NZ719338B2 - Modified kz144 endolysin sequence - Google Patents
Modified kz144 endolysin sequenceInfo
- Publication number
- NZ719338B2 NZ719338B2 NZ719338A NZ71933814A NZ719338B2 NZ 719338 B2 NZ719338 B2 NZ 719338B2 NZ 719338 A NZ719338 A NZ 719338A NZ 71933814 A NZ71933814 A NZ 71933814A NZ 719338 B2 NZ719338 B2 NZ 719338B2
- Authority
- NZ
- New Zealand
- Prior art keywords
- amino acid
- seq
- polypeptide
- sequence
- polypeptide according
- Prior art date
Links
- KDXKERNSBIXSRK-UHFFFAOYSA-N lysine Chemical group NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 title abstract description 26
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 188
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 140
- 229920001184 polypeptide Polymers 0.000 claims abstract description 127
- 150000001413 amino acids Chemical group 0.000 claims abstract description 103
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 26
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 24
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 24
- 239000013598 vector Substances 0.000 claims abstract description 13
- 241000894006 Bacteria Species 0.000 claims abstract description 10
- MSFSPUZXLOGKHJ-UHFFFAOYSA-N Muraminsaeure Natural products OC(=O)C(C)OC1C(N)C(O)OC(CO)C1O MSFSPUZXLOGKHJ-UHFFFAOYSA-N 0.000 claims abstract description 9
- 108010013639 Peptidoglycan Proteins 0.000 claims abstract description 9
- 239000000203 mixture Substances 0.000 claims abstract description 9
- 241000589876 Campylobacter Species 0.000 claims abstract description 7
- 241000589516 Pseudomonas Species 0.000 claims abstract description 6
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 68
- 230000002209 hydrophobic effect Effects 0.000 claims description 15
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 12
- WTJDAUWOECZENF-OZWITMHCSA-N smap-29 Chemical compound NC(=O)[C@H](C)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@@H](N)CCCNC(N)=N)[C@@H](C)CC)C(C)C)CC1=CC=C(O)C=C1 WTJDAUWOECZENF-OZWITMHCSA-N 0.000 claims description 11
- 102000044503 Antimicrobial Peptides Human genes 0.000 claims description 9
- 108700042778 Antimicrobial Peptides Proteins 0.000 claims description 9
- 125000002091 cationic group Chemical group 0.000 claims description 9
- 239000003910 polypeptide antibiotic agent Substances 0.000 claims description 9
- 108010002069 Defensins Proteins 0.000 claims description 7
- 102000000541 Defensins Human genes 0.000 claims description 7
- 239000002253 acid Substances 0.000 claims description 4
- 241000282414 Homo sapiens Species 0.000 claims description 2
- 239000003085 diluting agent Substances 0.000 claims description 2
- 239000008194 pharmaceutical composition Substances 0.000 claims description 2
- 239000000546 pharmaceutical excipient Substances 0.000 claims 1
- 230000035772 mutation Effects 0.000 abstract description 17
- 230000001747 exhibiting effect Effects 0.000 abstract description 16
- 230000000087 stabilizing effect Effects 0.000 abstract description 6
- 235000001014 amino acid Nutrition 0.000 description 85
- 125000000539 amino acid group Chemical group 0.000 description 35
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 19
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 16
- 238000006467 substitution reaction Methods 0.000 description 16
- 229930182817 methionine Natural products 0.000 description 14
- 102000004169 proteins and genes Human genes 0.000 description 14
- 108090000623 proteins and genes Proteins 0.000 description 14
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 13
- 210000004027 cell Anatomy 0.000 description 12
- 108020001507 fusion proteins Proteins 0.000 description 11
- 102000037865 fusion proteins Human genes 0.000 description 11
- 235000018102 proteins Nutrition 0.000 description 9
- 102220633075 Hyaluronan synthase 1_C14R_mutation Human genes 0.000 description 8
- 230000000694 effects Effects 0.000 description 8
- 150000002500 ions Chemical class 0.000 description 8
- 229910052757 nitrogen Inorganic materials 0.000 description 8
- 239000011780 sodium chloride Substances 0.000 description 8
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 7
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 6
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 5
- 239000007995 HEPES buffer Substances 0.000 description 5
- 238000007792 addition Methods 0.000 description 5
- 230000001580 bacterial effect Effects 0.000 description 5
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 5
- 235000018417 cysteine Nutrition 0.000 description 5
- 230000004927 fusion Effects 0.000 description 5
- 238000002844 melting Methods 0.000 description 5
- 230000008018 melting Effects 0.000 description 5
- 239000011534 wash buffer Substances 0.000 description 5
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 4
- 102000004190 Enzymes Human genes 0.000 description 4
- 108090000790 Enzymes Proteins 0.000 description 4
- 102220470542 Proteasome subunit beta type-3_C14S_mutation Human genes 0.000 description 4
- 102220476045 Tubulin beta-6 chain_C50S_mutation Human genes 0.000 description 4
- 230000000844 anti-bacterial effect Effects 0.000 description 4
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 4
- 230000002255 enzymatic effect Effects 0.000 description 4
- 229940088598 enzyme Drugs 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- 108700020482 Maltose-Binding protein Proteins 0.000 description 3
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 3
- -1 amino- Chemical class 0.000 description 3
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 3
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 3
- 235000011130 ammonium sulphate Nutrition 0.000 description 3
- 238000003556 assay Methods 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 210000002421 cell wall Anatomy 0.000 description 3
- 230000000593 degrading effect Effects 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 238000010828 elution Methods 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 238000010438 heat treatment Methods 0.000 description 3
- 125000001165 hydrophobic group Chemical group 0.000 description 3
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 3
- 230000002401 inhibitory effect Effects 0.000 description 3
- 238000000034 method Methods 0.000 description 3
- 229920000642 polymer Polymers 0.000 description 3
- 108091008146 restriction endonucleases Proteins 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- 241000251468 Actinopterygii Species 0.000 description 2
- 241000239223 Arachnida Species 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- 241000589877 Campylobacter coli Species 0.000 description 2
- 241000589875 Campylobacter jejuni Species 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- 101710184994 Complement control protein Proteins 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 241001494479 Pecora Species 0.000 description 2
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 2
- 102000002933 Thioredoxin Human genes 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical compound CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 230000002924 anti-infective effect Effects 0.000 description 2
- 230000000845 anti-microbial effect Effects 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- 125000000637 arginyl group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 2
- POIUWJQBRNEFGX-XAMSXPGMSA-N cathelicidin Chemical compound C([C@@H](C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC(C)C)C1=CC=CC=C1 POIUWJQBRNEFGX-XAMSXPGMSA-N 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 239000012149 elution buffer Substances 0.000 description 2
- 239000002158 endotoxin Substances 0.000 description 2
- 238000011067 equilibration Methods 0.000 description 2
- KSXBMTJGDUPBBN-VPKNIDFUSA-N histatin 5 Chemical compound C([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(O)=O)C1=CN=CN1 KSXBMTJGDUPBBN-VPKNIDFUSA-N 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 2
- 229920006008 lipopolysaccharide Polymers 0.000 description 2
- 238000011068 loading method Methods 0.000 description 2
- 230000002101 lytic effect Effects 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 230000003641 microbiacidal effect Effects 0.000 description 2
- 239000012071 phase Substances 0.000 description 2
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 108060008226 thioredoxin Proteins 0.000 description 2
- 229940094937 thioredoxin Drugs 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- PKTAYNJCGHSPDR-JNYFXXDFSA-N (2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-1-[(1R,4S,5aS,7S,10S,11aS,13S,17aS,19R,20aS,22S,23aS,25S,26aS,28S,34S,40S,43S,46R,51R,54R,60S,63S,66S,69S,72S,75S,78S,81S,84S,87S,90S,93R,96S,99S)-51-[[(2S,3R)-2-[[(2S,3R)-2-amino-3-hydroxybutanoyl]amino]-3-hydroxybutanoyl]amino]-81,87-bis(2-amino-2-oxoethyl)-84-benzyl-22,25,26a,28,66-pentakis[(2S)-butan-2-yl]-75,96-bis(3-carbamimidamidopropyl)-20a-(2-carboxyethyl)-7,11a,13,43-tetrakis[(1R)-1-hydroxyethyl]-63,78-bis(hydroxymethyl)-10-[(4-hydroxyphenyl)methyl]-4,23a,40,72-tetramethyl-99-(2-methylpropyl)-a,2,5,6a,8,9a,11,12a,14,17,18a,20,21a,23,24a,26,27a,29,35,38,41,44,52,55,61,64,67,70,73,76,79,82,85,88,91,94,97-heptatriacontaoxo-69,90-di(propan-2-yl)-30a,31a,34a,35a,48,49-hexathia-1a,3,6,7a,9,10a,12,13a,15,18,19a,21,22a,24,25a,27,28a,30,36,39,42,45,53,56,62,65,68,71,74,77,80,83,86,89,92,95,98-heptatriacontazaheptacyclo[91.35.4.419,54.030,34.056,60.0101,105.0113,117]hexatriacontahectane-46-carbonyl]pyrrolidine-2-carbonyl]amino]acetyl]amino]-3-carboxypropanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]propanoyl]amino]-4-amino-4-oxobutanoic acid Chemical compound CC[C@H](C)[C@@H]1NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]2CCCN2C(=O)[C@@H](NC(=O)CNC(=O)[C@@H]2CCCN2C(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]2CSSC[C@H](NC1=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@H]1CSSC[C@H](NC(=O)[C@H](CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)CNC(=O)[C@@H]3CCCN3C(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC1=O)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)[C@@H](C)O)[C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N2)[C@@H](C)O PKTAYNJCGHSPDR-JNYFXXDFSA-N 0.000 description 1
- UKVZSPHYQJNTOU-GQJPYGCMSA-N (2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[(2S)-5-amino-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S,3R)-2-amino-3-hydroxybutanoyl]amino]-5-carbamimidamidopentanoyl]amino]-3-hydroxypropanoyl]amino]-3-hydroxypropanoyl]amino]-5-carbamimidamidopentanoyl]amino]propanoyl]amino]acetyl]amino]-4-methylpentanoyl]amino]-5-oxopentanoyl]amino]-3-phenylpropanoyl]pyrrolidine-2-carbonyl]amino]-3-methylbutanoyl]amino]acetyl]amino]-5-carbamimidamidopentanoyl]amino]-3-methylbutanoyl]amino]-3-(1H-imidazol-5-yl)propanoyl]amino]-5-carbamimidamidopentanoyl]amino]-4-methylpentanoyl]amino]-4-methylpentanoyl]amino]-5-carbamimidamidopentanoyl]amino]hexanoic acid Chemical compound C([C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](N)[C@@H](C)O)CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(O)=O)C1=CC=CC=C1 UKVZSPHYQJNTOU-GQJPYGCMSA-N 0.000 description 1
- VFERDGRYIBXYRG-REVLRCOSSA-N (2s)-1-[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-3-methylbutanoyl]amino]propanoyl]pyrrolidine-2-carboxylic acid Chemical compound C([C@@H](C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(O)=O)NC(=O)[C@@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 VFERDGRYIBXYRG-REVLRCOSSA-N 0.000 description 1
- XJOTXKZIRSHZQV-RXHOOSIZSA-N (3S)-3-amino-4-[[(2S,3R)-1-[[(2S)-1-[[(2S)-1-[(2S)-2-[[(2S,3S)-1-[[(1R,6R,12R,17R,20S,23S,26R,31R,34R,39R,42S,45S,48S,51S,59S)-51-(4-aminobutyl)-31-[[(2S)-6-amino-1-[[(1S,2R)-1-carboxy-2-hydroxypropyl]amino]-1-oxohexan-2-yl]carbamoyl]-20-benzyl-23-[(2S)-butan-2-yl]-45-(3-carbamimidamidopropyl)-48-(hydroxymethyl)-42-(1H-imidazol-4-ylmethyl)-59-(2-methylsulfanylethyl)-7,10,19,22,25,33,40,43,46,49,52,54,57,60,63,64-hexadecaoxo-3,4,14,15,28,29,36,37-octathia-8,11,18,21,24,32,41,44,47,50,53,55,58,61,62,65-hexadecazatetracyclo[32.19.8.26,17.212,39]pentahexacontan-26-yl]amino]-3-methyl-1-oxopentan-2-yl]carbamoyl]pyrrolidin-1-yl]-1-oxo-3-phenylpropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-4-oxobutanoic acid Chemical compound CC[C@H](C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(O)=O)[C@@H](C)O)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@@H]2CSSC[C@@H]3NC(=O)[C@@H]4CSSC[C@H](NC(=O)[C@H](Cc5ccccc5)NC(=O)[C@@H](NC1=O)[C@@H](C)CC)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](Cc1cnc[nH]1)NC3=O)C(=O)NCC(=O)N[C@@H](CCSC)C(=O)N2)C(=O)NCC(=O)N4)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O XJOTXKZIRSHZQV-RXHOOSIZSA-N 0.000 description 1
- SNBCLPGEMZEWLU-QXFUBDJGSA-N 2-chloro-n-[[(2r,3s,5r)-3-hydroxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methyl]acetamide Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CNC(=O)CCl)[C@@H](O)C1 SNBCLPGEMZEWLU-QXFUBDJGSA-N 0.000 description 1
- 241000256118 Aedes aegypti Species 0.000 description 1
- 101710185380 Androctonin Proteins 0.000 description 1
- 241000256837 Apidae Species 0.000 description 1
- 241000256844 Apis mellifera Species 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 241000921185 Bombus pascuorum Species 0.000 description 1
- 241000255789 Bombyx mori Species 0.000 description 1
- 241001415440 Bufo gargarizans Species 0.000 description 1
- 101710117545 C protein Proteins 0.000 description 1
- 241000589994 Campylobacter sp. Species 0.000 description 1
- 101710115643 Cathelicidin-1 Proteins 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 241001529572 Chaceon affinis Species 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 101710136772 Crambin Proteins 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- 241000255601 Drosophila melanogaster Species 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 101000925662 Enterobacteria phage PRD1 Endolysin Proteins 0.000 description 1
- 101000925646 Enterobacteria phage T4 Endolysin Proteins 0.000 description 1
- 241001198387 Escherichia coli BL21(DE3) Species 0.000 description 1
- 101710198951 Esculentin-1 Proteins 0.000 description 1
- 241000272190 Falco peregrinus Species 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 101710168479 Granulysin Proteins 0.000 description 1
- 102100021186 Granulysin Human genes 0.000 description 1
- 102400000777 His3-(20-43)-peptide Human genes 0.000 description 1
- 108010019494 Histatins Proteins 0.000 description 1
- 102000006492 Histatins Human genes 0.000 description 1
- 101000898505 Homo sapiens Histatin-3 Proteins 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- 125000000998 L-alanino group Chemical group [H]N([*])[C@](C([H])([H])[H])([H])C(=O)O[H] 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- PKVZBNCYEICAQP-UHFFFAOYSA-N Mecamylamine hydrochloride Chemical compound Cl.C1CC2C(C)(C)C(NC)(C)C1C2 PKVZBNCYEICAQP-UHFFFAOYSA-N 0.000 description 1
- 241000108056 Monas Species 0.000 description 1
- 241000204031 Mycoplasma Species 0.000 description 1
- 241000701553 Myoviridae Species 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 229910019142 PO4 Chemical group 0.000 description 1
- 108020002230 Pancreatic Ribonuclease Proteins 0.000 description 1
- 102000005891 Pancreatic ribonuclease Human genes 0.000 description 1
- 241000309023 Pirata subpiraticus Species 0.000 description 1
- 101710196635 Pyrrhocoricin Proteins 0.000 description 1
- 241000269435 Rana <genus> Species 0.000 description 1
- 241000270934 Rana catesbeiana Species 0.000 description 1
- 244000088415 Raphanus sativus Species 0.000 description 1
- 235000006140 Raphanus sativus var sativus Nutrition 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 241000257190 Sarcophaga <genus> Species 0.000 description 1
- 241000304160 Sarcophaga carnaria Species 0.000 description 1
- 241000239226 Scorpiones Species 0.000 description 1
- RJFAYQIBOAGBLC-BYPYZUCNSA-N Selenium-L-methionine Chemical group C[Se]CC[C@H](N)C(O)=O RJFAYQIBOAGBLC-BYPYZUCNSA-N 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- 241001417871 Silurus asotus Species 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 108010070741 Tachypleus tridentatus tachyplesin peptide Proteins 0.000 description 1
- 108010076830 Thionins Proteins 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 241000269368 Xenopus laevis Species 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 230000002353 algacidal effect Effects 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 102000018568 alpha-Defensin Human genes 0.000 description 1
- 108050007802 alpha-defensin Proteins 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 230000003569 amebicidal effect Effects 0.000 description 1
- 230000000843 anti-fungal effect Effects 0.000 description 1
- 230000001857 anti-mycotic effect Effects 0.000 description 1
- 230000002141 anti-parasite Effects 0.000 description 1
- 239000002543 antimycotic Substances 0.000 description 1
- 239000003096 antiparasitic agent Substances 0.000 description 1
- 239000008346 aqueous phase Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 108050002883 beta-defensin Proteins 0.000 description 1
- 102000012265 beta-defensin Human genes 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000006287 biotinylation Effects 0.000 description 1
- 238000007413 biotinylation Methods 0.000 description 1
- 108010040767 buforin I Proteins 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 229940015062 campylobacter jejuni Drugs 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 125000000837 carbohydrate group Chemical group 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 241001233037 catfish Species 0.000 description 1
- 108060001132 cathelicidin Proteins 0.000 description 1
- 102000014509 cathelicidin Human genes 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 108010046237 cecropin P1-LI Proteins 0.000 description 1
- PRIVBYDFWSFUFP-RJLJEYQFSA-N cecropin p1 Chemical compound O=C([C@H](CCC(N)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](C)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@@H](N)CO)[C@@H](C)O)[C@@H](C)CC)[C@@H](C)CC)NCC(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(O)=O PRIVBYDFWSFUFP-RJLJEYQFSA-N 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 125000003636 chemical group Chemical group 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 238000011210 chromatographic step Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 238000012411 cloning technique Methods 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000001687 destabilization Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- XUFQPHANEAPEMJ-UHFFFAOYSA-N famotidine Chemical compound NC(N)=NC1=NC(CSCCC(N)=NS(N)(=O)=O)=CS1 XUFQPHANEAPEMJ-UHFFFAOYSA-N 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 230000000855 fungicidal effect Effects 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 230000002070 germicidal effect Effects 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- 150000003278 haem Chemical class 0.000 description 1
- 108060003558 hepcidin Proteins 0.000 description 1
- 102000018511 hepcidin Human genes 0.000 description 1
- 229940066919 hepcidin Drugs 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- USSYUMHVHQSYNA-SLDJZXPVSA-N indolicidin Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(N)=O)CC1=CNC2=CC=CC=C12 USSYUMHVHQSYNA-SLDJZXPVSA-N 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 238000011034 membrane dialysis Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- NFEQUGKCQWAGLY-UAAVROCESA-N parasin i Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@@H](N)CCCCN NFEQUGKCQWAGLY-UAAVROCESA-N 0.000 description 1
- 230000000590 parasiticidal effect Effects 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000006320 pegylation Effects 0.000 description 1
- FWZLYKYJQSQEPN-SKLAJPBESA-N peregrine Chemical compound OC1[C@H]2[C@@H]3C4([C@@H]5C6OC(C)=O)C(OC)CC[C@@]5(C)CN(CC)[C@H]4C6[C@@]2(OC)C[C@H](OC)[C@H]1C3 FWZLYKYJQSQEPN-SKLAJPBESA-N 0.000 description 1
- FWZLYKYJQSQEPN-UHFFFAOYSA-N peregrine Natural products OC1C2C3C4(C5C6OC(C)=O)C(OC)CCC5(C)CN(CC)C4C6C2(OC)CC(OC)C1C3 FWZLYKYJQSQEPN-UHFFFAOYSA-N 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 239000010452 phosphate Chemical group 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical group [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 125000006239 protecting group Chemical group 0.000 description 1
- 230000004850 protein–protein interaction Effects 0.000 description 1
- 230000002359 protozoacidal effect Effects 0.000 description 1
- UWTNKIQOJMCYQD-WWVPZDBJSA-N pyrrhocoricin Chemical compound C([C@H](NC(=O)[C@@H](N)[C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)OC(=O)[C@]1(N(CCC1)C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H]1N(CCC1)C(=O)[C@H]1N(CCC1)C(=O)[C@@H](NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)C(C)C)[C@@H](C)OC1[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O1)NC(C)=O)C(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC(C)C)C1=CC=C(O)C=C1 UWTNKIQOJMCYQD-WWVPZDBJSA-N 0.000 description 1
- 239000010453 quartz Substances 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 239000004627 regenerated cellulose Substances 0.000 description 1
- 102200065564 rs6318 Human genes 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N silicon dioxide Inorganic materials O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 238000004611 spectroscopical analysis Methods 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 239000011550 stock solution Substances 0.000 description 1
- 239000012536 storage buffer Substances 0.000 description 1
- 125000001424 substituent group Chemical group 0.000 description 1
- ZJQFYZCNRTZAIM-PMXBASNASA-N tachyplesin Chemical compound C([C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@H](C(N[C@H]2CSSC[C@H](NC(=O)[C@H](C(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC=3C=CC=CC=3)NC(=O)[C@@H](NC(=O)[C@H](CC=3C4=CC=CC=C4NC=3)NC(=O)[C@@H](N)CCCCN)CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC=3C=CC(O)=CC=3)NC2=O)C(=O)N[C@@H](CCCNC(N)=N)C(N)=O)C(=O)N1)=O)[C@@H](C)CC)C1=CC=C(O)C=C1 ZJQFYZCNRTZAIM-PMXBASNASA-N 0.000 description 1
- 108010032153 thanatin Proteins 0.000 description 1
- 108010034266 theta-defensin Proteins 0.000 description 1
- ANRHNWWPFJCPAZ-UHFFFAOYSA-M thionine Chemical compound [Cl-].C1=CC(N)=CC2=[S+]C3=CC(N)=CC=C3N=C21 ANRHNWWPFJCPAZ-UHFFFAOYSA-M 0.000 description 1
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- QHTGVJBNKLTDJN-ONHACJEVSA-N tracheal antimicrobial peptide Chemical compound N([C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H]1C(=O)N[C@H](C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@H](C(N[C@H]2CSSC[C@H]3C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(N[C@@H](CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H]4CCCN4C(=O)[C@H](C(C)C)NC2=O)C(=O)N2[C@@H](CCC2)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N3)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(O)=O)=O)CSSC1)C(C)C)C(C)C)=O)[C@@H](C)CC)C(C)C)C(C)C)C(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CC(N)=O QHTGVJBNKLTDJN-ONHACJEVSA-N 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 235000002374 tyrosine Nutrition 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- ZKIAWZPHVZQYMG-QYJCGYSGSA-N θ-defensin Chemical compound O=C([C@@H]1CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC2=O)C(=O)N[C@H](C(=O)N[C@@H](CSSC[C@@H](C(N[C@@H](CCCNC(N)=N)C(=O)N1)=O)NC(=O)[C@@H](NC(=O)CN)[C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(O)=O)[C@@H](C)CC)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]1C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H]2CSSC1 ZKIAWZPHVZQYMG-QYJCGYSGSA-N 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/47—Hydrolases (3) acting on glycosyl compounds (3.2), e.g. cellulases, lactases
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/48—Hydrolases (3) acting on peptide bonds (3.4)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
- C12N9/2462—Lysozyme (3.2.1.17)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
- C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
- C12N9/503—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
- C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
- C12Y302/01017—Lysozyme (3.2.1.17)
Abstract
The present invention relates to polypeptides comprising an amino acid sequence exhibiting at least about 90% sequence identity with the sequence of SEQ ID NO: 1. Said polypeptides preferably degrade the peptidoglycan of Gram-negative bacteria, in particular of Pseudomonas and/or Campylobacter bacteria. In addition, the present invention relates to nucleic acids encoding such polypeptides, vectors comprising such nucleic acids, and corresponding host cells. Finally, the present invention relates to compositions comprising such polypeptides, nucleic acids, vectors, and/or host cells according to the present invention. In particular, the present invention relates to a modified KZ144 endolysin sequence (SEQ ID NO: 1) which have heat stabilizing mutations. The heat stabilizing mutations are selected from at least one of (i) X23S (ii) X14S and X50S (iii) X82I (iv) X122M and X160T (v) X206V or (vi) X232T. ria. In addition, the present invention relates to nucleic acids encoding such polypeptides, vectors comprising such nucleic acids, and corresponding host cells. Finally, the present invention relates to compositions comprising such polypeptides, nucleic acids, vectors, and/or host cells according to the present invention. In particular, the present invention relates to a modified KZ144 endolysin sequence (SEQ ID NO: 1) which have heat stabilizing mutations. The heat stabilizing mutations are selected from at least one of (i) X23S (ii) X14S and X50S (iii) X82I (iv) X122M and X160T (v) X206V or (vi) X232T.
Description
Modified KZ144 endolysin sequence The present ion relates to polypeptides comprising an amino acid sequence exhibiting at least about 90% ce identity with the sequence of SEQ ID NO: 1. Said polypeptides preferably e the peptidoglycan of Gram-negative bacteria, in particular of monas and/0r Campylobacter bacteria. In on, the present invention relates to nucleic acids encoding such polypeptides, vectors sing such nucleic acids, and corresponding host cells. Finally, the present invention relates to compositions sing such polypeptides, nucleic acids, vectors, and/or host cells according to the present invention.
The giant, lytic Myoviridae bacteriophage ¢KZ (280 334 bp) infects Pseudomonas aeruginosa, an important unistic nosocomial pathogen ant to many commonly used antibiotics, and is therefore the cause of considerable concern in hospital environments.
In 2007, Briers et al. (Molecular Microbiology (2007) 65(5), 1334—1344) sequenced the genome of said iophage and identified the endolysin K2144, a highly lytic peptidoglycan hydrolase. In said endolysin as enzymatic element has been proposed for use in degrading the cell wall of Gram—negative bacteria.
While said endolysin and fusion proteins are effective in general, it turned out, that for some technical applications the endolysin polypeptide exhibits suboptimal characteristics, in ular in terms of stability and processing. Thus, there was a need in the art for a further endolysin enzyme, which exhibits preferably improved characteristics in this respect. The m of the present invention was thus to provide such polypeptide.
The problem is solved by the subject-matter as set forth in the appended claims.
In the following a brief description of the appended figures will be given. The figures are intended to illustrate the present ion in more detail. However, they are not intended to limit the subject matter of the invention to any extent.
Fig. 1: illustrates: SEQ ID NO: 1, SEQ ID NO: 2 K2144 endolysin without N—terminal methionine, SEQ ID NO: 3 K2144 endolysin without N—terminal methionine and with selenomethionine residues instead of methionine residues, SEQ ID NO: K2144 endolysin with E115A mutation without N—terminal methionine, and SEQ ID NO: K2144 endolysin.
Fig. 2: illustrates: SEQ ID NO: 136 Fusion protein of SMAP—29 (underlined with solid line; SEQ ID NO: 76), ed K2144 without N—terminal methionine and with C14S and C50S lined with semi—dotted/semi— solid line; SEQ ID NO: 28) and His—tag (underlined with dotted line; SEQ ID NO: 135).
SEQ ID NO: 137 Fusion protein of SMAP—29 (underlined with solid line; SEQ ID NO: 76), modified K2144 without N—terminal methionine and with T821, A206V and S232T (underlined with semi— dotted/semi—solid line; SEQ ID NO: 29) and His—tag (underlined with dotted line; SEQ ID NO: 135).
SEQ ID NO: 138 Fusion protein of SMAP—29 (underlined with solid line; SEQ ID NO: 76), ed K2144 without N—terminal methionine and with T821, A206V, S232T, Il22M; and A160T (underlined with semi—dotted/semi—solid line; SEQ ID NO: 30) and His—tag lined with dotted line; SEQ ID NO: 135).
SEQ ID NO: 139 Fusion protein of SMAP—29 (underlined with solid line; SEQ ID NO: 76), modified K2144 without N—terminal methionine and with C14S, C50S, Il22M; and A160T (underlined with semi—dotted/semi—solid line; SEQ ID NO: 31) and His—tag (underlined with dotted line; SEQ ID NO: 135).
SEQ ID NO: 140 Fusion protein of 9 (underlined with solid line; SEQ ID NO: 76), ed K2144 without N—terminal nine and with C14S, C23S and CSOS (underlined with semi— dotted/semi—solid line; SEQ ID NO: 32) and His—tag (underlined with dotted line; SEQ ID NO: 135).
SEQ ID NO: 141 Fusion protein of SMAP—29 (underlined with solid line; SEQ ID NO: 76), modified K2144 without N—terminal methionine and with T821, A206V, S232T, 1122M; A160T, C148 and C50S (underlined with semi—dotted/semi—solid line; SEQ ID NO: 33) and His-tag (underlined with dotted line; SEQ ID NO: 135).
SEQ ID NO: 142 Fusion protein of SMAP—29 (underlined with solid line; SEQ ID NO: 76), modified KZ144 without N—terminal nine and with T821, A206N, S232T, 1122M; A160T C148 and C50S (underlined with semi—dotted/semi—solid line; SEQ ID NO: 49) and g (underlined with dotted line; SEQ ID NO: 135).
SEQ ID NO: 151 Fusion n of SMAP-29 (underlined with solid line; SEQ ID NO: 76), K2144 without N—terminal nine (underlined with semi—dotted/semi—solid line; SEQ ID NO: 2) and His—tag (underlined with dotted line; SEQ ID NO: 135).
In a first aspect the present invention relates to a polypeptide comprising an amino acid sequence exhibiting at least about 90% sequence ty with the sequence of SEQ ID NO: 1, wherein SEQ ID NO: 1 is characterized by X1 may be absent or any amino acid, in ular M, X14 may be any amino acid, preferably S, R or N, more preferably S X23 may be any amino acid, preferably S, R or N, more preferably X50 may be any amino acid, preferably S, R or N, more preferably S X82 may be any amino acid, preferably T or I X122 may be any amino acid, preferably I or M X149 may be any amino acid, preferably M or P X154 may be any amino acid, preferably L or T X160 may be any amino acid, preferably A or T XI67 may be any amino acid, preferably I or L XI79 may be any amino acid, preferably N or F XI80 may be any amino acid, preferably M or E XI86 may be any amino acid, preferably V or Y X206 may be any amino acid, preferably A, N or V X212 may be any amino acid, preferably T or N X224 may be any amino acid, preferably P or Q X230 may be any amino acid, preferably N or Y X232 may be any amino acid, preferably S or T; and wherein the polypeptide does neither comprise the amino acid sequence of SEQ ID NO: 2, nor of SEQ ID NO: 3, nor of SEQ ID NO: 4.
In one embodiment, the t invention provides ptide comprising an amino acid sequence of SEQ ID NO: 1, wherein SEQ ID NO: 1 is characterized by X1 may be absent or any amino acid, X14 may be any amino acid, X23 may be any amino acid, X50 may be any amino acid, X82 may be any amino acid, X122 may be any amino acid, X149 may be any amino acid, X154 may be any amino acid, X160 may be any amino acid, X167 may be any amino acid, X179 may be any amino acid, X180 may be any amino acid, X186 may be any amino acid, X206 may be any amino acid, X212 may be any amino acid, X224 may be any amino acid, X230 may be any amino acid, X232 may be any amino acid; with the additional proviso that the sequence of SEQ ID NO: 1 exhibtis at least one of the following: i) X23 is S; ii) X14 and X50 are S; iii) X82 is I; iv) X122 is M and X160 is T; v) X206 is V; vi) X232 is T; wherein the polypeptide does neither comprise the amino acid sequence of SEQ ID NO: 2, nor SEQ ID NO:3 nor SEQ ID NO: 4.
The term "polypeptide" as used herein refers in particular to a polymer of amino acid es linked by peptide bonds in a specific ce. The amino acid es of a polypeptide may be modified by e.g. covalent attachments of various groups such as carbohydrates and phosphate. Other substances may be more loosely associated with the polypeptide, such as heme or lipid, giving rise to conjugated polypeptides which are also comprised by the term "polypeptide" as used herein. The term as used herein is intended to encompass also ns.
Thus, the term "polypeptide" also encompasses for example complexes of two or more amino acid polymer chains. The term "polypeptide " does encompass embodiments of polypeptides which exhibit optionally modifications typically used in the art, e.g. biotinylation, acetylation, pegylation, chemical changes of the amino-, SH- or carboxyl-groups (e.g. protecting groups) etc.. As will become apparent from the description below, the polypeptide according to the present invention may also be a fusion protein, i.e. linkage of at least two amino acid sequences which do not occur in this combination in nature. The term " ptide " as used herein is not limited to a specific length of the amino acid polymer chain, but typically the polypeptide will exhibit a length of more than about 50 amino acids, more than about 100 amino acids or even more than about 150 amino acids. Usually, but not necessarily, a typical polypeptide of the present invention will not exceed about 750 amino acids in length.
As used herein, the term "% sequence identity", has to be understood as follows: Two sequences to be ed are aligned to give a m correlation between the sequences. This may include inserting "gaps" in either one or both sequences, to e the degree of alignment. A % ty may then be determined over the whole length of each of the sequences being compared lled global alignment), that is particularly suitable for sequences of the same or similar length, or over shorter, defined lengths (so—called local alignment), that is more le for sequences of unequal length. In the above context, an amino acid sequence having a "sequence identity" of at least, for e, 95% to a query amino acid sequence, is intended to mean that the sequence of the subject amino acid sequence is identical to the query sequence except that the subject amino acid ce may include up to five amino acid alterations per each 100 amino acids of the query amino acid sequence. In other words, to obtain an amino acid sequence having a sequence of at least 95% identity to a query amino acid sequence, up to 5% (5 of 100) of the amino acid residues in the subject sequence may be inserted or substituted with another amino acid or deleted. Methods for comparing the identity and homology of two or more sequences are well known in the art.
The tage to which two sequences are identical can for example be determined by using a mathematical algorithm. A preferred, but not limiting, example of a mathematical algorithm which can be used is the algorithm of Karlin et a/. (1993), PNAS USA, 90:5873—5877. Such an algorithm is integrated in the BLAST family of programs, e.g. BLAST or NBLAST program (see also Altschul et al., 1990, J. Mol. Biol. 215, 403—410 or Altschul et al. (1 997), Nucleic Acids Res, 25:3389—3402), accessible through the home page of the NCBI at world wide web site ncbi.nlm.nih.gov) and FASTA (Pearson (1 990), Methods Enzymol. 83, 63—98; Pearson and Lipman (1988), Proc. Natl. Acad. Sci. U. S. A 85, 2444—2448.). Sequences which are identical to other ces to a certain extent can be identified by these programmes.
Furthermore, programs available in the Wisconsin Sequence Analysis Package, version 9.1 (Devereux et al, 1984, c Acids Res., 387-395), for example the programs BESTFIT and GAP, may be used to determine the % identity between two polypeptide sequences. T uses the "local homology" thm of (Smith and Waterman (1981 ), J. Mol. Biol. 147, 195— 197.) and finds the best single region of similarity between two sequences. If herein reference is made to an amino acid sequence sharing a particular extent of sequence identity to a reference sequence, then said difference in sequence is preferably due to conservative amino acid tutions. Preferably, such sequence s the activity of the reference sequence, e.g. albeit maybe at a slower rate. In on, if reference is made herein to a sequence sharing "at least" at n percentage of sequence identity, then 100% sequence ty are preferably not encompassed.
"Conservative amino acid substitutions", as used , may occur within a group of amino acids which have sufficiently similar physicochemical properties, so that a substitution between members of the group will preserve the biological activity of the molecule (see e.g.
Grantham, R. , Science 185, 862—864). Particularly, conservative amino acid substitutions are preferably substitutions in which the amino acids originate from the same class of amino acids (e.g. basic amino acids, acidic amino acids, polar amino acids, amino acids with aliphatic side chains, amino acids with positively or vely charged side chains, amino acids with aromatic groups in the side chains, amino acids the side chains of which can enter into hydrogen bridges, e.g. side chains which have a hydroxyl function, etc.).
Conservative substitutions are in the present case for example substituting a basic amino acid residue (Lys, Arg, His) for another basic amino acid residue (Lys, Arg, His), tuting an aliphatic amino acid residue (Gly, Ala, Val, Leu, lie) for another aliphatic amino acid residue, substituting an aromatic amino acid residue (Phe, Tyr, Trp) for another aromatic amino acid residue, substituting threonine by serine or leucine by cine. Further conservative amino acid ges will be known to the person skilled in the art.
The term ion" as used herein refers ably to the absence of 1, 2, 3, 4, 5 (or even more than 5) continuous amino acid residues in the derivative sequence in comparison to the respective reference sequence, either intrasequentially or at the N— or C—terminus.
The term "insertion" as used herein refers preferably to the additional intrasequential presence of 1, 2, 3, 4, 5 (or even more than 5) continuous amino acid residues in the derivative sequence in comparison to the respective reference sequence.
The term "addition" as used herein refers preferably to the additional presence of l, 2, 3, 4, 5 (or even more than 5) continuous amino acid residues at the N— and/or C—terminus of the derivative sequence in comparison to the respective reference sequence.
The term itution" as used herein refers to the presence of an amino acid residue at a certain on of the derivative sequence which is different from the amino acid residue which is present or absent at the corresponding position in the reference sequence. As mentioned above, preferably such substitutions are conservative substitutions.
The term ,,cell wall" as used herein refers to all components that form the outer cell enclosure of egative bacteria and thus guarantee their ity. In particular, the term ,,cell wall" as used herein refers to peptidoglycan, the outer ne of the Gram—negative bacteria with the lipopolysaccharide, the bacterial cell membrane, but also to additional layers deposited on the peptidoglycan as e.g. capsules, outer protein layers or slimes.
The term "amino acid sequence stretch" as used herein refers to a particular stretch of amino acid sequence in the amino acid ce of the polypeptide of the invention. Said ce refers to a sequence of a cationic e, a polycationic peptide, an amphiphatic e, a hobic peptide, a sushi peptide and/or an crobial peptide. The term does not refer to conventional tags like His—tags, such as HisS—tags, His6—tags, His7—tags, His8—tags, His9— tags, Hile—tags, Hisll—tags, Hile—tags, Hisl6—tags and His20—tags, Strep—tags, Avi—tags, Myc-tags, Gst—tags, JS—tags, cystein—tags, FLAG—tags or other tags known in the art, thioredoxin or maltose binding proteins (MBP). Preferably an amino acid sequence stretch as used herein as a length of about 6 to about 39 amino acid residues.
As used , the term nic peptide" refers preferably to a peptide having positively charged amino acid residues. Preferably a cationic peptide has a lue of 9.0 or greater.
Typically, at least four of the amino acid residues of the cationic peptide can be positively charged, for example, lysine or arginine. "Positively charged" refers to the side chains of the amino acid residues which have a net positive charge at about physiological conditions. The term "cationic peptide" as used herein refers also to polycationic peptides, but also includes cationic peptides which comprise for example less than 20%, preferably less than 10% positively charged amino acid residues.
The term "polycationic peptide" as used herein refers ably to a peptide composed of mostly positively charged amino acid residues, in particular lysine and/or arginine residues. A peptide is composed of mostly positively charged amino acid residues if at least about 20, 30, 40, 50, 60, 70, 75, 80, 85, 90, 95 or about 100 % of the amino acid residues are positively charged amino acid residues, in particular lysine and/or arginine residues. The amino acid residues being not positively charged amino acid residues can be neutrally d amino acid residues and/or vely charged amino acid residues and/or hydrophobic amino acid residues. Preferably the amino acid residues being not positively charged amino acid es are lly charged amino acid residues, in particular serine and/or glycine.
The term, "antimicrobial peptide" (AMP) as used herein refers preferably to any naturally occurring e that has microbicidal and/or microbistatic activity on for example bacteria, WO 71436 viruses, fungi, yeasts, mycoplasma and protozoa. Thus, the term "antimicrobial peptide" as used herein refers in particular to any e having anti—bacterial, anti—fungal, anti—mycotic, anti—parasitic, rotozoal, iral, anti—infectious, anti—infective and/or germicidal, algicidal, amoebicidal, microbicidal, bactericidal, fungicidal, parasiticidal, protozoacidal, protozoicidal properties. Preferred are anti—bacterial es. The antimicrobial peptide may be a member of the RNase A super family, a defensin, cathelicidin, granulysin, histatin, sin, dermicidine or hepcidin. The antimicrobial peptide may be naturally occurring in insects, fish, plants, arachnids, vertebrates or mammals. Preferably the antimicrobial peptide may be naturally occurring in insects, fish, plants, arachnids, vertebrates or mammals.
Preferably the antimicrobial peptide may be lly occurring in radish, silk moth, wolf spider, frog, preferably in Xenopus laevis, Rana frogs, more ably in Rana catesbeiana, toad, preferably Asian toad Bufo bufo gargarizans, fly, preferably in Drosophila, more preferably in Drosophila melanogaster, in Aedes aegypti, in honey bee, bumblebee, preferably in Bombus pascuorum, flesh fly, preferably in Sarcophaga peregrine, scorpion, horseshoe crab, catfish, preferably in Parasilurus asotus, cow, pig, sheep, e, bovine, monkey and human. As used herein, an icrobial peptide" (AMP) may in particular be a peptide which is not a ic peptide, polycationic peptide, amphiphatic peptide, sushi peptide, defensins, and hydrophobic peptide, but nevertheless exhibits antimicrobial activity.
The term "sushi peptide" as used herein refers to complement control proteins (CCP) having short consensus repeats. The sushi module of sushi peptides functions as a protein—protein interaction domain in many ent proteins. Peptides containing a Sushi domain have been shown to have antimicrobial activities. Preferably, sushi peptides are naturally occurring peptides.
The term "amphiphatic peptide" as used herein refers to synthetic peptides having both hilic and hydrophobic functional groups. Preferably, the term "amphiphatic peptide" as used herein refers to a peptide having a d ement of hydrophilic and hydrophobic groups e.g. amphiphatic peptides may be e.g. alpha helical, having predominantly non polar side chains along one side of the helix and polar residues along the rest of its surface.
The term "hydrophobic group" as used herein refers preferably to chemical groups such as amino acid side chains which are substantially water insoluble, but soluble in an oil phase, with the solubility in the oil phase being higher than that in water or in an aqueous phase. In water, amino acid es having a hydrophobic side chain interact with one another to generate a non—aqueous environment. Examples of amino acid residues with hydrophobic side chains are valine, cine, leucine, methionine, phenylalanine, tryptophan, cysteine, alanine, tyrosine, and proline residues The term "hydrophobic peptide" as used herein refers to a hydrophobic peptide, which is preferably composed of mostly amino acid residues with hydrophobic groups. Such peptide is preferably composed of mostly hydrophobic amino acid residues, i.e. at least about 20, 30, 40, 50, 60, 70, 75, 80, 85, 90, 95 or at least about 100 % of the amino acid residues are hydrophobic amino acid residues. The amino acid residues being not hydrophobic are preferably neutral and preferably not hydrophilic.
As used herein, the term "tag" refers to an amino acid sequence, which is typically in the art fused to or ed in another amino acid sequence for a) improving expression of the overall amino acid sequence or polypeptide, b) facilitating purification of the overall amino acid sequence or ptide, c) facilitating lisation of the overall amino acid sequence or polypeptide, and/or d) facilitating detection of the overall amino acid sequence or polypeptide. Examples for tags are His tags, such as His5—tags, His6—tags, His7—tags, HisS— tags, His9-tags, Hile—tags, Hisll—tags, Hile—tags, Hisl6—tags and His20—tags, Strep—tags, Avi-tags, Myc-tags, GST-tags, JS-tags, cystein-tags, FLAG-tags, HA-tags, thioredoxin or e binding ns (MBP), CAT, GFP, YFP, etc. The person skilled in the art will know a vast number of tags suitable for different technical applications. The tag may for e make such tagged polypeptide suitable for e.g. antibody binding in different ELISA assay formats or other technical applications.
The term ising" as used herein shall not be construed as being limited to the g "consisting of" (i.e. ing the presence of additional other matter). Rather, "comprising" implies that optionally additional matter may be present. The term "comprising" encompasses as particularly envisioned ments falling within its scope "consisting of" (i.e. excluding the presence of onal other matter) and "comprising but not consisting of" (i.e. requiring the presence of additional other matter), with the former being more preferred.
The polypeptide ing to the present invention may exhibit in the amino acid sequence ting at least about 90% sequence identity with the sequence of SEQ ID NO: 1 at least one (e.g. l, 2, 3, 4, 5, 6, 7, 8, 9, 10, ll, 12, 13, 14, 15, 16 or even all 17) of the following: X14 is not C; X23 is not C; X50 is not C; X82 is 1; X122 is M; X149 is P; X154 is T, X160 is T; X167 is L; X179 is F; X180 is E; X186 is Y; X206 is N or V, X212 is N; X224 is Q; X230 is Y and/or X232 is T. It is understood that the number indicating the position of the respective amino acid residue indicates the relative on in the sequence corresponding to SEQ ID NO: 1, and not to the overall amino acid sequence of the polypeptide according to the present invention, which may be longer.
The inventive polypeptide exhibits said at least 90% sequence identity. The inventive polypeptide may thus for example exhibit a higher level of sequence identity, 6.g. may exhibit at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 98,5%, at least about 99% (e.g. less than 3 amino acids deviation) at least about 99,3% , (e.g. less than 2 amino acids deviation), at least about 99,5%, at least about 99,6% or even 100% sequence identity with the sequence of SEQ ID NO: 1.
An inventive polypeptide comprising a sequence sharing a given level of sequence identity with the sequence of SEQ ID NO: 1 (or more specific sequences f, see below) can for example deviate from the reference sequence by addition, substitution, insertion or on of one or more amino acid es and all possible combinations thereof. Only for the sake of clarity it is pointed out that such ations refer to distinct positions in the sequence. A "deletion" followed by "addition", or "addition" followed by "deletion", of one or more amino acids, at the same relative position, is not an combination of an "addition" and "deletion" (or Vice versa) but falls under the term itution". Preferably, the ions in sequence from the sequence of SEQ ID NO: 1 (or more specific sequences thereof, see below) will be of conservative nature, e.g. conservative substitutions. Even more preferably the deviation in sequence is limited to those positions in SEQ ID NO: 1 (or more specific sequences thereof, see below), which have been identified to be non—critical for the tic activity, i.e. X1, X14, X23, X50, X82, X122, X149; X160, X167, X179, X180, X186; X206; X212; X224; X230 and/or X232.
Preferably, the polypeptide according to the present ion exhibits in the amino acid sequence ting at least about 90% sequence ty with the sequence of SEQ ID NO: 1 a ic acid residue at position 115. As shown in the publication Briers et al. (Molecular Microbiology (2007) 65(5), 1334—1344), the mutation E115A led to a loss in activity of about 70% of the enzyme. Thus, while an inventive polypeptide comprising said mutation will thus not be a loss of function polypeptide and may still serve various technical purposes, it is certainly preferred if such mutation is not present in the sequence stretch corresponding to SEQ ID NO: 1 within the inventive polypeptide.
In a particular preferred embodiment ing to the present invention the polypeptide of the present invention comprises the sequence of SEQ ID NO: I.
The inventors of the present invention have found out that three cysteine residues in the amino acid sequence of SEQ ID NO: 5 (K2144 endolysin sequence) are not essential for the enzymatic activity. Thus, in the sequence corresponding to SEQ ID NO: I nsus sequence of the present invention) of the inventive polypeptide (or g at least 90% sequence identity therewith), in some embodiments X14 is not C, X23 is not C, or X50 is not C. Combinations are possible, e.g. X14 and X23 are not C, X14 and X50 are not C, or X23 and X50 are not C. Likewise, it is also possible that r X14 nor X23 nor X50 are C. In principle said amino acid residues can be d or substituted by any other amino acid.
Examples for such other amino acids are S, R and N. Thus, X14 may for example be S, N, or R; more preferably S or R; most preferably R; X23 may for example be S, N, or R, more preferably S; and X50 may for e be S, N, or R, more preferably S or N; most preferably N. X14, X23 and X50 may of course exhibit different amino acid substitutions, for example X14 may be R while X23 and X50 are S; or X14 and X23 are S, while X50 is N; X14 may be R while X23 is S and X50 is N etc.. Any other ation conceivable is also contemplated by the present invention. Conservative amino acid substitutions are preferred.
Particularly preferred is a substitute of a serine residue for the cysteine e. Thus, in particularly preferred examples of the present invention X14 is S, X23 is S or X50 is S. Of course, it is also possible that X14 and X23 are S, or that X14 and X50 are S, or that X23 and X50 are S. X14, X23 and X50 may also all three be S. Absence of one or more or even of all of these cysteine e has the advantage that the risk of aggregation of the polypeptide according to the present invention, e.g. by red disulfide bridge ion, is reduced, and is thus an preferred embodiment of the present invention.
Aside of the dispensability of the above referenced cysteine residues, the inventors of the present invention have also elucidated that various other residues in the sequence of SEQ ID NO: 5 are also not essential and, moreover, may be replaced by other es, thereby WO 71436 sing for instance the temperature stability of the inventive polypeptide. Examples for such substitutions are X821, X122M, X149P; X154T, X160T, X167L, X179F, X180E, X186Y, X206V, X206N, X212N, X230Y and X232T. These substitutions may be present alone or in any combination. A typical combination is the ation of X122M and X160T.
Other examples of combinations are, without being limited o, X821, X206V plus X232T; X821, Xl22M, X160T, X206V, plus X232T; X821, X122M, X160T, X206N, plus X232T; X821, X122M, X206V, plus X232T; X821, X122M, X149P, X160T, X206V, plus X232T; X821, X122M, X160T, X180E, X206V, plus X232T; X821, X122M, X160T, X186Y, X206V, plus X232T; X821, X122M, X160T, X206V, X230Y, plus X232T; X821, X122M, X149P, X206V, plus X232T; X821, X122M, X149P, X160T, X206V, plus X232T; X821, X122M, X149P, X206V, plus X232T; X821, X122M, X149P, X167L, X206V, plus X232T; X821, X122M, X149P, X179F, X206V, plus X232T; X821, X122M, X149P, X206V, X212N plus X232T; X821, X122M, X149P, X206V, X224Q plus X232T; X821, X122M, X149P, X154T, X206V, plus X232T etc.. Of course, this second type of amino acid modifications may be combined with the above mentioned cysteine replacements in any type of combination conceivable. Examples of such combinations are, without being limited thereto, X148, X508, X122M and X160T; X148, X508, X821, X122M, X160T, X206V, and X232T; X148, X508, X821, X122M, X160T, X206N, and X232T; X148, X508, X821, X122M, X206V, and X232T; X148, X508, X821, X122M, X149P, X160T, X206V, and X232T; X148, X508, X821, X122M, X160T, X180E, X206V, and X232T; X148, X508, X821, X122M, X160T, X186Y, X206V, and X232T; X148, X508, X821, X122M, X160T, X206V, X230Y, and X232T; X14R, X508, X821, X122M, X160T, X206V, and X232T; X148, X50N, X821, X122M, Xl60T, X206V, and X232T; X14R, X508, X821, X122M, X149P, X206V, and X232T; X14R, X508, X821, X122M, X149P, X160T, X206V, and X232T; X14R, X50N, X821, X122M, X149P, X206V, and X232T; X14R, X50N, X821, X122M, X149P, X167L, X206V, and X232T; X14R, X50N, X821, X122M, X149P, X179F, X206V, and X232T; X14R, X50N, X821, X122M, X149P, X206V, X212N, and X232T; X14R, X50N, X821, X122M, X149P, X206V, X224Q and X232T; X14R, X50N, X821, X122M, X149P, X154T, X206V, and X232T; etc..
In SEQ ID NO: 1 (consensus ce of the present invention) the first amino acid residue is indicated as being either absent or any amino acid, in particular M. The results of the inventors, and of previous work (see of K2144 is dispensable. Thus, in some embodiments of the present invention the position of X1 in the sequence corresponding to SEQ ID NO: 1 in the inventive polypeptide is not M. If the polypeptide of the present invention exhibits for example N—terminally of the sequence ponding to SEQ ID NO: 1 further sequence elements, it may for instance for the purpose of effective expression in a host cell be useful, if the methionine at position 1 of SEQ ID NO: 1 is eliminated or replaced by another amino acid in order to avoid a ng codon in the corresponding nucleic acid sequence, potentially g to parallel expression of a polypeptide lacking the further sequence elements located more N—terminally. On the other hand, if there are no r N—terminal ce ts in the inventive polypeptide, X1 is of course preferably methionine (e.g. for expression purposes). For the enzymatic activity X1 is however never required.
Sequences falling under the definition of SEQ ID NO: 1, which have been ularly tested by the inventors, are for instance SEQ ID NOs: 6—27 (and corresponding ces without N—terminal methionine, SEQ ID NOs: 28—49).
It is understood that everything which has been set forth so far in terms of the generic sequence SEQ ID NO: 1 applies in similar manner also to more specific sequences. Thus, and only for the sake of clarity it is pointed out, that a polypeptide according to the present invention, comprising a sequence exhibiting at least 90% sequence identity with the generic sequence of SEQ ID NO: 1 as set out above, may in preferred embodiments certainly exhibit in analogous manner at least 90% sequence identity with more specific sequences of SEQ ID NO: 1 described or even particularly disclosed herein. Thus, in preferred ments of the present invention, the polypeptide of the present invention may for example comprise a sequence exhibiting at least 90% sequence identity with a sequence selected from any of SEQ ID NOs: 6—49, wherein the polypeptide does neither comprise the amino acid sequence of SEQ ID NO: 2, nor of SEQ ID NO: 3, nor of SEQ ID NO: 4.
The ptide according to the present invention may comprise aside of the enzymatic amino acid sequence, e.g. the ce ting at least about 90% sequence identity with the sequence of SEQ ID NO: 1 (or other sequences falling under these tion), further amino acid sequence stretches, e.g. as already disclosed in similar fashion in WO 49792. The polypeptide according to the present invention may for example comprise additionally at least one amino acid sequence stretch selected from the group ting of amphiphatic peptide, cationic peptide, polycationic peptide, hydrophobic peptide, or naturally occurring antimicrobial peptide, like sushi e and defensin. Such additional amino acid sequence stretches may improve the antibacterial properties of the inventive polypeptide. In some embodiments, the ive polypeptide may comprise at least two distinct amino acid sequence stretches selected from the group of amphiphatic peptide, cationic e, polycationic peptide, hydrophobic peptide, or naturally occurring antimicrobial peptide, like sushi peptide and defensin.
These one or more additional amino acid sequence stretches may be present N—terminally or C—terminally of the sequence exhibiting at least about 90% sequence ty with the sequence of SEQ ID NO: 1. They may for example be located at the N— or inus of the inventive polypeptide. Preferred es of such additional amino acid ce stretches (without being limited thereto), are the ce KRK and SEQ ID NOs: 50-120, as set out in more detail below. The polypeptide according to the present invention may comprise at least one onal amino acid sequence stretch selected from this group. For further guidance, in particular with respect to the generic and specific nature of possible additional amino acid sequence stretches, see for example also es for cationic and polycationic amino acid sequence stretches are listed in the following table.
Table 1: amino acid sequence stretch length SEQ.)ID NO: 91 A)m 91 U) 6‘ LI] 0 WA) U) W.N WA)WKQKKRK W RiRRRR KKKKKKKK KiKKRKK W5UWWRKKRKKRK W KiKKRKKi WWWKKKKKKKKKKKKK Wx0WWQKKRKKi KiKKRK W KiKKRKKx K itA15U50 {RRRRR{ RiRRRRR K RKKRKKRKKRKKRKK'RK K {KKRK {G SGKRKKRKKRK Kt{KKRKKRKRGSG SGKRKKRKKRK KfiKK Table 2: —sequence Bama- LL-37 [LL-37, 37 aa] SEQ ID NO: 75 RGLRRLGRKIAHGVKKYGPTVLRIIRIAG Indolicidin ILPWKWPWWPWRR SEQ ID NO: 77 Cecropin P1 SWLSKTAKKLENSAKKRISEGIAIAIQGGPR SEQ ID NO: 79 Pleurocidin GWGSFFKKAAHVGKHVGKAALTHYL SEQ ID NO: 81 Cfggomflf‘ GGLKKLGKKLEGAGKRVFNAAEKALPVVAGAKALRK SEQ ID NO: 82 in A (D. GWLKKIGKKIERVGQHTRDATIQGLGIPQQAANVAATA SEQ ID NO. 83. gaster) RG Buforin || TRSSRAGLQFPVGRVHRLLRK SEQ ID NO: 84 SWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATA SEQ ID NO: 85 Nigrocine 2 GLLSKVLGVGKKVLCGVSGLVC SEQ ID NO: 88 IWLTALKFLGKHAAKKLAKQQLSKL SEQ ID NO: 92 KGRGKQGGKVRAKAKTRSS SEQ ID NO: 93 AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRK Buforin I SEQ ID NO: 94 eptin 1 ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ SEQ ID NO: 95 Bactenecin 1 RLCRIVVIRVCR SEQ ID NO: 96 Thanatin GSKKPVPIIYCNRRTGKCQRM SEQ ID NO: 97 Brevinin 1T VNPIILGVLPKVCLITKKC SEQ ID NO: 98 SMLSVLKNLGKVGLGFVACKINIKQC SEQ ID NO: 99 Esculentin 1 SIIEEIELCGRKKIKNLLISGLKNVGKEVGMDVVRTGIKIAGC SEQ ID NO: 100 Tachyplesin RWCFRVCYRGICYRKCR SEQ ID NO: 101 Androctonin IKICRRRGGCYYKCTNRPY SEQ ID NO: 102 alpha-defensin PACIAGERRYGTCIYQGRLWAFCC SEQ ID NO: 103 beta-defensin NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK SEQ ID NO: 104 theta-defensin GFCRCLCRRGVCRCICTR SEQ ID NO: 105 defensin ATCDLLSGTGINHSACAAHCLLRGNRGGYCNGKAVCV SEQ ID NO. 106. saoecin A CRN Thionin (crambin) (TagquNSIVARSNFNVCRIPGTPEAICATYTGCIIIPGATCP SEQ ID NO: 107 defensin from QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSC SEQ 'D NO' 108_ NYVFPAHCICYFPC (EEEIEGPCAVWDNETCRRVCKEEGRSSGHCSPS SEQ ID NO: 109 DTHFPICIFCCGCCHRSKCGMCCKT SEQ ID NO: 110 SEEEPIRRPPIRPPFYPPFRPPIRPPIFPPIRPPFRPPLG SEQ ID NO: 111 PR_39 PYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRF SEQ ID NO: 112 Pyrrhocoricin LPRPTPPRPIYNRN SEQ ID NO: 113 HiStatin 5 DSHAKRHHGYKRKFHEKHHSHRGY SEQ ID NO: 114 The at least one additional amino acid sequence stretch may be a sushi peptide which is described by Ding JL, Li P, Ho B Cell Mol Life Sci. 2008 Apr;65(7—8):1202—19. The Sushi peptides: ural characterization and mode of action against Gram—negative bacteria.
Especially preferred is the sushi 1 peptide ing to SEQ ID NO: 115. Other preferred sushi peptides are sushi peptides S1 and S3 and multiples thereof; FASEB J. 2000 (12):1801-13.
Preferred hydrophobic peptides are Walmaghl having the amino acid sequence according to SEQ ID NO: 116 and the hydrophobic peptide having the amino acid sequence Phe—Phe—Val— Ala-Pro (SEQ ID NO: 117).
Preferred amphiphatic peptides are a4—helix of T4 lysozyme according to SEQ ID NO: 118 and WLBU2—Variant having the amino acid ce according to SEQ ID NO: 119 and Walmagh 2 according to SEQ ID NO: 120.
As mentioned above, a polypeptide according to the present invention may comprise at least one additional amino acid sequence stretch selected from the group consisting of: KRK and SEQ ID NOs: 50—120. Corresponding examples are for instance polypeptides comprising a sequence selected from the group consisting of SEQ ID NOs: 7 (and ponding sequences without N—terminal methionine, SEQ ID NOs: 128—134.
A polypeptide according to the present invention comprises an amino acid sequence exhibiting at least about 90% sequence ty with the sequence of SEQ ID NO: 1, wherein the polypeptide does r se the amino acid sequence of SEQ ID NO: 2, nor of SEQ ID NO: 3, nor of SEQ ID NO: 4. Thus, a polypeptide of the present ion may also comprise an amino acid sequence ting at least 91,5 % sequence identity with an amino acid sequence selected from any of SEQ ID NOs: 121 — 134, wherein the polypeptide does neither comprise the amino acid sequence of SEQ ID NO: 2, nor of SEQ ID NO: 3, nor of SEQ ID NO: 4.
Such inventive polypeptide may thus for example comprise a sequence exhibiting a higher level of sequence identity than 91,5% with an amino acid sequence selected from any of SEQ ID NOs: 121 - 134, e.g. may exhibit at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 98,5%, at least about 98,75%, at least about 99% (e.g. less than 3 amino acids deviation) at least about 99,5% , (e.g. less than 2 amino acids deviation), at least about 99,6% or even 100% sequence identity with an amino acid sequence selected from any of SEQ ID NOs: 121 - 134.
In addition, and irrespective whether or not one or more additional amino acid ce stretches as set out above are present in the inventive polypeptide, the polypeptide may comprise onally one or more tag sequences. Such tag sequence may be t N— terminally or C—terminally of the sequence exhibiting at least about 90% sequence ty with the sequence of SEQ ID NO: 1. They may for example be located at the N— or C— terminus of the inventive polypeptide. In a preferred embodiment, the one or more tag sequence is located C—terminally of the amino acid sequence exhibiting at least 90% sequence identity with the sequence of SEQ ID NO: 1.
The one or more tag sequences may for example be linked to the amino acid sequence exhibiting at least 90% sequence identity with the sequence of SEQ ID NO: 1 directly or via a short linker of 1 to 10 amino acid residues, preferably 1 to 5 amino acid residues, even more preferably 1 to 2 amino acids. Linker sequences are preferably flexible sequences, comprising one or more glycine residues. Numerous examples for tags are known in the art, some of which have already been mentioned above. In the context of the present invention a particularly preferred tag sequence is a His—tag, preferably a His tag according to SEQ ID NO: The length of the ptide according to present invention is in principle not limited, but preferably the length will not be ively large. Preferably, a polypeptide according to the present invention has an overall length not exceeding about 320 amino acids, preferably not ing about 310 amino acids.
Specific examples of polypeptides according to the present invention can be selected from the group consisting of SEQ ID NOs: 136—142 (and corresponding ces without N—terminal methionine, SEQ ID NOS: 143-149).
A polypeptide ing to the present invention comprises an amino acid sequence exhibiting at least about 90% sequence identity with the ce of SEQ ID NO: 1, wherein the polypeptide does neither comprise the amino acid sequence of SEQ ID NO: 2, nor of SEQ ID NO: 3, nor of SEQ ID NO: 4. Thus, a polypeptide of the present invention may also comprise an amino acid sequence exhibiting at least 91,5 % sequence identity with an amino acid sequence selected from any of SEQ ID NOs: 136 — 149, wherein the ptide does neither comprise the amino acid sequence of SEQ ID NO: 2, nor of SEQ ID NO: 3, nor of SEQ ID NO: 4.
Such inventive polypeptide may thus for example comprise a sequence exhibiting a higher level of ce identity than 91,5% with an amino acid sequence selected from any of SEQ ID NOs: 136 — 149, e.g. may exhibit at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 98,5%, at least about 99%, at least about 99,25% (e.g. less than 3 amino acids deviation), at least about 99,5% (e.g. less than 2 amino acids deviation), at least about 99,6% or even 100% sequence identity with an amino acid ce selected from any of SEQ ID NOs: 136 — 149. Deviations from SEQ ID NOs: 136 - 149 may in ular occur in the two sequences linking the components SMAP29 peptide, modified K2144 endolysin and His—tag.
A polypeptide according to the present invention is preferably characterized by the ability to degrade the peptidoglycan of Gram—negative bacteria, in particular of Pseudomonas and/or Campylobacter bacteria. In particular, the polypeptide according to the present invention is preferably capable of degrading the peptidoglycan of Pseudomonas aeroginosa, in particular Pseudomonas aeroginosa PAOl, Campylobacterjejuni and/or Campylobacter coli.
The peptidoglycan degrading activity on gram negative bacteria can be measured by assays well known in the art, e.g. by muralytic assays in which the outer membrane of gram ve ia is permeabilized or removed (e.g. with chloroform) to allow the putative enzyme access to the peptidoglycan layer. If the enzyme is active, degradation of the oglycan layer will lead to a drop of turbidity, which can be measured photometrically (see for example Briers et al‘, J. Biochem. Biophys Methods 70: 531-533, (2007).
In a further aspect the present invention relates to a nucleic acid encoding a polypeptide according to the present invention. A person skilled in the art, having the racy of the genetic code in mind, will be aware of means to generate such nucleic acid.
In a further aspect, the present invention relates to a , such as an expression or cloning vector, which comprises a nucleic acid according to the present invention.
In a further , the present invention relates to a host cell comprising a ptide according to the present invention, a nucleic acid according to the present invention, and/or a vector according to the present invention.
In a further aspect, the present invention relates to composition comprising a polypeptide according to the present ion, a nucleic acid ing to the present invention, a vector according to the present invention, and/or a host cell ing to the present invention.
Preferably, said composition is a pharmaceutical composition comprising a pharmaceutical acceptable diluent, ent or carrier.
As set out above, a polypeptide according to the present invention ses an amino acid sequence exhibiting at least about 90% sequence identity with the sequence of SEQ ID NO: 1, wherein the polypeptide does r comprise the amino acid ce of SEQ ID NO: 2, nor of SEQ ID NO: 3, nor of SEQ ID NO: 4. However, in a further aspect, and slightly distinct from the above mentioned polypeptides of the invention, the t invention also relates additionally to a polypeptide comprising an amino acid sequence exhibiting at least about 90% sequence identity with the sequence of SEQ ID NO: 1, wherein the polypeptide does neither comprise the amino acid sequence of SEQ ID NO: 2, nor of SEQ ID NO: 152, nor of SEQ ID NO: 4. ally, said polypeptide of this additional aspect does also not comprise the amino acid sequence of SEQ ID NO: 3. All embodiments and combinations disclosed above, in the examples or in the claims for the polypeptide of the invention, and respective nucleic acids, vectors, host cells and itions, are specifically contemplated for this further aspect as well.
Examples In the following, ic examples illustrating various embodiments and aspects of the invention are presented. r, the present invention shall not to be limited in scope by the specific embodiments described herein. Indeed, various cations of the invention in addition to those described herein will become readily apparent to those d in the art from the foregoing description, accompanying figures and the examples below. All such modifications fall within the scope of the appended claims.
Example 1: Identification of mutations stabilizing K2144 endolysin For identification of advantageous sites of modification in endolysin K2144 (SEQ ID NO: 5), the inventors used in a first step targeted destabilization of the target protein. For this purpose an N—terminally truncated K2144 was generated (SEQ ID NO: 150) into which sequence mutations were introduced via random mutagenesis (error—prone PCR) ed by subsequent fusion and selection with a chloramphenicol assay (CAT .
The protein g temperature of promising candidates was determined by circular ism (CD). Changes of ellipticity for the ns were recorded at 220nm as a function of temperature using Jasco J-815 CD spectrometer and fitted to a simple sigmoid unfolding model using JASCO analysis software. The protein melting temperatures (Tmelt) were determined as midpoint of unfolding transition. The spectra were recorded at protein concentrations of 5.0—5.8uM with a heating rate of 1°C/min and incubation time of 35 in 410ul volume in a 1mm light path Hellma quartz cuvette. Measurements were performed in 50mM NaPh buffer, 300mM NaCl at pH of 7.4, 7.0, 6.2 and 5.7.
Some of the most promising ates identified are illustrated in the following table: WO 71436 Table 3 SOlublhty. . TM ATM Substitution* "_ + 53,5 0 54,1 + 0,6 55,8 + 2,3 T821— + 543 + 0,8 1122M + 565 + 3,0 A160T * Please note, the on indicated refers to the position in the sequence of K2144 sequence, SEQ ID NO: 5, and not to the position in SEQ ID NO: 150.
The thus identified stabilizing mutations can and were subsequently introduced into other sequences such as full length sequences, increasing stability there as well.
In a further step serine was used in some constructs for substitution of cysteine es C14, C23 and/or C50 (position indicated with respect to SEQ ID NO: 5; conservative substitutions). Other substituents at said positions tested were N and R.
In a further round of experiments, various combinations of mutations were tested in the context of the full length endolysin K2144 (SEQ ID NO: 5): Table 4 stitution mutatlons.
C148 C508 T8211122M A160T A206V SZ32T C148 C503 T8211122M A160T A206V N230Y 3232T C148 C503 T8211122M A160T M180E A206V 3232T C143 C503 T8211122M M149P A160T A206V 3232T ’ C143 C503 T8211122M A160T 567 +35 V186Y A206V 3232T C14R C503 T8211122M A160T A206V 3232T C148 C508 T8211122M T160A 58,3 +5,1 A206V SZ32T C14S C50N T82I1122M A160T A206V SZ32T C14R C503 T8211122M M149P A160T A206V 3232T C14R C503 T8211122M A206V 61 7 +85 3232T M149P ’ C14R C50N T8211122M M149P C14R C50N T8211122M M149P 8 63’4 "0’2 A206V 3232T C14R C50N T821 1122M M149P 8 62’8 "'9’6 A206V 3232T C14R C50N T8211122M M149P 61 5 +8 3 A206V 3232T ’ ’ WO 71436 C14R C50N T8211122M M149P 8 60,9 +7,7 A206V S232T * A TM vs. SEQ ID NO: 5 Example 2: Melting temperature of some polypeptides according to the present invention and MIC for selected bacterial strains For the construction of polypeptides according to SEQ ID NO 151 (w/o mutations) and SEQ ID NOs: 136 —l42 the lytic enzyme (gp144) of the Pseudomonas aeruginosa phage K2 was used. As peptide fusion r SMAP—29 was chosen. SMAP—29 was found in sheep leukocytes and consists of 29 amino acids (RGLRRLGRKIAHGVKKYGPTVLRIIRIAG; molecular weight: 3.3 kDa, SEQ ID NO: 76). It is built up of two LPS—binding sites which are connected by a central hinge.
Cloning The nucleic acid molecules encoding the respective peptide and endolysin were constructed with a NdeI (5’—CAT ATG—3’) restriction site at the 5’—end of the nucleic acid molecule and a XhoI C GAG—3’) restriction site at the 3’-end of the nucleic acid le. Peptide and endolysin are connected via a BamHI (5’—GGA TCC-3’).
Fusion proteins were ucted by linking at least two nucleic acid sequences using standard cloning techniques as bed e.g. by Sambrook et al. 2001, Molecular Cloning: A Laboratory Manual. Therefore the nucleic acid molecule encoding the peptide stretch was cleaved in a digest with the tive restriction enzymes NdeI and BamHI. Subsequently the d nucleic acids encoding the peptide stretch was ligated into the pET2l b expression vector (Novagen, Darmstadt, Germany), which was also cleaved in a digest with the respective restriction enzymes NdeI and BamHI before. Afterwards, the c acid molecule encoding the endolysin was cleaved in a digest with the ction enzyme BamHI and XhoI, so that the endolysin could be ligated into the pET2lb expression vector (Novagen, Darmstadt, Germany), which was also cleaved in a digest with the respective restriction enzymes BamHI and XhoI before.
The sequence of the peptide—endolysin fusions was controlled via DNA sequencing and correct clones were transformed into E.coli BL21(DE3)pLysS (Novagen, Darmstadt, Germany) for protein expression.
Purification Recombinant sion of the fusion proteins was done in E. coli BL21(DE3)pLysS cells (Novagen, Darmstadt, y). The cells were grown until an optical density of OD600nm = 0.5—0.8 was d. Then the expression of the fusion n was induced with 0.5 mM IPTG (isopropylthiogalactoside) and the expression was performed at 37°C for 4 h.
Cells were harvested by centrifugation for 20 min at 6000g and disrupted via sonication on ice. Soluble and insoluble fraction of the E. coli crude t were separated by centrifugation (Sorvall, $834, 30 min, 15 000 rpm). All proteins were purified by Ni2+ affinity chromatography (Akta FPLC, GE Healthcare) using the C—terminal His6 tag, encoded by the pET21b vector. Samples were iltrated (0.2 um) before every chromatographic step.
The Ni2+ affinity chromatography is performed in 4 subsequent steps, all at room temperature: 1. Equilibration of the p FF 5 m1 column (GE Healthcare) with up to 10 column volumes of Washing Buffer (20mM imidazole, lM NaCl and 20mM HEPES on pH 7.4) at a flow rate of 3—5 ml/min. 2. Loading of the total lysate with wanted target protein on the Histrap FF 5 ml column at a flow rate of 3-5 ml/min. 3. Washing of the column with up to 10 column volumes of Washing Buffer to remove d protein. 4. Elution of bounded target protein from the column with an increasing linear gradient of 15 column volumes of Elution Buffer (500mM imidazole, 500mM NaCl and 20mM HEPES on pH 7.4) to 100% at a flow rate of 3—5 ml/min.
The Hydrophobic Interaction Chromatography (HIC) is performed in 5 subsequent steps, all at I'l temperature: 1. Equilibration of the HiScreen Phenyl HP 5 ml column (GE Healthcare) with up to 5 column s of Washing Buffer (850mM ammonium sulfate, 500mM NaCl and 20mM HEPES on pH 7.4) at a flow rate of l—2ml/min 2. Preparation of the sample (5mg per lml column volume of the protein pool from Ni2+ affinity step) starts by first setting the protein concentration to 0.5mg/ml by adding a predefined amount of Washing Buffer from the Ni2+ Affinity step. Followed by adjusting the ammonium sulfate concentration by stepwise adding of a predefined amount of ammonium sulfate stock solution (3.8M) to a final concentration of approx. 850mM. 3. Loading of the prepared sample on the HiScreen Phenyl HP 5 ml column at a flowrate of 1—2ml/min. 4. g of the column with 5 column volumes of Washing Buffer to remove unbound protein.
. Elution of the target protein from the column with a step of 40% Elution Buffer (500mM NaCl and 20mM HEPES on pH 7.4) at a flow rate of 1—2 ml/min. The target n is eluted in broad peak at this step.
Buffer change by membrane dialysis: The elution pool of the HIC step is dialyzed (membrane: regenerated cellulose with MWCO: 6000—8000D) into storage buffer (500 mM NaCl and 20mM HEPES; pH7.4) at 4°C. Dialysis factor is 160 — 250.
Characterisation g temperatures characterizing stability of the ptides ing to SEQ ID NOs: 136 -l42 at elevated temperatures were determined by ar ism spectroscopy (CD) as mentioned above.
Activity of polypeptides according to SEQ ID NOs: 136 —142 on P. aeroginasa, C. jejuni and C. coli was characterised by ination of minimal inhibitory concentration (MIC) on the respective strains.
Determination of the Minimal Inhibitory Concentration (MIC) In analogy to the determination of the "Minimum inhibitory concentration (MIC)" for antibiotics, the MIC was determined as a microdilution test. The test on Campylobacter species is med completely at microaerophilic conditions and 42°C.
The setup of the experiment is the following: The respective overnight culture was diluted 1:10. PS. aeruginosa was incubated at 37°C up to OD600=0.6 (approx. 109 cells/ml). Campylobacter sp. were incubated microaerophilic up to OD600=0.08 x. 2,5x108 cells/ml). The bacterial culture was diluted to a concentration of 2x105 to 8x105 colony—forming—units per ml in Mueller—Hinton—broth (not cation—adjusted Mueller—Hinton—broth) and split in the required amount of tubes.
The polypeptide of interest was added in different concentrations (determined as ug/ml final concentration in the Mueller—Hinton—broth). In case of Ps. aeruginosa EDTA was added to a final concentration of 2 mM. In case of Campylobacter sp no EDTA was used.
The mixture was incubated overnight at 37°C for Ps. Aeruginosa and at 42°C for Campylobacter s. Bacterial growth was visibly determined by turbidity (in ison to negative control). The MIC was defined as the tration in the tube where no bacterial growth was observed. Positive (without ptide of interest and/or EDTA) and ve control (Mueller—Hinton—broth without ia) were included in the experiment.
The results are summarized in the following table: Table 5 MIC 0n MIC 0n MIC 0n PAOlp Camp. jejuni Camp. coli S82 S371 S344 [Mg/ml] [Hg/ml] [Hg/ml] SEQ Mutations* Concentration Tm 500 pM "0 EDTA "0 EDTA ID NO:- [by UV] 1°C] EDTA 151 5,5 11M 44,14 5 5 4 136 5,2 11M 49,07 5 5 4 138 55 HM 4757 4 139 56 MM 51,42 4 140 5,3 11M 50,31 5 3-4 2 141 5,9 pM 51,68 3-6 5-7 5 A206N SZ32T 142 1122M 5,3 11M 50,64 3 5-7 5 A160T g temperatures measured by CD, buffer: 50mM NaPh, pH 7.45 300mM NaCl Please note again, that the position indicated refers to the position in the sequence of K2144 sequence, SEQ ID NO: 5, and not to the position of the SEQ ID NO: indicated in the table.
The mutations introduced did thus not only increase melting ature of the polypeptides of SEQ ID NOs: 136 —142 vs the polypeptide of SEQ ID NO: 151, but did also not affect activity of the polypeptide, not even the sevenfold mutation of SEQ ID NO: 141.
Exam le 3: Tem erature stabilit of the 01 e tide in to SE ID NO: 139 and SE ID NO: 141 In order to illustrate that the sed melting temperature does indeed affect temperature stability of the respective d polypeptides, the inventors exposed exemplarily the mutated polypeptides of SEQ ID NO: 139 and SEQ ID NO: 141 to temperatures clearly exceeding the melting temperature of the native, non-mutated reference polypeptide (SEQ ID NO: 151).
For this purpose both polypeptides were ted to prolonged direct heating at temperatures of 51°C and 52°C. Subsequently, an activity test was performed on Pseudomonas nosa strain as a model system at adapted conditions.
The results are summarized in the following table: WO 71436 Table 6 MIC on PAOlp Concentration SEQ ID NO: Mutations Heating [pg/ml] [by UV] 500 "M EDTA 1min 51°C 2min 51°C 2min 52°C 1min 51°C 2min 51°C 2min 52°C Protein Buffer150mM NaPh, pH 7.45 300mM NaCl As previously, the position indicated refers to the position within the sequence portion corresponding to the K2144 sequence, SEQ ID NO: 5, and not to the position within the full- length sequence of the SEQ ID NO: indicated in the table.
Claims (30)
1. Polypeptide comprising an amino acid ce of SEQ ID NO: 1, wherein SEQ ID NO: 1 is characterized by X1 may be absent or any amino acid, X14 may be any amino acid, X23 may be any amino acid, X50 may be any amino acid, X82 may be any amino acid, X122 may be any amino acid, X149 may be any amino acid, X154 may be any amino acid, X160 may be any amino acid, X167 may be any amino acid, X179 may be any amino acid, X180 may be any amino acid, X186 may be any amino acid, X206 may be any amino acid, X212 may be any amino acid, X224 may be any amino acid, X230 may be any amino acid, X232 may be any amino acid; with the additional proviso that the sequence of SEQ ID NO: 1 exhibtis at least one of the following: i) X23 is S; ii) X14 and X50 are S; iii) X82 is I; iv) X122 is M and X160 is T; v) X206 is V; vi) X232 is T; wherein the polypeptide does neither comprise the amino acid sequence of SEQ ID NO: 2, nor SEQ ID NO:3 nor SEQ ID NO: 4.
2. The polypeptide according to claim 1, wherein X14 is not C.
3. The polypeptide according to any one of the ing claims, wherein X23 is not C.
4. The polypeptide according to any one of the preceding claims, wherein X50 is not C.
5. The polypeptide according to any one of the preceding claims, n neither X14 nor X23 nor X50 are C.
6. The polypeptide ing to any one of the preceding claims, wherein X14 is S.
7. The polypeptide according to any one of the preceding claims, wherein X23 is S.
8. The ptide according to any one of the preceding claims, wherein X50 is S.
9. The polypeptide according to any one of the preceding claims, wherein X14 and X23 are S.
10. The polypeptide according to any one of the preceding claims, n X14 and X50 are S.
11. The ptide according to any one of the preceding claims, wherein X23 and X50 are S.
12. The polypeptide according to any one of the preceding claims, wherein X14, X23 and X50 are S.
13. The polypeptide according to any one of the preceding claims, wherein X82 is I.
14. The polypeptide according to any one of the preceding claims, wherein X122 is M.
15. The polypeptide according to any one of the preceding claims, wherein X160 is T.
16. The polypeptide according to any one of the preceding claims, wherein X206 is V.
17. The polypeptide according to any one of the ing claims, n X232 is T.
18. The polypeptide according to any one of the preceding , wherein X122 is M and X160 is T.
19. The polypeptide according to any one of the preceding claims, wherein X1 is not M.
20. The polypeptide according to any one of the preceding claims, n the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOs: 6-49.
21. The polypeptide according to any one of the ing claims, wherein the polypeptide comprises additionally at least one amino acid sequence stretch selected from the group consisting of amphiphatic peptide, cationic peptide, polycationic peptide, hydrophobic peptide, naturally ing antimicrobial peptide, sushi peptide and defensin.
22. The polypeptide according to claim 21, wherein the polypeptide comprises at least one additional amino acid sequence stretch selected from the group consisting of: KRK and SEQ ID NOs: 50 - 120.
23. The ptide according to claim 21 or claim 22, wherein the polypeptide comprises at least one additional amino acid sequence stretch having the amino acid ce of SMAP-29, SEQ ID NO: 76.
24. The polypeptide according to claim 1, wherein the polypeptide comprises a sequence selected from from the group consisting of SEQ ID NOs: 121-134 or comprises a sequence selected from the group consisting of SEQ ID NOs: 136-149.
25. The polypeptide according to any one of the preceding claims, wherein the polypeptide degrades the peptidoglycan of Gram-negative bacteria, in particular of Pseudomonas and/or Campylobacter ia.
26. Nucleic acid encoding a polypeptide according to any one of claims 1 to 25.
27. Vector comprising a nucleic acid according to claim 26.
28. A non-human host cell comprising a polypeptide according to any one of claims 1 to 25, a c acid according to claim 26, and/or a vector according to claim 27.
29. Composition comprising a polypeptide according to any one of claims 1 to 25, a nucleic acid according to claim 26, a vector according to claim 27 and/or a host cell according to claim 28.
30. Composition according to claim 29, n the composition is a pharmaceutical composition comprising a pharmaceutical acceptable diluent, excipient or carrier. SE ID NO:1 XKVLRKGDRGDEVXQLQTLLNLXGYDVGKP DGI FGNNTFNQVVKFQKDNXLDSDG IVGK NTWAELFSKYSPP| PYKTI PMPXANKSRAAATPVMNAVENATGVRSQLLLTFASI ESAFDY EXKAKTSSATGWFQFLTGTWKTMIENYGXKYGVXTDPTGXLRKDPRXSALMGAELIKEX XNILRPXLKREPTDTDLYLAHFFGPGXARRFLXTGQNELAATHFXKEAQAXPXI FYNKDGS VYNLMDGKVAAHRK SE ID NO:2 KVLRKGDRGDEVCQLQTLLNLCGYDVGKPDG| FGNNTFNQVVKFQKDNCLDSDG IVGKN TWAELFSKYSPP| PYKTI PM PTANKSRAAATPVMNAVENATGVRSQLLLTFASI ESAFDYEI KAKTSSATGWFQFLTGTWKTMI ENYGMKYGVLTDPTGALRKDPRISALMGAELIKENMNI LRPVLKREPTDTDLYLAHFFGPGAARRFLTTGQNELAATHFPKEAQAN PSIFYNKDGSPK TIQEVYNLMDGKVAAHRK SEQ ID NO:3 1M=Selen0methi0nineg KVLRKGDRGDEVCQLQTLLNLCGYDVGKPDG| NQVVKFQKDNCLDSDG IVGKN TWAELFSKYSPP| PYKTI PM PTANKSRAAATPVMNAVENATGVRSQLLLTFASI ESAFDYEI KAKTSSATGWFQFLTGTWKTMI ENYGMKYGVLTDPTGALRKDPRISALMGAELIKENMNI LRPVLKREPTDTDLYLAHFFGPGAARRFLTTGQNELAATHFPKEAQAN PSIFYNKDGSPK TIQEVYNLMDGKVAAHRK SE ID N024 KVLRKGDRGDEVCQLQTLLNLCGYDVGKPDG| FGNNTFNQVVKFQKDNCLDSDG IVGKN TWAELFSKYSPP| PYKTI PM PTANKSRAAATPVMNAVENATGVRSQLLLTFASIASAFDYEI KAKTSSATGWFQFLTGTWKTMI ENYGMKYGVLTDPTGALRKDPRISALMGAELIKENMNI REPTDTDLYLAHFFGPGAARRFLTTGQNELAATHFPKEAQAN PSIFYNKDGSPK TIQEVYNLMDGKVAAHRK Fig.1a SE ID NO:5 MKVLRKGDRGDEVCQLQTLLNLCGYDVGKPDG| FGNNTFNQVVKFQKDNCLDSDG IVGK NTWAELFSKYSPP| PYKTI PMPTANKSRAAATPVMNAVENATGVRSQLLLTFASI ESAFDY El KAKTSSATGWFQFLTGTWKTM| ENYGMKYGVLTDPTGALRKDPRISALMGAELIKENM LKREPTDTDLYLAHFFGPGAARRFLTTGQNELAATHFPKEAQAN PSI FYNKDGSP KTIQEVYNLMDGKVAAHRK Fig.1b SEQ ID NO:136 MRGLRRLGRKIAHGVKKYGPTVLRI | RIAGGSKVLRKGDRGDEVSQLQTLLNLCGYDVGK SEQ ID NO:137 MRGLRRLGRKIAHGVKKYGPTVLRI | KVLRKGDRGDEVCQLQTLLNLCGYDVGK SE ID NO:138 MRGLRRLGRKIAHGVKKYGPTVLRI | RIAGGSKVLRKGDRGDEVCQLQTLLNLCGYDVGK SE ID NO:139 MRGLRRLGRKIAHGVKKYGPTVLRI | RIAGGSKVLRKGDRGDEVSQLQTLLNLCGYDVGK Fig.23 SE ID NO:14O LGRKIAHGVKKYGPTVLRI | RIAGGSKVLRKGDRGDEVSQLQTLLNLSGYDVGKP SE ID NO:141 MRGLRRLGRKIAHGVKKYGPTVLRI | RIAGGSKVLRKGDRGDEVSQLQTLLNLCGYDVGK SE ID NO:142 MRGLRRLGRKIAHGVKKYGPTVLRI | RIAGGSKVLRKGDRGDEVSQLQTLLNLCGYDVGK SE ID NO: 151 MRGLRRLGRKIAHGVKKYGPTVLRI | RIAGGSKVLRKGDRGDEVCQLQTLLNLCGYDVGK
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
PCT/EP2013/073869 WO2015070911A1 (en) | 2013-11-14 | 2013-11-14 | Modified kz144 endolysin sequence |
EPPCT/EP2013/073869 | 2013-11-14 | ||
PCT/EP2014/074671 WO2015071436A1 (en) | 2013-11-14 | 2014-11-14 | Modified kz144 endolysin sequence |
Publications (2)
Publication Number | Publication Date |
---|---|
NZ719338A NZ719338A (en) | 2022-03-25 |
NZ719338B2 true NZ719338B2 (en) | 2022-06-28 |
Family
ID=
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10167462B2 (en) | Modified EL188 endolysin sequence | |
US10184120B2 (en) | Modified KZ144 endolysin sequence | |
Wessolowski et al. | Antimicrobial activity of arginine‐and tryptophan‐rich hexapeptides: the effects of aromatic clusters, d‐amino acid substitution and cyclization | |
Giangaspero et al. | Amphipathic α helical antimicrobial peptides. A systematic study of the effects of structural and physical properties on biological activity | |
EP3448992B1 (en) | Antimicrobial agents against salmonella bacteria | |
Scocchi et al. | Structural aspects and biological properties of the cathelicidin PMAP‐36 | |
KR102560651B1 (en) | Novel antimicrobial agents against Enterococcus bacteria | |
Li et al. | SUMO mediating fusion expression of antimicrobial peptide CM4 from two joined genes in Escherichia coli | |
Skerlavaj et al. | Structural and functional analysis of horse cathelicidin peptides | |
US20170051266A1 (en) | Antimicrobial agents | |
Wang et al. | Rapid and efficient production of cecropin A antibacterial peptide in Escherichia coli by fusion with a self-aggregating protein | |
Pérez‐Peinado et al. | Structural determinants conferring unusual long life in human serum to rattlesnake‐derived antimicrobial peptide Ctn [15‐34] | |
Kim et al. | Design and engineering of antimicrobial peptides based on LPcin-YK3, an antimicrobial peptide derivative from bovine milk | |
NZ719338B2 (en) | Modified kz144 endolysin sequence | |
EP3068877B1 (en) | Modified kz144 endolysin sequence | |
EP3068878B1 (en) | Modified el188 endolysin sequence | |
Azmi et al. | Introduction of cell‐selectivity in bovine cathelicidin BMAP‐28 by exchanging heptadic isoleucine with the adjacent proline at a non‐heptadic position | |
Bandyopadhyay et al. | Micelle bound structure and DNA interaction of brevinin‐2‐related peptide, an antimicrobial peptide derived from frog skin |