1fim—‘(1—‘nq "x "xfi n nm he" ) " " "i " ’\ \ JGLJSLJ'JLJ'qu'Lr'L’J 'CRATLvCRASQSJSSSYLAWYC AJRLLTYGASS{A'GTPCRESJSJSGTDFTLTiS EE‘EDFASTYCQQYCSSPLTE ®n51n ~1~r~n1ITrI[:\_'L3‘_J_rnD\J\J(«r 7» 1 Vt (J'LJDLZ_\3\J_ACL, 1‘4 LBJ.

G' bu1.~r\r. S’lC‘G:rnAG [~11 ’sr \ SGTWCAGGGTGGCCG'AGCCCAGATTJTTCTGACCCA GA‘"CCC7CAA11A1GCGC/AC'CC 7CT‘ZLAA’GTTICCATGCTTCTGCGCCAGC AGC¥K1CGTTVM3CT‘"7"TGAPJT[GA?RT"M3QHXAAAGCTX1CCH\GC(CJ Kn1 TTTD'AT?C(AKCA3:CTCGCAZGCGGTGTTC"GGCAAFTTTQGTGGTA%"1GTACCGC CA CC' (22-.‘l'A’l'A1V "CTGACCJ‘']".VA(_12C(_12 T?ATGG} ACAGAA11J1TG 33,2\L3(,2"\2X\CC' AT'TA.'I"T( "_ CTGGTJA" VCAA[CCGTT".‘1‘1CVCTTTG‘: XVVITGGC’L V2CA1‘125\2(,"‘G"2\13AT ' (FEQ N": 233.) GAC VEGG SGCCGSGGCqQ ARVGA,VAWQTAASGY ‘TRYTMHWVR RPC’GLEWTG; RSRCYTN{NWK TFVSSSTAYWQLSSTTSELBATYYCATY ][Y’*G9Cr""TVSSGGJK:SGGG’(AJACOFT\]IVW PATW[V&_PK1V‘W""TC"AS SSVE’MRWVQQKSGTEPKPV:YDTSKT"SGVPAHFRGJGSGTSLTLSCMSAELTATfY" QQVSSFIFPFGCCMKPPTNR (SEQ ED PO: 232) ged 4Dllv2 Antiboc c tggg r g'flactct CCZngLdOC,.CCWTACLCQLVLLLdOCdCVCJLqCCitqagctgggtCCgCC&ggCtCC agggaaggggctggagtgggtgtCdadeLLudchqgaquLcoocaOdvda-C3pJLJ JMLLLCQLOddCUCJCJJ (aaccat010cagagacaawucaaagaacacgctgtatctgc QMALQJAPWOCCLCHCM’JC-qudeCpOCJCTaT ILLPOdddUdJEiC- egg CsychqvucLCLgacfac:gggccagggagcqctqg ac;:c:cc:c3gctagva,v BquqCCCdL Lstb'wflwctqgcapch:tccaaqa cacctC"zg< "Pctngc1gCfg-tcaaqgafitact1ccccgaaccggtgacgjtgtcg"u m aactcc+gggggjaccgtcagt:ttcwtfi "CQJCJQJGCc?cccagcccccatcoaoaaarccGLCCCCJQJGCCadJAOQCJCCCCcg caqccgzazaacaactscsagafi'anCCtCCG [{IVHLLT‘OGGGIAN PG 4531.PJ 0’4""? S‘.’Z‘%[‘VJST,"J‘VP\APGVGLEEAJVSSI )]§'[{1G[\Q'I"EYA PTISPDNbKNTLYI "NS[WTLWDHNPTYYCAI‘XiSiTcAJ[T’*GQGTTA/"SSAST KGPSHPPEEPibKSmSGC‘lAL‘"[VoLLPJPVLHONNSGH \%TJ"7"P" ]"°VV]VPibL JTJT§[NVNHKPSPTSVPKK73Px"’PKTHTFPPLPNPLL’GCPOVPL PPPKPKIN.__4'LH'OPMPPVTCVVV'QNCPPPVKPNWVVDGVF7HNAE KP}PHVNPYRV" SVLTV[{QPVLJGKLKC""kKA[PNPTP' <:_TMPP1R}PVTKNKVQ LTCL‘]E{GF‘:PSDTA‘J:3§JA‘SI\TG'WPJZI\I\V{TTI’ P\\fLDSDGSFFLYQKLTVDKSRPJQOGJIFSC Anti—hum A‘JLCLdOdL*acqc¢’tctucatuc,Vuctotct’ca+ deOOdOdvdudg:cacca :caPtLqPLoqvc~o+c¢’g *qcpiiiL&aa-quchaJ;audaaccacg.2- _ _ . gspaqPLCLtaauctcctgatctatgcggca+eddb:t:gcaaagtgg3gicuc;:caacg tTlaquOcaOfigTiici"ggaggatLtqutctcacca-cagcagtctgcwdcctqmg afLLLngd(L:actctgtn udqug.ttgtgc cgttdt1300¢csgggaa CudququddLGdfia"’ngg’ng CddCfiLLL"CC-LLJLCZLCSGTJCJLCCQRL‘3" 1 qwagttqauafc+o3afictgcctctgttgtgtgcctgctgaataacttCLaLCCPagag BJQCCJQJGLLagggcaagctggataacgccctccaatcgggtaactcccaggagagtgt+ C'GCJQJQCQQ3Cr3CECii/3CgacaqcaCC"aCéigCC'L1Q<"d\jCJCCCLCEJCCLJB :3 atk."{1) 1 £1) gadgdctacgagaaacacaaagtctacgccCgcgaagtcacccatcagjgcctgagctcgc "Pqtcacaaagagctccaacnggggtgagtgt (3?? ID N1: 235) LIQMTQSPSSLSASV‘DRViliC'AS’SlSSV?JNVQKKEVRAPhLLiYAASSLQSGVESP ‘LQ: [DE-’LZ‘li‘I-Y YC'QQmVth’ EI—LTFT EQLWQCKPOVVATVWWVYCBE""h:NALQS"NSQQSVTEFDSLDSTYQLQSTLTLXR AD’EK1<""ALL7WEQGLSSV‘lKSFflPC" (SEW IL NO: 236} Antiwhuman Jagged 4Lll Antibody: Heavy Chain qugcaGC1tt: "P'ngcaGCCLCLegattcacctttagcagctataccatgaqctg:gtccgccagcctcc gtgaaggoccggthaccatthuughgkCaattccaagaacacgctgtatctgc aaatgaacaguctgfiga ccgaggacauggcugtutattactgtgcgaaagubutcggcgg .:tcbcbga.3ccggtJachtQt-g'ggLaCLcagg _ J J: C0t3cagtuctcagguCzecactcc thagcagug ongaccgtgccctccagcagcttfiggcacccagauctabutctgcaacg tgaatcacaagcuc1gcaacaccaaggtggkcaigiaagttgagucuaaatcttgtgacaa aactcacauatocvcahflggchaCquLTCtCCCjtquQacgtcaqLthcctL tttsccciddddCdaggacascatgdtQithcucgqin miga3Q Q'qafngtgg tgqtqgacthdcha3’a3fascstgag tcaaqi tcaa:qudLQLcave ggig’dedtOCJaETJCJaJLPLgcgEgdCulucaqlaCAJLJ*PdPOtfiCJTt’t’"t3 39c;-cctuauQsicctgcacudqggLLQQCYQadYQQCQagQJQacaagtgcaafgtct cc;JLJAdYPLctcuc;_cccccgttgagaaaag0%:ccccaaagccaaaggucajccccg agaaccavag LWLQC&CCCT’pLCLCdtpCJOigi’"34aqucadeaCQagqtcaacu.2 .2 .. . ctLJLCLCLCLCQLCd:QQWLtutathcaQadvafcgpqLQOQQL ggcagcchanacaa;:gkc’gg (‘3c2cgpctcucj:;ctg(a:tcc3aCQgctccttc;t cc;ctacaQQauctcaCC’fc'caaQana wt’cafitacrwoaacof ctca+'c .. .2 .J .2 .2" .. . . . .2 V.) V.) aLJ(e"Qquctctg1LJA(uac;acacgc;’aa(agcctc-csch+ctcccg qttat (SEQ ID NO: 2j7) QVQLLESGSGLVALGGS R SCAASC"TSSIAMCWVRAEmAGLTN\SSfu} UI:zmDWGHMI—g "J \ am '1‘ Y IQW4.2 mA"VVCn .IJ_ ("mm ‘DDC;ASL: TVSSAS'l KGESVFELAPSSKSTS(5G[YA CCVWUVLQLQVTVJENSCALIOC7HTFPAVTQESCL’" VPSSSLGTQm‘inNVklé SNTLVLYKVLAKSCL'I1IPPCPAPELLGGP‘ \‘jQYNS 'lYRV\7 SVWLF/L'iQLJE/v ’YLEAl—‘TELKTYSKA G’7PREPO‘V7Y'TLPPSK'LV'iYN(WS LlSL"W~E"PSLIAV3VESNGQPENI{YLTTLPVLDSLGSFELYShLTVDKS'fQ"¢thS" NV5 1 Q ,l LM (7) Q *r:V 0 fl P < Co + Cu O I._J m E? ri' FU 9 (_n U.) a l‘D I l_‘ [\) 5 gm C? I...’\ f." / [\) {"4 F. 15 S m ChaLn ,01cctacaCCLtLagcaaQua.ccctgac L'gfingddOC; IagaaadCEiddd'CC‘C .‘LCT edothqc;ctcagggc ctcde;COPCCuthc (SEC ID NO: 239) QGQSGQCHTT’TLVGGDCRCA/'71 GSSCGSTJ'.JST»}GLST»}RSD1\THGCGS P‘SCJLLJALJ RVTLL ti(.RA /)rQST SYLNVM‘Q)KPGKT PKT LTYAASSLL‘SGVP STJ'CGSGT DETLTL.SSL .11.) .er': EA T VH‘TCQQTVVAL/R 1b'GQCTKVLTT.RTVAARSVJ. --1. L‘PSTTL'QLTS .JTAS17‘7’TLLNT YPLE.TTCT/QWKVDT- QLSGNSQ"'SVTEQDSKDSTYSLSSTLT KHKVYACEVTHQGL LSSPVTKSF1\:RG3C (SEQ L 170: "'40) Anti—JagJJG 4D11v2 — arxti— CD3 GKT3 Mul ispeciTic Ar’ : Heavy din AGTGC CTGTTCGAG 'GGGGG GGCTTGJTACAGCCTGG GGTCC TGAGJ ’'CT CC TGC CCTCTCGAT'CACCTTTAJCACTATJCCATGAGCTJGJTCC -GGC' CC LTLGGGALZ‘1G TJTTCJT'T'TTG"’-TTGGGTCTCAA TJTL'TATTGZ CCCGCA-GGTC G-TJCAGZ3GAT'T73T'T-TTGCA G233.TT T CCGTGZ 1 V"n.-GG’TC’TGGT'TCACCATCT'TCCAGAGACr123TT CC- TAACACGCT’TTATCTTT 7'GC AAA' TGAACA" AC TT73TATTT/\TCTGCGAAATTACA' TCGGCGG GAGLer.~TGC: L~1~1r,1.1Ir1111G ,11.»11» 51.11, .

'LmLCL ' L" 1T 51.,T| GCCAGGGAACG '7 TT'TCC""71" ’T'TA A/:3_\.A.3chrL,-1r~5~. ~71 ~1.LL,UUGILJ.III'1ITI.1Ir~JIr1Ir~JIr1Ir'\.»‘.,'\.L1., ACCC -EL .-»A1ACCACCLLM1Amfir11 ",11mCTGGG,LG,LLCLCAGCGGm.-nrp MC' CL,11L1 C1111,Cr T 1» 11, ,Lr15~.11_Jr1 TAC‘T' L-2 1 L1,L 11 ,. D 115111 L111,~1 1 11.1 11 ~,L 1U; GTTJITLL/T_{L3-.2731. 213,: 'CL (37,33‘3; 1.1:: 3.121C1L'L: bi L, UGAAC1113.131: I111,L5~.,L5~..-1.~11 1111 "'""r’1 ,L,L .11,L1~1» 511 1rLr1111~1~1~1,~1 1,11111,11111_1~1,1. ~1r1v 111 L 1, «11151.11» 11111I1~.,L LUCK/C {JACCLL‘LJ‘LJUGK. 1.1LA'CL‘1CC TLCLUGL-T 3 1C1!»‘GG: LTGTAC J.\.."UTA3,211.11CL 'CC I111.TCL1GC2 CJLUGLGAC'CDTWCCC51D ,L, _L~1 .1, 1 ,Lan L1 L111,L1~1 11,11L11-1,L-,» I ,LI..~.,L5~.111~'C'CL3. -L.,12G3 3.LC11I51,~1L11.1I11 51rL5~D J. LGLJ11LZ'3CCCL‘CC' 23L,~1~1r111 «[1 J. 1113-14233.stI..~.,L »1 :332D1T'CZXCAL L V1311 »1,~1',~1»1,L » .. 3.11.: 1» 11L ~Lr1_LI»1 L.. Lmfimw .113 ' CAL»-{.[ACCT P113 vi (.1273‘15273213, U231». 3.13. J. .L LCXLZ‘1 AAC $213,23leZ3i LIL,D 1~ 11 ~111rv1,11'1,~1'11.‘LJACLLDT JKJK/VLL‘wC, 1LTGA,1111,L. .,L.1~.,L5~.1 ~ 11 1~111r111» 2.,'CT.)TTTT'TV'J73pm (1.1.:"TECH.C T'TCCCCCC"AA7 C’TTjAAG SATACCCTCATGATTTTC'TTGACCCCT'TGA TJGTTCACAT GCG' TGG- TGC 1C.’\CGTTGZ3K CT'T.3.1TWA/"1TT’TTT'TG12LCJ3' i'jZ31233GT17"CZ31A "EGTAC TT'TLiTK'L—TJAC JGCG" GGA GTTT. GCAT. T'.Z\2"\2'1.'GCC"Z3AAGACAL31A(1CC2'G"2'GL'3G2GT'SAG T2T3GTZ3CL’3LLCTL'LGCCGT ACT-'TTTT'T’T 23.11.73.151.\,'L_1J_‘L,L\‘L,C‘J.L‘.,C,1 rLI,1 11 11 —L1--.—L Lv1r1rL-1,’LI,11Z.'\31.,2'3\.,'L_L3\1\..1’\(, G‘LJCT17-3Z31.3'123‘L3J_2\2C2-\2L.Z\‘L.133C p3.2'313'c.1.'\_1, rL m - 11m - r1L,- 11 —L L -,1,'L_r11.v1,1 312'L'32.AGC3CT" TT'JCAGCCCCCATCGAGA CCA'L'C'L"C'CLZ‘32’31Z3GCL3132-12Z3‘3 J‘SCAGCCCCG Z31G2’3LZ‘3'C2'C2’3 C2"GL'JT'LL'G'I'LT3CACCC'.T’JCCTCCTCA'T'L3C'TGG TIT3’2GL‘1GAJ'GLZ‘3C321Z3GZ323C'TZAGGTCAGC "T'17"1LZ‘3C2'TT'[ GLCT'TG‘ST‘-1L31GC.C'[T'] .'’3.'1.'L,C(3Z3G CGZ('T73'TCGC2'C112'TGG232 3T :ITSCII’XCIIDIC1CILDI T2G'C2'LT‘311CC2'G'T'\GZ3123C3TT'TAAAGACCAC'G'CT'TC'TC'T' GC'T’JCA’TT'TCT3G2—12.C"T TCTCCTT CTT T'TLKLTLMJCZ23GCTCACCG'TG TAAGAGC2—3 3‘3: 3GCL’31GLL‘3GGG113/1 {\{1'1-11 AT: VH1 xrxr $173 r15-rx J2-12 J .L\.,. CA 3C 1,.LI,11,L.- 11-. . ,ZL.- ,111- ,'L ,1- 11 ,1- 11 1.,'L. 1:1. ’\.J.L3C,2 .‘.JG1.,.'\.,T 1.73. LL33. '3.'L L"2-3C2—CG'TTT’Z"AGL AGCLICT'TCT'TCTTCT" .1Ir12'1Ir12r1Ir f.Lk/KJCI 3]. 7\LZ32(3'33 L.\GC:I.3L G‘J .5L,- 1 Lrn —L m 11:1,11012151123L-,1 L, 115'. Cj'LJ'_._1rL,1- «DI-urn 11 J1 ~r71mrw~ L,1- «111—1 11mWGIT'LJCHALM.)1 \r‘ .L AGEC .1. L1 GLL (3'TTA\LJCj»/J.»/l\.{LI,- ATLJZ-LLJC'1LjGL‘JALJL’JiLJHCLJ'LJr371 J‘ JLJ‘GEV‘:1LJ7Mfi1~ fifimmm .. fimT GCJJCLJJ’3JLLJC LJGTC J‘ JLJr\_J7‘73J‘V-iGLJC-J73JCGLC L.'LJLJ'Jm fin flfl fl mrcflfiflJflwfl'LJLJZ-L ALJLJ‘JJTTZ-‘JAJAJAiLJPJLJCL'LJTA-I-J"JLJMVAZ-LLJ7 "VI" ‘r .. mfimr‘ mm 7 "F‘ 7\"V -LJ JJ 1731;. L.CTTT _\-‘:1LJVLJ 1 11731173JCC-dJLLJ'LJATrpm-[‘7‘ [:4 I" ,..,, "\flfirfinrflm MA rTIfi/‘V7. ,fl—‘n p 'LJLJ‘JJ TTAAAJVAELJ-JTGGGGTGAGJJG C' GGAJATC‘JGATT JLJTTATATVJJATCLJ-JALJ IJJGTGLJTTA TACCAACTACJAJAGGAGA7‘ATTCAAA GATAAJ-AAGGA-AGAG 'GJ7GCACCCJ'ATAAAAAGIGAGGJLGC AGCGCCTATATGCAGGTGAGGAHVGTGJCTTGAJAG'LATAGCGCAGTTT TTALTGJ'GCAC LJLJTATTATJ'ATLJAJGACTATTGCC' G-JAJJTAi1GGGLJTGAGGGGACCCCCTGACGGTTJ4 131 (A «manLJALJ JJTGLJTI LJLJJLJGJALJTLJ'LJT‘JJLJ \-VLJ JJiGLJiAnn—"A m A. Q'rxrw ,«Afl—L LJGLJ'LJLJm—J An—Ln ,m _) 0 1E4 )1E4 JL J‘:1LJJ‘ JJLD \ \JI '77. C7) 1—] H<1 '31 ACCCZ GAGT CGCJGAATTATGAGCGCAA JJTLLGLLJJLGTJA7‘AAAGTTACCAJ CCAGCAGCAGC"ETTAGGTATATGAA 'TLGJTATC‘AGEGAJ7AAAGCLJGLJALJ T LJGATTTAJJLLJAJACLALJVAAALTHLJCA‘7.. rV mm m I‘V ‘V/‘V7 *r‘ n" LJLGLJTLJJ"In . m Vfir‘J'ILJ'LJIJJ'LJJV- LJJ1111mr—n—nr—w 7’771C7"17'CA71'A71'AGCC'1'GACCA "17'Z"\JGCG3'1'AJ ..

L J k [J EVHLLESGG‘GLVG‘L GGS R 7 SCAASG7'717'7S31771MB?"7R;73 1713KGLEN‘\/7SS7 DEEGRQTY YAi...) 7) A 71 1' 1'1" 7-71 [- 1-"1 SRDNS 7»L1\171' 7-Y Q31}JC_J S D717'A7‘7YY D 1’: J} 10 L3'I‘LVrvssA'0''1 KGE’SVE‘REZJPSSKG 7 SGG7 AALGCZJ 7 'PEP7‘7'17‘V7S7111NS GnEl SG3v711717'EDA7‘V7EQSS’7 YS 1"- U) 7/;A7771, V PSSSEGTQ‘TY 1771\I\Z1\149S1111ND1’K‘7E7KSC‘DI 717117171: 13 13"HERVE"1711312'1'1‘77‘77177‘77\/7D77S11E1‘137‘7'\IK1NWYV7DG E‘Q‘YNS 71YR\,\/777 877137177111Q17J17\:'L1\1GKEYKC‘ 3MLEAR 17EK71'1S {A.KG’AJEREPQ3V7Y7‘7'1JR13SREEMTKNQ"'VS L71 77E773v-17'7'13SD1A7‘VE7 WESN5Q13I7~71311\Y('1‘717'7817‘VEDS12GS17‘717‘ LYSI‘LE717‘IJ’DELS7WQQ3G 1‘77ESC SJ... GQ3VQLQQGGALLARDG" 7777K371SC AJ'LJLJnrwfir‘r r17x1’1LJALJL.G17ETAZ»_1»‘TZ»_L3I_,_I» / m7’ 7’r1r17r fr‘ 11 C r‘ {'1 (:7 r117 «A IT'IA \JLZ‘1'L: 11} ‘L_J LJ-TZ {-14 (w .1: rw .2»; JED L. T GAC ID. n nL_,_I» ! ACGATAGCGC77GT'I"E7L'17'T7/\C'7‘Gl7'7GCACG7CT7LT'I"27IJTG_7"77CZI_TC27I CTJ :1I»:V":F"; [-5. CI 0 \iH C) C\V L‘ Cl' P" H 1.1AT'CT 1L3JGC27L’7 ACCGTT7L JCACCGGTGJTCG‘ 7GC~T7‘G7’7J7‘GGTGGCG7’-7'7l7GCTTCA TGJCGGATGCCZ»_GZI_T'1 GTT7TG C7AGACTCCGC 77I’7CGG- "CAAYTTATG2JGIL'7G C7 7GAAYAAAGTT7LCC27IJ'I"C71‘CC '1'GT7&7 J GCAG’XI"'7"CGIT2«GCTATATGAATTCGTATCA JL'ILJ‘LDI7 «A» («map I-~\ 7‘LDLJILJLJIJ'LJI DLJL‘LIX- ITKI’Y1ITK’IA\' 7(77777I’XC'7 Z‘EEC/7‘131.L J'. TIT DA 2 \JL1LJ G Jr1r~r~1 OCT;\LJ"I-— um uTxmuTxm /~1 rm .r‘(1.17 DL‘LT T7T_I_.J'. J. " .._, 'IJLJ AGCCT LJ'7ATTAGCGC TCGAA '2 - 77'7"C’7.2»_GCA7/\_CCT2L7«.T’I‘27I’I‘TG ’1‘C’7C'7"l7'ICCTT TCG"-7 . 2.27 CTCGI»_27IY2L7«_T'T27IYATCCT EITQLI'ITCSPSSLQAI375]7DRV7IIIL, ASQ 7.QE777DEIYYCQQIWAI‘TLE".

NEYI7RE_7YII‘VIJWK’77DN ADYI;K1<""ACLVTHQCLSSC‘145E GQGGGGSGSCGCSCGCGSGGCQVQLQQS CAEELJA.RPGTI SVKT‘ITS I77KASCY17777'1'RY[M C)’..[..E'.7u7[7—.Y]'\7 .EIRGY J2I7YPITCJ.LJ853]J"17‘7 :IIIIEJ‘A‘IFYYLAELYVF] [ rrV' 1DIT erQ; flown/Ll, 1. LHIILDY WLJ'Q. LJ.I. J'_J'.JJ'_ VLJIJG‘J ’HJL)‘JL_T‘J\JS (1rv f‘L‘f\l IVT 11-1,) TQJLC C H GGGGLIM TJJ I C .JLJz-ILJLJLJV"LL.IVHHIJY. g)LL,AVLLmc4LTILL}.L1. 7\:L{7I\L.'\‘A77'777D'7178K1ASC—7. \7"'L7_‘I' 11le- n «n «m'JCJ‘LJLJ‘LJT =. Y LUCA" \ITEm Iv V \r 1': {1'1"vaer VrVr'TvT'GSG.=.~.\.J.JILIJ.

I.’T.r.J. 1. T NC' : 27. 4 4' ) CdeantimLUwax" lltiS : Light CE«a.in AAIJHLJL JA‘LJTLJr14. er rxr-1 1hl I \ V ('1LC AIL:‘1 r1 , L,'L5L5 \V- A‘C-ACT'CCL5ATCACT1CGCGC5GC-AGTC5AC5AGC5A1TAC5’,AGC ATTT AATCL5T7‘T 7 -GC AGAAA7‘ ACGAGGGAAA 5CCGCTAAGG' GCTG5-TC5'TAT 5L,C5GCATGCA 5TTTGC5'AAAC5TC5GC5GT -ACA5GTTCA5TC5GCAC G'GATCTG5CC5ACAL5ATTTC CTCTCACC5ATCAC5C57‘C5TC 'C.

’GAACL'7' CAAGL5-TTTTGCAL,TTALTACTGTL5AAL5'AGA‘C5'5TTL5TL5GL5‘.5C5'CTCC5'C5TTATTCG GCCAAH5GACC5'AAGGTC5L5A57AATC-AAACGTACGGTGGG' GC-AVCATCTGTCTTCATTTTCGC GCGATCTGAT 5A A5TTC7‘AAT5TGGAAC5'TGCCTCT‘C5T'L 'GTGCCTGCTGAAT7‘AL,TTCLi) TATCGCAGAGAGGCV'AAAGTAGAG' L5AGC5TC5CAT7‘7GCGCG' CCAATCGGGTAAC 'CGC ‘77. L5‘z'-\_L5‘ AL5AGAKJ'5A73KJA\V-A‘-.L5A57AGL3ACAGL5.5L5L57T2AL5z-‘L5V 5iL-, m—L A1 «mm—r5", . fir": firmrwn—L A . A55 A55 «7‘ Arum—pf Imp LJ 5AL5'L5L57CF. 'C57 m'55- \V- I—Lp 1-‘11‘1L57A51AL3L.ALUAL5TA'L5'3AL3AAAL55A . mfi‘nm.,7/‘er «AAA—L L57A57AA,- .5-5 mmmmIA/A "~an mm A Imp.

L3'L5 7571—:.\/7—'.1{TA.7\/\.5-7‘\/\/ .1573L1AL3UACL.CATL5_LJ'LJL5‘\V "lGAGCTC"C""CT"’CA/Z 771L3~55.~r~55 ‘3"... ~ Llanlr‘IlTlf\I/'~< L3\.35"51L3i L3 C; VJ"(-55".

IL3‘-5 L3\.3ITAngry-"WI". 51‘1LJLJLJ‘WT‘F'T‘3‘7L3L3wary-55L?.5'L3.3-r>‘1|.3 555‘C Am.-C3 "55555555557.»2*1-L3‘3'L3772‘71112‘l5iL3AC3(\rwf". v 55 5.55 1» 5. «mm/~55?» 75 "In." '1 .L ". . r»‘1;--r»‘1n 5‘1 ‘CCGII.ccmm TGGAATGG27717'TL5’f"GTTA1ATGAA‘ 7CCGZ‘GC57 7 77717727‘5CA2‘L7577AGAATTC-A5 m5 55555 55;. 1 ~55 A 5155.5".\WITU‘L»L:\7\3‘L/5~5~5» An I\ :2". L3G". -L_5 "77"GAGCTC" 7’TGTGG "7G"G'1 3177271771-TG271777727‘5717’7291’7'7172‘571 TGCC TGGAT‘ '1771’77‘7'7C5L73GTCZ "iGGC‘AGC/77C TCAG5m 5.55 5.5.5L5V55VL555I. 5..." 5 55 . 5.5.5555‘555555 55.55.5555555 5.55.5. L». m. 5 -L5 -G1~V5L5~5L5-.V51LGCLJ‘LGALTGT J-L35L'L3;_'L-5t_5'\32‘1"‘2‘1L3i C5 -GCAA : 1AJlG G77 AL5L5'5L5-T'r‘.r"-*\ 52‘5C5L5'u ~5~m «m f" "r ‘4’ :"‘r" r\~~ A ~1»sy-mr7175L5: 5 LGCl-Al-ATGA1/‘(r17‘r17‘r1r""'\ : G:"LGCG-JLJAGC-rAL-ILJAG C"GAGCL7'CGA ZCGTTGGA-T' T757'727‘757'7G2711’77' 7" (-5 5‘ ."T' Z‘ LJ"'\5L1 1GTG'T‘717’7C’7GC 2-717 TT TCL5 -75T 7G'1'AGCGGTZ»: T7C777C577757:7n\IIKZA{TC_,C7T7GL7AL3{‘th 2‘11 175‘":bi 11A1r ~rL.~ 555 GCA -75TGG'T‘CAAGCAATC "GCT T7 55GC7'7’77'T"GTA’TTGGGAGC/55»CT JGA2AgAfl1-77T291-27‘5717CGT (SEQ _D NO: 245) V‘JQSL'WLJL,/\,’\r w (xv- v---55i.‘-/"JJ:7:1\/‘3:11.J51’.7C\-- 771751177" 5 Vf\r'r\ -. ' '1 J_7\J:SE-‘Lj'c ULJGS GG C1<81-\[\11’173G'7~U])T’7 9.7373)715071.5- RV7T 17 7177 \I ‘ O \7 .-\ IL) ,1. ‘1‘117Q KPGKAPKLL: VAASG 17. "SGVP‘777L17SL5SL5S '7C'13'E7’717175717 [7.73815 2"[V‘7L5 EG"77'1A7‘L :17:7 73:71777PPE7DE ’\G777}/7\57"G.5[ 171‘-171\7"E7‘ 7YE7EL13255V<7VQ1A17171111175.... 7.73G1‘1Si 77F'1:'E§Q1:ILSK[)E57 ' 77018737717177.717117?<5’_<7.27‘5DV:7V71/7777 ACIEZ‘J'T'HQG 175.777 S 1_'1LS1: LJ'LJLJ'LJLJ' LJ‘-'.ILJ [,—. [mm—Ln [. [.J-—rJ.-— \r'} 7C'Cmr: (3.1.‘-.'"1.’-'L3''32XLJ«mm-r» («n7 fNr.[r".)'r1r1 ‘A'C‘T‘Gn2L1'\.iiL.1L.L.- .A‘L-'L.J'J'L3HL;L‘\.\..‘L3 LIL L.7 1f~ LI.JIL.L.IL. GAGGJ‘.LJL-L3 «.CC"-"‘1"CW‘F‘C'iv‘TmTAG"; GG‘."G2"\.GGAG'I‘GTAG""CC (7..TL.21L.L.2 1L.[‘fiD rL, LA. 7...: "T. L ‘ L3G: (LA-L33 man. ~.rL[J~..- J~'L.C5»‘.1L.11b'L3‘JLZAL.L.L.5LL‘51‘L-MJL-lb-2‘1AGC1‘L... LA} {3.me .JerrL [..~.rL[.J~.L A1' «NJ «7 .J‘. JLJL?» [.‘fir\ JGL.L.

CAAGC‘G.LAGGAAT/GGAALJ-J-GLJAGnALJAAZ-GTTGACL,CL,AAATGTTG 'GAGAA AACTCACAGA GC"1GG'I‘GAA ‘ '17 {3111(qu1f‘f:r.r\‘- TTGGGGGC H512L... [..~.rL[..~.rL[.»~. ~71 . 71 731' JL.’.‘L.A.»-L3132»‘I-AL.'L.L.TC5»‘._bA-L1L‘.L.u""5:\-'L.L.'L.L.'i7 J «(WK rL[.J~.rLr ~71 m». m Lm .- «(L L» JarLrarL m '15».L:1b'T ‘L-A‘L-‘A'» L»... 7 - 7 1 «JL3‘.L;".

I."JACCCT‘ GA -‘1L3"I"-‘A2LGTTGZ»AL."" ‘GGTAT‘GTGGAG"GGGTGGA [:r‘[[..._r ‘1"C1 7JL[,.~.r:[rrL[.J~.,..[J»~L.'L.iL.5"1L. GTE- LTb‘-2»‘1‘-L.51L3\J2XLTm». [1'1/‘1.1r'~ 'G'l GAGC" ‘1GGTG‘G'I‘C’ 5-27".GL;‘G T' '1‘ CTATCCGAG"GACATG5GCGTGG.- -‘1T ‘A.’-‘.'»-GGA2-TG «(Law r L».. ".71 'L3‘3'L.51'L3L.'L. 1b51b235.5".L-‘27 I 1CTCCGJKCGGjTP"TT"Il ""1"".-Abc11 Cb15‘5‘.1L.»A ~\ ~1 :r‘1/CrTllTlr-n’It-T'I-2‘1'L3L.(‘7‘ ~r~ TGC'G'WC’\.’1_'13L,'"' 3‘15"..13GG'G' C‘.Z‘L5\L,(ACT? ‘"C"".CAAGGT,L,TL,TL,"‘CT J’ITC’TL‘JGGG GTAAAGL3A13 ‘TGL'‘5‘ AGI G’I'T‘ 2"AG‘T'CTL‘GC‘G’JHLJGU’I'HAK‘ ‘T.JG'[ GC.A.(3G "TIGAG""'G"‘\L3GTG21 "1‘ "'1 AC2—C2-G‘1‘C‘I‘C'.‘5".GC.GA"""""GTL,"T'T ‘17C"CG5‘.G(JC.

LJL,‘ CC-"" 'flGL-C2C"L "m GA‘TGTTAGC.C3AGLT‘ZT‘ACCC ALL2L\\:"LJ2,"C:15‘.JL510j... .,.. .[... .—. ,2er _.L,IC_ AGGL‘M. . ‘3 1L,'L AGU' :CTCA"1A1Gr "].-.-L3L,5-.J_.,L, 1‘ 5",.\.Jb\JLL,2’-".L,-JL1J1 V'J rxr‘rvw" r‘ '.[G(3CATC ‘GAG5‘.L'.‘5".13 "I." GAG'T' GL3CA ""GL3G"‘C"‘G3CALD1\"J\: "TC-’3‘. CT‘CT‘C!‘nC/"TA'1"‘[\1\,‘\/ Emu/"A, "ij..Z\L3CL--1,'L- rLr rL, .1 3‘15"..291G5‘.'T"]."I" T (3CA’\".'["J‘T‘1'"T." C TGTLI"ALGA’V‘.'Z‘{I‘GG’I'AGG :23 {x [r‘if\n1: 1 [r- 2‘LL,L\-', _'L_J1 CT T "] GL3CL3G2-G‘3 G2—1CG5".5‘’3G'.["’~.L...\TL,5‘21C""C"1.‘CGLAC’JGTLLJ‘.‘\L, 2"T2"15‘.""."‘CG'[.L TAA'T .'A’T'ACT5"..T5".i'-‘.1GAAGTTA]"""'[L,L\LJCK"TG’L‘GJL‘LJ -.rL- -.1J. Lm p7,." VLF ,L 3LJ55"L:1L-J_L3 L—L :1 _".L\.:2‘,LL, \J'LJL: L3\.72’"L:'LJLJ'L3J_L3(«,n- r\r' or m ~er x—L Vr‘r (:J<,'L- ,L[, :1.J‘L-Z'LG LL, L_.\J2/"L:.' ‘L‘3T (35".‘3‘15‘Ji'. ::1[/’\[f‘i.'1[r'L,L .LJ 3C2"\GCLL,TL,TG‘17CGAGL ".

TTAGCAC .TATGCCATCJACJ'TCGCTLJCCCLJAGCJCJTCJCA‘TCJCAAG CTGCACTGGCTCTC A‘C. CTATTAC3T GGTAGTCI‘ETI‘GG 'ACCACATACTALJGLJAGACTCCGTCAAC3GGCC,GCJT' C7CC A" C' CCAGAGACAATTCCLAGAA,AC-JL7,‘TG'TATC,'TGTAAATGTAJALJCCTCACAGCCGCG 7/3‘rr1" "1 1m ITI‘7‘ITH'TI r3 f‘ flfirfi‘r ELL/AL}:.1LJCC3-T ETTA; iAIKJTKfTKf\/7~1A‘VAAAAC KvCL mmvmmlm7/‘V.1fl"‘.'A'VJT'VJLJT-‘r mm": m IITI II‘:'IKV"*KV,"‘/‘V"\r3 J. _'. \V-J. i ,JTTTCTCTKJ J'V'ILJ'VL,‘..Z' TCJCC .'"CTGL3TC,'AC,'T.-T’7TCTTCAC (33,/ TD NC): 247/) EVPTLLFSCCGL77Q75CLJSLPLSA.A0SCFT SS7T7ATVTSTPJVT'TQAT5‘GKGLLTTT7SSTDPEGRI‘T'YYA DSVKCRFT T CRP‘JGKNTL17LQT TNSLRAE TAT T YCAKT): GCRSAFDYTIITGQG T LVTVS SAST KGPSVFPRTSSKSTSGGAALGC VT.DYFPET TNSCALTSGVTTTFPAVTL‘SSGLYS7:4 LSSVVTVPSS,LCTQT‘CCNV \TPTKPSTTTTVP CKVEPKSCJKTPTT,‘PPCPAPELTIGGPSVFL 7' 777L‘QYNS''7TYP‘WZ7 7 _ 177..IC777777VD77£77TTTLTTJRL ‘ZLTTQTIT/I1LTV’KLVT \VSTVMTLPAPTLKTTS <2"TKC7’7T7RLPQVYTLPPSTEEMTKN"IVSr LTCL":r\7"-GT7‘T'PSDTZTVSWESNGQPTZNN TILTTT PVLDS LGST7E7LYS1ILL‘T7‘T/77T7JK7S7‘fC1137G TI.77T7‘7SC SVI 7- LS7C- CRT RTIS RLLPLJTZVZYT TKRGGGSTTTST 11/7 vmp’r orgc‘r r71 \v7/\ r W JA3U|JL.-JJ— I7\.~zg’ GGW. "PGRSGAJJS«NW TVV IVY-WV",.AASGS'TT‘ bleLLLVJQJAT71/L\Q17LLJI L, C, L- ‘1 . z".7\.Z\LJ"I .LJ Z3. ‘JJIJCJCAIJ CJ'CGGGAGAA'["IT'C‘CACTCTCA "CAT ‘25 JCZ3IGTC' G _IZ 23G? .‘GCAACT .ACT ‘TCA CZ3.GACCC"3'. 3GCGCC TCC A T T"AT T C G ACCZAG‘J.L\_J\_JZ\3/Cxl\3 C2.Z\Z\CLJJ_2-\JC‘."VI"."IrV rV 7‘ VD‘I'A V’VV JL.L:.CJZ\CJL_J\TCJ1C:ITCJ'V rVrV/V {’V r\ r" V rV1 VrV1 VrV1 Vr CASITC’IT' CCC GCCATCTGATGAC) C)WGTTK7AATLl GKCTCTGT"G'GTGCCTGCTGAATA/CTTG TA 'CCCAGAGAGGCGAAAGTACAG' GGAAGGTGCATA/GCCCC GGGTAAC 'CCC —, mm «A zl-L'Kuzl-L'K: i K:=7m—K—K K.‘ «rm—Km"K.) AKJAGAKJ' ,IA'UKJA‘V-A‘JL/ALAAGLEACAGknfl' /K.TA'K/fi'K:M. :iKAGmm L—Km-r vn—K «7K «mam GCACCK. Kjf-‘M-r—K r—K .m‘r GC 'GANCAAAGKMAGACTACGALTAAACACJAAAGTCTAGGGC 'GCGAAGTCJACCCATC-GGGC1:: GTGAGCTCC$CCCG:CACAAAC.AGCTTCA CAGGGGATAGJTCTCGAGGTGGATCTGGAG CACGJTCTCGGGGAGCCTCAGGTGGTGGGGATCAGGCGGAGGTGAAATTG"GTT G/CACACTJTCCAGGKACVC TTTGTTTCCAGGGGAAAGGLCCACCCTGTGGTGCCG GCCAG' CAG GTGTTAGGAGGAHCTACTTLJCCTGGTZCCAGCAJAAAJCTC; CCAGGC 'C TGAHGCTCL JATGTATGKTCCATGCACAJGGCCATTGGCATG'CAGA CTTCAG CG GTCLGGGACAGACTTCAC' CTC CCALJAGC-GAC'CGAGCTGAACATTT 'GCA (3:1; "TXTTZKKJmm »1|Tx'1arc[\I'Vl"SHIPCCTCAnAfflr‘mlljvkcliTTC K.

AAA Linkhc7* 7 1 1- ~\ :r1ITxr1/1 1r~* («r1f-Kr1parx7 r1r~. 1 r'11 *n /\r}1lTl'1/Vr}17‘ r17> r1r\r‘.’*\ ["1" Annwm x11 ‘1 17 (-K. 1.

-K..KJ 'L/G_I\3L)I\Jl K.\JACCA iAL; .L TL, - LATA;-T\JTLL1.LA LALJA LGA’A'K.l TA TC m.K.'lK.[Ar -K.K..~rKr .lr1.‘~-.r1r.rx7XKJVK, \er ~r~ 7 er11’1} TCCGCCA‘GC . ’1."C":" L TGGGTGECZGGTTTA7T‘GTAGTGGTGGTAG AGATA"? ETGAGGATG'CCAGAGACPA'TGCALGAAC ACKJCTUTALCLKJLtTnpnrvKr-mrv VA," A 7 HA» 7", m ,- K ~rK 1". leZ;.r»‘LI-.rX\.-:K.K.KIA/Kr 123G}-KJL,K.CJAGK.AK.’AK.-K.K.C"('1’er "7 ~ij vmmm»' \KLALTAArw-Krw-Knl.~»1.l'Ksl'Kst-K.-u‘1. } ":x'7‘ - lmmemmnAmAnm»mKKCTCCC LTA LG.TACT 'CGAT'CLCL GGGG CG' GGCACCCu' G-LCAW~K ~H~HALALAKA1AAAK~AK KC€21GTKTGTT AJCTAGC (SEQ ID NO: 251) QGQSGCCQTWLVGGDCRGVGGGSSGGSGGSGGLS‘TSDNHGGCSUTQNT’QDSS’ACT" SR‘GGSGGCTLLTLTT"O QCETFATTYCQQTVV KAPSVTTTPPG)QAKG‘TAQ\TCLLNNF YFREAKVQNTV‘VAQSGJQVC‘TGQUG‘ST'STCOTLTLKNA YERflK/YAGLVTHGG {GECG 1GSGC~GK1311311GGCL3 1L3C :‘GLSGE [V]JIQS P "I: AGQSVSSSYTAWVCHKPGLAFLL]]{G"GA‘AT GTPCTGT vyycegvacs ['LS-WETK‘vTfl [KEKSG fi_Ty-< V‘A.{][ ifi",7 K/- V’J KVQ'L CA/fgrxhw TK m" Kr ,A,T FUCK: L OT. L‘K. JK) \,£.1.\E.1E 1o r; o r\7\ L 5IT] ‘0'""" 3K); vD\vVGP[ [[{LV KCLRAFETTA/"1YCA'MKS)]YMMV}[AW[\G'I‘L‘K’ T‘K’SSAS 'SEQ ID NO: 2 r2) ccqtt"aCcanqtqct’ CQaaCancthaaajccz’""":.. 5::{CQCQCOJCjaCCtafLJ,.'k.

,...:Qattatgaattttc QQQQCCaQQQcaccct’C C+M131 '21 1 x \ aSCQQCCcatCQC‘CL+CCCC,QQCaCCctcctccaagagsasctctQQfi*j.4 l‘l;}/‘1;} / , / ' g.1 C C« CCCQQQCLJCCCQQCSEa’QACtQCtLCCCCC'dCCQQtLaCQtQtCCCCngctCC' CQCthCCCosctqiCCCCC;qtcctcaQQaCCctacth ctCaQCCocgtgjtcy CCQ dvctCt’Caé CQaatcacddOCdCaGCaJCfilvaquLQacaao~32Qtt(aQCC:add*cth Qacaa aaCtC1CdcaLCCCCaCCQ CCCCQQ{QQ*aCCQthQCCthc-c CttsCCCiddddCdaQQa CLCQtQACCCCCQQQCCCCtgantC'C3+(C(+QQ tggtggacgtgagccacaQaCCCLgxgjtcaagttcaactggtacgtgc taatgccaagacaaaQCCQCnggagQanaQtacaacanacrt agCQLCCLCaC. CaCCQQQaC1chtgaathccQanLucua.J "‘1"d3C3daCECCCTC' J ("C‘CCCCLLCL/dbdau3 WictccaaaczCCJCLJHOQCJQCC‘CCCg(‘1 ( Q ggcaqccgzajaacaactacgaQaCacgcctcccatcctggactccgacagctccttctt Qttaatga (SEW ID NJ; 253) QVQLKOSGPbg/CQQQ"ilAl/SCQTNYC‘H‘V’RQS‘GKGLEWLPVIWSTGNT rmXIT\i PEN-[I CC)"UWJQLWA1VUR7©7EKXhEL" T‘.\.' LCSQIEFlvCFRF[[Y{‘VFTFVMCCGT["T"SFA31 EFVVELF gcxcwcn: AALCCLWwaLJLJfiTVSVN LISGVHTFPFVLQESCLX LFSVVTVPSSS 3TQTY[CNVNHK‘RVPVVFVR73P""D’TP TOVT‘L "1J[EQ}WTL\¥"[CVFJ\LJFSE{EIIP"H/V[‘QFW"JP" FYRV VJTVL4Q1WLE8L3" ""PFLPFPIERW ;7'T‘QPREPCVXIHPPuRLCLIKNKIQ IIV‘LVKFFVPS[ O 3:11 \JJ. 1. . 1‘- 712134 n]\l 1.3.3C VWHVF'T T.=;y 13§ 3 (SEQ ID NC: 2r4) £3, Antibody: Light Chain CF3.3~‘L"["'. ’1'L3CT12-3C"CF3CCCC‘CGCT GF".".T‘C'Z‘ 12-39; cI'TCF3(3CCCL3 ijCL5,Z\I3CI3'I‘C' GFJG'C ]_' TWFFG(_ (ECCHC'TT3C""VFxnjF .TEGCFCCZ3C[FCF[T%C' TCFGCZ‘CCC3CCFA CGGCFGCCC C' CF1"[F3FJ‘3TFTCI3C"CI3/3""‘F]""[‘3L3(,L3‘"Z"(Am '1‘ Cf:73f:f"/"{" r‘. .L J \J!x\JL\/\J\/ TTTAGCGCATAGCGG ACTGGCACGGALTiTACCCTGAGGATTAACAGCGTGGAA/GCGAAG TATTHGAGATTATTATTGGCAGGAGAACAAGAACTGCTCGAGCCCiTTJGCJGCGGGCAC 'CJAAA'CJm 7\"\. 'C’J‘GTTACJLG."AAALJ' 3T‘ "m ‘7‘ fi.,7/‘V"‘rfiALJ'C’J‘C'J'T‘J'C’J‘CiGUACCLu p.r"* F"! " [:3 TCTGTCTTGAT.TTCC CATCTGA' "f/ r‘r‘vn .rr! A Amr‘mr‘r‘n/ Immfimr‘mr‘ v'x T‘r‘V mm vm‘flm/‘Vflx/‘V7fl‘rrfi G GC-G G 'C' 'AAJrm ij‘f'M pmGCG VibiiUiUiUCvavTHAfiAAACTTCTATCCCA,AG ALGCGAAAGTAAGTGGA/LTGGATAACGCJCTCCAATCGGG' AACTCJCCJAGGALTAG' C;T (1 «nan—CCA'\Jrl\JL".M;' ' ACAC) m CHAD 7km"J'A'CJA'CJ‘CACC iTAk.AL’JCCJLmmfiv "ml-\fir‘v m m—‘xJALJ'LJAT'CJACJCKJiGnan/1 mm CL’JCAKJAKJ JAAAyn vlrv‘lmvr": -»—\ GCAGACTACGAJAAACATAAAC; GTACCJCCTGCGAAA1:: AT TGAGC'CGC GCGTGAGAAAGAGCTTCAA"/GGG~_GAJTGT ( (’1') ’fi J—\ ~ ' A: '7:5J D f. 3:LLTOGPVTLSVSPGERVSFSCRASQSTGTNT1WiQCRTUGSPR‘LTKTASES SG BSA -4 E; [7.3 U) [1 t3? H fr; t‘" r—C w; (3 IO IO 23 ’qNTTT CQLRSGTAS‘VWCLLNNEYI‘REAB"Chi" ADYEKHKV"ACE7TPQGLSSC‘14 4" CLZJVS Antibody: Heavy Chain ca ngcaGC1oaaa cctgcaccgtgagcg gggcaa: quqLGatCT tcTttatgaatttcfloCaCqung-ngzcaccctgctcchgtgagcgcgactaccacc aangcccatcgqcccttPTPCngcaCCCCCtccaagagCTcctctggngcacagch F) O D rT .0 LC.) .0 O (—r LO (. Q (-+ Q a O Q) .13 ‘Q Li} Q1 0 (-r £1) 0 r1" r?‘ O C:- Q (‘1 CO [‘11 9) C1 0 ‘Q r+ LQ in 0 LC.) Q rr Q rr (. LO (-+ QE B r+ 0LJL LC.) cgccctgaccagc‘ngrgCQCJCPLLCCggctgtCCC1C3gtCthaggaCCC11CtCC gCgggtGBCCU'UCCCCcagcagcttgggcacccagaCctaCthtgcaacg tgaatcacaagcCcigcaacaccaaggtggCCCigCgcgttgagCcCaaatcttgtgacaa aactcacaCa:occcaccCtgcccagcacCthiCtCCtggggggaC0;:CCchthctC ttccccccaaaacccaaggacaccc:cathtctcchgaccccTgagg-cacanchgg tggtggacg:ga.gccacgaaCaccc"gagchaagCCcaachgTanngacggcgtgga ggtgcataa:gccaagacaaagccgcgggaggCgcigtacaacagcacq-iccoCgtggtc agcgtcctcaccgtcctgcaccaggactggctgiCtggcaaggagtacaagtgcaaggtct ccaacaaaCCCctcCcagcccccatcgagaCiCCcitctccaaagcaaaqoqc:\ccc.g agaaccacaggtgticaccctgcccccatCTcoggitgaactgaCcaagaiccaggtcagc CtgaccthctggtcaGagLc_tctatCccagcgacatcgccgtqgagtgggigagcaatg ggcagccggagdacaeCCacgagCCchctCCC5C1‘ggaC1CCdCqutcctCC;t CC1CtacagaauctcaCCQ+LgCClOdOCfi9_iJQCEQCwggjgawHcgtcttctsat gC tCC(t(atJCiCOdUGCtCigLJLJACcaCLacanca:a9agtCLCLCCdfofctCC' ’tCaC (DEQ ID NO: 257) QVQLKCSGFJLV CSQSLJFTCTVSGFSTTJYGVHWVRQS"GIGLEVTjViWSuCNT"YKT iFTSRLSlFE.DNSKSQ\FF MNSLCSH TALYYSARALTYYYFFAVJSQGTTIVT/SA KGFSVFFTAFSSCSTSSCAALGCLVE< LVSWNSCA'SCNVHT FAWCJSSG Y’S LSSVVTVFSSSLGTQTVZCNV{HKFSHTLVDCKVEFKSCJKTLTFFCFAFELTGGFSVFL FFEIIJC)‘u(:\‘V'JT'" SJYSLSST[[.L‘h|\7\-.- \‘ ‘1 Au LAM M/{ZV1'\\' 1'1V\ /v-x IO-v N".\, 400)"fr AnL'——EGER C"25v4 AnLiboLy: CJLngLdLCtgaaQCLQC_CLgcccgjgCLO:LadagC:(a(CsagagCCL;;’cade CC-9LJLCOLO&0QCCLLLCL ,qudesLangcgtgsaLiCQCLQCJCCCQqCCC gggc:LgJC2ngaatggCngjIIOdLCtCUdGCQCng’idCdpdeCldIEQCM,L acct;LACcaOC¢;¢C+gagcattaacaaajr"r '.§ ""’1".*jJL;LLLLLL3aLa 'acagcctocaéwoviacgataC30CQaLs" gdcctade LgattatgaatLLJCCLELLgngCLdooocaCCCL’foastqtgagchTfictayca5: aSCQIPLCdICJ_CCt+CCCL,qudLCCLCCLCCaC’agsaJCLCLFOfiCfiCJC;cg; CC:LgggC: ,LCLCCchaggLLLJLLLCLLCC'dccggtq:gototgwiudCCLCCL ‘"aCCtLLCLCQCLCVCCLCLJqLLC,CaouquCLaCLCC\ 'gggcacwcaqaLc1avaT4LgCa3cg agaaag gachLaaaT4LLngaCaa C 4LC<3Lg gngaCCGL'agCCLtCCtC Ltccccccaaaaccca:gjaCaCCCLCuLaLCLCCCCgacccctgaggtcacathgtgg nggaCGLGaJCSaCQalgtCCCLgagchaagLLCaachgtacgtggacgccccha aatqccaaa agegLCCLLaC4-:LCCLgCaCcaggictgjCLgaangcaaggagtacaag "CaacaaaacchcagCCCccatcgagaaaaC4aLCLCcaaachaaauogcagCCCcr aQQJCCaCLgzLuLacaCCCchccccatcccgagaLg GaaCagtcaqc CLQJCCLCLC1ogL2aaag ggcagccggazQ) <3C' aCCJC‘SdgdC‘.J "CLCtacaGCuagCT CtC\ t LGTLC QV’L"SGP%LVSTFLSITCTVSGFSLTIVCKW’R""PCKCLENLG"IW16—N'TI)YNT #VISRQSINdeuhSQVFI{MNSLQSNIIAIVCAM[[Y{‘VFTAVMP©GTLVT""AASI KGPSVFPTC 8K0O r31 0 ,nr‘.x) \J\3 I‘S\] I’TVPSSSI‘."'"‘L2'""I IC,NVNI]KPSI\£""‘ : M67) CILLTQSPVELSVSPGES[¥SESCLLSC ’YTQIPRCSP;LLEKVFOFO]SC[PSR L){CJJQ\'W\hVPE ECKC1fiLELLL_ EQLKSGTAvamTLNWEYD EAEVQWKVKAZQSGNOESVTECDSKDSLYSLSSTLTLSK ADYEKHKVYAC:3VTHQG "TWIKSEIRGEC (SEC I 3 x 4‘0 RV rm (x [caaggccagtctggccag][tg CCCCgtgg+tgtccggacaocccatantca tgtacgqctcgagcq"t":cagcggtggctct"gtgflatgcggt [at a c cc ttcc gataatcat] agchgaoCCgjgcgaaC’tjtgagLLtLdudtqq,ggcgagCCQOdoqathinsca acattcatLoqLdtvdgCMgcgcga‘ddCOCVC‘cchgCCLgCtOstudu; cattCCgagccgct:tagcg"(tangggcagccmgCaccgattttacc ctgagcattaacagcgtggaatgcraa:atattgcggatattaftq auca atctgtcttca"v"‘, ,g, "'" -""C 3" ~_~' '"4-'.‘gcctctgttgtm tgcctgctgaa"' «"",' gataaCQCCC thaatcmgjgtaaCtCCcaggtgartgtcacagag jgucaqcaaqbacagsachaCag gCCtgc ID NC): 77)] [Linker Q ~ U) W.4 a.2 ID NO: 1204 Substrate (SEQ ID NO: 26)}[Linker 2 (SEQ ID NO: 289)][C225V5 (SEQ ID NO: 256)] [QGQSGQ] [CI ‘3¢‘\K3C"‘=>CPYV 'Y "GGGGeo’CSG][LSGRSENH"GSSGT][‘IH LTQSP\IAOVSBGLPVSFSCRRUWS GIJIHWYQQRTNGSPBLLIRYASESISTIPSRFSG SGSGI‘DFTLSINSVESEDIADiXCFQN\\IBHIFGLCIKLwL<"mVAAP~VFIPEPSDEQL KSG ’S‘v‘M‘iJLN‘MIBRLAKV’W. "I;{286QCLME’UWLW‘YS'semi?[4 P‘s IT‘- U) 'C*4 FK%AVYALEVTGLSSPVIKOIR{ (SEQ ID NO: 270, CALAGCGGCCCTLTGCCTGCTG -GCCGACCCAAGAGCC.TGAGCATTA Irv—1T.n—Lr—L —. n .. «mt. LTA ATALTTATGLTLAT' iCJLTCJTGCLJCL.A.L3/LTL.LT-"5.11.15. «n—L. «(L m n ,1. In «mam LTL. T3T'17L/Ll‘l7L/CL3TLJAGCGLKT‘TTTAL’T‘L L3'L3L3\.-AAACJL3CLTTGL’JAATL’TLJLT L3\.:IL3\-.L3iL31 TLJGAGLTLJLTLTLTGLTATCATCCT -JATi TLA AALT,firv 33rI3 "\ 3 '3I "HT! n71 . "KW" m I Tmmn " 33h '11 3n run—13A 2’": / -\-LT-11r- GCGTTTACCAGCCCCTGALTLALTTAACAT ALJAC CCATGGTGTTTTTTAAAA m—r—‘wj—L'LT‘ALI‘lLTLI‘lL’T‘CLTiLJL"AHHLJ'LTLT _LT''L.1:71:21?12:713..7LT-JL: -JAT iAxmfixmm mfi/‘V rLI—L mrI—‘m-flmm7 J. 1:54.11 TLA LT -JLT -JLT -JCTGALTLT ATTA.

TGTATATCJATATTTGGTATTGGGGGCALTCJCACCCT :G’ 'GACCGTGAGLT -JC GGC.TAGML-CC 1L3\-.LTCATTLTL3GTCLTLTLTLTLTLT-, «n—Lfl—L anC. .15..II.,—LT—1,—LT-1—L —L n ,1.

L3\.:ILT«m—L LC T'I CLam mmm / -L3\.-- ‘-L-LT'iLTliL3CJGL3GLTALT .L’T'LTL’T";I«(L flap-V1.11». 5—31: II—LT—L—Ln TL LCAAL’) LT'LTLTInn—L. L3‘.1L3C1CJLT.vTLJCiLTA/LTUA‘«n—L m Axmmfi "Iv—17 1m .311"me m 1.11 T11 -LTii L-TL. LTL3AALTLTLTL3 LTALTKT1L3=L3ILT-JTLJC*1ATTLTAFL3H:1,11me ~17x1v1~xm TLTL51TL51.»1.~1 111 ,1"er1 7r rerL 1 1rLr ,11CCL. GGLT111/ LTLn1TLmTLT1.».TL.I-TA-'7L.22‘1'L31L.Ci-\I.-~.1 11,1" 'L.I3'L.LT'L. 'L3ACTCA"‘TL3L-L3L3L. I3'L.ACLL1LTL. 171A‘TGGALTGTAL.L 17 «mm-1» ".151" 'L.L.

ICr‘ZX :IA:CCILUGLLJIALTm r 17 (1 LL13. 1n 'L.IAG77C" 1/‘1n1l'rl1/"(r‘r‘4.'..LLJ'LJ'J'L. 2/:3.L.LTL.LL1L.)ACCTA[1LT.—1-.r1I..~\ 1r13 {'17 1r-Lr171J.L.-1L3I_T.r3‘T./3-' "3C" 7T7'7AJ-AA7AAAG'1'"-"72 AAL. 1L.AL.AL.[ 1 GE-m - .‘.-AI-'L.I3.L 3L.L.L.2‘1L.C‘TCL.1GA2»‘T-L.L.TI-- 7 TLTLTL.~TL5~.TL5~.1 Ln L~1m L7 Lr1.».TL.~r GL3 \. 1.... Giza-(Jam (1411. .Z 1 511 r3 r .rL \U T1L.LTL.LTL.C 2‘.AL-.. I..r1I..rLI.. 11m 1 m 7 17’-{L_/[A.L/’_IL3'IJI’\(27-A1L.L.L.1C2‘TiL.:L3:(«(17 fNIr‘thr 11m 711;»17 mmmmamrwx».‘L-'L.I1'L3./:37L.LTL.L.1 323GI"f\|"‘f\ m » 1,1113 151(151. ' i CAL-A2Ir17 L3I- L3 - l GGAC G"12'GAGCCZ CG2»-ACACCCT‘ G23. 7G7'T'CAA 7G -72"I.GJA rwlTl’1/‘1.'|I"< f1 1 1-. D. "f [KCI1 1r1 If 7‘\r;‘ . -.1. L:)‘-.T£’1‘-L.T\.L1'L.)\..'.I‘ :IGCI L.I_:.ALL1'LT » 1,-1.1»2L1.AA1'C1 »1 1~TLn1TL»TL»I L: -;-L3I.:L.«7\.\TAT\.L.I1r 5 51." -1 - 7 ..I. Ii‘T 32’ 1» TL», 151/LT} L»L.1Ir.L.I.nTL TLT1TL.1 L.L.L.LTL.CAT_ H.L3L3L3ATTI321TZ~rL5~.rLI.-~. 111 151». "1.11 r:r17‘* AGAA . CJLJ'GJ. ’-LI- 'L. ’7'1 GACC" -CCTGGTC7 ’ GL;C T‘ TL.’7' TATCCCAGCGACATGGCCGTGGA 7TGGGAG2»-GCA2Z-TG L3I3'L.2‘1L3LTL. IL3AG:7A1LTL5L1 ,LITL. L».1 L Xer Ljfljm‘m'ml-‘ITKWT l1 CC"L. AZ1L.AGL 1GL.1..L. , LTL GGTGGIL "T. L, L323}AL.1* 3\ :IrEwrcrEwlTlIrv-T'II-.r»‘Tr37" f‘ "12'GC2"I.'T"GAGGC'T"C'T"GI'L.AC -ACCACTAL7 ccrncrn1I~CIrE1r:-.1512.1Ir11r1I1-r11L; 'L. .L.)‘I G".]AAAG121AG 7TI'GG}.3"1.'C".'C7 "72’3 "7" J_.LT‘AG(.CLI\333I\_wA\LJCj1/J_1zl- r12: «mm 1- n 3L3/TL3'L Vr71r‘t'1r3r1r3-r1r31ml" J'C,3.- .,-1_r- .rL 2’3'7177AZ‘111GIC77G277\L:G""C 1G2"1"7AL C'T GC‘AGC2—G.2-117 £2.7GG'. "GCA ’2: "mega0:3 3C,"Ir‘ ,v’\|' .r1Ir3- l33J\.\J. \J\_ A\ 7'1 f1 If" r1.- .[ .UJ\_ .[7'"]2'A.AA.Z\'.2 G21 AICTG'TAAAGLA.A'LL1CL3G'" '22"A'22".1C TT'T"A’7"7 ’7"37331213}? CI.2.7Z3"7'GC}‘.1"[G(:IG ['1"\.12AGL237""C27GI TWA" hrbmflaamgGq‘3C"ICC [A’77C2..Z‘LC77"1'2IL, i2.7C251GA.Z3.A'2["'.'(77AZ‘LAAZ‘11.Z\'."Z\2—I.Z3GCA .3T.I2.7C’C'2 "GACCAC3CG\mA’X}AGCAGC IC AC(TGIC'C'2[7'A'T'A'T' 75.72357 C".'C..21.C.CA’7’77’7'LG 7C23' Z3GZ3I27’ TAGCGCT 7"'""'."7\"" "A 7"CI'V7CA’7 CC 'T' .Z‘.'2.[ ].'A."12'L2:7.Z\'." 4A2 .3C'2["A.'2 "FL.I’2 - G23\..L3n er1 rV1I .I. .5. SGGGTCA "EGG ’7L,23.CC23AC23CIi2.7 :ACC’G'T"?AG (EL/L--r1Ir3- 7'2[7'GL2:7"12'L2:7G"7.'GI.3'22.2 r3Ir1r3 er r.1 ' TG .G . LL..L,L:G"'GL2:'22 AGGCGCT’1G’77’7G'IJA GC23C2-1G2-1'22 2["C'27'G 2’3TCC77’7 ’\G"'L,23GI’2C7AZ3L"]."2["A.['"GAG\ 2 f‘ \-z_\\ G‘J11 (—1 —1 Vr‘if‘ —1. - '1 T 11:12- 1 3...'L:: AA.A.JL\1'L_. 5.C.'L.3.1./2'1L3'L_3L.1—1 ,-LIT--rL L.LT.A.L3f‘t TL - r Z‘.(:C2-IGC 4""'22"251GL,7'2["A'2["A'2 7GA..Z‘T'2.[7'"12'L2:7G'."Z3 1 ‘1'" V"'I‘A,’\'l‘ 2-1 1I.- A."L:G.23,7\L3L, 71I2JCCGA123.ALL3. nr—Ir—Ifim fi'xrvfifl‘rfl mr‘i JLJiLJi LJLJLJLJLJ.JJiiiTC-GTGG TALJLJLJLJ. rvm :JJJZAJJGG'T‘ 'T‘ / nmnnpnflJZ‘JLJLJL‘TJLJL‘TJJJGJJLmtCi ACJ,'dACCTATT AT 'GTI..AGTACTG3TCAAC~CAATCCCTTTAC.JTTT JCJTACT'GCCACC ACTGGAJ—TATTAA 'CC (SEQ, TD NC: 27:.) "-TZQLKCS JT‘CLTZQPSQSL ’7"CTT/SC STTJJYGV IWTZRQSPGIGLET 7T J'T’T'ZZSCCNTPYLT 'J FTSRLS TELDNSKSQTJFFKIVINQLQSQ KCPSTZFPTIESS LCJTCJCZ AALGCLT/K YFPEPVJVSWN ACLTVGTZPJT PA‘ TQ‘SSCL LJSTZT’ZTT/ZPSSSLGTQT‘ZZZCNTZ SJITI VD CKVEPKSCDKTE TCPT‘CAPSTJTCCPSTZFL FP . LTJ TJJMJ :JRTPt":TJTJJJ/, TJ I/DI/Ip'3. EDPJJV. Jr‘ 7 f"\"/‘ 7\‘ \‘ (If TNT -LFJ,Jx Jer~V~JrV7~Jfi TT 1 1— J,/JJ'L»JTJ LT«:1‘J..J 23 LJ4 TYRT/V SZ7LTT/L'IQLJTZIJ’LNCKEYKC ZTLPAP TEI.TI SKZJKC’H‘REPCV I'TLPPSRDELT ‘NQVS LT CLT/IJ4’I'-T‘YPSDTAZ‘ZEWESNCQ JDJT\7YIT’I‘TL I‘TZLDS JCS-FLYSITLTTZDKSZTZ7QQTCNT’ESC "Q rSAELZT. PC:Z" SZ’KE’JSCKASCMT‘Z7TT TT ZTJ‘ GCCG’A ZTTT-CCZZTCCAZJ".TTCZTT TL. ~. r 1 Cl’rerrwrzr‘T .me 7 «Hum ~~mpn ,VJIA» ’1 «n ~~J~Hnm~mn7 "an?" LJ3L3LJJTIJ'ILJCJCCCLL3_,L.J.mr~.~r~f r~;- -I_,TJJw.r»‘Jl TZJJTZJTZJTGL, 7» A," firm u". -L,L3Z\..r»‘J;JL3I_,.rTl A. 'C 'LJ ZJJ JL, .JJJTHLJIJGL, C TCAGC’C7 ,an/x- \JLK/fllr; ‘4‘: Vf’fifolfo’fi'fka’1 ’IK/LJ’ITJ'LZ'Jk/l'.

TAACC17’TC(:C.’7’:C,TCZ CCZTT3T G'T'CT’Z] ‘1‘er,L rT7I1ZTZICC‘Z7G‘Z7CATP/CI GZ—TZII «SAC WGAJJWCWGCAJ'7206_:TGTWGWGWG"P"""AATALTTJTZTCCCMCZG MCGCCAAAGTACemechsczthJTprC"CmC"x TWTZLCZI‘GAGT' nxnCJICCZCZ‘JI3CAJIJJCAIACCAC,‘777".Z 7Z3G"CTCA’Z"7ACCZACZCC3’I'L3ACG'"ZC‘CZICCAZT CC’TC’TC'TACZCJICITACACAAA‘ Z,’\(,L3(,(3'Z7IZ‘CI.‘TZTC 17’7ZJCZCICZZT'Z7CJICL3 7Z7CTCA’ZC' 'CCC "ACAAACZIC" I:CAQMI""GTCJZFVITGCAT I (SGZTCCJ’I'I: 1C JCT "1.7CZJ.(:IG ALJGL, TL, .‘TTJ'c."Z("II‘I‘H’Af‘f".1f";’\l‘.f:rnwaZTJ‘.Am {n V {nG‘J/JTJJC'\ 7‘ \_AL\\'\J\..V ,- rxrpn-I- r71 w 5,"er .LJTJ. J. \LJL,.GL, .‘TTJLZ D3x"\/ CGT— .ACTG‘3C2—CG'Z CCG("\J.IIZG'CZIZ\Z‘CII ‘TAZ 7C.2 .’Z:IC' CTAZ‘.‘\LJ(,’T}"CGC. fCC T'Z7'I‘ZT'I‘ITCC’A ZCCA'T'TCi: IZTACZMGL‘I’ZI 7CC(:C’:JZIZ,ZTL3CL3’I'CTCZJZT, ZCGA’I' TT-JLJTTATATCTAAT-CCJGKGCLTCTs-JT-TTATACAATJTA'TA7‘CCALTAAT TTCJAAAGATA‘K-A‘CJCA ACCC 'GACCJACJCJATAAA/LJTJAGCACCTTCCJCJJCTATATGCACCTGAGCAGTCJCTGAC.C 'CAG AC-JCATAC GCAGTTTTATTALT' ’C'T'GCA JTATTAT JA'L'TATC-TCT TTC'CCJTCLJATTT' GCJC' CA'GTJLJCATCCJACJCCTC-JACCGTTAGCJCACCCJTCJCTT-JLTTGJTAGTCJGTGGC GCJ' GC-JTTCA LJ'T-JLJ«TJLJTLJTJLJTJLJTATLJCJCAATGTTTGATCCJC.ALLJA JTLTCGC-JCAATTATGATGCJCJCJAAG' man—L, v-L a AJm-nfi .. r1 mnmnl. . 2 ,fi.."‘3\3r3\3r "Irv-1131 "313‘ 7 #1231. "3 {3131- AAA 3i TALJLJATLJALJ'LJ7 'L3TA\T3LJ -JLJCTTL’JCAGLJCTA3JLJTTN'LJ‘LTA AT GAAT TL3L3 AI v 1313‘ 7\"‘F‘FT1 1-71 1-71 I nmmpfi. 7. "\7\ L3 'LJA "TCACA’_AAGCGCJCJAJCATCLTCCAAACGTT-GGATTTA T-JATACCALJCATAATCTJGCAAC-TT-JCJ'GTTL] TCCGGCACATTTTCC TAGCCJCTTTGCJCJGCACCJTL7" ATTGLJCTGATCCJAATTLTTJLTT-TA TCGAACCCAJAACATGCAGCAACCTATTTTTT TJA‘C-J TCJ LTTCAA ACJATTCJCGTTTALTCTT TGGTACTGGCATCJAA-AKTTT-JLTAAATTAATCL (SEQ TC- \iO: 277273) "JT.73LTOSRV'TLS7LSELJLRVCTCRASQSTGCN HW‘T’QQRTNGSPI‘LLLTATAS7‘3TSCTPGI".

TSGSGSGTDT'T77? JC INS 7ESE'D TATYYCQQNA\IN'LETT CCACTT’TLELT’I‘LT‘VAAL S\.2'T7’TT7’L‘ T‘SD 7*7'Q.73'.7\’\‘1(‘.T£0"JCLLNNEYCRE’L‘LLJLLADN 1Q-LSGN CES‘L‘TECDSADSTYSLSSTLTLST’T ZJ1LYL7JK7T1<7r7721LL‘v7'T'11QCJ.J' 3SSI‘Vl4517'"ERCECG‘GTGGCGSL-1 ‘ L GALKJ-LAR.E’GAS‘v'7KMS CKASGY'TT 'TRY T' MET/1’32KQR'EG C‘G7 EW T GYT NRSI’ C N‘T'7'TKIQKFKDKA YMQLSS7 LTCttTLatabT e Z‘J‘Jtior‘dy‘ 3954w JLJAL-I L-J7TC3UCLA.~~ "mm" TJV, A }171'13 '1L3721CCTL-J «J m. «J «m JGL 77G «C 31 n 'T‘ n\ Apr-[1p 7‘ TIA-T A ..J T 7 by,JV? m (Tr-JV r13DTLJ T312, :'\J 'LQGJA 'L-Jv LJCJ -C3L3‘-J_‘1'J'L-'JL-'JVCJV Tm TJVJTT pan.» «FL/VEH-lnrwxrw 7 ,,\ '\.3J£GCGC’I(NT-J TL ‘TJ'L-|31‘17 TJTAT TCATCCCALJ\m. «11171 (BC1UG TACCrALTA-TCC,r‘ "T‘ ‘4 ‘4 ~r .133L5G1L3r1' H‘i’ AJ 31.2J1L31J-(3C'LTCJL3JCTC3TJT'CT- ' G,A.Z‘3LZ:Z‘3GLJ(3’I'GC3Z332-3GCJ‘C;A3GGAT’\’":G' 32"1'77‘TMT ‘.’]?‘1‘GLZJGCG'G'G' ACT‘S.3LCC1"3'1"1‘Z‘3 TGAATTTGCGTATTGGGCCCAGGJ'CACLJCTGIG’ 'G’ CCGT= GAGCLJJCLGGCTACI—JILJ’7'-CC AALJ\.'.ILJ\-VLJ7 «AAA—L -ALLLJLJGL CLTLJLJLJLJLJ'«m-L AI-I InI-I. «AAA—L. ALA—L CC- "I111 Inn—IA. I —L «AAAAImAIm—I A A.

LJ\.'.ILJ / -LJ\V-- \V-LJLLJLLJGGL'JGLJALJ -LJLJLJ1.1I—LI III—LA—Ln J L CL L LCAALLJ Imp—LT ALA—L A. Inm AL LJLJLJTLJ‘JLJCL GLJ L.ILLJGL'LJA/LLJ'LJAm "Immfi "Iv—I7 AT Infimm_LJ'L L -LJL.LJLJA.ACLJLJ1LJIIALAII—L LJALJKL'JLJL= Ln «AAA-I LJ .'JLLJGAALTLJA'TLI‘L'! CGCCC' CIAACCAGCGGCG‘ 'GCACACC 'TLJCCGCCTGTCCTACAC CCTC-AGGACTCTAC' CC I11. IIIAGCJJGGJ GAGLJILJ"171 "F‘ I r11 I11 I'1rIIrI11r111. :1 I IL, J.'LJI-'LJ 'LJ'CAGLJAGL..J.run—H11 'LJV'LJAG11r11171 GCJ AGA L.,TI‘LIJIILJA/- 'LJIJm urn/'1. *1/37 :1r1 Irv1r11.JAATIVACAAGL.GL.AGILJAAILJL'LJIVAA'LJG-GGAGAAGAA‘JAILJ.r11r "I111 1111\fi/1I7 I11 11r11 :1 m '71fi'717 .Ir1'11r1 Tcmmfl IrI7/1I111 IJ- CCJ'AA L..J-I.J J‘I.JAA.

AA'CJ'T'LJA'LJ'ML " L.GLVAC , LL Lm .,.LL .GLLLL LL. .. ,Lp ILJ 'LJIV'LJA'LJCACLJJC-ALAN IJJ'LIJIJG GCG JCAJTCT ILJILJ IL TT'LJHV'LJV'LJCAAAACLJCAA'JLJA'LJAIV-LJIV-TCALGA JILLJJLLCLJLJLJA’LJV'LJV LGZAGLJLi CAJATLJLJLJTLJI3II fiflfiflfi I11 I‘VKI7/1I1r111r1 I r11 4I'TII'1,I/I11rv:1 fiflfiflm m1 «#111.

TLJLJ LJ‘JACLJL= LJ.A 3LCLJALJ'JAALJJA LVJVTGALGLJ LCAAA JL'1Ir11'1I f‘VI" 7h Ir1 r1 Ir'1 mfim LJAACLJ13LI/1I7 "mm LJ.1L J JLJ'JLJTLJLJA.m firIr‘IrI. Irv'111 I—LFI 'I.1’LJZ-\_TAA L.,A—Ln ALI—r, mfi AL -, AL LJ'LJ CLJAA JA'JAAA'LJC LJI-.’LLJGCJGA 7» f‘,‘1\r:r. r~I11=I11~LJLJLLJZLLJILJGW:L.,1 "1/\ 1N1 ’1 ."L'IV1LJLJ III'w/C l'L3‘I.J.r"L‘I.J\J21.L3\.3r3LJL CILJ'JC"I’7r‘7‘ C‘.’"‘Z\I7‘r‘7 _..\.AWAZLLJLJL,~ LAI/Lr;I/~I~,LI A,"7‘." I-~.rL .3. IL, IJ'J'L3‘I.J' .JLJLJJA1L.'"7' GA Z I: F‘:A: F‘:A: C"11 I11 C) (:(I LJI 1I-—~\I.I~.r~r-.:II~I~Ir,1r~LJLLL'LJKJL LJJLJL UGL"TIC?Al"ALLJ_lV CC ITL’7' TATCCCAGGGACATCGCCGGGA 7T7» -7 7’729\.’-72I-GCA2I-'T‘G IJL,LI,.~I\ , LAI ,LIn7JL.I;I JLI ,LI ,L.. I L313LJZ1.L3LJL: 1L3AL3:7A3 21:31., [.'JLJAAIJALJ'LVA ACTCCGILCGGCTGGTIGIT («r1.,TLJ1LVZJL3C 3(3 L. LL..;-'L.III.,'L3fNr.‘1’l\ 7 N/VFI'I/V’ rxrwr-xr1II-«rx7 r~7 ~\ I-11\ *1/11an III 1: L31323LJZ3Z: 17» ("TL r17» 'Z'L' .Z'k' (33(3'L313213L321.GIG- ACI :ri1/Cri1l11rmi VTVA 111LJ‘CZ'LATI;AG -GC 7GA"GTG7 LAT'Tl7T"- . . . .. ‘GGI-J72LCCCT 7T 7T’T"i"-7'i"7.TCCAGI"-7I‘7 1I|TKI'1ITlr:f\.1/Nr17.J ‘ I I .J LJ‘IJ' -'T TAGCZIC-IAGC'J'"AC'T"TZ GCC'TI."7 rJ3xJ2‘1LJLJIXL37» AI». 1 , 'A P.'ACIAIITI VLJMI LI , LA LA. LI L .J L (3L3‘V 'LJZ- CCAGGLJ"TE,'7TC".A.TCTAT‘- CAQU‘SLICJACmm GGCA'T CCCAGACZ7 , L...,L...,L .,LI ,L LI.

«LC.» GGGLJ.JLJG3GZ-L.AGAC,L, 7"" DIANE AC- C IL.2\.L.-IL... Lm.,,LI.,L GAGCC’TGAA GIT -7TZ L12'Z‘ m 77,117: :IIAJITIIrqy (hang 1L Jt ‘I.J'\JI'I"\JI GCIZ'XLJJLJ1 ,LI»L L "EAL-7321311 ‘ 7""7AA ‘4 AII11nI ACT]: 1Cr1ri1lpl - fir" ‘GZ‘LC Z3L'7‘Z3J'J7 GAZ3IG'T‘TJ’3 T ' CGAGCG 7'1‘ZK'J‘CCAGfi '-f\'Z'XL3L.,LL3mm 1m 14 (2-1 r1I' r\{' r _ 1. Z‘3L13/3LL,.13'\3\.:.r171 L313AL3'3LJ'L3 LLJL3L(14f\' r\r' err' hl qu CI‘IJZ‘AIS (,L,‘1 II-1I 3f r1-L.1.3A\.:f\r ‘JJ_L3Z"ALL,1I1I ""II 3C AGCCTCTGGZ3TGCACI T" ,1.73G:Lm‘I_«AL1\_JC.LLL\..L"‘2 m LII—L. L-III-I-IIIL-I‘pnan-w.IL,"3'.L13!I13L 1L. :CGCC.Z‘3 7"7T'J7CACGGILZGGGGCLI‘ 7GZ3 "I'I'I/"If‘(SI-.1: {CI-[1C1IJ .'L I1 .[l.x\J\_f\ : AT TAG ’1'GGr7‘3 1|"! 7'1 r14: 1CI3.- -,I I L —L I. I—L L3L13'L3. .[I'AL3C"lCATAC -, I’L-r ,IL.- CIA-Gm L‘3C1‘313131313. . (St-LAB 1‘.3L.‘.., ,IL.-[:r1r‘4'113. .L..

.[IAA].I\_'1 r 1’1 GZ'EGZ'XCA14' 5671111711r1Ailx13zA\\A\\ 1L3LL3LAP1" Ir" -1 m '1I11 'n I -IAA2.2\L\LJL,(JJ_‘ZAZIJ .AL‘CJLC/bI mu —~ v1 \f‘ J .Lj ALJAL,L3\3'_ CL3'J. 2-'1 r17\ err' f‘ r" 1I1'I'A I'I'I' I' r71 ZAL,'[13I[13LI.AC.A.Z.r" In I" ,1- r‘ 'n r'1 14 II-1I 14r71| r71'1 r" [’\I/' -1II11 y"\r1 In(1 {1 Ir" r; .'L A. 21‘.\C.'. C‘.,CJ A _ "v I.[ 3L3 .21".LI.,]'I7_\rNI':1I1:I::1'AI1':'11II .J .'L \J'LZ'I \J'LZ'ILJL TGGCACCCTGG'7' 7Z3LCTG'[C'[C[ QVQLK‘ISGP 71.31. I f‘]...3 .[ TC 1G'7[3'.‘/\‘’RQ"PI..2’LCL..I.AZLL'3"\I'._ 3‘117NT .. I."'.["SR:.IS INT. 1.NSASJQV'{i'VJNS ].IQSQI.I’1'ZI. .. iJZ3PATTYY}:.EAYWL 1"»’SAAST PSJC. LSTCICSAALGCLV’7KDYEPEE VE‘JSWNSCALTSJCA/"EVITERAVT Q‘SSGLYS LSSVV'TVPSSSJLGTQTV'CCNV \TrTKPSETTEVD CKVERKSCJDKTL TL,‘PE‘CE‘ARELTCCRSVEL FEET"T‘KDTLMECRTREVTCVV/‘JV_)V/7S HE DPEV CENT/ITYVDCVEVE N. .E .TE 7m {21L1V EQYNETYRVZV SVL rTQD-7...ITCK3Y.C. VSNKA. LT‘AE QVS CEY S ITAVETITESNCQPET‘TNYKTTE RVLDSECSEELYSK' TV7DE..Ln SVLTHEALETTEVIYEQKSLSLSPGI’7C’7 l '3 C.) ) C) {I} C) ) C) CIT Q a)(17) (7) U) (7‘) C7) ) L'IJ "T ,4 .7 t-Vl IV} D \ 4 U) LI L: C u L: j) "LT C7) H L" U) L" (/1 "J 774 ERATLSCRMSL CVC. QCKE"5QAPRLLEYGASSRATGEPDRESCCGCCT'"'" LTES RLEPEDEA YYLQQV‘GLLIVLTV'GC’7 'KVEiKTVLCCGST._TSYT‘TVYYTKTSCSLJEQVmV\/ )‘G CGVVQE’CRST RLSCAASCSTESSYA7-4tun(J) «1 4 pa FEVPGKGT-EVTVSAESCSCGS 7IYADSVJKCRET E SRDNSKETTT Y LQMNC LRAEDTAVV ' NO: 27y.) ) ChaCn [\LCLVZ‘ TV‘H 'TV'(57h,VmCJALLTJm ‘I/‘(’JAG’-LIL/Lug:(5» («rum/u.V— f\\JT'VV}A)1V7rV1/\r}1rVVn rV arm 1;»:' [\LJLJCLJLIC 'CVru IrVr~ » ’5 ‘1‘"! 57 VA Ax TJ'LJ' VITKK‘I’IK‘T rVrVn": ' 'Z11V1 .GEDTDAD' T .1: .11 ECTr CTCCC 7C’-75’7291C-‘7CACACCZT7'-T77C7C21CCA291’7A'TTCAT 7'C'C- TATC2JGCZ CAA («mp/‘7LUCK/PT CC7C CI'5 ’7T-’7 C TCAT TAA 'T'TTACCC 7CAC7LCCC 7Z1TT (1C 7C7AT'E‘A'E‘TAT'TCCCAGC'2‘1VZ123C723A‘CAA5 I.~ ~7 » x» 7 '17 m Ann-(hang 5 IN." D'LJ‘JLJLLEQJLJA 7C'T'r'7'T' «A "(w-(n, (‘7 r L _\JL;I‘J U‘J'LJKJ'LJKJEVTLJ .] (ml. (:11 'T'Cpl r'VCr'V'VV'A'CfirVTjC/A'TIC'T (VET .15 '\3-CJk/l’x r31 {VI'1r\.'| Ir:prjr If:7T D11157:(AC rn III {'1 117"" an n Imp 73 r‘7 IJCIJ25.521"\_7( AGGCCPS CCL"V3GM2[V7171 [\xJ23pLL3p~\ -— ~77 ~~7 '17 «A Z3 n7X xcrrwMIA LL75 CCTJL bliTJU‘J«mm ~ «am-Inf7‘7 hm» 7 5‘ "A VIthLtEGL-sz'1': [\xJL‘p JAVJL»LE_IEXLL1 ’7’7’1‘721CTACC721C2921LACLLLAACTETACC‘CC'TCCCAACT’7ACCCPT'7C"7'7C7CCTCZCCC' "CCCIV) .’ .

. CIT?Z71}:[3pr .AGA‘VGVG ..\ J'\_‘(V‘I’77' errx-. \CHJF .(5GACI5’L'I5 7I7GG'T" .7CI. I XCGI'J7'TIi'7JAGC" 7CG'TT’7L5.\\5C2"\.’1'J.I'7 7'7CI5Z7LIJL 5ZXZ\.ZX"77’1'L57’1'L5’1'TACAC 17’7 :' CCACCCACII3CTGTCT "7173CAG’5CL5ZX2\Z3I5Z3I CI'J7Z3LCCCT7'C'. (,7'7II3’7'L5LJ2VCI "CATCA 57. .5C2-\CII3ZZ3Ii5CT .3."TTKCC" 7’7L5TZCI3Z3.iI5 7AAA’7C' 7GL5CIIZ3XI5C77"7'77C'73LGCC'. "CC'T' .'T CCTCC ATIJCACCAGGC" \/.£,'\.(/.T (2!ng [-11 JC‘JIIVX\_J!VX\C/ZI\CI\fx' Ver J-L awn-.5 «a ,n-, 7" ,L, ".T‘CAGTGIT5C271G".7CGCTC"7 L_V.\J'\3ZZ71\_J 2z71'x31.z\‘rV,’ r" r' 'HI'II'VT V 7x Vrn ‘1.7!If‘i IrerV/\ '{77 . MC.C 1L..-.L,z[\"C'LT.\\5L,2\C2\C"77CI7Z3I5CC' «JAA175AV77’1'VI7’7'L5L, -1G"77CT’31.7TAC"? J21'L3L,2’\.VI [AT CH: .L1-1GL,-V\ r r‘ VrV1 V rn "I'I'I n 7'an 1,7"'CZ‘VLCCJ7" ,V f; 73A3’7.'T'TIi'7J 767CI5C5ZVCCGIXCCZ.7XL57GTGI57Z3L271Z3LTCZV TACG 'TT'CCCGACC 7TCCZ CCA'[AAC'TTC TA}. .‘\2-\ .L‘JT.’rV1 V VA IVVI "I"! "n |er 7x3 (V. 1 1 ' C".TZ3"T [\LJLVnz-err VrV1hIVI VA1‘.2-\.J.IJ CI(,kJ/UJMKJ\_h‘l‘V‘ VrV1 V4,, f‘f‘f‘I’ 7 rVIrV r‘ rv m x a V L \ ALA, \,Z\\J'EJ. LJCZ’VV VI'VerV C7771":Z\C:'7 LCCCCAGGLI51I5L5" .LCA’VL ’CTCI5C2—1GI51IJLC. CmJZV- VA «mm—~25 er. \IP. ‘57 w. —\.-- .

QCJLKJ I'['./’\I".f\lr. p. . ~77 [.1rerrV 7..- .p n \/\ (5 ’7'I5LJ2IC'7C"77C 7L5GA‘ .7173..CZ-\ err:h'Il'V1hV|Vl\ an 775-. «77-7 mpn \/\ . i 1'. Z-XCV‘IJZVL‘JC .1 {TLVL,\_J Z1. uZ—‘G‘J .LJG‘JT‘JCKCCCILLMVL, TCCACGCAAGGCJC.TCJCACTC CIC:TCTCACTATTACTGGTAT.C.GTL"SGT TACTAC.

C) IO4 I") 4 (T) H O C.) :3 C)I C134pC) ) I")ITCCCTTCACCATCJTCCAGATAAAT 'CCAAGAACACGC 'CTATCCI CICAAATCJJ-AC-GC.C1CIACIACICI..GAGGACACGCJCC.GTATATTAC.JTCJCCAC‘AAI'CCC' TTAC TTCJGATCTCTCGCGCCGT.uGCACCCT‘TCI'CAC 'CITCTCTT' CAGCTAC'C (SEC :L, 170: 275‘ TGTNT ‘TQRTT‘CCPRTLTKJASES SC PCJ.

"‘IZCVIJTVDJTAGLSGTr‘I.gESVTEGDSKDSTYSLSSTLTLCK JGGCSC. GSCC1GSGGGGSGGCJTITVT-TGS T‘ GCIAI‘RLLT ’GASST‘A’T‘ I‘IPDRL r-x (‘1 :‘T (1 xii-JUL) G'T LE‘TLT T PEDLA312 ("‘ZJIO0 I—g‘ (3‘) CG CI, W t-w‘ In] In C) C) ‘41"‘iE:.\,LLT.RSGCSTL’T‘SY\1\"'VTKL SSC- ‘1‘Q‘V‘V\K\L\7Q‘I‘GGT\Zv‘7 ‘PGRS’ .R‘ .SCAASGST TI‘SSJ2IT‘I’LS‘LI‘I'VRQAPI’G:JI’G"‘E,IIJ‘VI‘SATSGSGGSJ TY AJJSIIZACRLLLC{DNSKNT '2"! CA’TNS L‘JLLIIYTDLJJ"‘ CTT I" "17S SAS table r‘I’ 7 r1. I"‘-1\ ~111~IITI 1rV'1/N » ALJJ LLG KLI‘JL-J/A .‘iI/‘(rw’fxKJIJ-IX C-‘IG‘CC‘ I".IJTACI3' 'CAT GT .w.-~.TLCIZZ‘J IL, Ufa J-(JL-J~Cr: «m 1r:r17f\r\f\,» mJVnJVnr-mw rV» ».

K-II.J-‘1I.1GI.1G'I " \J ALLI‘IJU‘JT‘U IJZCICCIGC‘JVJGTTTWVPT 7_I.,K.I1-r‘1'AJZ1 '1511GMGAGJ., J.I- NDJTJZJJJGIJGG.I AI AGATW. New- D fcr.,wGCEGACC.AG;~GCGMLGH-ICAGleGA.., .JJfiJJ.JV.JVJn-,.Vp J,W.J.nv_ .JJ.J..A 1C -GCGAAC-,. -. .A .- VCr‘L/\SCI 1m :IGCZI .)-_T‘_T‘r‘./'\TJZL T/Ax-JCx-J ICAL J~rV. VerAummm/V.GAGLKJIJ'1IJT T«7 I \f1/‘kr1r.r1r231-be ILAGK-IGK-I ‘.,Jt GLI‘JU‘IJ-XCGIJJP J i J V.- VA" JV J Va, JrVrVJan erer7\ mr1mm ~\ «Amey rVrV».EJLIJZ‘JIJK...»-L Tr1:1 Z3131.K_JZ‘\K_1\,K_1,VJZ .’J,.I,.J m 3.1151 J".‘JGZ‘1Z‘1IJP.Jr..._q-J. [-31.,-..-JV," «J T'T‘ rm Z3mr .f\r~.;’\I3LI.,.2’\\.1K_ JZ‘1L5JZ\ZZ‘\JCAJZ\‘.,.5...I-1C .,K_1JZ‘1f\r"'z - m w '1 I "n \JK_ (fly. .I. .L1-1L. .1. «mafia/«l,- J. L1G CCA"""J""L""GGQ‘ I’T'JGG wCZJCCAAJx. GGAJAIIJ'. GZ3..AZ3CCTACGC'GCTGUACCATC'G'. CT’T CA".L"C".L""T ‘IIZ3GIIZ3CF1T 'J'T‘GZ3J’TGJ' 'LWGA 3TCTGGZ‘.1"'."~CC"T.‘3’J.'G’J."."GTGTGN"‘GC' G AJZ‘1.LJZ‘1.2’\J\, .L7. p.- 1111"ml-n VCR, \‘lex‘JIAX\J\T\/\ J.12.J.Z\L.1 J_Z-\JC.IZ‘1Gi. G‘3 1731911'1 VJ '1 ,n p-p pl» leP-‘Z - ‘ITI'A ‘1' m ,I r1 ,m fl." J_‘..3J_z-\ «fix-I nipp . \_1JZ‘1.‘.r'1z\ZZ‘XCGC‘ (4.1.(JIK/ZI‘1Z‘1K/KJCI'1 «m ""TAAC" \GGI1GI1"""J‘CACJKGAGCJGG‘AZ‘3.I5.—‘ICF1Z3JGGJ' CAGCAJ‘II.3’J_'AJ2C-1"‘CT"AC.CZ\JG r14. ("r\ {<- L AIJ. CI. :Z3.Ii'.—‘ICAZ3.AGCAC’\"'L"\I.,GGJ23Z13.F1C231CJAZ3AL ’Z'Z-IJCGCI.3’J_'I.3CG "TCA ..C,IJ'1C:I.3C,..12511‘ .LC'QC'C J-.-1,\,V, - m V.—..-.-I,'V<,.VV.,'V-I. K_JZ‘1K_J.Z.Z\JZ\L5Z" CAJ.r" Vr1 CAACAle’wCAGGTGTGICCTCCAJ J‘;__';Cj(:.:' V \I"r71 ‘4 r1 r~r1¢r1r - 1‘J.L 1.'\:'IJLJ.K_. GLJIL\LJC:‘ '\r1 Efiflfla’im} s W651? used to express the enti-Iaggei (40} IV».) heavv chain the 53421294491 IVZ 1i ght ending the anti—EGFR CZZSVS heavy chain? and the 3954,1304- 3225V5 iigh‘i chain sequences shown above. Such vectors are described in eo~pending appiieations PCT/US2013/(I38540, filed April 26 2013 (entitled "Activamhie Antibodies That Bind Epidermai Growth Faetor Receptor And s Of Use Thereof") and PCT/USZOI3/O47109, filed June 2L 2913 (entitled "Anti-Jagged dies, Aetivatahie Anti—lagged Antibodies and Methods of Use Thereof"), the contents of each ofwhieh are hereby incorporated by reference in th eir entirety. tsunami Vectors were digested with etion enzymes Nliel and Noti and the veetor fragment isolated by gel electrophoresis. s were prepared as follows. Human igG CH2Cl-l3 traginent was amplified in reaction l, from Pop Hygro 4Dl lVZ using primer HCEoerie (Table 89 SEQ ll) N0: 3i and primer HCReVOL (Table 89 SEQ. ll) N0: ll)? C'l‘LA-4 scEV was amplified in reaction 2," from C'l‘LA-4 seEV CDNA (SEQ ll) NO: 229) using primer CTReVNot (Table 8, SEQ lD N0: 1) and primer CTEorOL (Table 8, SEQ lD NO: 2), OKT3 seFv was amplified in reaction 3, from OKT3 seEv CDNA (SEQ ll) NO: 23 l) using primer QKReVNot (Table 8, SEQ ll.) NO: 5) and primer CTForQL (Table 8, SEQ ll) NO: 2). Human lgG, CH2CH3/C'l‘LA-4 seFV fusions were prepared by ing lllll/E; ofreaetion l, l(l% etion 2, and amplifying with primers, HCEoerie and CTReVNot.

Table 8. Erimer sequences Primer Nucleic acid ce SEQ ll) C'l‘lievNot 'l‘CGAGCGGCCGC"l‘CAAC'l‘AGCTGAAGAGACAGTG SEQ ll) CTEorOL GCCC'l'C’l‘r‘kGAC'l‘CGATCTAGCTAGCTGAAGAGAC SEQ ll) AGTGACCAGG NO: 2 l-lCEorNhe CTCAGC AGCACCAGGGCC EATCGGTC SEQ ll) NO: 3 l-lCReVOL CTTTACCCGGAGACAGGGAGAGGCTCTTCTGC SEQ ll) NO: 4 ot CGGC:(::{i’(:T(:f ACGATTAATTTCCAGTTTG ________________________________________________________________________________________________________________________________________________________________________________________________________________ {$630483} ing amplification? tire resulting DNA was digested with restriction enzymes Nilel and Notl and the CHTZCHS/Cl'LA-A scEV fusion DNA isolated by gel electrophoresis. Human lgG, Cl-iZCl-i3/0KT3 scEV fusions were prepared by combining "3% ofreaetion l, lO‘Z/o of reaction 3, and amplifying with primers, i’iCFOi‘NllQ and C’i‘RevNotl Following amplification, the resulting DNA was digested with restriction enzymes Nhei and Noti and the CH2CE- 3/ClLA—4 seFv fusion DNA isolated by gel electrophoresis. {$388484} To insert the CH2CH3/seFv nts into expression vectors? the following combinations shown in Table 9 were ligated overnight with T4 DNA Ligase (lnvitrogen ind, Carlsbad, CA). Following ligation, the DNA was transformed into E. coli strain MCl on and ed for iilin resistance, DNA sequeneing identified clones containing DNA s encoding the correct rnuitispeeitic antibodies or innltispeeifie activatahle antibodies, and DNA was prepared for mammalian cell transfection.

Table 5‘}: Ligation reactions 1 til Nhe/Notl digested anti-Jagged (4D! lv2y) it} Edi Nhe/Notl digested human lgG, heavy chain Cl-iZCi-lEi/CTLA scFv tiision DNA 1 nl Nhe/N otl digested anti-Jagged (4131 lvl) 10 iii Nhe/Noti digested human lgG, heavy chain Il—i’2CH3/OKT3 seFv fusion DNA 1 gal Nhe/Notl ed 5342—1204—4Dl iv? 10 ui Nhe/Noti digested hurnan igG, heavy chain CliZCi‘lS/CTLA scFv fusion DNA l til Nhe/Notl ed 5342—1204413} iv? 10 gal Nhe/Noti digested hurnan igG, heavy chain CHECH3/OKT3 scFv fusion DNA 1 gal Nhe/Notl digested anti—EGER (C2256) it) ui Nhe/Noti digested hurnan igG, heavy chain CliZCi‘lS/CTLA scFv fusion DNA l til Nhe/Notl digested anti—EGFR 5) 10 gal Nhe/Noti digested hurnan igG, heavy chain CHECH3/OKT3 scFv fusion DNA "rinnssinsi'a;s;is;{at"3'as2t:r:5ait:i5::":"§;¥§""" "i'53"iiiiiiiéfliéiifilééiiéiiiiiiiiiéiiiigii""""""" /C'1‘LA seFv fusion DNA "'i"'fli'fiii'élfi§iiiiialsotartan1204(136 "'iii'ii,i'iiiiEEili75ii'iiigééiéii"iifiiii§iiii§i§""""""" CH2CH3/0K’i‘3 SCFV fusion DNA ..........................................................................................................................................................................................................................

EXAI‘VD’LE 2: i’rndnetion of Mnltispecifie Antibodies and Multispecific Activatahle Antibodies idflfi} Fully human lgGs were expressed from transiently tr‘ansi‘eeted HEK~293 eelisi Co—transfeetion with distinct heavy chain and ii ght chain expression vectors, shown in Table 10 enabled the expression of speeitie activatable antibodies.

Table 10 'l‘ransfection Light chain vector Heavy chain vector number anti-EGFR C225v5 LC C225v5-—OKT3 Ht: 3954—l294—C225vfi LC CZESVS—OKT'S HC ., 25x75 LC CZZSVS—CTLA HC --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 4 3954—l204~€225v5 LC IZZSvS—CTLA HC anti—Jagged ilDl lv2 LC ilDl lv2—0lfilT3 HC 53424Dl lv‘Z LC dill lel-OK'I‘S HC """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""2i inhabitant" ....................................................................................................................................................................................................4+ , 5342—l 204l~4ll2§l lv2 LC le lVZ—CTLA llC : Ellillldtltl} Multispeeifle antibodies and n'rultispeeifie aetivatable antibodies expressed in HEKQQS cells were purified by Protein A chromatography. {999497} ngAssays: As shown in Figure ll, ELlSA-vbinding ments revealed that anti—Jagged»»»»»»CTLA—él and anti~lagged»»»»»»QKTES peeilie antibodies and intiltispeeifie activatable antibodies bound human lagged l9 and anti—EGFR—C’l’lA4 and anti-EGFR------0K3?) niultispeeifie antibodies and multispeeitic activatable antibodies specifically bound human EGFR.

Ellillldtm} Human Jagged l—Fe (nan Systems; Cat # l277—l64350) and human EGFR (nan Systems? Cat # 344—EvalfiG) were adsorbed to different wells of a 96~well ELlSA plate. ed anti-Jagged------CTLA and anti-lagged-------OKT’}, anti-EGE'R------C'l‘LA or anti-- EGFR»»»»»»OKT3 antibodies were d to the plate and d to bind. Bound antibody was ized with an anti—buntan lgG~HRP conjugate (Fab specific, Sigma, St Louis, MO; Cat #- All293--llvlL) and developed with the genie substrate 'l'MB.

Elllllléllhlj As shown in Figures 12A and l2B, binding experiments revealed that antidagged—CTLA—ll and anti—EGFR—‘TTLAd specifically bind both human and mouse C'l‘LA—zl- (the uman C'l'l'..A~-4 antibody crossreaets with both mouse and human CTLA-d): Either huinan C'l‘LA-d (R851) Systems; Cat # 325--C'l‘~200/CF) or mouse C’l'LAn 4 (R841) Systems, Cat # 434—CT—200/{3F} were adsorbed to the wells of separate 96—well ELISA plates. Purified anti—Jagged 4Dl lVZ—CTLA—d, antidagged aetivatable antibody 5342—1201l—r-l1'3llv2—CTLAJL anti~EGFR C225V5—CTLA -4, or aetivatable antibody 3954~1204—(3225v5 »»»»»»CTLA—L‘l were applied to the plate and allowed to bind. Bound antibody was visualized with an anti~lruinan lgG—HRP conjugate (Fab specific, Sigma, St Louis, MO; Cat # A0293-li‘vil...) and developed with the ebrornogenie substrate TMB.

Specificity of binding was demonstrated by the in ability of antibody—OKT3 fusions? specific for human CD38, to bind.

EXAMPLE 3: Cliff» binding to CD38 {ddtldltl} As shown in Figure l3, ELISA—binding experiments revealed that anti—EGFR multis eeifie activatable dy 3954—1204~C225v5—OKT3 and anti—Jagged inultispeeifie activatable antibody 5342-l204-4Dl ly‘Z-------OKTB specifically bind human CD38. Human CD38 (Novol’rotein, Can‘t {3578) was ed to the wells of a 96~weli ELISA plate. d anti—EGFR speciiic aotivatable antibody 3954—l ZSVS— CTLA—d, anti—EGFR multispeeifie aetivatable antibody 3954—1204~C225v5—OKT3, anti— Jagged multispecific aetivatable antibody 5342n12tl4-4Dl lVZ------C'llA-d, or agged multisnecitic aetiva‘table antibody 5342—1204—le 1V2»»»»»»QKTES was applied to the plate and d to bind. Bound antibody was Visualized with an anti—human lgG—HRP conjugate (Fab specific: Sigma, St Louis" MO; Cat # At)293--lML) and developed with the elu‘omogenie substrate TMB.

EXAMPLE 4: Protease activation of inultisneeifie aetivatable antibodies.

Activation {Mile-til} Multispeeifie antibodies and niuitispeeific table antibodies were diluted in PBS to a final concentration of 0.8 ing/ini. Recombinant human uPA (R851) s, Catalog l31tl~SE) was added to a final conceinration off/’00 nM and incubated at 37%? for ~29 be Digest aliquots were removed and prepared for SDS—PAGE analysis as described below, and diluted to ltltl nM in PBS; 015% 'l‘weenZO and 10 nig/rnL bovine serum in for is in binding ELISA assays.

{Mill-412} For PAGE, the samples were denatured at 70°C for it) min in in LBS sample buffer and TH??? was added to a final concentration of 40 mM before electrophoresis. Six gig of antibody was loaded onto a. Nul’AGE 10% Bis-fins gel (lnyitrogen) and proteins were separated by size using the MOPS electrophoresis buffer.

Following electrophoresis the gel was stain with Coomassie blue and the results are shown in Figure l4. The change in mobility of anti-EGFR activatabie antibody 3954 CZZSVS, anti—EGER speeiiic activatable antibody 3954~1204—(3225V5 »»»»»»(ILA—4, anti— Jagged aotivatable antibody 5342—l 204—4Dl lVZ, and anti—Jagged innitispecii‘ic aotivatable antibody 534242044131va»»»»»»CTLA~4 light chains, in the presence ofuPA, demonstrate protei‘ilytic activation of the inuitispeeitic activatable antibodies, The lack of any change in the mobility of the heavy chain fusions demonstrates the resistance to protease cleavage, Bindin ‘ Assa s ldlflii Panel A in Figure l5 shows that anti—EGFR pecil‘ic activatahle antiht’idy 3954—l204~€3225v5—CTi_JA—4 bound to EGFR, hy ELiSA, with lower affinity (Kd = 12.8 nM) as compared to C225v§ (3 nM) or to C225v5—CTIA -4, (9.33 nM). However, once activated by uPA, anti-EGFR multispecific activatable antibody 3954-—12tl4--CZZSVS ------- CTLA—L‘l bound to EGFR with similar affinity (0.45 nM) as ed to % (0.21 nM) and (IZZSVS—CTLAd (0.33 his/i). importantly uPA did not cleave the anti—CTRAd scFv fused to the carbonyl us of the heavy chain: As illustrated in panel B of Figure 15, uPA treatment had no effect ofbinding to human CTLAd. {9994M} Similarly, anti—Jagged multispecific activatahle antibody 53424204- 4135} le—C'l'LAA bound to human Jagged l, by ELISA, with lower affinity (15 nM) as compared to 4101 NZ. (0.44 nM) or 4101le-------CTLA4 (0.77 nM). Once activated, antit- Jagged multispecifie activatahle antibody 5342—1204—4131 »»»CTLA~4 bound to human Jagged l, with similar affinity as 4131 iv]: {0.5-4 nM) and 41M lv2—CTLA4 (0.92 nM) e 15, panel C). uPA treatment had no effect on C'l’LAd binding (Figure 15, panel D).

ELISA binding measurements were performed as s. Human Jagged l—Fc (R8410 Systems; Cat it 127748—050), human EGFR (R85) Systems, Catit344—ER—05tl) or human C'i‘LAr-t (R8513 Systems; Cat # 325—C’f‘—ZQO/CF) were adsorbed onto wells of a 96—well ELISA plate. Three-fold dilutions, starting at Hit} nlvl, of ted and uPA treated antibodies, multispecific antibodies or muitispecific activatahle antibodies were applied to the plate and allowed to associate with plate—hound antigen for l hour. Following binding, the bound antibody was visualized with an anti—human lgGvHR 3 conjugate (Fab specific, Sigma, St Louis, MO; Cat ti Atl293~lML) and developed with the chrornogenic substrate EXAMPLE 5: Additional multispecific dy and multispecific activatahle dy sequences {hhhdifi} This Example provides the sequences of additional multispecitic dies and niultispecific activatabie antibodies.

Antibody OKTBm SCFV PJV' I NC) Z‘ITII I) II} «:1 ’0 L" ’0 ."w ’7) f12;}T31 {:4 IL"W h- C)I \j) :3:CK7‘S GYT FTRVTP’IEWVTICTIT‘GQC.EEWT ’fIPYi‘v‘IQLSS DS. ‘7‘1YCPIRYDDHESIITTYJGjC'TTETT/ISSCGG \D'x ,"/',"/:",:\\IJLL'KIJLL' x) FPT)‘CPCT’G13KVTMTCS)PSSSV’SYMNWY.._QKSGTSPKRWTYT‘"I: TSI<.LZ‘II' GVFPHFRGSGSGTS.’3T.TTS IFIDPIPITYYC'QQWSSFNFTT FGSC'TKLETNR (SFQ TD ITO: I706} ,n—IzAIKIJ'kJ 'L/AGTL1TI‘1CAGCA 3A.I,—._r «m Imn II—I,'Ir.-,—.r~.,—..I7\j'IL'Lj'I: .IJ'L/AGAZAILJITJG HAILijITIL'L/avai JCAIAT.I:1m »fim-'\ .nfipr .r—V- ,«r-m ,TI-13L.mmmfi7—I7 ""11. AAA.".'L:A .j'ILII'I: .A1F‘1AGTL:AIA.GC.r‘r‘117 1-". w ’\ fi .. IAIA'L/II1". 1" fir". ..

:ITI.‘1 .. .7\ -'\mm’\m’\,4'\r"71'\r‘7..m" ,4'\/‘ ,4'\r1'\r‘~ _ . .ACTLCTI 3L.1./AI.1./AIL,'I,A.'Lj'I_.1.L‘1TJ_T.:1GT.:13'_.1."mma/.IAIAI'L/A'ASK j. '\/'\_. ,4'\r‘"\r1'\7\,'\("3&3'0. '\/L"\.I\‘J(.3 m '(IIZ'A "PIAJImm "AA,4'\ «r- mmmm .n—T r:r7*\,r\*\7r~ .,4'\r-v7....r-"\....7\m7\mn—T 3.TC1.1 3TPI3,I. . 3L3PII I'I3’L3. .P.1P.1 .C 3141 3I’I/Iw'TaG.. 1P.1' P. , "PIPJI- .PI ,AI‘I_.

CPIGPPPIJTCPPIPGPTPPPPGCPPCCCTT3,ITCPCLIGPTP .PI CCZ‘IPCPGT."CG JC'.P'.TP'.'GC{1:4 II’II—P’II—,PI.3TCCTGPI’LIL.I'TC'PGZ‘GGPTPGT:G.,II3TTT.PI'.T".'PC'.'G'.'GTLLPICGCTPTTP'GPIGP TCPICP JPGCCT 3'G,PIT'.'.PI'. T'GGGG'T' CPGT3GC.PICCP. JCCTGPCCGTTPIGCPG’LI. 3'G'. ’3 T3G'.'P.’I3'.'GT3T T3GLI '.".IPCGCGGTG3CT3GT.II3 JCPGP'JJ'JG'. TTITT3P.ITL‘. C 3TCC'GG CPPITP3,ITCGCP,IIT3'ICCCGC GPZ‘IPP.IPGT.ACCATF'CCG PIGCGCTIPIG J. .GCPGC'GII' TPGCTPTPTGPIPT 1 GGHP' I GPPPI CGGGCPCPGCCCGPIIPL.-3I GGPIITTP. 'I3PT 7/‘1'\7\ "‘F" mt" ‘7‘ ACCPGI-APPICI L3GC‘.PIPCTI‘ 133#1 rm". .F‘.'I3TT1C3LGCPI.LPI1111L,3T13'I3TPTI3TII.‘ .3T3 1PIGCC‘L3 3L. T-L.1..TI.Pmm '1r1". ~r Irv-1 m «n .n PTPGCCTGPICC-=IPGCGCTPTHGPPGCPGZIPI3PI1GCT-GCPPCCT TTPITTGTCT-GC7‘G 'G G' ’CPPGCPPITI'TTITTTPI,I.TTTTwIITPGTGGC‘PIC‘CPPIZ—‘ICTGGP_PP_TTPIPTCGT (SFQ‘ D Antibody QKT3m scFv Lv 'V']NO Z‘ICTTIT S7E‘.TI7)CFINC[‘5‘. :1";1m PPIV IKVT‘M13’7"PIS SS‘I’S'TVNT'VQ " n (VIC‘V 7:373 SLIM: V I LI I.'cSIEISIL ." CT‘VTTIPITIDPIZ‘I'H CQZQT3S T5GS C'[ 1a" 1337? 7 N C LEOT 7D171 EFTv}NC[‘5'. {"73f7_\ ‘ 1-3 ‘1"‘7A7’27Afll'zrxlr- f\r' r\'\n CTI_GGGTGP. I-I WWI.- (VI C105,: .I, Ling/I13 \/'\_ \J'I:L,Z-\. III-3G .IPJI CP 'TTEZ‘ICIC'TCIZ‘PL3CT CTL‘PIGC’IPCCPIC’I’" 373’1'ATPITT3ZIT'T .‘GGT[CPG'"\L3ZPIZI"ICCGCCPCI CPGCCC G1"\.Z\1\CT3'7C‘TGTI"éI'TTTZ‘éITT7'«P'TI I (32-13‘ TZ"IIIZI'J'I‘CCCPIZ‘IGCG 3T 3T’TT7'3fCT3 3ICZ3I''1."7[""]7"7[" ' G 'T'AGC GGT .—JC'I‘fI (37),"er I. 3 I V7-.GC-AC, AI JAJJICJTCJAGL,AJ.J 'GGJ ,AA.GC,A LC ,0TTTZ—LL,\V-i i iGCJLJEJLJiLJLJL,‘_LJ'VJA'ALI‘\_I 'JT‘F‘ J. "\ "‘IF‘F‘H'V'IF‘I Irv-1m fimfir‘I’K " ‘\ ACTGC ’AA_ATTA.-ATCGT (S::C, D NO: Antibody QKTBm SCFV Hy AMINO AA' I1'2 SECLEI CE .—.. V V V 1 1-1 "\J’g'TJI'QJ.)SL315'\\‘ff\ (V: J2AI1J. G2—1S‘JIJICS {(AE. GJ111 V-JJ 7... J -1J1-J m 11 7 .—(V.- v- J- J. J. PYJ. IVIIIII‘I‘. KCJ\I'T"31:31". I.G‘.JCTIJIIT1RC{TNYI\ JS "‘CYYCAR{YDIMIYEIJJIIJYW AC3GT'T I"‘70".100 I (V 1'1 r L C1 J:.. L: II II) NI C'JEOT TI)JE SIEI v EI'CII‘. r1 73 r\( 1r1-n V "1| -~J-, r1, ,ererrg TIT" 1 "I"! '1 V .1...IAAIAJZA JI LIA.J- .-.,V- C! .Jc. 1‘,I. ‘3 C’JJ/Jm/ALJC \Jj . pl" I.'_1L,2\G2-\L‘A‘f‘l‘ J.‘:J 13‘ .AL,L157'er. 1rVr1r rV/311II.L\,'1_1\:J LJC/Z‘JLA'VJC‘J.V'Vl' GC'TJETAJL‘12-\AA GC" TA"TAJC'C T'I‘TACC3CL3'TI A V AL/,LVrV. 2D [\JL: 2E1Jrv .- .J1_-J V-J1_-er —V ,LVrVrVr or \ J.L_1 1L3 AJLAZA‘J/ALJLLJJ L/L GGCA. 'C A LBGCI'CTI'G CGAII"1CA'I"I_'2’-"T'A'T'L CGJJCCCC .VerTJ-m \IJV _ 1. J.2-\..L [ALVIZ—V mam. 1-,CIT A..J\.,/A2L\L_,LV-, {'1 7A r\ A I'm A 7 L/JZJJZUJAJJL‘1A I""C,2\...L.2AGIJJJJ- J’JAGCAAC CC I'GAC3C2ACCGIATJJJJAJJGCJI1J~C,2\ AL'C3AC3 CL3C"TAI'A.‘IGC AGC'. CAG"AGCJ‘CTL EJIAGCIT C3GC‘A.L3'TI .I T’ACT'ICT'I AL'C3AC3 AC3'TI'2A'TI'C‘T7 "II TCJL‘1'CTA'AT2AC'I'G" "I"ILAI CA'ICA AGGC‘ J..CC2CC‘CTCJL‘1CCG'I'CI'JL\GC,2\ (SEQ III) NC): 31. i]. ) Antibody OKI3111 SLEV w/long Iinker11:0 aIIow attainment to the Cterminus aer the hem/y chain (TIC) 01’ fight chain (LC) of an antibody or activatable antibody to produce a, multispecific antibody 01‘ activatable antibody, respectively AVII" ACT) ICJENCE GGGSGC’A AEI AEGL3 SGCGCCCGCDDTQQ G2AILAP.PCASV’KIIIVCJSL12"\.:,3‘YC"I'.I'I\‘J"III'I‘IIIAIV’K.

RPCTCACTIJITJILIIGJJ. T‘SRCY'INfl‘T )I12A T I..''T' C" DK 8 S STAJYII‘CJQIJSE. JT S E I)3A.VYYCCAJ‘3 ].S‘{ ].J I)‘C‘L3CJL3'I"" T""SCGC’~SG AG AE GL3 AGSQ IVIJJTQS PL T3IIVIE1IAE1IIPL TJK‘J/C TI‘ITC F‘AS .ILIWYC'1). _‘ AC‘TO'C‘IxRI‘JIII {U'IS‘ I..J25SL"JCTJ‘APIRG5 G5’3‘TSY E1IIJTIE1 AI‘VIITI-i".l J" [.l ;CATIYYC,‘ ‘SI‘TPC'TC'‘SGT.. JINIR" (CD TII) NC): 290) NUC .JJ_.-C.TI DE SEQUENCE (-an(C.- "." ..,. m.'JLJ. EJLJGIJ. JILJJL‘JGLJ'VJ—V VmAm—V .ApIzV—JILVFJ'Vr «71 W J. L1 ZAGG L‘J . 31A j'VJLJ. L/t—‘GGTJG'IG‘31‘.C1.EVLJ'V3.PA'."Va «r7 VIA—J",L‘AL: rum/""1,LJLSL‘ALS'VJJ'. (J IA\(1GLik/ALT'Vr' YT] mmfi (\r". .I'VJL,AL:L_.J.LAL3EL:JCL:JG'JGLHEJHZAPA'V,.I'J1L7L_ECG.LCCG‘3G‘GCAE‘LE'VJ ;'\"\ 'VrV'n r- m 3 -'\’\ 7 PW Ir- '\r m m rum/3. J L: j'V, TAAJFALL‘.7171.73. 3 J'Vh’AAlA jL_.L:L3.. TIE..V"EC CTTA "f7"I'VIrV'V/"r‘u am I m31.19.1 fir'I'Vr-n J." WWI"! v'Vr- .717 .L,L,'VJ. .' I 1E1 JZAC CAT1CAA ..GL‘J"V3 .n. J’AAJ‘ ,—.~,'V,.‘AL3.L/L3.,-V—V,-._rV.,—J.'J_.CL:JGL1JLLHE.V‘JC 3T ,T—V «mA—J .—V .I'V _I.LV "xv-JV‘J'LJJEMET‘C'.’ 71mm "—me m—J .L3. 321i.i :I‘JJ'J. I . 1. .1...IA.:—'.ICAATCCGAJGCCCATGJJTACTACCTA ACTZ‘C z—‘CC.J3AJ.AATTCAAAGATTAAAGCAAmACCCT .AA.C,’CACCGATAAAAGCAGCA"CACA""C‘C‘J'V,.'V L, ‘VJK/ TATATCAGCJTGAGCAGCC' GAGCTCAGAGCATAGGGGATTTATTACJTCTCCAGGGTAT TATGA"EATCACTATACTC 'GGATTATTGGCTVAGGGG/CCTTCCTGCCTTAGCAGC1 G' GG AGTGGTGGGGG GG 'TCAGGCCTGGVGG 'AGCTACATTCTTCTGAGGCA GACJTL\UUJCJAAHiiA UUUUUHA'firww mm mr‘ Hnfinv "m 'CCJGUT G-AAAAUTTA‘LAT-CUT JTHUUUUU/LU"\ "HT! ‘7‘ ‘7‘7r' .. finmp Arr! mu fir‘V "r‘V *r‘ GTT GGTATATGATTGGTACACfiCAGAAAAGCoG~ACCAGCCCGAL ACGT 'GGAl.i: TTTATG:THCTAGCAAAC"GGGAAGCGGTGTTC'GGG/'ATTTTCGT-TTAGCGCTAGCGGJ] CZCC'CTTHTHGCCTGACCATTAGCGGT TTCAAJCACA/GATGCAjCA JCTATTATTGT CZGCAGTJETC-AJCAATGGGTTTACCTTTGGTAGTG gG/CCAA_ACTGG AATTAA"CGTTr.1 GA (SEQ TD QC: 291, dy OKTBm SCFV with," Shfjl‘t Einker t0 allaw attachment to the N—tetminus fifths: ETC of an antibody 01" activambie antibody to produce a. multispecific antibOdy or activatabie antibody respectively AMTUC A_CTD SEQUENCE TRYTMINVKCRPGJGLEWTJITIjSRGYTNYN SAVYYCARYYDDHYSEDVWGUGTTL'VG’GGG GSGGGLL'CGGSQTVAT‘SPATMSASPGERVTMTCG-SSSVSYMHVYQQKSJT PTTRTTYD TSKLASGVPAHFRGGJGGTSYSLTTQGMEAEDAATTGOCNSSUPFTFGGGTKHE’NRGGG Go (SEC TD NO: 292) NUCLEGTT E SEQUENGm CAGGTTCAGCTGCAGCAG7C71TGCAGHACTCGU-‘TGCGGGT'CAAGCCTT.A"ATGA rl TGGG’T‘TAAACAGCGTCC | (3 C'T GTAAAG "AAGCG-GT TA' ‘ACCTTTA ‘CCGTTZTTACCLJTGCATi "Aprcf qua~7 .nfi mm»m~7mmafinynmnp1~~mm»mmmaymmnyny»p DUO XE:GGLLT-GAt DUAT UUTTATATLAATL.DADUCG UriTATA.LAALTAUAAU UA\JA£uTT'L "IIUXTAAAUUEAUCUTUALLL‘J'ATAAAACILAU Av ALLJLLTATAn7\,\ WHNA**HA*W’T*Am7\~nI "flamm'T'Tr w~ ~~umfiam~m»m»mnp \GC"'GZ GCAGC"TCAfm G! "A AC 7'5AGTI'T‘ATTACTCT' JCACG g 3 a TG/}:1: ULL\UTATLAVWC;' ALT/AT1Im~\ m 1 n um «r71/ 7 » 11wr\.~r\r1r~ n ~ 17 x chm. 11"" ‘~r~>~'r1r'1~ ’1 ‘1’ rV'er «I’lr‘ xr‘r K3\._'.I‘K3\._'.I‘ W131 'VLIACL‘G L‘JK. K3LL1'UUK3iiPi'LvL‘3'L, '(JTDK3r K3\._'.I‘T (—W{IU H x,:2(.0 I——1" m } x-a Ct (‘\ C.:(UGLGI,Nmtfi .mvflcnI :inCGGTZG.CAGAlTGTT'\p1 C," N ~,~n1 1,‘ ‘ ;wr1 \r1nq» UAUUCU CAATTATTATCGGAAGTCCGGGTGAAAA ATTACCATGZCCTCTAGCTCAAGGAGCAGCGT ‘I’V‘lU-ii"AGCGG12:M vm «Ntwmmmm.G-LJAC'U ATAUCG"""CC9TTTGLGGTTGGA‘GCAGAAGATGCAGCAACCTATTATTGTCAGCAGTG 111chv l’.'III H"!V -r ‘4 J.__J_[I];I""‘\QCTT"GGTATTC"AC""AA"‘GG;AATTAAT"GTGGAGG‘GGT GGA 'CC (SE‘ ID NO: 293) Multispecific antibody CZZSVSOKT3m—IIN hasmy chain (antibody OKTBm attached to th63 minus of dy C225V5 HC) .J 3NCi: YTD’IIINR/7(K,‘RP rv‘ CDT 1—- L. 11.11:) V L’D‘KJL’D‘JDJDI‘I"TGYINPSRG TNYN SSSTAY SAVEYD1 CnRYYDDHYSLDYINGQGTTLI 'DIZSSGGG .'.LQS 1‘7'7'IVI'D'7JSDSSSDISY T S KLAS GVPAH FRGSGSG'I"SYSL"ID7 GD/I77'Z‘1E D2"7T'YIYL7CQQWSSN :EJQDVQLID‘QQ GPDC7L7\ZQDESQSLS'DICr 'VS IIDGLTNYC\IIIWVRCSR 71C NIRDTSLDLSIIIKDDEM:IKS Q37 7LLULD777 LYYCZ-RDL'TDYYLY7ED7'LD11 D7\/7'I"7\/7S1D«_Z STSGC'ILHILGCLVKDVDEDD‘VTVSWDISGZXLTS"VETEIID1D\.I7:DC‘ISSGL LCDDIDQTYTL7 IV 'L DSN"D7'IC\LKYVLDD 2171.3 .GGLSV SR'I'LJVDDCVVVLVSDIEDID‘ *7D'7‘VDZKI7'DIWYVL x/EVDINADLTDLI R777 3QYNS'I"YR V‘fo‘x/LTJ77\, L-Q LJCDKYDYKCK3‘7SD1 KP.LRLRLD 7ZL'I"L.C\DIKZ317GCJD7_1D RQDIJCYTLL IDSE-EDI'TKDIQ 112911177311171G0 D7377. ND'D'1\.T TDD‘RVLDS DG S EFL 71 SKLTVD IS JLDII‘IICQC‘IGNDIZE TQKSLSLS G:7\'7* (SEQ ID NO: 291) NUC 30r1DE I11(DOAA ."I'GG V I1- v w ‘J'_._ 7’1 f\f‘i,’\l rV {V . . DIUJ'L \J \/7\_ GGG'C 'GGTCTGI TID-LwILDafI" ]"'CwIC—.'I "I 23.1 23.1.D 2511-11 i7‘CGZ3uD-L L,Lw['.'V r1 I""(l\hll\hl AITI ,V’\f‘if\lf' VrV1I1"'IAnIA1.1—112—CCZ 7D1C7'L,"].D’3ICZ3IZ\C WGANI .'"I‘CAAAG2D1'I".D1Z3I.7D1.G. CZ3DZ‘1C7 CC7 CIDICCD‘GIDI'I".1/ID"GCAGCAIG73Z\C3 CGC7J'I" .7D1.'I".7D1.'I"GC7 C7\GCITI.Z—VA‘w'n(—1 (VTLI’7.7D1GL‘Z I’7f" DCGJ- V ‘7}77 \‘IJDI.(-V I-rI rV Ir\ ' A \KJCIA D.."[ 17’3CD'I G'I G73Z\I3C3GD .L . \DZ3.

"CACIAwaa'LmGPIWIAITGGGG'CAGG‘":3c2C""PCACCCTTAGCDG"G"'CCTGC" DCJD""CGTG4"GI:33GGI". CACflKXwCCTflDCP7TVHCG»IHVDTGI"'21D\IC‘VIsAG'CX:GG C:Z%Zx‘[]..:a (:2AP'GCGchGAg-AA‘DI"‘"JP'.CCIGAGCGCIZI‘DCCACCC" T.TGPIA CACCAGnuAv4"GCACCACCCC \DCUTTGI "TA"GAT ALLAU3"- If‘ifN' rV . 127-71.Z\‘7"H11 —V V w .‘J r‘ G ,1 ,ZV . r J _'1} \3‘J \3 \J \L. . .\_:CGC:I‘7,Z\CDZ3. . .7D1.'I Z‘xGCC3" 7' GAG C 231 T .'Z3.I—VrV.,.V_rV. Z37]."wCZ\\‘VJC/Z‘CII’XZD‘77 3.7.77 V\ ' J'L \J'L" 1L,I3IIDLZ\AL,V_{’1 7"er I err‘ I1I 2A I1IrV1Z.AIrV (.3. -fL,ADLD\\"L,Z'.\.I C‘D- r rV A V rV1 m V r7 7’1 f"77'_1\_:..lr-f\|‘.7IIZD1LDJ_ GVnI ’I‘V—K. ML V- If‘ir‘ilf" rV- DI3GTG —V 7773 ,erV 1fV f\l". beL T'I"'7I] . VLADxAUI . J! uJ'L" . GUI {V rV 'V \JG 1I \/'\_ L,Z\ r[.rV r" rV -A (3 'Vh‘l DJ. ‘JC ’771G‘.,77I7I ..ZAXK/ll'\;\, .A.\_.rV r: 3GGCCCG 4GCCD'7'(_ -2C.2’-\.Ii.G73CGAGO; —V-,A,':rV/V..r:'{1 J! UJ'L \J ,erV. Z\'7 7‘ 47.1.DLwID1GCGGC7 ]"7"I7'"7'2D]IGC.73C77D4DC7JZ3D L7I".DZ3"].'CwGC GTGJ'37A? \J'LA\ I]7’\CII7'"'GC,I1C G 4G' "GC’GC’CD 77:7Af:{7‘ f‘r‘f ’I‘(.12 JI\JK_ L,K_ \J‘J 15.31%;. G 3C77C7wCDDZ3DL‘x'4 GG‘CTGG7 7‘D477.1 4231TI"'7 CDDCI‘xiwCin'37GGCIIZ :CCDDZT'I" Z‘x'I ZD1.I731 L, AL,rV rV {V GI'W {1| 77275.1(;7IDICCCL7CD7CL7C' GZ-\.GC37\7I"'I'2-1Z3.Ii7Z3..DIZ3..GZ3" 7Z31Z‘1C7Z‘1Cw7C2-I.Z\2DIZ\GC7‘Z3.GGI TG" TTAAAATCJAACAGCCTGCA.7ACCCAC-JA-..CJLJCJATTTATTATTCJLJ .JC LJLJCCJCTCZ C TATTATCJATTATJAATTTCJCCTATTCJ CJ’CCAGCJGCACCC' C~CJTCJACC -JTCJ"CJCCJCCJCJLJ AGCACCAACC JCATCCJCTCTTCCC CTCJCJCJACCC’ 'CC' CCA‘.GAGCACCTCTCCJCJCJCJCJA.

I—-J «man—L -LJLCJLJGLJ JLLJLJC LJ'LJTV Hz—‘LTJ -JJAmm J -LJ \-VL’J\;.ILJ mmfi/‘V (EA Jmmm JII—AJ—J—x 7 mm A) 'T" m/‘VI—x. ,I‘va‘r" -L EACL JL JCLJLJLJAALLJL'JLJLE G LJ -JGL GL'ILJLJ LJ'LJAZ-L LJTLJFLL’J‘LZILJ -JLLJC-LJ LGACLJ ALJLJLJLJLJL'ITHLJALJA LJJL L CLJ CL’J'LJLJ LJA. AD An—x J anI-J J AJCJ-nnI-J Jm JI—erIAJ A. LJ\\V- iArm—J CALJL CCJJ—J-J J .m «m7 J—J r.

' LJ-LJ"LJ!‘\1LJ \V TAC' CCCTCJAGCACLJCG' CG 'CJACCCJTCJCJCTTC'CAGCACTT CJ'CCJCACCCAGACCTACA' CT LJLIJAALJsJTCJAAiLJALJAAL- .L.JL./LJJVAALJ*1/33 "\n J r‘im‘flm‘fl KIN/3" "F‘A"\fi LJCAA JLJJLJ'3 firJ—Ir" LJAAALJJ EGACJC‘CCAAA‘7\/‘:7 '1 3"\"Ir33r‘1 7. .. .n 'CJACAAAACTCACACATCJCCCACCJCJTCJCCCAGCACCT.AAC'CCTCC CJCGACCGTCAG 'C TTCCTCTTLJCCCCCAAAACI’TCAACCJZ CACCCTCAT JA"L "CCCCJG CCCJCTCAJCJCTCACAT CJCC' CCJTCJLJJGCJAG1GAGI’TCACLJAAGACCCTCJACJGTCAACJTTCA CTLJCJTAC’LTTCACCC r‘xr‘r **\ ~r1 NA n17lr‘ "\:2Z\1271[16C rV L." VL;2‘1"L-: vi JL-JZ11221’1'TIVJ'LJ ' G 1."f\r n7X ~~J ~rJJ~J~JTJ~7 ("‘.r‘f‘l .n.‘~;JI.-‘r~7 ~~J~ nr 71 Cm"L-JEJL'JU’1L.J'. (3L;TL3;--r*11L3\.3L-J[1;‘.L3L3[1(J-11*1..’-IADTD«JANA» 3L; 3iL-L-J LEVI 'LLILJP’X 7:1I,.-—J\~J~J7J LMJJ "TV" A» 7J~J>JJ~IJAI~\ L313 .J'L.'W .J'x; 2L1 2‘11;7"? F 7~Anmnmn¢JI IJmf GDADT»TAADJ meADm~~A~7 7nfiflpw L. T'L. CZE‘ 12:121'; L; I; L. l L- I; 1.2‘1L3CL; CL. 2>1 - 2»1L32»1-r1;--r1I-J'L. -CL-J'Zg1Z1G CAA-r‘Jx-JCI; 1.2‘1 IJ-(IJJAJLIJAJW JJ ALJ 13-J'\;LJ'L;IVI.» GZ-Z1L-J 'AD"..r~amLJ‘CL:1._\;LJ\J_ L"1-L.I.-ACJL.LJA(.A L. -JL.L. - JG -2»1-lIC-J(JIC-JJ1IGPJ.

CTT‘ CT‘ TCCTCTACZCCCACCTCACCCT 'TC‘-A'13CTCC ‘T""TGC;»-'TCACI’ ECT‘GCA A’ZJ"11CC’1C EA"/‘CCJ{.PGAAGZJGC".T’TTCCC'TCT "lCCCCCE‘Z».Z12».'T‘CZ1 (SEQ ID NO: 295‘, Muitispecihc antibodyC22515~OKT3m—E-E—C heavy chain (antibody QKTEEm attached to £116 C—terminus of antibody (2251/5 EEC) I"'] NC) AL.EE. D CE".

C'E‘JI’Q]JKQSGPGIEJVQP"‘Q EwJIE'T'C'E‘ZSCE‘CTJ’E'WI'3V "1W"ZE1538 .E‘CJ IELJEEEWTJ JV :EEI‘E "‘ISCJNT E".E' . KIDN"KS ,J‘JI’EE'E'KIV' .E"..‘J.E.JQ. ""0"" :E.IY"I.’C2"1.E1AE.JEEIYYEZ. I"2—1YEAE‘Ii3GEE.‘ AZ".S'E KL:I".I..E‘"‘J "Zr: E‘ TJAPE} GEAA.E.J(:IC 'J\Z ".:‘JE."/"I"'SEIJNCJC." E'..J EE’E' ‘E-Y"‘.

L831/‘\Z'.E"Z AT‘TYEN‘TEEEKP FI’E'KVEEKK‘J I‘PKSCEDJEE-E'EECPPCPAPEE ‘IvIr ,nI~-. L—q— 71"]UL?r113 1’1"].J IE‘KIE‘KIEJ .. IQ. PEEK!I’ TI"; .] IELEAK": ' I EQ"N"'E‘JR"Z'IV L"VEJ".E"Z']'.JE]")DW'..JIELJE’E""KCIK"7"‘E\./LAE IE‘2-1 PI. IJIE‘IQ‘J.VY’EJTJ PP"‘PE .IEEVEE.‘ KN QV S.

"ETC 'JZKGE:YPE3D2E2"1‘J/.I]EIJIEEEE"‘J EICJQ ...ELE‘ .. V]'.QKEJLLJEJT..IEJ‘C'L:L-.- V V'I'\If‘ - '-f\r' J. - - - V—VJAJVAp wry- _ _. JLJLJLJLJ3C3JG‘J 31305313".3 EIE"J.’"E'EVEEEE’E‘J’E"WE'LP’") JLEQE’LJKSJ \EE‘"‘PGY'.EE.\EY ‘EEJEE TE). SSS 5Z1"YYCARYYE) YESTJI )‘I'EI‘""CIST E.\I’SE‘CI’JGCCGGGGEGGc1281 \ZL YMJTVI QQI‘LGCTSGTRWTYDTSLLA‘SG‘JGAHFR. SC.

CT‘PFTFGSGTKTFTN’R’A (SE\_ TD NO: 296) TTDE S E GC CGTCAAAACAG GCGGCCGJGGG'GTCJCTG GCCG?GCJCAGAGCCTCJAGCATTA.

ACCGTTGAGCGCTTTACCC 'GA AALJTATGGCG' CCATTCGGJPCGCCAG-GCCC GGGC-AAGJCCJTGGAA'GGC' GGGCGTG' r"TTCJGAGCJGGCGGCACACCGATTAT.7AA’GZ-CC GCGTTTACCAGCC GALJJ.ATTAAC.. AGATAALJAGGAAAAC.CCAGGTGTTTTTTAAAA 'CACACCLGCAAAGCG-GGATACC.1CJ.1ATTTATTAT GGJC.GJCCJJLJJLJJCTCACGTTTA.f7 AATTTCJGTATTGGGGCCAGGCCALJCTGG’ 'GTCGJJTGGCJJCCCLTAGJ.2CC AZA'L;5‘55 5555.L.C.2‘.TL.L_JG:‘J-1'L.‘5-'L.‘5-'L.57171155755 1351.1» 551I 55» 55515-555 L: L. GOG 5555 \JL/’_'\3'I_/\3‘J' I. Ir—rw.- ~4r1~1 CrnrV ("11(17’ 545‘ 7 r5r.LLl'L._‘. ir~=x1wr1 ~4~15~5~r~5>n vLL-‘J- 'Z’ELIA‘J-'L.'J'L3'22' LJLL‘V‘G‘J ‘.'].L L.7 '1IrVrVr'V. ~\ r "117")1’2’" :5n1rVU‘CJIA‘A'L.»'2'L.l‘ALJ‘J‘5 It‘V.1II-V< 555 'L.‘-'L. 'LLI‘..'.I‘LJC.‘ G". 5J.L.J (JT‘-£"3;_'L3'JTA‘G It" 5‘ 5:5. 55.5:5. 1 55 '1 55 LG'L.L.'L. GACAG£-- ("T/\GAG'C‘C"GGACTCTAC"GC lL.21L.JL.r55. 55.3 rw 'L.C.2‘.55 51 5C 555571.157 5555555 55.55551 5 5511517 'L.! [ACJ 5TTCJL3‘1LZAGCG2‘AUC‘I[3J- 7155.5155517»5lL3I5-.r3.A.L.\J55.55 .23 3G 7T-7GA:27AG2"3AAGTT GZ» GCC G'Z‘ A 2‘3TCTTGTGACAA AACTCACA"ATL: .7CCGAGC"‘.CCTGA"3CTGC'T'7 (5 L.L.L.C .. 5555555555. 551 7 51 A r’ ,555‘.A2:-{3~J2‘5-.AL.'L.L.TC2‘.TLJALT.LK.L.‘J.J{.~J{32A'L.L.'L.L.i '72GLJ'TC.J‘JA.A'27 » 55575 5555555 551.1155 71,55 555 5» 55555555 515 5 5 1 7 5 7 1 55GCC-3'25.

CJACCCTGA -7L':2TC.'A2nGT'T'JJJA2727GGTAG'C {:r~r-r 7'7G .55G'I‘J- LlLst-2‘3‘5-L.2‘3LJ\J2XCviI7I5155.5155517551I,55 557155555 2»3|.JL.\755555555..55I.55.111[5L.'L.T‘.[2‘3‘.

I555, ILJL. (..‘..rAA.‘55 5 LLllfAl‘AvaULIJ.1 55 55555715555‘. 55»5;-(3‘5JC5.J'L.‘L..2A2 DOA 72A55 5 55.55 55 5 7A5223 '22C"71 111 C52 ’C‘ '7GCTGCTC’225Cil‘lfim‘CCAGCJACA"CJCCGIGC 7T7GGAGAGCAATG GGCAGCG7GAGT3CACT}. 7ACGACG‘GTCC 2CGG"m""r1"11 - .55.- w 5555 5m 5- 555555: 27." "2773’21I’7‘Z‘("CILSGA‘AC ~r71 VFY1I'I'I/‘n' .rx-p r1I5-553 LL, L,'.1‘J‘3'L_ ACJCT‘AGC.,:.C.."3L5L,'c.' an"AL,27\.z.‘\‘5212.‘\‘L21 CAGE-:1 J'LZ'.\_5£L\J'L_J2L1'L_"\J 7 .LL,. L,2L L:L, TCCGTC’\.’1_'L:L,2"' :7AG GC'2'L,"2’" C(7212LC721Z‘LAL,‘\L"22""C"C27’73GAAGCJ2JL,""LJ""‘LJ‘2‘C"" 7"].‘CTCCGG G".]AAAGGAG 7TG€2:72' TCTGGAG :GCGG’I‘T7 3G‘T2I"C"‘CCC7'C’111L:GJ23’1'JJ,\K27 7"".7GTGCIAGG ATCLAL:’7’7G272\GG"7C 1C'"TGA C'TGC'AGL,G21 7(T2JG‘2:7'. "CCA 2A2""GGC0:3 CC’7C'"GCA ZALKJ'L- L: ."2[] 7A.5.‘.2 5.‘\.‘.3I".’"f"' 5.v m 5 m 12-3 5 {5—17-5155J.L\_J'[Z\3!Axl\3\'7\/l23LWC,‘LJ -.L2-3.L2-3C‘--,1 5 55,\ Vr'1l"1n|‘r1n 5 (2‘ '2T'.2]'[2'2‘3'L_J[7.51 55555 55555 r'1hl'n mm —1 r71 551.51 [5.5555 L,'L_J L3,: J.2-‘.J22-‘C‘- 2253-.GLJL'T'T' \J'L:\.:5 ["T’ML:GAGCJ 7TCL‘GG 7."].‘C.AGG' :2G2"ATGGAT 2:7'GT'T" A'T'Z"2 C25ATCC2JG2"137 GCC—7'1"GCI"]"2[7'IZ‘3 '22'[Z‘3'L_J L,2.‘2‘3'L_J5555- 55711-51J.2‘.C2-‘.5.2L‘.,'C52-3Q1."32'AL."3'.[5—5 5-1 5- -v..51,557 5 rV1Z\2-32333‘ CLIA5-1‘5—15555.55,\55I55V‘-LL,'2' ‘32L,'L_J2"3‘2.2JC‘L21.‘\2AZAL2AGC/2AJJLZ‘3'LJL,ml 5555 ,-555 .'L_J 2"32A2"3'L:2‘5. 735151555515Cur :r'1Iz\r:1_IV (32353 C27'f7’22l‘1 .’7 2'77\r:I.’:7(:'2[' G2AC‘227'2 5-1 «5 '7 5 err f"" r71 In lx‘u'x CI1.'L_.\_,£' 5ZA‘JZA‘JCZ‘ [Z‘3'L:L,'L:L,2‘ ~rr1x1lrr1zJ. ‘.2.‘\' 2'3 V215~21C5.C: ZAC»\_,£'..'L:.

"I 'T'"]2' ’\.’1_'L:,\"" 2AC'2["A'TAGCC :2G2"\.T".I‘. i2:7 7GG"].‘CA 27GL:2C2"CC2JAC2JC‘2.‘ :Z‘LCCG'2["T2AG V'zhzhmgsTmee Z‘3'L.552155555]:55.55- 555G‘JI LjL:L,'L:C:I.‘. (3‘53.5m -5.- r7151AG‘JLAJ'LJ .L:\.:5'L_JL:.‘L3J22‘C:I‘J2JC2A12-3.'L.2..[2'L,—5555555.v1I5- 55,555 571.71 - "n 5-n.-.-x.v155.v1.- 55.- i;\ < (, T:3:54 C3]CGGCAATTATGAGCGC GTCC3G3TV‘TAAAA_GTTAACJCATC1AACC' G' AGCC1 1%TGTTACEGTATATP GAA.TTGGTATCAG ,AGAAAACGGGLALCAGCCCG/-A/CG) ’3_:I3 T' ’GGATTT.1T3ATACCAGCAAACTGGCAAGCGGTGT CGGCCTCATTTTCGTGGTAGCGC AGCGGGZ CTTTATATAGV’TCTGACCATT.CCGCT..TGTAAGCAGAA 1.1T 3CA3.,'ALC.CTATT GAGTAGTG3TCAAGV’TAATCCGTTTAC ,'TTT 1G' AG CA..ACTGG/-AATTAA Muhispacific antibody CZZSVS—OKT3m~1.—C Tight chain ( antibody OKT3m ed to 1116 C—terminus of antibody C225v5 LC) AMINO A117T SEGTK,TEN-CE DTELTGSPVTLSVS'LR‘I’STVT‘TCT’1SQS‘TCTTTHWYQ’R'TDQSE‘LL11V1ASESTC’T""73% 1.1-111m..mTQ~5_\-\1 91113 -TS‘VEL‘ETSTIAT YY CQ’1 :TTT1111TTZJPT1T'1'T‘TC13’T1(LELIKRTTT‘VTZ».Z1PSVET"T' K‘\ITQT’V-T"1J11291L"‘SGNS’YTSVTEV’WDSTV11""VSLSSTLTLSK EGGLSS 311111-33 -G -S- . - . 1.1-.1.-..H.w..,..1,. m V..- ..1SI.-.-':~I.-.-G S -G I-GGGGG G»1.1 7,.L,m .

GAELARPGASVKMSC ASGYT5"‘T11\‘.1’"1TME1TITVKQRL GQG I’IW‘I’ITGY T1\TSR 11"1'NYNC1'4 TLTTDKS SSTAYMQLS 8:.TSET SATx/Y 1' TARYVDDH S.3DYTNGC"’1"1T'TLTVS S GGGCIS(47 PATMSASPGEKV7' 1Y1)TSKLASG I; r‘ NUC TJELZT CT" ,yK-, ,1-\JZKKA TTK1..er .111-TG..GT1Z1GZ1GLL,K GK:TGZm1. 1} —. 1 - . L m 1.1 V- mum-111GLG' "GAL—K CK. GGGLG2\Z1 1.1 1.1 - 1 T1 G "T."GAGC'T' "1"."[Z1L1C' GT1."3CGCGCGZH3CCZ1CZ1CCTZ1'T T GGT‘ Z1Ti3C231Z3Ji3Z1TTT' "‘73'T'T‘C141'25Z1'Z1GC2"1TG:CCACCAZ {'er r\I/‘ \xGUVx. TC '3LTJ".TL12 A':"T[] A.Z1A]'2"\."1'GL,TZ1GCG 3AAGCA'T]ALG"3GT3C2‘1': TC AGCCGC .VVI-V..'-.-1. .[ .K_\:IKJCZAV\.T.,GT3’1K.K,K3\_J'G2L\\KK,K3.Z\1.11_LCJGD1GGZV1TP1Z-1CA-1Cj.GT3Z‘1Q'GAJZ1Z‘1K3.f‘{" f‘ - V (-1 V n rV {'er rVrV. V r" rVr- V rV1hIrV1I1I 7x3 V (-1 VrV1 rV ,I'x -.rV.VV ' VI'A -' VrV1 ,v'VrVrV',‘ r n[1V.\.,'G.L2\K3K,.Z\.-2K:IZ\..\T.:Z.'1C’1Z1‘31KJGGLCI.Z'\.K,K_Z\T.C.11.1GT3CTJLKJK3KJLZMI er ,I'xrV V1 Irrx- rV A V _ V 'n "II'I'I,’\rV ,A(V. r‘ r\ r" V rV1h‘IrV1 ‘1 -~ (V. ,n (V ,n rV V\ r" C’1AAC'L3Z12\L,TGI1‘2"1CG'."[ACGK :IGT""T'GLI1C3‘Z1."T‘ ‘"PG".1_T'TT'T‘CAJI'.3TTCT.3 CG CT,"Z1"1TCTL1Z1'" rV7 rV V1 V- V "n m VI'rI err V.er 13.!GC K. KrVr-"GKTrVn[. rTrTTG . . . (3211 K, .. .1L,. .. .L J .L GILL, \J\ AGGK. Gz..12-.rV f‘ r" r\ 712 1TZ1T3‘Z3T3TT3GA/1GL]—K r 1C.’\]'2"\.Z"1CC3T,CA/ .‘CJGGG'TT Z12-L,TTTL,T C2"G‘3Z1GZ1G'TG'T' ’V‘."T1GGI1C1G3Z11L1GZ1CAGL] I.L,TT1T"ZHC:I:LTC!xCCAT\:T‘ClCL3CTG2-1C3 ‘TT rV/K7 V. Z31 K3. Z3 rVerx '.-\.CG .Z1G'TCT ...GT.3C.1.G G2—Z11G'. "L,Z1L,K_ CAI..... 3GG.- m -. 1 1 I1-I-1 ‘ \J'Lm . . ‘.

CCG'. 'CAC2"\.T12\GI1GC". r. ,A er' er' ‘h'l "I'I'I V-[rVI:rV/V V . (:rV. VV VrV1 V 'VrV Til' z/K f r" . LZ‘1Z1GZ1K3KV\:KV2\K3Z\KJ_I TJJLT3GZ1 ’HJ.\GK.2‘1 .1 GKJZVJV .GT3 CTJKJ1 GZAUJKJ CTC'TGGCGGNG3CTTTC231L1G'.TGL11"1G’\CGZ1TL,I1GTCG 1A.L1.G'. CAGG ’1'TTTC2-1GL3': G.—K ‘1'" rV /’\ AG/1L.,A ,n ,A 3K,Z\\...rK ,:Z,1-.11.—K~—1-\.Z\T "(V errerrVr' .3‘ V‘..Z1LK3..LK,K3.\JK_ 1G21Z1GLT3'" 1231Z1A'. "GAGC T"1'2A.Z1A.GL3Z31GT‘CC'T TT’3]A CCTTTAC J.1LLALA.CMm .. 7\"\ mm‘nm‘nm/‘V7. CCATTHGYLLA-ACA1CC TC"A"V/‘V‘r mm‘nr‘ "V. "K/‘Vfif‘fi. JT’TT‘JLCLGGAA GGATm 7. "Vm‘r.

TATCATCCGACCCCTGLJTTATACAACLAC‘AACCACAA TTCJ AAGAT7AAAGCA. 7AAA GACCJALJ L.G.A LAAA/LJLLAHLJAGCACLJLJC A AA "m 7 AAA AAA AA C "Am m7 ,A/AAL1LLAGCT GCA LLLJALJLLTLLAmfi AA AAA ALCAT GCAJTTTATTAL, TCCA JTATTAT JA"L1ATC-7CLATACCCTCLJATTT' GGC' CAC-1CJ'CAC C.ACCLTGACCCTTACJJCACCGTGGTLJLJTCJTAGTCCJTCJCLCLJ GLCT' CA GGCGCTCLJCJLJGTAGCAYAT'LTTCTCJACLJAGAGTCCGGCAATTATGAG ACALJTCCCG ,‘"V.L"‘"\‘r"\‘r "Irv-1m 1mm lr17/"1"~< "‘ n" ["17‘ 7\"‘r1r."1 r."1 r."17\1-."11T1r1"V 7. "\7\ L3 K’JAAAAAjiiACK.JALL2A'LJKJ7 K’J‘TA\L'JKJ7LJK7CLLKJLJAGKA’JLJTTNKJVLA Al LJKJ' A KJJ'"\_ GCAGAAAAGCGGCACCATCCCCAAACGTTGCATTTA LATACCALJCAAACTGGCAACJCGCJ I"V. .r‘firfi" 1"}"11-."11T11-."II"1r1"V nfirfifim "#1 film/"1 L1' LLL-1L1 .ACALLLL L.CTCJ TAHLJGLJLAGLJLJGLAL..CTL 7‘ATATAGLJCTGACCATTLCCCGTA.

'IGC7‘—AGLALJAACLJATGCATLCAACCTATTATTCTCAGCAGTGL:TCAA CJAALTCCGTTTACCTT G‘7'7TAG NIT /\'17 JLLJJJ(VAC? ""717.KJL LL\»TT’TATCTTTAG (8777‘: TT NO: 2997)- 297(2){DKT3111TTN heavy chain KASGYT.'7’7I7I.'T VSLTC .JVKGFYLPSDI ‘JEST\.L1L:,PLJT\71\L LSLSP ( NUCTJLJLJTL. SEUENCE2:.

,AA AprJAKZL: 77K/HGK-JL KL1CAGCJT :77 j'LLKj'L: LLJKJHGHJAKJL‘JG HAL/'LjTLLK/ULJU GCAAL.L:1 ,KAm "Th—L A A,-.A,-L_r~.,-LA7\ A JAmA .LAA,A,- .r-Ar ,Arm ..AmmA7A7—AAA L L AAAA' sz’A ,"Vr‘.jLLTL: JAPM—‘GKLlLAGC.r"‘r‘."'\7 1-"1 "\ "* —. "\ ,"Vr‘r‘,"\’1'\r" .. "\. :IK17. TA .T-7AK/L."\r". .. JACK-CK."A .. -"\mm"\m"\,«"\r‘t7L.L.JA.L.JALJ'LLA7.K1L..JL‘17TIJ:_T:1GT:1LL"\rV. .1’1"1 "VrTH'nZ‘A . . J.[AA/AKJ’ 3L- :7. KJ'LJ («/-j'L.7K"7. K/AKSK71G}1 Ci."l «71 'V( m m :1K.-1/A.L."11—. "Ar-'7 .. .r‘fi. .. . 1L3A7T J.

CL-CAAATTCJAALAGATAAAGCL-ACCC 'GLLC7JACCGATAA.7AACC-7 GCJACJ'CLLCCGCCTATATCC A7 Yr. "1T "‘7\"‘ "mm/"V‘7‘ 2K/7TK’J‘AK’J‘CLLGUK. r"n./"17r1‘rrfi"‘7\ K.J'LJIT'LJALL1A\L'JKJJ’-\_TAK77J'CCJ'CAL1TLTA‘TTACCA'TGCLCCJ'CL TC-7ACTATACCLJTCGATTTTGCGC' CAGGGCACCACCC 'G7CCGTTAGCAGCGGTGCLTG C' 'LJ'LJTJ-T'L’J27. 27 27,27 277. 27 'L’J -JTET-J LJL GLJiLJ'LJ2.27 22.272- .. -LJIT'LI'LJIT'LI'LJI' (JGLJ'LJ 3T ".CJ CLJ/ BITTTCTGATCCLJPT 3A3272727272722. I7. ("m T227 227 I. .2727 I727'LJ'LJLJIT'LI AATTATGGCGCAATT CCGGG' GAAAAAGTTACCA' 'CALJL"3 GTAGC :JCCALJCACC/TGCG ATATCA:TT G") II—JA'C7 -LTJC: GAAA GCGGCALJ'CI-GCCCGAA C .JTTTGGATTTATI.TAT AILJCAGCAAACTC‘JGCAACI’TCG' GTT:CJ'JJLGCACATTTTCC .JLJTALJLJ3LJ'TA LJ 'CAT ATAGCCTGA.CCJATTALJCI‘JITJTATITJCAAGCJ'CAAALJATGCLJLJAACCT TTATTGTCZGCAC 'G L? CAAGCAATT'TCTTTAC‘JLJTTTLJLJTACJLJ'CACLJ'AAAC’ 'CCAAATTAATCGTGLJAGIJTC ITJTTJATCCC LJ' AGC' A?ACACACCLJCT'TLJ'GGGLJ'C'LTT. 'GCAGCTJ'JAGCCAG-GCC' GA LJLJATTAJCTGLJ'AJ'LL.GTI.TJACIT’ CLJ:CTTTALJ'CCTGACLAJACTATGLTJCLJ'TLJC..TT"}GG' LJCGCCA GACCCCG .JLCAAATEGCCTCITJAATCGCTLJCLCGT JA C"JCLJ'CLJCLJALTACCGATTAT AACACCC .GTTTACLJ'ATTJI’TCGCCTCACCATTAACAAAITJATAAC.’ GCAAAAGCCAGCTCTTTT T' l AXPTZXPT I-—w C12$ 0 N7:72/Li.1 I2I-J IJ'_‘.IL1 rIl3::>CCCAG -:2"I.’T‘2-CCGCG29IT "1 TAT TATT AC AC JCGCGCGCT ISAC .,(1 .T. 7)H t: l-—w C 55 5. [- I7:- ilIATTTGCG"ATT JL'J'GJL'J' V'GJCZ-LJILJ' CC -‘:TG2"I.’-‘I’LZCLZCLJ 7 27I.27.»\I.27.277 -. 27 727272727 72 2‘TL3LJ2»XAL3 'IL3L..E_J 2A T 27. .272-. 72727.2 no I_J'L3II3TI3 'LJ'LJLJ'C-LT L3L3E3AE3LE3 T'II.J'L.I.27.27I.27. 72.77.27272 2777.2 .73T73TI3L3I3L3I3'L321 ‘IlTlI'1lTl 27 2-7 2‘ (-7 2‘ I.2~. Z‘ I727I272 27. 7 "7.2.27 "7.7.22.

- CL. LJGL 3.'«_2I ACT-2 ITTTCCC‘CGA’X"TTG’T‘TAT’GGTI’WT‘G ‘GGAA 7A: NAIITK 7 'wnv («272-72722 \r . I-r L ZJGIV 'L3I.3'\3\.. ’111’1'1/‘1n1/N' (-72 2 I;1('Vf‘f‘(. {:7 ~r.'1*\ A". ["T 23- E . . I...

TAC"LICCTLJAGTI."-‘C’-‘TGGTCACCGT- T-AAA. '7 T T CHI ACCT."I AAATI"'T TC 2.277 277 n 7TJJALJAJITAA- 2.72.2.7TI.LI2 A g-JLJALJILJ:-.-TI277 :7 7772777277X27I2727217I2.7LJLC I2727 nI 2727..62L..I.G_Z"2I.ILJ;I2_I27..- I2727 r1'LJ1GI’JGI’JGGAIJLJCIIJJJJJTLJ7 272727..77 272-.27 .2..2T l'I.27.272-. 272-. .JI2.UCC C2‘.A;_.r»TI_J'L3I_JrX21"IT-IA7 » 7 2727277 ’M‘"r"7 77. 72.27277277..7I2. . 2. 2727.

.L, .2»‘.T(3.r»‘Tl'L377 7727.27I2727I.27.276 27727L32‘.L3I.3TI.J.r*‘TI.Jer.277 277 .27 2‘. 23'. L3LJ'L3:;.- ACCCCJ. - I27I27I.27 I272: 7I27.JI2.I2J 277. 27GU21. -E’L3TI.3£*‘TI.3'L..I_J.I>XLJ7.7.277 2727277 "2"" 7 'Yl’XC-EJL-J.77. 72.27277277. 27 72 .72 'u‘TrX 7.2.277» 277 7A 2727.LJT'L3I31‘TI.JL3\.:I7277 I27I.2727 'L3I.J'L3 'L3\.::T' '2". 'GTI3ET;-L31 T'C 24-2":C'TbGCI TIA AG 21" -‘:CATZ 2-. 277X 72. 272 727.7272 7 27» 'L3I3 LCITCLJEE3T3-tI2..I.I277 I.J'L.I3I27_2727.2 .27I.JL3 L3LJ2'X LAGUALJTL3L3L2T'L3A2XTL;'I;IL_,A2- IGAGT2»‘.L;;_AI.3TI327277X 72.- ""7‘: 2727.27 7 772 2.. 2,. 7-. 7.7.» 727.2.27I27q2:. 7. ‘ I.... "CC,C2‘-TE_J7 72,. .72.I2 727. 277. 7» 7 27.2 n2 27227 72.- 2,. 2‘.L32»‘..r»T;_.r»TI_J''12 TL, 'CLAA TGLE3AAAI3'L3I3'- 727277» 7 272727.27." 21:3 L3 2:. (72.27.2777. 77 2,. - . 7L32": 277. 2727.2.272.» I.27.27I.27..J_2.27 727n.-2.2727272727.72. 27272 7.77.2 -. I2 277. 7 277»AD ‘ 27272 27 'L3I.J 'LJILJ'LJIJJXCIJIX 2‘. 'I3TI3T-A'L32LT'L3LJ'L3TL3 L; ‘TE.2'L.I.J 'L3I3'L32‘1'L3II2‘. I2‘-TL3[ 2I.J.rf>XI.;I If"!‘i{"‘\ 2- 2777.11 7m 7 I27 2 7... '0 .L_AL\I\J\/l\_ ‘LJJVLJC EJC. LJ'IJ LJr.2sz.VrWIf‘Iv'\.'/'\'/\f\I{'\rf1IW'l("1l'I'l'n \3 .L (L. T23 .JCJ'3103\sz.LJZ-XTLJG‘LJCJ‘LJT‘JGIX7I 7277727- 27- 7272277-3GAL~Jx GCAJATGLJCJL'3J'\LJC"CJIAGAACAA"'.'I\IC"A:G2-:CCf‘.Ii'J"CCTCCTC'GC'f’l'GG2-ICVETCL'J‘GACGCC'TC CT".["C".["I'CC'T‘C'T‘AL'jAfiGCAAGC’" ;\C"C(:’1'LJLJI.C2-2".."JIZ‘I'J‘ICA""".C’JCAGL'iAb AI3G2-I.‘.CG’1‘CTTC :CAJT C'TCC "TAA': I"JCA' 'GAGL:C"["'[LJL'fALJZA‘CCZ"'[A("CTALJA:GA. "‘C""C"CCCTL ".

CTL'CG ’3’5’1'2"I.A2"I.' 3101.) AM: 1L. ACTD SEQ INC LIJ' T‘JQLKC‘S JTCLVQPSQSL :.TT"’»}VHW‘»7PLQST‘CKCLEE IT GVTWL GTTJNTDYNT 'T ETSRLS TT'IKDNSKSQVFEKTI’TTTSLCSQDTJ.TY T LJ'APAALT 1' '1DYE FAT'JIJ'GQGTLTI’TVSAAST TSEETE'TGPSS KGTGCSAALGCLE’KDYFPE h- VL‘JSLIJNSGAL'S,GVE3LT F /TVPSSS,LGTQTE':CNV \JrTKE’SLTTE VD KKVETKSCDKTE TCPE‘CE‘APELEIGGPSVFLK E'E’PTT'i‘.DTLT‘TTSRTPEVTCV\17E\/_}E/SHEDPEV KFNEILJYVDGVEVET‘JL.E.TE.E‘REEQLGSTYRVV SV rEGDLILUJCKZY.'G VSNKALPA, EL-E-EL Di] I91 1.] -L (0 IAFEE3LC.3 .J "U DUIT] n-J CW <3 -] L." L11 EU m 5‘3 ,_ L‘J LU r7».31 F3 1’532 3 {B LTCLVKGFY S ITAVETIJESNC"PLT‘JEKYKTT'L PVLDSDCSFFLYCDKLTVDE.SRWQQG JE,7FSGK SVETHE". ETEJETYLQKSLSLSPGE1T3SGCCG’GGGGG 3SCGCGSTGGQVGLQQGCAELARPGA TRY TLEITHV‘JVE QRPGQGL''E/LJTGYTN'L 'YEVQKFKDE‘KA''GTTD SSS (:7) C134.11S4 *4. F4 (E) 335UK 1.

KLL1LA"f‘r‘r‘T »1\1, 'LK3K3K3J. (3K3LE7EKITE1 11-31"; 1.~r~."r‘:""’L K3'31K.» K31IK3K3K3 ' CCGT'TTACCAGCC’TCK7".'ETGA-GCATTAACE" 2‘ .I»GI5L'E‘25LACAGC2»-.27»L2ZEL.27ZLGCC2»LE EG’T‘G'E"? T" 'ET'T' TA2-.»7A 'T' 3A}-CAGr‘ ‘\ ‘\ ‘1 A 117 ’ AL AK3L GGAT21. -L3‘KZ»-{33ATAK,'K.'’n r r‘ T r~."‘ V’") ‘I n LTLrI1LTL n LTLrI1 7" 1 'E 1L. 1.".L L LAL LA'E Lg7nmEmTT 'TL7.AE‘PTT-T'CA‘LTTTG""TE‘T'TGGCGCGAG‘G‘".CCTGG'T1.7.E.»E7~KCC\7.-ELT1 L.-EE'GGGC'ETAGCACC .rELZEKG'7* I.»~~I.:r~I1-. ‘1}A11’L’NIIV ITK’1|T[.'|Ir‘(f"Ir‘(rwI."‘.."II." 1.121 x ANTI 1/er1rx'1-r> ra/ r‘(’ .3K3K3'K3 LK3K3K3GL£3L K.»‘«3 3 K3 JDIKCCL L£3L1iK..£3.r‘LL7E\.K3L7E\.K3K3EKK3K3L~111meK3CLGK3UK3K. 7K.»L7*-K3«3K3\.3In C («rwI-1rx I. K313K3K, K3CK3K.1~r1.1-1 "I11 111-Inr111» («If 7hr {angry 1A.11111~».r 11» ‘.'T‘ 1 11.111 ~r1 K.»3«'K3 J. rEK3.I.‘«3.I>‘LL7>.K3LLMTG LL1.'K3L L 1K3K3£3 ' 3L 3K3 ‘IrpnK3'EK3tT7:\.K.»EK..T»7:\.K3\.3 "f‘r‘F‘F-Ll ("‘1K.»L1'K3K3'K31K3 [3K3 H "Ia/K£~‘K33K3'EK3w/Nr‘r:r\r‘<’L3TL3K.»7E\.'K3L‘1.'K3K3."1 anmmc «CAK3K3K3K.LK3L'K.1L«3 T1731K3L1K31CLCTLKJGALL ~ m 111 ~ 11 amnm» 11.1151" 'K3K3 11.513TK3L1K3K3Lr1, :ImK3CILK3K3L'EK3113K.»L3r1111 "'T‘r’11 (111,1. .r1I.1~.r~I.1~..-1I\J.1~. ~~I r" Cmm «(1,1,1 1'K3K3'K3 ‘. K3A'EK3 LL'EK3K311K.»- 'TIGAAETECACT‘. E‘L E7 "C 77251.77 CA2»-C/ACC-A}«G 51THE AGES;’25G25AAK.'7"T T G?» GCC "AAAT 7‘. T T G'TGACAA.

ILL1K3[3K3[AKKJ_LGK3L1K3I53K.»'1_311» I.1~. ,1 11111 (11131.13 I.1~.r~I.1~.1 ~ 11 1mm 1 1'K3K3'K3L‘1.'K3 'IEACIKJLGZTI..'K.K.L13namnrwzr.

T r .C‘CC‘CC‘CAAAZjCCALGGACAC’E‘T Em2-LL‘. ‘.‘CTC'.‘CGCL . ICC CTG25 GL3’T'C.‘%.LiI3‘Z‘%I'E 'TGG .7\(,LE"'GALCCZ.CGAJIL3’\7E"7ETG2LGGT31253"?"7‘1"" :IGTLZXLGTGG}KC 1CCCETCK12\ GG'. 'GCIZ‘KT'ZXATGCL-"ZAGACAAAGCC‘GI"GGG2LGJAG "AGT"ICC‘XGAXGCACGE’I'AC'.‘G'ETG'E .‘GGTC AGCG' CCTEAZ CCL'LSTE 3CTGCACCIZ‘KGGACTGGCT1AATGGCA:GI’EIKGE’I'2"\(,2-.,ZXL3TL3CAAGC "ETC" 7E7‘A‘ZKC‘IKZ.ZXGCC GCCCCCAJTCGAGAAAZ E I53K,'T7". CCAAZ\\K3C(.LZXAZXG 1L3CAGCCCC G IKKJAAHK \/.£,'\.K/Z".CIIKJ L‘JJLAC DAG 13K,1 wrx- w-n «m "FF!" ‘1 (marshy r121 r121 nmI- a ('1 VA (‘7' '." 1 m 11-1111 111—1 ,1K_n.1r~.- r"f\ . K3K,'K_K,'K_CZ",JE‘EI3»‘«C3G‘3C’L’XK313/KL3ATKL32\KE:Cz-LAKJIFKHC‘V KLJLJ. LAKJK, 7‘TGLIE3CTGL3T3AAAGCCTJ :A’TL':CL3AGCG}""1 ‘CGC‘CGTGGAGTGLGILGACCAATG GG?AGCCG"\GZLCA1CTAA"A"TALG'CWC"C"'CC'TCACTLLGALL CTCCP'CT] ICC/VIC.-AL ,.Z. GCAAGC CACCG ACAAGAGCA #3:? I.1KI1:,11-,,A,1K,1.13K. Irrx \3! ask. .GGGG25LALIZ3GTC . TC'. C715 _ 3K1 TCCG' GATGC" " AGG7KI'.'K,7." GC‘I‘XC‘AAU.LZXL.ETAE I5CG("CA AA ’-\G'CTCTCL'ECTGT’EE‘CCGC TTAAAJ~AGJTGCATGTG.7.GTGGCGGTTCAGGCTS"GGCGGAGGCT'AGGTGGTGGGG 7. LJAL’J‘JLJJCJALJLJJL LJT CJIILJL"\flfirfi—x , "xfim mr‘rv," «m \1LJGCALJALJCLJGTLJLAJIJAACTCJALJCCGL CCLJLJ'GTKJLJI_fi‘nfi n A fir": «7‘7 —, 'T‘F .

ALJLJ\.'1TTAAALATLJALJC_LJTAAI-LJGAALJ7m'N/fi ‘r .. r—Jfi‘nr‘ mm 7 *fl‘rfl" -C3 JJ. iAiALJCTTTI _\-LJVLJ\'1i TALLACCAALJLLJLJATrpm-[‘7‘ mm ,..,, "\flfirfir—Jm MA .fi/‘V7. ,F—‘nJL’J‘JJ :‘flTAAAJAGGJTGGJGGTG-GGG' G'GGAATGGATTJGTTATATVAATCLJAGGGTGGT 'A AGTACAACGALJAAAT'LAAAGATAAACCACTC 'GACGACCCJATAAAAAGLALJQJGGLi an 7m—x/I—‘r‘ AGCGCGTATA"AGCTGAGGAHCGTGACTTCAJAGATAGCGCAGTTATTAG"GJ'GCAC ACJATCJA_CAGTATAGCC CJATT-TTJGGwTCACGCCACCACCCTJACCCTTjgJ GAGGGGTGGJGGTGCTAGTGGTGGGGJJGGTTG"GGGGG GGGGGTAGCCAGAJ'GTTG ACGCTGAJTCCGCLAATTATGAGCGCAAJJJGGGJTJAAAAAG' TAPJCATGAC'GTG'AGGLJ GGAGGAGCAGGGJJAGIVTATATCJAArx/‘V‘rrfififlfi "fimm‘flfi/‘V WWW—1pmJAJGAJCALALAAGJGGLALCAGPGGG/ALLGmm‘flr" 7r17 Jflfifl r‘J/‘V‘V 7 "Vn 'T TATGLTL""AGGAAACT "CSWSAMLM GCCTGACCAJTA GCAGAAGATTCT""A/"GTAJT Al TUTGAG ATr1r1r\r1r~7‘ ~~x~\ ’JITK ~r~r}1/~q* 7r~r~v 7: r~.r~."l'fil’HTl’fl Ax ‘1ITKI’I'IIIK «(x '1 ' JG - J. ‘JuLJ./»__A GGL3J i 1;: .LJJ 31 Multispecihc dyL225(1\N297(2)OKT3m—L—C light chain \iC' :L,JETCE [[JJJ'q P\7 W319SPR"HP‘(RAS’ '.AESEMXAJJ, J TxT w r GLGLGTDFJGQJS7ESPJTA{3f0JPJNWPTTFGAGTKJPLKRTVAAPSVP:PPPSP;.

EQLKSG' ’ K‘KfiKVDNAT ' APYEAK RKLPKAGECJSCSGGGG GJGGJSGCWGEGGGQVQLQQS GAELAFPC31LCVKMSCKAGGY'''ARY'TM1.1:::31(‘4‘XI:0?U Q) 1" L11Ll 1—1 C) L.(' H Z :0 ""1 2)YTNYNQKPKDKA TTTTDLJbV AI .. oml\7 ,. mm ,1— 11—" —\J~ 7,—1 AmmT mv J. n .—L,- a,- «r ..

. L _. .L SSLTSEDLAV"PF . CAREXDDEXSLD.WGQGJJAJJGSGCGGGGGGGJ SGGGSQTVLTQSEATMSAPGZKVTMTCCASSSVSYMNWYQCTSGTSPPRWT{PTTLASG VPAHFKGSGSGTSYSLTISLJMEAEDAATYYGQQWSSNPFTFGSGTKLETNR* (SEQ ID NUCLEOTTVE SEfUENCE2:.

LJAIJfi«7L TV"?.JGCJ L11ALJ JLJA JA1mm?) A —\ q—J,«,-..\r.-,-.r~.—‘ JLJILJL_.ILJL: .CJJAJ. immnmn—JnJJLL‘J/AL‘JC"nap—J «r ,«rJ'. JAILJ'GILA. G.:1ij Gt‘.1ALLJGT7‘21 A ‘11 , A:4 J <2 TTPGC' PFCGCGJGAGCCAGAGCE'TGGCACJAAGATDGATIGGTATGAGCAGCGCACCFA CGGCYGC_CGCGCGT3C'FATTAAATATECGHGCJAAAGGAGTG(G1CAflTTGAGCCGC TTTAGCGJLWAJGGGCTTGGCTCGGTTTTTACGCJGAGGATTAA'AGCGTGAAAGGGAAG :ATATTHLJ -JLJAi TAJ TAT. mm‘n mm . .rvrx/‘V‘r n'wfl " v ‘7‘ mmr‘fl"MW"? "ma "1 r‘m‘! JLJ JLJILJALJGJJCLJL i i firfi/‘Vr‘flr‘fi‘r r1 L; JLJAL'1LJA'LJAJJCJJALJAALJJL ’JLJCJLJLJLJLJLJLJA\- GAAAG' GGAACmGAAACGTACGGTGGCTGCAGGAJCTCTGTTGAT.flmJCC GATCTGA' "1/ r‘r‘Jrfi .mJCJAJAIJJLJJI Ammmr‘r‘ 7\/ J'JTLJMVLJ7*. r‘r‘n pmLJJCJJJLJJLJJLJCJLJImmfimr‘mr‘ 17* LJLJT\1I‘-‘JJ-\JAJACJJCJAJLJLJLJALJALJmm HTIJ‘ITI/‘V.Wfl‘rrfi LJ -LJ\V- ‘:1 JLJ1 AGGCCAAAGTACATTTGA7‘./GTGGATAACGCJCTCLJAA C'GGG' A CJTCJCCAJGGALTACJ' GT I1 11111LJALJA'LJA'LJCJLCJLJACAGLJAJA'L-r' A JJ-J'LJV-ACCJ JACALJCLJ JLJALJLJAH'LJALJCLJ-1,1 1A1 11 111 ""11 ,11,1m CJLJCJJ'LJA'LJ JAAA.Ifl71J1 11 LTCAGACTALJJJJJJAAACATA7‘AG CTACC»J'CCJTGCJGAAT'LTACCCAT TGALTC'CGC LJLJLJTLJfiLJAJJALJdGJ J LJAAJLJ1/1 " "\7\ "\ m r17 1 / -L’J‘JL’J"JAGJJ :JJLJJLJGAGLJ«,1 7 mnmr‘ F" .Ir-‘rwv. Am .. *x . LJLJA CTCJ ALTJLJ'. GLJCJLJLJT LJALJG LT' 1,1 LJ1.1,11LJ\:1LJ :JL LJLJCJJCJ- ,1I1 , m1. , LJLJ1 ,111 1‘:1LJALJ :JJJJCJAGLJCJ LJ :1koLT 7mIJ1. LJALJ‘J'1J JL11 1,1mmC m,1 rm" 1 J LJCJ LJCJJALJL / -L’J/_ LJ\-V1rL LTGTGCJAGACTGGCACGTCLTGLTGTswLJAJJGCJGTJAAAAT'TAGC 'GT A G .JAGLGLJTTATA LJLJTTTACJCLJJJJJAJACC7" LTCATTGLJ-JTTJJAACATLJ'T' 'TCGGGTCJAGGGTCJTGGAA' GGAT TLJLJTTATATCA-TCCJT/JCJCLTG TACJCAACJJA'T LACCJAGAAKT TTCJ AAGATA/JAGCA ACCC 'GACCJACJ CGATAA7‘ALTCAswCAGCACCJGC'TTATAT CT GCA TGALTCTCJTG ArJpnACCT‘PGE 12%.1 1'7ACT'1ITTGCZXCGCmA[TE'IKI’A'IKCJTA T Ll}J'Tr‘x".

SAG 11 1A J11 7 1 Ar *er r Lr 1 1r1r1mr1 L 'LJYGCJLCACL J'J-JJ»-V‘LJ'\--.-J' TAGCAG - J -G ,CGGC TI'IAJLAGC’TCAA’T "CC (NI/3.1r ~\ "r‘ ‘_J iLLlLJLJH 1J1AJ-AL AA-LGGLJ JL» 1» 11W, 1J1 L..- 1 J .1LL L L... ... ' f .. L" AAL.‘ JJJ - -.AJJJA GAALLA r1r.IJL.1.rLI.1 1n 1A.T"1.T"1J1JL. .JLIJ1. JJLI..1. ,1» 11,1 1J11J11.»;J11.»17;17p11mJG .LJJLJAlAlJ»\JLJCVJLJACVLVJ1» JXLE'LJL LJJACJ 117 ; 'rl' LJ'L.\.:'LJ J‘»‘ VJ‘JJJJJLJD waLJ .1»: JJZ»-'LJ.J'LJ'LVJ,1IJLIJ1JL ""1TATTTTJA ‘GTTTA""TJ C*:’J‘TLACCAAAC GGZAATTAATCGTTAG (8?? ID NO: 299) Antibody C22 V5(N297(2) heavy chain h; .40 ACID ENCE T-V’QLI.QS-CTPGLVQPSQSLSIZ'C'T\J’L GFSIJTL {GTV IVA/ILLS JKGIJELIJGTJTTI.LJGL~]\I DYIIT PETSRLSTITKDNSKSQ‘VEEKIVINSLLJLTUDATYYCARAITYYDYTFJWGDGTTTVTTTSAAS'T‘ .LGLJTJI7KDVFTEPVTVSWNTLJAL . T’A‘v7TJQSLGTJYS LL ':T- VVT'‘JT . SSSTJGT,JTYECNVNHKPSI‘TTKI7PIxK‘7ERKTLTIJ‘IT'ITCPPCP.IEIJTJCALTILT‘JETJI. 'r'PPI’LPKDTIJMTSRTP‘EVTCVVJ7IVL'H..JDPEVI\F7\L.XT/IJ‘TVEVIVNAKTKPWEFCYQSTY{Ix/TV SL7 ..' VLHA’EDT, LJJNGKEVILLTILRSNI’LATJPAIIEK TSKAKGTPREPQVVTIJPPSREE'VTILNC‘S LTCLE7KGFYPSDTAVE‘JESNGJPEAA{TTJPVLDSDCSFELYSKITVDKSRNGTNVESCL ’x.

SVMJEALWFTTTQKGESLLJGJ* (TEQ TD NC: 33d) NUCLEOT. ,ENCE CAGCJTGC CTGAAACAGAGCGGCCCJGGTTTGCTG -GCCGAGCCAGAGCJCJTGAGCATTA CCTGCACCGTGAGCGGVTTT-GCC' GA GGCG' GCATTCGJJCCCCLA -GCCC GGGCAA_AGGCCTGC>AA' GGC' GGGCGTG’ TTTGCAGCGGCGGL‘CACCGATTAT7AAT/JCC CCGTTTACCAGCC CTGTGCATTAACAAATGATAACAGCAAAAGCCATGGTGTTTTTTAAAA Ir'77\17\1'LJAfiL,z-\L7CL,'iLJL.AAA"#11111 11/1'J'LJCI TLJLJATA\L,r11 T'JL, T'JTATImmm'flmm']. Ir'1r11 1 JL TAT JLTI-‘TT'IT'LJL,\T'1L,'1L,CCJCJCTCACG’ATTA 'GATTATGAATTTGCGTATTCGGCCCAGGGCACCCTGGTGACC:TGTGCJGGCTAGCCC AACGCCCCATCCJTCT7 «nfiflq fific K1mT. A « J m CICCICC GGC CCJTCLTCAAIbCTpLiLibGGUGLACGICGGan" r 7 Tfl.fl~mfimfi K TflTn ~pr «n—L m ammn "(V77 «KI-Jr. rfimm CLCL'JPTAC'T'7m Am LJLJL,TL7‘T'1L7C' GL,' Gi'CAI-L7'LJPM~TJ1L,i i fin. and mm mL7J1L,‘T'1LJILJTIC TJTLJCdALJ-T'LJALJ‘:K—.

W1rv1r‘1I1A1n1r‘Im 1'1 CGCCC' LJ CCA TGCACACC CCGCLTGTGCTACAC CCTCAGGACTCTAC' CCmmr‘m 111.1 r1 111/1. I’ 1m KA. «FAA . ma m ~1m .mqflq. A m. 1r117\ I 1 C LJAGCAAGC .IITGGTGACLKI 'ITJLJCLJ' LCAGLJAGCCTT Q,II1r',1 mm. 1/17 1/1 7D K/TCCCAGACCTACA TCTGICA/TCG TCTA'CACAAGCCCAGCAAA/CCAACJTGGACAACAAAGTTGILCCLAAATCTTCTJACTALlr C7 17\1 r1111LICLCACKuTuCCCAGCACCTGAACTKCI11 I r1,I1r' 7\1 1m 111m,I1/1.Ir'1r11r1CGGGGG CCG JCAGTICTTCCIIrv-I I 111/1 I. 1/1 r1 TTCCCCCCATAATACCCAAI1KV77LJTI-‘T'LJACLACTCTTTLJ- JLL.JL1h mC" q' 7AL,-\-L,CiGTAGLJiCACAT'L7LJL7I I1 1r‘1r‘m 1m .,I1/1I1.1r1L7\'1 LTJC'I'ACLJTLJAGp», Lama, «ma, mu.» 7» "A"IA/w ~».m .7 .LJt tCLJZ'Tl'DALJ'LJL, iCICLJtALJLJD'. 'ILJLJILJA :H 1r~r~r~ .AGG TGIACACCC' GCCCC AT~.}\III1IICIC.I1C-G 31CACC'"CCTCCTTAZACGCTTCTATCCCAGCGACATCGCCGGCA ITCK'CACAGCAATG GGCAGCC CGCCTCCCGTCCTGJICT‘CG" STCCTTCTT CCTC'ACAGCAGCTCLLCC"GGICAAGACCACGTJGCAGCP CTTCTCA1CC MCC(:Irr: CLDWTC ' I' .' _> :Lcrncrnc'wmr'wn erxr1CCGIr; G"AA1GA (SEA TD NJ: 337) IUDGI‘JIL/T7G\‘G S'7FLLJUNL.L7SSLJT‘T2JLJLJ.IV- ,«J— I'\ a.- —. .L. Amp—— J-T TQSPVTLLVJS PCERVSESCRA1J_TJTNTHWYQUFTAGSPRLETKVQESTUCTPbiFKGSGSGTDFTLST NCVECCDTADYYCCCWNNW~TTCCAGJKLELKRTVAAPSVETEP"DEQLKRGAvaVCLL NNEYPFLEATVQARVDIALQEHGQEFJTEQPSKP1TY§LLCULULSTDVEKFK"YAC."T HQGLSTZ7TKSENRGEC* (SEC TL CO: 304} NUCLEOTIDE CE ,«117I/111Ir'1'n\zAJ.":L7'LT LA" m m :13 J'LJALJT'LJLJJLK17‘1I1r'7 'JL CCTLJG11 m IIr' 11f If? .

:I.I Cl. Lv-1m. LJL/ULJECI‘JGLCI,r'1r'17'\ ..LLJ'L::T'LJ'.P'1'.LI7T 7/11r1v-x. L, T'JTTGLL'JGL GLJ'LJA'LJLJ'LJL71/1 A'LJL7‘T'1L, 'T‘ r17rw1rv,.1 L7‘T'1L,I' inLJL’JiL’JGAi LJ'LJL7'LJTCTK'1ATGL, T'JLJCC L'JJL i 'LJLJLJTI-‘TT'f-‘TJI-L1r11r'11r'11'1mr1 I'TIK1/1II1KV r1 r111rTHTI/11rv7IT'r1 , LJAT'L7\T'1L,ALJ TATL'J1/11 Irv-I 11(7 L7Gi ALJLJLJAL7J1'TC-Ti LJC'[11 1/1I/1 17\ .r‘ .m mC'7‘ "11;" ,I’1/11r‘1r1r‘1 rTI "F‘ L'JT’ATL.C.CL PT 7AL7'LJLA-CL7K'1iGEATT TCJL LJHLLJLJLJT'LJI L7\-C CCCGCCCAACGTGTGAGCTTTAGC GCCJCGCJGAGCLK "/CCTTTG'CACCAACAT"CATT ill"1"] LJC-TATC ACJGLTGCACCA/CJGGC-T GLTJ CJ.JCJGCCJCTGCCJTGATTAAATATGCJGAGCCJGAAAGCAT T/-GCGGLTJ TTCJCGAGCCGCTTTAGCGJJACJ'CGGCCAJGGGCAG'TGATTTTACJCCCJJCAG'TJATT ALLTJA'GC'GTLJG.AAAJCJGAAGATATTJJCJ-JLJATTATTATTCGGAJLJAC'AACJJACJAACTTJGGG'GA LTTTGGCJGCCJGJGCA‘C TJAAALTJ' GGAACJTGAAACJCTJTACGG 'GG’CTGCJACCJCATCTGTCTT LTJCCJ .JCJCATCJIC-LI JJ‘ r—TT Cf) r‘r‘v‘r: .rr!LTJAJAJ-7\FTI fl 7\/ ij‘fl- LJiLJiiGiLJiLJLJLJTL’JLJ"Im'fimm mnmfi/‘J’x. ,rV/‘J .n -KJ‘LJ_ JLLLJTLJGA -C LJ‘CLJ Us AATAACTTTJTATCCJAC-AC-ACGCLTAAAG TA.LCAGTGGA‘AGGTGGATAACCJCCCJCTTCAA C'GG TAA'T LTJCCJGAGAGAGT"TJTLALTJA'GA'GCJJGLJAnGCAA'C-"TALTJA'GCACCJTCAG CJCC TLTJAGCAG C -LTJCLTJ' 'TALJ-JLJTGAGCAA/GCAGACTALJ-JAGAAACA'TJA-7A ACCCCJTGCGAALJTG/CC LTJATCAGG.JCJ TGAGCJJCGCGCGT'TJALTJA-JALJAG.Tl 03J5?C2 '- r. JJgc ICCTCJAGA JT JTGGAGGTGGATI ,2—-J. LJKCJT—‘J‘1LJTLJCLJLJLT—JLALJCJLJ«n—rnv-‘m "I" mm ,"V. 111 2*..{1r' .rfififl Jrvfi LJ LJTLJ‘JLJCJLJand LJLJCTC-G"JTJ'CJT‘JLJ1—\_LJC iLJAGLJCLJ'CJ-d"H" AW CC"-J""T LJ'JJGC tJGL.2JJLJ2»-G.43 - .m JC‘A JJC» JC» V "1"DT"LZ\1;1.\L-JCA TAGLJUJ.(.l T) Ll 3.LT’ J‘ JRP’"H ) L) J _:4 J +4 H J L.l *n Am Amp Jana-n C . l ,2,r (T) CT) CT.) 0 ya] I-J Cw") L (_ J3) H +4 (I? C) (-7) J-i I"? JVJ'5‘:VJC>C- *rC- L (_""l 'L-A-J'L-JLJ' A"l' G'CIlTTATZ‘TC 'T'"l GAGCA 3CCTGACC'I"CAGAGLEA-TAGCGC2»-G"T"'I""T"A"T"'T"2»-C "l G" TGC.AC GCTZ‘JT'I"ATGATGATC ACTATAGCTTGLJAITAT'T"GGGG"CAG 3G ‘ATCACCCTGACCGTTA G JGGTGG" GJ-J- "TGGT 3GCGGTGGT" ‘TA’TGCCG'G‘JCGGJWJGCT’3CJA'T""lGTTCT 3J2"; ‘CC2G2GTCCGGCA ATTA"TGZ 3CGC"A2GTT.CGGGTGAAAAZ‘JGTTACTATGACCTG"lAGC 3C2\-"\3CZ GCZ(JCTl‘T GC"T"?J"T"Z‘JT 32"\-"‘J"T" "I"GGTATCAGCAGAAAAGCGGCZ CTAGCCCGAAA TGTTG "T'I"ATGA"l2’C ACC/A»CTGGCAZ"JGCGGTGT"TCC \3 2‘ 72"\-'I""T"'I""T"CG' "GG" A" 7+JV"n 21.JLJLJ L-J JTTA44} r1"|'r[n "« £l2_\JkJ 1.1T 2A .L C2-ACGA2TLJCG'J" .L ACrs NO: 3 5‘) Muitispeciiic activatabie antibody 3954CZZSVS--0T€.T3mHywhich CODlpiiseS light chain 204425 plasmid and heavy chain C225V5OKT3m~H—N piasmid.

Antibody CZZSVS Tight chain AMINO ACJTD SE :"LJ. LIT D LL'TQST-‘VTT GETJi‘x/TSE'SLTJJ:ASQSTGTNT HTJY ‘JT-TT‘J'GJJT‘.LL =I.TASES SG BSR ""TC.’TG’TGGTDFTTJSTJTSTJ7""TJS""TJDT-T "CYY TJQQJTNNWBT : r G/-G'TI LET KJ'TVJ-AJ’SVEL-LET/ESL, AD EKITVT-J-C"3"JTEQLJ SPVTKSET NUCLEOTT DE SE20 m ENGE "3/ -LJATVTi 7\ r7 TT‘ mC 71C ("J/"x A «nfirw-vfi ".LCLAL’J -LJ'LJLJMV'L’J‘JTGEAiimrflmmr‘mr‘r "V . LJL JL’i JCL LJ/- 'LJV-LJVLJ"r7"Vr7 GCGAliLCJi'LJm", .fl7r7"V.LJA'LJLJT TTAGG' GCGaGGCLJArTKCL/G"GCATTGGCAGCAAGA’ " CAT" GGT TCA ACGGG‘AG‘JCAA AGGCLJ LJGGCJCTGC 'GATTAAATATGGGAGJLGAA" GGATTALJC GATJC'LLGAGGCGG TTTAGGG LJLLJAGGGLJLG GGJCACGGA1T1TACCCJGAGGATTAAGAGCGTGLJAA-GCGALAG ATATTsGwLJ LJLJ TTATTATTG T'GAGG_LJ [1:1 C") E" yCLJALJAALJJL7\ v7\‘7\I"VrTI,"Vr7"V/"V,"‘7\,"V"A "1 mm ("vHfi/"Vfirvfi/"V‘rri (7 JLJ JLJLJALJVACLJL J iGLJCLJJLJLJ'LJLJ'LJA1V- GAAAL" GGAAGTGAAAGGJTACGGTGGCTGLJACLAJCTGTGTTGAT .TTGCCGCGATCTGAT "V/ ,"rvrIr: .rpLJ AmdiLJJLL’J'LJhAJumMmr‘r‘n/ ,»"V. LJ' rifimfimr‘ .rfi‘rflm\JAAJ'LAALCJL-C1H1LJLJLJALJAmm -LJ‘V- ,"jr‘rV.LJ‘-VLJ LJiLJiJLLJJLLJJLLJCLJ LJ'LJ,"Vm v,"V "VI/"7 1mm mnW/"w "1 ALJ AAGTAJAGTGL7‘"-GLGTGGATAACGCCLTLCAALTCGGG' A GTLJCLJAJGALJALJ'GT ("xJALJAL’JAL’JCEAGLJACA JL«jaw—L —, 7 I"\L"LJ JJ71m—L -LJ2'"\_'LJ\-V-ACLJ iLALL.AL’JCLJLJLJALJLJH11LJfiLJCLJ_"\‘nfir‘v m mmfirm pm, "In": LLJJLJJ'LJA'LJ JA-(—JI 7 IA 712'"\_ GCAGACTAG'G2»L’-7291271291".2_L72_271A_GTCTACGCCTGCGZ?GlL/1CCCPJ'7C7" 7G7C’L7717’7AGC'7'CGC LGlLVACA7LAGAGGTTC7‘/\"/\G(‘.G(‘.2"1-2L-7TL3T’-‘GAGGTG3"l77l7 GG2GGTGGC’TG TTGAGG LJTLVLL77ILLLLI.LJLILL LJLJLJL L31V'1'LJ-JLJA'L3‘LV1‘LV27L3L277 LL, 7mm IJLIJL mm JLL" L mm 7 L7 JLJLLLILJILJLLH," Gm 'xV-JGLLLG-J21_CAGLJLVLJGAJVGTGAG-7131 1 C) '5‘:V, L‘ (3 1-3 L '"I :3 (:1L .,(lP L(:1P Ii7(L I'Vf‘r f‘r‘t’D,.7113» L3" \J'xJLLl'LVI iii ii?"' (J. (:7) H I: CCT‘TTAGCC 7T'T'L"LT21’7CATGG"TTGGCT 1L1121211JLIL LL L 27 LLI117 LJLJLJL. ,LJLJ IJL JLL LL 27w," 7 .LV -L»_G-VLJ \J'LLI 1‘2"122‘11; .212 V I‘JV'LJLJT 1:217» (up-fur: r77fh ‘1’") ~\ Aux («7 1717* 7* («(37 er.‘-.~\I.~ ~71 ‘1 A: r‘ '1 /‘1l’} LVALVL. (3A1AZ»_2»‘JL/»_'L31V2»1\JLV21L3 A JLJLJ‘LVLJ12 12ilb1Vr1;17 r717" rwr-xru7 r AGGAT'AGCGC2G1LTTTLil/V717TGC21C7‘C7'77i'1'21'1'f""GATC VL("x f‘ LJLLrV21rVV1cog-71'1211-71: *rJLJLLJJ1VL 6112"LLJLLUJLFJLJ1LV11 C2737:V7131-7151123;CA@2111:11CTGA TCCGGCAATTATGAL1"""71/1" "cess- G 121212113111211372112;31cc1:1AGC 7c 7291GCAG’TAGCG "1215(2111211G21211'1‘sc12L1: cc127221212113271323132113123.327.:21221: "-72111"1*21'1G2;1.21CC2113 7212111171131’7;»_2LGC2V71:1 G7T"CC(V-7G7AC27"1"'T" 2T"1\7CCTGI\C"ATTAGGGG' TEGAAGC2L3A2G1L '7 '7"CA2LGCA2LTCGGTTTACCTT 7GL3' 7'AG'T' 7GCACL7V‘Z2—1AC'7 GGAAAT ]77’\.,\TLJL3'T {17311114167} Table 11 shows exainpies of pairing of heavy chain (HG) and light chain (LC) sequences to make a mui‘iispecific antibody or muiiispecific activaiable 2111111101131 of the disciosure AS use(i hrein when referring to Eiaht chains, aniibudvi ight chains carnprisirig 25 are also referred to as Eight chains comprising C225.

Tahie ii. Muhispeeifie antibodies and mui‘rispeciiic activa‘rable antibodies of {he disclosure Protein name Piasmidinucieatide} hairs fhr transfection €225v5nOKT3mvi-int23 HG CEZSVSnOKTSmIHc E C (3????- —‘1294—6225V5OKT3m—HN HC ~OKT3m—Hni\i LC (3225—3553544 264 C225v5~b§29?QnOKT3m~H—N HC CZZEVSN237Q~UKT3mvH~N LC (3225 CE25V5AN29?Q*OKT3FY3"L*C Hi) C225v5~NZSfiQ LC C225-Oii'i'fimuL-C 3954-12(34—(3225v5w253?Q~OKT3m-H~C HC C225v5~N29?Q~OKT3m—H~C LC 022535; 44264 VS refers its version 5 of C225 EXAMPLE 6: Binding 0f muitispeeific amibodies m C7038 rm durkat T Ceiis {999M373 This Exarhpie deim‘msirs’tes the ability ofmuitispecific ahiihodies ofthe discldsure to bind to 'i‘ ceiis.

} Three formats ofmuiiispecific aiitibddies were tested: 4: i) C225vS~OKT3rn— H~N, a multispecific ari‘ribody in which an OKT3m scFV ( which binds CD38 (also referred to herein as CD3e and CD3) on T ceiis) was attached t0 the Edi-terminus of the heavy chain {ifahti—EGFR antibody 7225x157; (2) ,.22Sv5—OKT3m—H—C, a muitispeeific hddy iii which an OK'i'Sm scFv was attached to the ious of the heavy ch aim of anii~EGFR [Annotation] CLGUS Aug 2021 antibody C225v5; and (3) -OKT3m-L-C, a multispecific antibody in which an OKT3m scFv was attached to the C-terminus of the light chain of GFR antibody . The amino acid sequences of these multispecific antibodies are provided herein, as are the amino acid sequences of the C225v5 and OKT3 antibodies. Also tested was an e control, namely human IgG1 e control, Enzo, Catalog ALX133-C100. 2020200981 9] To determine if the three multispecific antibody formats could bind to CD3- positive Jurkat T cells (also referred to herein as Jurkat cells and Jurkats), a flow cytometrybased binding assay was performed. Jurkat T cells (Clone E6-1, ATCC, TIB-152) were cultured in RPMI-1640 with GlutaMAX™ (Life Technologies, Catalog 72400-120), 10% Heat Inactivated-Fetal Bovine Serum (HI-FBS, Life logies, Catalog 10438-026), 100 U/ml penicillin, and 100 µg/ml streptomycin (Life Technologies, Catalog 15140-122) (also referred to herein as complete media) according to ATCC guidelines. Cells were harvested by centrifugation (200xg, 4°C, 5 min) and re-suspended in PBS with 2% HI-FBS (FACS Buffer). About 250,000 Jurkat cells per well were transferred to a 96-well U-bottom plate, harvested, and pended in 50 microliters (also referred to herein as µL or ul) of the antibodies being tested. The ng concentration of the antibodies was 100 nM for the multispecific antibodies and 166.7 nM for the isotype control, followed by 5-fold serial dilutions for a total of 8 concentrations for each antibody.

The cells and antibodies were ted at 4°C with shaking for about 1 hour, harvested, and washed 3 times with 200 µL FACS Buffer. The resultant Jurkat cells were resuspended in 50 µl of AlexaFluor® 647 conjugated anti-human IgG (H+L) (Jackson ImmunoResearch, Catalog 709149) and incubated at 4°C with shaking for about 30 min. The resultant Jurkat cells were harvested, washed 3 times with 200 µL FACS Buffer, and resuspended in a final volume of 150 µL of FACS Buffer with 2.5 µg/ml 7-AAD (BD Pharmingen, Catalog 559925). Samples were analyzed on a BD Accuri C6 flow cytometer (BD Biosciences), and the median fluorescence intensity (MFI) of viable cells was calculated using FlowJo V10 (Treestar). 7-AAD staining showed that a forward side scatter gate was sufficient to identify viable cells. EC50 values were calculated in GraphPad Prism 6 by curve fitting the data to log(agonist) vs. response (three ters).

Figure 16A demonstrates that all three multispecific antibody formats bound Jurkat T cells with EC50 values ranging from -digit nM to sub-nM.

EXAMPLE 7: Multispeeific antibodies bind to CBSa—ennressing 1‘ cells and recombinant human EGFR EtltltleZ} This Example demonstrates the ability ol‘inultispeeilic antibodies of the disclosure to bind to both (also ed to herein as ) T cells and target antigen containing cells. {tidbit-23} To determine if innltisbecitic antibody CZZSVS--Ol Also tested was an isotype control. namely hunian ’1',ng isotype control. Fnzo Catalog [XLX-htldulfi-Cllltl.

Etltltldld} lurkat cells were cultured and harvested as described herein. About 500,000 Jurkat cells per well were transfen‘ed to a U-bottoni plate, harvested, and res uspended in 50 lull of r-lll nM ntultispecific dy or 67 nh'l isotype antibody. Cells were incubated at dot: with shaking for about l hour, harvested, and washed 3 times with 2th) uL FAQS Buffer. The resultant .lurlt'at cells ng a specilic antibody of the disclosure) were resuspended in St) ul biotinylated recombinant human FGFR protein (Abcani, Catalog abl68702) starting at about 290 anl followed by 5-fold serial dilutions for a total of 8 concentrations. Cells were incubated at 4°C with shaking for about l hour; ted, and washed 3 times with 200 ill, FAQ‘S Buffer. The resultant .lurlrat cells were resuspended in fat) ul l0 ug/rnl avidin, R—l’hycoerythrin Conjugate (Life Technologies, 8866) and ted at dot: with shaking for about l hour. Cells were harvested, washed once with 200 uL FACE; Buffer, and re—suspended in lStl uL FACE Buffer. Samples were analyzed on a Bl) Accuri C6 and MEI calculated as described herein. ‘8ng vali es were calculated in Graphllad Prism 6 as described herein.

EtltltleS} Figure loB demonstrates that all three inultispecilic antibody formats exhibited concentration—dependent binding of EGFR that required concomitant binding to CD32 on T cells. ECSQ values ranged from sub—nM to single digit nMi EXAMPLE 8: ’l‘argetndependent tion of T cells by peclfic antibodies {tidbit-26} This Example trates the ability of specitic antibodies of the disclosure to activate T cells in a target—dependent manner.

Elltllldllfl To determine ifco—engagement of lurkat T cells and BEER—positive target cells by multispecilic antibody CZ25vS—OKT3rn—ltl—N, C225V5—0KT3Ul—H-C, or CZZSVS— OK'T‘Sni—LC could induce activation of .l'urlrat cells, a flow cytometry~based assay was employed. lurkat cells and CFSE-labeled target cells were eta-cultured for about 15 h and T cell activation assessed by staining for surface expression of the early T cell activation marker, C1369. ldlllldld} EGFR-positive SW480 cells, also ed to as SW480 cells, (A’l’CC, Catalog 28) and EGER—negative {1266 cells, also referred to as U266 cells, (ATCC, Catalog 6) were each cultured in RPMl-l 640 with GlutaMAXTM, l0% ill-PBS, l00 U/ml penicillin, and l00 pg/ml streptomycin (referred to as complete media) according to A’l'CC guidelines. These target cells were harvested, washed once with PBS, and re-- suspended in PBS at 2Xl06 cells/ml. A 5 lel CFSE stock (Life Technologies, CellTraceTM CESF Cell Proliferation Kit, Catalog C34554) was prepared in DMSO and then diluted to nM in PBS. The FSE working stock was used ately. Equal volumes of the target cells and CFSE stock were combined for a final CFSE concentration of l5 nlvl and final cell density of lxll)6 ml. Cells were incubated for l5 min at 37°C. Labeling was quenched by adding an equal volume. of S, 'l'he incuba ed target cells were harvested, washed once with te media, and rel-suspended in complete media at 5le5 cells/ml. 50 uL ofcell suspension per well was added to a 96~well flat bottom plate for a total of 25,000 target cells per well. ldlllldlh} Jurkat T cells were cultured as described herein. The lurhat cells were harvested, re--suspended in te media at tall}6 cells/ml, and 50 iii otcell suspension per well were added to the flat bottom plate containing target cells for a total of about 50,000 .lurlrat cells per well, The ratio of effector T cells to target cells was 21: l, {Mild-fill Three times --concentrated antibody stocks were prepared in complete media.

The t concentrations used were l2 nM for each of the multispecitic antibody formats and l.5 nM for OKT3 (Bioltegend, g H7304), CZZSVS (the arnino acid sequence of which is provided herein), and isoty e control antibodies. Five-fold serial dilutions were prepared in complete media for a total of 8 concentrations for each antibody. Fifty pL of antibody per well were added to the flat bottom plate ning the T cells and target cells, diluting all stocl Elllllléllil} Alter about l5 h, cells were erred to a ll—bottorn plate and harvested.

To maximize recovery, the cell culture plate was washed with lSl) uL FACES , and the wash was transferred to the Uvbottom plate. Cells were harvested, ire—suspended in 50 till D69 PE conjugated antibody (BD Biosciences, Catalog 555531, used at the acturer’s recommended concentration), and stained for l h at 4°C with shaking. Cells were washed once with 290 uL FACS Buffer and then re~suspended in a final volume of l50 uL. Single color controls were used to set sation on the BD Accuri C6. lO,(lllll cells were collected in a forward side scatter, CFSE—negative gate and l‘vlFl calculated using Flowlo. Elisa values were calculated in GraphPad Prism 6 as described herein. {$88432} Figure l7 denujnstrates that the most potent {1369 activation, evident beginning at sub-prl concentrations depended on each inultispecitic antibody format being co—cultured in the ce of both lurltat T cells and EGFR—positive S‘Wdélfl cells, in contrast, '1" cell activation induced by turing with EGFR—negative U266 cells was significantly less efficient, exhibiting d ECSU values and a 75% reduction in maximal CD969 induction relative to activation d by ECE'ER—positive cells. The EGFR— independent tion of the niultispecitic antibodies, as seen when ll266 cells were used, was similar to that of OKTS antibody, and negligible C1369 staining was observed with C225v5 and isotype control antibodies, EXAMPLE 9: Targetudependent activation of primary (338+ T cells by pecific antibodies Elllll3433} This Example demonstrates the ability ol‘inultispecilic antibodies of the disclosure to activate prirnary Cl)?» positive (CD8 l) T cells. {b88434} To determine if iniiltispecitic antibody CZESVS—OK'l‘Srndl—N, C225v5~ m-ll-C, or -0lé’l‘31n-L-C could mediate EGFRnde endent activation of primary human (338* T cells, a llow cytometry based assay was performed. CDlll' T cells derived from human peripheral blood rnononuclear cells (PBMCs) and DDAO—SE labeled target cells were co-cultured overnight, and activation was assessed by staining for the early activation inarlter, €369. llllllldilfil Elfililiapositive S‘Wzlllll cells were cultured and labeled as bed herein with the following exceptions: (l) SWdSQ target cells were labeled with Cell'l'raceTM FarRed DEAD-SE (Life Technologies, Catalog (734553) and (2,) complete media was supplemented with 25 U/rnl lL—Z (R&D Systems, Catalog 202~lL—ii5ll/CF). Fifty uL of target cell suspension (at Sal ()5 cells/nil) per well were added to a 96—well, tlat bottom plate for a total of25,llllll targets cells per well, {$88436} Fresh normal peripheral blood C138+ Cytotoxic T cells (AllCella Catalog PBOOQ-S) were obtained from AllCells da, CA), harvested by centrifugation (ZOflxg, RT, l5 min), and re—suspended in complete media supplemented with 2SU/rnl l ~2 at l .SX l06 cells/ml. Fifty all of cell suspension per well were added to the flat bottom plate containing target cells for a total of about 753% CBS+ cytotoxic T cells per well and a 3:1 ratio ol‘T cells to target cells. lllllll'n’lil’fl Three times—concentrated antibody stocks were prepared in complete media supplemented with 25U/l’lll ill—2., The highest concentration was 6:90 plvl followed by Svfold serial dilutions for a total of eight trations for each antibody. Fifty pl; of antibody per well were added to the llat bottom plate containing CD8+ cells and target cells, diluting all stocks 3—fold for a starting concentration of 2th) pill/l. ltlllll438} After an overnight incubation, the flat bottom plate was fuged and 100 uL of supernatant was removed for the luminescent xicity assay bed .

The remaining supernatant was erred to a U—hottom plate, and the cells in the flat bottom plate were detached with 0.25% tiypsin (Life Technologies, Catalog 25209—95 6): ’l‘rypsin activity was quenched hy adding 3 volumes of FACS Buffer, and the cell suspension was l‘erred to the U—hottorn plate. After harvesting, the cells were resuspended in 50 "all of either an anti—CD69 PE/Anti—CDS FlTC il (anti—CD8 FlTC, Bl) Biosciences, Catalog Sol 948), Fl’l‘C isotype control (Bl) BioSciencesfl Catalog 340755), or PE isoty e control (BID BioSciences, Catalog 34tl76l). All antihodies were used at the manufacturer’s recon'irnended ct‘ineentrations. Cells were stained for l h at 4%? with shaking, harvested and re~snspended in a final volume of lSO pl. FACS Buffer with 2.5 rig/nil 7--AAD. Single color controls were used to set sation on a Bl) Accuri on, and a fixed volurne ol‘cell suspension was collected. Gating on CDltl' cells was sufficient to distinguish between target cells and viable T cells. Activation was quantified as the tage of T cells with expression of C369 above the PE isotype control.

Etltltldfilll Figure lllA demonstrates that all three multispecific antibody formats demonstrated concennation—dependent activation of y CD? T cells with single digit prl £ng values. Treatment with OKT3, C225VS, or human lgGl isotype l (Enzo) antibodies resulted in negligible CD69 induction.

EXAMPLE l9: Targetwdependent killing of target cells by specillc antibodies {999449} This Example trates the ability ofinultispecitic dies of the disclosure to induce "l‘ irected target—dependent cell lysis {999441} To ine if inultispecitic dy CZZSVS--0Kfl‘3in--ll-N, C225v5-— OKTBin—l-l—C, or (IZZSVS—OK'HnnL—C was capable of inducing T cell—directed, target— dependent cell lysis, SW489 cells were co—cultured with CD8+ 'l"~cells at a 3 :l effector—to— target cell ratio as described herein, After an overnight incubation, llll) bill; of the supernatant was assayed in white wall 96—well plates (Greiner Bio One Catalog 655998) for distinct protease activity associated with cytotoxicity following manufacturer’s protocol (Cyto'l‘oX-Glol'M Cytotoxicity Assay," Catalog {39292, Promega), which uses a luminogenic peptide ate to measure activity of proteases released by cells that have lost membrane integrity and have subsequently undergone cytolysis. ispecitic antibosly—dependent cytotoxicity ol‘target cells was expressed in luminescence after ound subtraction of untreated values and plotted in Prism with curve fitting analysis log(agonist) vs. response (three parameters). {999442} Figure lSB demonstrates that all three iniiltispecitic antibody formats induced "l‘wcellnmediated killing of SW489 cells. As expected, Oli’l‘Zl antibody alone exhibited no detectible killing of 99 cells, suggesting a requirement for co—engagement of both CD3 and tumor target for effective cytotoxicitv by the rnultispecitic antibodies.

EXAMPLE ll: Target—dependent Twcell activation and killing of target cells by inultispeciilc antibodies {999443} This Example demonstrates the ability of multispecific antibodies of the disclosure to induce ’l‘ cell-directed, target-dependent activation of (IDS; T cells and killing ot‘target cells {999444} To determine if the observed "l‘—cell tion was dependent on EGFR expression by the target cell: CFSE—labeled ositive SW489 cells or EGFR-negative U266 cells were co~cultured with human CD9+ T cells in the presence of multispecilic dy CZESVS—OKTSrn—ll—N or GRIT}, each in a 5—fold dilution series ng at 299 pl‘v’l as described above CFSE labeling of the target cells (39 anl) was used to distinguish the target cells from the T cells using a method described herein. Frozen normal peripheral blood {7109* Cytotoxic T cells (AllCellsg Catalog P899931?) were thawed as ed by the manufacturen After an overnight incubation, the "llcell: (CFSE negative cells) were assayed for surface expression of the early activation marker, CD69 as described herein.

Briefly, cells were removed from the assay plate, adherent cells were lifted using trypsin (Life Technologies} and cells were washed once with FACS Buffer. Cells were d for l hour with artti--CD69--PE (Bl) Bioscience). Cells were washed and analyzed on the Bl) Accuri C6 for cell surface CD69 expression. MFl values were calculated as described herein. s were expressed as the percentage of T cells with expression of CD69 ahove isotype control using FCS Express analysis software and plotted in Prism with curve fitting analysis logtagonist) vs. response (three parameters). la’la’lS} As shown in Figure lSC, n'iultispecilic antibody —OKThndl—N demonstrated potent ll activation at suh—pl‘vl concentrations in the presence of SW48!) cells and only minimal Tncell activation by U266 cells, even at concentrations that were greater than 3 logs higher than concentrations used with SWL‘lSll cells. The Glilfl antibody exhibited minimal T—cell activation. These results demonstrated that effective T—cell activation is ent on target cell expression of EGFR.

Elllllléléltl} To determine the dependence oi‘EGFR expression tor target cell ltilling, lilt) ul of supernatant of the T cell co~culture with S‘Wéltll} or U266 cells was measured for protease activity associated with cytotoxicity (Cyto'l'ox-Glo, Promega). Results were expressed in luminescence without background ction to show the U266 response and plotted in Prism with curve litting analysis log,'r--{LiloTM Cytotoxicity Assay ega) was added directly to the plates (lSO ill of supernatant) to measure released se activity, with the exception of the U266 s, where lilt) ul of the ll266 supernatant was used to assay for protease activity, s were expressed in luminescence after background subtraction of untreated values and plotted in l’risni with curve fitting analysis logtagonist) vs, response (three parameters), ltllllltlf'itll Figure l9 demonstrates that all EGFR—expressing cell lines treated with rntrltispeci’ric antibody C225vS—Ol4'l‘3rnllvN in the ce of CDX‘" T cells exhibited dose-dependent cytotoxicity. in contrast, EGE’R-negative U266 cells remained unaffected by inultispecific antibody CZQSvS—OKTZlmd-l—N. None of the cell lines treated with anti— EGFR antibody CEZSVS at 200 plvl exhibited any evidence ot‘cytotoxicity, regardless of their EGFR expression EXAMPLE l3: Attenuation of EGFR binding hy specific aetivatahle antibodies {$99451} This Example demonstrates that EGFR binding by a intrltispecitic activatable antibody of the disclosure is attenuated compared to EGFR binding by a niultisnecific antibody of the disclosure. This Example also trates that EGER binding of the niultispecilic activatable dy, which includes a protease cleavable moiety, is restored upon cleavage of the specit‘ic aetivatable antibody by such protease {999452} Multispecitic activatable antibody 3954--l2(l4--C.225vfi"OlQlBin-ll-N, activated multispecilic activatable antibody 395442tl4—C22SvS—OKT3rn—l-l—N, and rntrltispeci’ric antibody CZZSvS—Olé’ldrnllvN were tested for their abilities to bind to EGFR-expressing Silt/48% cells.

Etltltldfiill tion of the inultispecil'ic activatable antibody was conducted as follows: 8.25 ug ol'rnultispecitic table antibody 3954—l204-CZ25vS—OKT3rn—ltl—N in PBS was cleaved by the addition of active itrated niatriptase (also referred to herein as M'l’-—SPl and M’l‘SPl; available from R8510 Systems, Catalog 3946K-SE-Qltl) to a final concentration of llltl nM. The digest was incubated at 37°C overnight, and cleavage was confirmed by removing an aliquot for capillary electrophoresis analysis (GK—ll ary Electrophoresis, Perkin . Protease and the cleaved mashing moiety were removed by Protein A purification. Briefly, the digested sample was diluted to 2 ml with PBS and loaded onto equilibrated MahSelect SuReTM beads (GE Healthcare Lille Sciences, Product l l~0026—0l AD). Beads were washed with 5 column volumes (CV ) of lxl’BS, followed by CV of SXPBS supplemented with 5% isopropyl alcohol (lPA‘), and finally with 5 CV of leBS. Antibody was eluted with ltl CV ol‘0.l M Glycine, pH 3.0, and tractions were neutralized with l M Tris, pH 8.0, pooled, concentrated and buffer exchanged into PBS.

Ellllllzlfiél} SW480 cells, which express EGFR, were lifted with cell dissociation buffer (Sigma, Catalog (35789), washed, and incubated for l hour with a 5—fold on of l000 nh’l of niultispecilie actiyatable antibody 3954—l204—C225VS—OKT3rn-ll—N, activated niultispecitic activatable antibody 3954~l204—C225VS—0K’l‘3m~H—N, multispecific antibody CZZSV’S-{lK’l‘Llni-HuN, activatable antibody 3954(3225V5, or antibody CZZSVS in FACES Butler on ice. Cells were washed 3 times with FACES Butler and incubated with l :400 of a secondary antibody, namely anti—human FeGarnnia specitic AFth (Jackson linrnunoResearch Catalog 109098) in FACS Buffer on ice. "ells were washed 3 times with FACE. Butler, and the Ml:l ol‘AF488 was read on the Bl") Accuri (BD Biosciences) tlow cytometer. The thl of a e comprising only the secondary antibody control was subtracted from the experimental MFI and d in Prism with curve fitting analysis logtagonist} vs. se (_three parameters). {06894553 Figure 20A demonstrates that EGFR binding by multispecil‘ic activatable antibody 3954— l 204~l3225V’5 —OKT3rn—l>l—N was attenuated compared EGFR binding by multispeeific antibody C225VS—0Kl‘3indlvN, but EGFR binding of the multispecitic activatable antibody was fully ed upon protease cleavage of the multispeciiic activatable antibody by rnatriptase. Figure 203 shows that EGFR binding by antibody C225y5 and by aetivatable antibody 3954l~l20ril~C225VS were able to EGFR binding by innltispecitic antibody S-Oléfl‘3in-ll-N and multispecilic activatable antibody l204-C225V5-0K’l‘3mil-N, tively, trating that the anti-CD38 moiety present in the inultispecitic format did not alter the EGFR binding profile of either the rnultispecitic antibody or multispecilic activatable antibody.

PLE l4: y of multispeeifie table antibodies to bind to (733+ '33 cells {000456} This Example trates that a rnultispecitic activatable antibody; an activated rnultispeeilic activatable antibody, and a rnultispecitic antibody, all of the embodiments, are each able to bind to CD}? T cells.

{Mild-5'7} To determine if CD35 binding had been affected by masking of the EGFR binding site of an anti~EGFR multispecifie aetivatahle dy, a Jurkat T—eeil binding assay was performed as described herein with multispeciiie aetivatabie dy 3954— i204—0225vS—0KT3rn-l>l~N, activated niultispeeilie activatable antibody 39544204— (fi225v5—OK’I‘3m—H—N, and inultispeeitie dy C225vS—0K’l‘3inllvN. lnrlrat cells were incubated with a 5-fold dilution of 1000 nM of inuitispeeitic aetivatable antibody 3954-- l2(l4—CZ25V5~OKT3m—H~N, inatriptase—activated multispeeilie activatahle antibody 3954— i204—(2225vii-OKTSm—H—N, or multispeeitie antibody C225v5—0KT3ni—H—N in FAQ'S Buffer for l hour at 4°C" Cells were washed 3 times and incubated with a ary antibody, namely 1:400 of anti-human FeGamma ic AF488 (Jackson lnumtnoReseareh). Cells were washed 3 times, and the MFl of AF488 was read on the BI) Aceuri (Bl?) Bioseienees) flow eytorneter. The MR of a sample comprising only the secondary antibody control was subtracted from the experimental MEI and plotted in Prism with curve titting analysis log£agonist) vs. response (three parameters). {999458} Figure 2 l A demonstrates that multispeeilie activatable antibody 04— C225V5vOKT3m~H~N and inultispeeitie antibody C225vS—Oi4'l‘3m—llvN exhibit equivalent binding to Jurlrat T cells. Figure 2 18 demonstrates that innltispeeifie activatable antibody 39544204—(3225v5—Ol{T3ni~l-l—N and activated speeilie aetivatable antibody 3954— i204—022SvS—OKThn-PLN exhibit equivalent binding to Jurkat T cells. These results indicate that g of the EGER binding moiety of the speeific aetivatable antibody does not affect the ability of the speeiiic activatahie antibody to engage T eells.

EXAMPLE ES: 'l‘argetmdependent Tneell activation by multispecifie atttivatable antibodies EillllldSQ} This Example demonstrates that target—dependent T—eell tion by a multispeeiiie aetivatable antibody of the sure is attenuated ed to activation exhibited by a multispeciiie antibody of the disclosure. This Example also demonstrates that target—dependent T—ceil activation by the rnuitispeeitie activatable antibody, which includes a protease cleavable moiety, is restored upon cleavage of the multispeeitie aetiyatable antibody by such protease {filllldtitl} To ine if masking of the EGFR binding site of an anti-EGFR nruitispeeitie activatable antibody attenuates target~dependent T~celi activation and to ine if protease activation of the niultispeeitie activatable antibody restores aetivationt a inrkat activation assay was performed, as described herein, testing m'nltispecilic activatable antibody 3954—l204—C225v5—0KT3m—H-N, activated mnltispecitic activatable antibody 3954~l2tl4—C225vS—OKT3m~ll—N, mnltispecitic dy C225v5~OKl'3ni—H—N, anti-EGE'R antibody CZZSVS, and a Synagis (Medimrnune) e control as described herein. {$90461} Figure 22 demonstrates that EGFR~dependent activation, as determined by (7969 induction ol‘lnrlrat 'l‘ cells co-—cnltured with EGFR—expressing Silt/48% cells, by maltispecilic activatable antibody 3954—l2G4~C£25v5—OKT3ni~l-l—N was attenuated compared to ependent activation exhibited by n'niltispecitic dy CZZSvS— OKTSm—H~N, The figure also indicates that EGFerependent activation by the rnnltispecific table antibody was fully restored upon protease cleavage of the rnnltispecitic table antibody by matriptase. Neither GER C225v5 nor the isotype control antibody exhibited activation ofT—cells.

EXAMPLE id: Target-dependent T—cell activatinn and g ot’target cells by multispeeific activatable antibodies {$88462} This Example demonstrates that target~dependent T—eell activation and g of target cells by a nialtispeciiic activatable antibody of the disclosure is attenuated compared to activation exhibited by a innltispecil'ic antibody of the disclosure. This Example also demonstrates that target~dependent T—cell activation and killing of target cells by the innltispecific activatable antibody, which includes a protease cleavable moiety, is restored upon cleavage of the mnltispecitic activatable dy by such protease. lilillla’ifiii} To ine if masking of the EGFR binding site of an anti—EGFR mnltispecitic activatable antibody attenuates target—dependent activation and to determine if protease activation of the ninltispecific activatable antibody restores activation, at Jorlrat activation assay was performed, as described herein, testing intiltispecitic activatable dy 3954420442225,vS—OKT3irnll—N, activated maltispecilic activatabie antibody 39544 2G4—CZ’125v50K'l‘3m—H~N anti—CD38 , mnltispecitic antibody C225v5~OKl'3ni—H—N, antibody OKT3, antiaEGFR antibody CZZSvS, and an e control as described herein, {$90464} To determine the impact of masking the EGFR binding site of an antinGF‘R. mnltispecific activatable antibody on xicity and the ability of protease activation to restore cytotoxic ty of the activated specitic activatable antibody, EGFR— expressing SW480 cells were ctr—cultured with 'l"~cells at a 5:1 effector—to—target cell ratio with a 5—fold dilution series, starting at 200 pM, ltispecitic activatabie antibody 3954— l204—022SVS—0KT3tn-llSN, activated speeilic table antibody 3954-1204— C225v5—OKT3ni—H—N, or ntultispeeifie antibody C225v5~0Kfl'3ni—ll—N} 209 ply/fl of OKTB, CZZSVS, and isotype control Synagis (Medinnnune) lgGl dies were used as controls.

After an overnight incubation, lOO ttL of the supernatant was assayed for in white wall 9t» well plates distinct protease activity associated with cytotoxicity (Cytol'oX-Glo, Prornega).

Results were expressed in luminescence at‘ter ound subtraction of untreated values and plotted in Prisrn with curve fitting analysis logtagonist) vs response (three parameters). {$630465} Figure 23A demonstrates that epen dent activation as ined by (7969 induction of primary T cells co-cultured with EGFR-expressing SW480 cells, by niultispecilic activatable antibody 3954—l204~C£25v5—OKT3ni~l-l—N was attenuated cornpared to EGFR-dependent activation exhibited by n'iultispecitic antibody CZZSVS— OK'i‘Bin-H-N. The figure also indicates that EGFR-dependent activation by the rnultispecitic activatabie antibody was fully restored upon protease cleavage of the rnultispecitic activatable antibody by niatriptase. OKT3, anti—EGFR 02256, and Synagis lgGl isotype control antibodies ted negligible activation of ils. ltltltldtiti} Figure 233 demonstrates that EGE’R-dependent lysis of SW’dStl cells by niultispecilic activatable antibody 3954—1204~t3225v5—OKT3ni~l-l—N was attenuated cornpared to EGFR-dependent cytotoxicity exhibited by n'iultispecitic dy CZZSVS— OK'i‘Bin-H-N. The figure also indicates that EGFR-dependent cytotoxicity by the rnultispecitic activatabie antibody was fully restored upon protease cleavage of the specitic activatable antibody by niatriptase. CZZSVS and OKT3 and Synagis lgGl isotype control antibodies exhibited negligible eytotoxicity.

Qtlier ments {$630467} While the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims Other aspects, advantages, and modifications are within the scope of the ing claims.

Definitions of the specific embodiments of the invention as claimed herein follow.

According to a first embodiment of the invention, there is provided a bispecific activatable antibody, wherein said bispecific table antibody comprises: (i) a first arm comprising an n-binding fragment of an immune or cell ng antibody that includes a first antibody or antigen-binding fragment thereof (AB1) that binds a first target, wherein the first target is an immune effector cell target; (ii) a second arm comprising an antigen-binding fragment of a target binding antibody that es a second antibody or antigen-binding fragment f (AB2) that binds a second target; wherein the AB1 is attached to a first masking moiety (MM1) such that coupling of the MM1 to the AB1 reduces the y of the AB1 to bind the first target; wherein the MM1 is d to the AB1 via a first cleavable moiety (CM1) sequence that includes a substrate for a protease; wherein the first arm of the bispecific table antibody in an uncleaved state has a structural arrangement from N-terminus to C-terminus as follows: MM1-CM1-AB1, wherein the structural arrangement optionally comprises a linkage peptide between MM1 and CM1 and optionally ses a linkage peptide between CM1 and AB1; wherein the AB2 is attached to a second g moiety (MM2) such that coupling of the MM2 to the AB2 reduces the ability of the AB2 to bind the second target; wherein the MM2 is coupled to the AB2 via a second cleavable moiety (CM2) sequence that includes a substrate for a protease; and wherein the second arm of the bispecific activatable antibody in an uncleaved state has a structural arrangement from N-terminus to C-terminus as follows: MM2-CM2-AB2, wherein the structural arrangement ally comprises a linkage peptide between MM2 and CM2 and optionally comprises a linkage peptide between CM2 and AB2.

According to a second embodiment of the invention, there is provided a pharmaceutical ition comprising the bispecific activatable antibody of the first embodiment and a carrier.

According to a third embodiment of the invention, there is provided an isolated nucleic acid molecule encoding the bispecific activatable antibody of the first embodiment.

According to a fourth ment of the invention, there is provided a vector comprising the isolated nucleic acid molecule of the third embodiment. ing to a fifth embodiment of the invention, there is provided a method of manufacturing the bispecific table antibody of the first embodiment, the method comprising: culturing a cell comprising a nucleic acid construct that encodes the ific activatable antibody of the first embodiment under conditions that lead to expression of the bispecific table antibody of the first embodiment.

According to a sixth embodiment of the invention, there is provided use of the bispecific activatable antibody of the first embodiment, or the pharmaceutical composition of the second embodiment, in the manufacture of a medicament for alleviating a symptom of a clinical indication associated with a disorder in a subject, wherein the antibody is for administration to a subject in need thereof in an amount sufficient to alleviate the m of the al indication associated with the disorder, wherein the disorder is cancer, inflammatory disease, or autoimmune disease.

Claims (33)

What is claimed is:

1. A ific activatable antibody, wherein said bispecific activatable antibody comprises: (i) a first arm comprising an antigen-binding fragment of an immune effector cell engaging antibody that includes a first dy or antigen-binding fragment thereof (AB1) that binds a first target, n the first target is an immune effector cell target; (ii) a second arm sing an antigen-binding fragment of a target binding antibody that es a second antibody or antigen-binding nt thereof (AB2) that binds a second target; wherein the AB1 is attached to a first g moiety (MM1) such that coupling of the MM1 to the AB1 reduces the ability of the AB1 to bind the first target; wherein the MM1 is coupled to the AB1 via a first cleavable moiety (CM1) sequence that includes a substrate for a protease; wherein the first arm of the bispecific activatable antibody in an uncleaved state has a structural arrangement from N-terminus to C-terminus as follows: MM1-CM1-AB1, wherein the structural arrangement optionally comprises a linkage peptide between MM1 and CM1 and optionally comprises a linkage peptide between CM1 and AB1; n the AB2 is attached to a second masking moiety (MM2) such that coupling of the MM2 to the AB2 reduces the ability of the AB2 to bind the second target; wherein the MM2 is coupled to the AB2 via a second cleavable moiety (CM2) sequence that includes a ate for a protease; and wherein the second arm of the bispecific activatable antibody in an uncleaved state has a structural arrangement from N-terminus to C-terminus as follows: MM2-CM2-AB2, wherein the structural arrangement optionally comprises a linkage e between MM2 and CM2 and ally comprises a linkage peptide between CM2 and AB2.

2. The bispecific activatable antibody of claim 1, wherein the second target ses a cancer-related target wherein the cancer-related target is a tumor target.

3. The bispecific activatable antibody of claim 2, wherein the cancer-related target is a solid tumor target.

4. The bispecific activatable antibody of any one of the preceding claims, wherein AB1 a leukocyte engaging antibody; a T-cell ng antibody; a NK-cell engaging antibody; a macrophage engaging antibody; or a mononuclear cell ng antibody.

5. The bispecific activatable antibody of any one of the preceding claims, wherein the immune effector cell engaging antibody is a T-cell engaging antibody, and wherein the first target is a T-cell target.

6. The bispecific activatable antibody of claim 5 wherein the first target is CD3 or CTLA4.

7. The ific activatable antibody of any one of the preceding claims, wherein the second target is selected from the group consisting of 1LFA-3, 4 integrin, Alpha-V integrin, alpha4beta1 integrin, alpha4beta7 integrin, AGR2, Anti-Lewis-Y, Apelin J receptor, APRIL, B7-H4, BAFF, BTLA, C5 complement, C-242, CA9, , Lewis a, Carbonic anhydrase 9, CD2, CD3, CD6, CD9, CD11a, CD19, CD20, CD22, CD24, CD25, CD27, CD28, CD30, CD33, CD38, CD40, CD40L, CD41, CD44, CD44v6, CD47, CD51, CD52, CD56, CD64, CD70, CD71, CD74, CD80, CD81, CD86, CD95, CD117, CD125, CD132 (IL-2RG), CD133, CD137, CD138, CD166, CD172A, CD248, CDH6, CEACAM5 (CEA), CEACAM6 (NCA-90), N-3, CLAUDIN-4, cMet, Collagen, Cripto, CSFR, CSFR-1, CTLA-4, CTGF, CXCL10, , CXCR1, CXCR2, CXCR4, CYR61, DL44, DLK1, DLL4, DPP-4, DSG1, EGFR, EGFRviii, Endothelin B receptor (ETBR), ENPP3, EpCAM, EPHA2, EPHB2, ERBB3, F protein of RSV, FAP, FGF-2, FGF8, FGFR1, FGFR2, FGFR3, FGFR4, Folate receptor, GAL3ST1, G-CSF, G-CSFR, GD2, GITR, GLUT1, GLUT4, GM-CSF, GM-CSFR, GP IIb/IIIa receptors, Gp130, GPIIB/IIIA, GPNMB, GRP78, HER2/neu, HGF, hGH, HVEM, Hyaluronidase, ICOS, IFNalpha, IFNbeta, IFNgamma, IgE, IgE Receptor (FceRI), IGF, IGF1R, IL1B, IL1R, IL2, IL11, IL12, 0, , IL-12Rbeta1, IL13, IL13R, IL15, IL17, IL18, IL21, IL23, IL23R, IL27/IL27R , IL29, IL-31R, IL31/IL31R, IL2R, IL4, IL4R, IL6, IL6R, Insulin Receptor, Jagged Ligands, Jagged 1, Jagged 2, LAG-3, LIF-R, Lewis X, LIGHT, LRP4, LRRC26, MCSP, Mesothelin, MRP4, MUC1, Mucin-16 (MUC16, CA-125), Na/K , Neutrophil elastase, NGF, Nicastrin, Notch Receptors, Notch 1, Notch 2, Notch 3, Notch 4, NOV, OSM-R, OX-40, PAR2, PDGF-AA, PDGF-BB, PDGFRalpha, PDGFRbeta, PD-1, PD-L1, PD-L2, Phosphatidyl-serine, P1GF, PSCA, PSMA, RAAG12, RAGE, SLC44A4, Sphingosine 1 Phosphate, STEAP1, STEAP2, TAG-72, TAPA1, TGFbeta, TIGIT, TIM-3, TLR2, TLR4, TLR6, TLR7, TLR8, TLR9, , TNFalpha, TNFR, TNFRS12A, TRAIL-R1, TRAIL-R2, errin, Transferrin receptor, TRK-A, TRK-B, uPAR, VAP1, VCAM-1, VEGF, VEGF-A, VEGF-B, , VEGF-D, , VEGFR2, VEGFR3, VISTA, WISP-1, WISP-2, and WISP-3.

8. The bispecific activatable antibody of any one of the preceding claims, wherein the second target is Jagged or EGFR.

9. The bispecific activatable antibody of any one of the preceding claims, wherein the first target is CD3 and/or the second target is EGFR.

10. The bispecific activatable antibody of any one of the preceding claims, wherein the first arm comprises the structural arrangement from N-terminus to C-terminus as follows: MM1-CM1-AB1; MM1-LP1-CM1-AB1; MM1-CM1-LP2-AB1; or MM1-LP1-CM1-LP2- AB1, wherein LP1 is a first linking peptide and LP2 is a second linking peptide.

11. The bispecific activatable antibody of claim 10, wherein LP1 and LP2 of the first arm are not identical to each other.

12. The bispecific activatable antibody of any one of the preceding claims, wherein the CM1 of the first arm is oned in the activatable dy such that, in an uncleaved state, the MM1 interferes with specific binding of the AB1 to the first .

13. The bispecific activatable antibody of any one of the preceding claims, wherein: the MM1 has an equilibrium dissociation constant for binding to the AB1 which is greater than the equilibrium dissociation constant of the AB1 to its target; the MM1 does not interfere or compete with the AB1 for binding to the first target when the bispecific table antibody is in a cleaved state; the MM1 polypeptide sequence is different from that of the first target; the MM1 polypeptide sequence is no more than 50% identical to any natural binding partner of the AB1; and/or the MM1 is a polypeptide of no more than 40 amino acids in length.

14. The bispecific activatable antibody of any one of the ing claims, n the second arm comprises the structural arrangement from N-terminus to C-terminus as follows: MM2-CM2-AB2; MM2-LP1-CM2-AB2; MM2-CM2-LP2-AB2; or MM2-LP1- CM2-LP2-AB2, n LP1 is a first linking peptide and LP2 is a second linking peptide.

15. The ific activatable antibody of claim 14, wherein LP1 and LP2 of the second arm are not identical to each other.

16. The bispecific activatable antibody of any one of the preceding claims, wherein the CM2 of the second arm is positioned in the activatable antibody such that, in an uncleaved state, the MM2 eres with specific binding of the AB2 to the second target.

17. The bispecific activatable antibody of any one of the preceding claims, wherein: the MM2 has an equilibrium dissociation constant for binding to the AB2 which is r than the equilibrium dissociation constant of the AB2 to its target; the MM2 does not interfere or compete with the AB2 for binding to the second target when the bispecific activatable dy is in a cleaved state; the MM2 polypeptide sequence is different from that of the second target; the MM2 polypeptide sequence is no more than 50% identical to any natural binding partner of the AB2; and/or the MM2 is a polypeptide of no more than 40 amino acids in length.

18. The bispecific activatable dy of any one of the preceding claims, wherein the antigen g fragment f of AB1 and/or AB2 is independently selected from the group consisting of a Fab fragment, a F(ab’)2 fragment, a scFv, a scAb, a dAb, a single domain heavy chain antibody, and a single domain light chain antibody.

19. The bispecific activatable antibody of any one of the preceding claims, wherein the bispecific activatable antibody comprises an Fc domain.

20. The bispecific activatable antibody of any one of the ing claims, comprising an agent conjugated to the antibody AB1 and/or AB2.

21. The bispecific activatable antibody of claim 20, wherein the agent is a therapeutic agent, an antineoplastic agent, a toxin or fragment thereof, a detectable moiety or a diagnostic agent.

22. The ific activatable antibody of claim 21, wherein the agent is ated to the antibody via a linker.

23. The bispecific activatable antibody of claim 22, wherein the linker is a ble linker or a non-cleavable linker.

24. A pharmaceutical composition comprising the bispecific table antibody of any one of claims 1-23 and a carrier.

25. The pharmaceutical composition of claim 24, comprising an additional agent.

26. The pharmaceutical composition of claim 25, wherein the additional agent is a therapeutic agent.

27. An isolated c acid molecule encoding the bispecific activatable antibody of any one of claims 1 to 19.

28. A vector comprising the ed nucleic acid le of claim 27.

29. A method of manufacturing the bispecific activatable antibody of any one of claims 1-19, the method comprising: culturing a cell comprising a nucleic acid construct that encodes the bispecific activatable antibody of any one of claims 1 to 19 under conditions that lead to expression of the bispecific activatable antibody of any one of claims 1 to 19.

30. The method of claim 29, further comprising the step of recovering the activatable antibody.

31. The method of claim 30, further comprising the step of conjugating an agent to the recovered activatable antibody.

32. Use of the bispecific activatable antibody of any one of claims 1 to 23, or the pharmaceutical composition of any one of claims 24 to 26, in the manufacture of a medicament for alleviating a symptom of a clinical tion ated with a disorder in a subject, wherein the antibody is for administration to a subject in need thereof in an amount sufficient to alleviate the symptom of the clinical indication associated with the disorder, wherein the disorder is cancer, inflammatory disease, or autoimmune disease.

33. The use of claim 32, n the er is cancer. FIG' w I R}:‘4} From Chm and Carry, Nazi. Rev. Irmmmal. .20 0 AntigemB1nd0 , mg Build\. m“9; Blfickfii :esific Antibfidy FragmentS :v: b' ¢