NZ622997B2 - Polyethylene glycol based prodrug of adrenomedullin and use thereof - Google Patents

Abstract

Provided is a polyethylene glycol (PEG) based prodrug of adrenomedullin of formula (I), where the variables are as defined in the specification. An exemplified prodrug is O-{[(3S)-3-Amino-4-({(2R)-1-amino-3-[(2,5-dioxo-1-{3-oxo-3-[(2-{w-methoxy-poly-oxyethylen[40kDa]} ethyl)amino]propyl}pyrrolidin-3-yl)sulfanyl]-1-oxopropan-2-yl} amino )-4-oxobutyl] carbamoyl} -L-tyrosyl-adrenomedullin(2-52). Further provided are processes for its preparation and its use in the treatment of cardiovascular, edematous and/or inflammatory disorders. 3-yl)sulfanyl]-1-oxopropan-2-yl} amino )-4-oxobutyl] carbamoyl} -L-tyrosyl-adrenomedullin(2-52). Further provided are processes for its preparation and its use in the treatment of cardiovascular, edematous and/or inflammatory disorders.

Description

Polyethylene glycol based prodrug of Adrenomedullin and use thereof The invention relates to novel polyethylene glycol (PEG) based prodrug of Adrenomedullin, to processes for preparation thereof, to the use thereof for treatment and/or prevention of es, and to the use thereof for producing medicaments for treatment and/or prevention of es, especially of cardiovascular, ous and/or inflammatory ers.

The 52 amino acid peptide hormone adrenomedullin (ADM) is produced in adrenal gland, lung, kidney, heart muscle and other organs. The plasma levels of ADM are in the lower picomolar range. ADM is a member of the calcitonin gene-related peptide (CGRP) family of peptides and as such binds to a heterodimeric G—protein coupled receptor that consists of CRLR and RAMP 2 or 3 (Calcitonin—receptor—like receptor and receptor activity modtfiing protein 2 or 3). Activation of the ADM receptor leads to intracellular ion of adenosine 3‘, 5'—cyclic monophosphate (CAMP) in the receptor-bearing cells. ADM receptors are present on different cell types in almost all organs including endothelial cells. ADM is thought to be metabolized by neutral endopeptidase and is predominantly cleared in the lung where ADM-receptors are highly expressed [for review see Gibbons C., Dackor R., Dunworth W., Fritz-Six K., Caron K.M., Mol Endocrinol 783— 796 (2007)]. mental data from the literature suggest that ADM is involved in a variety of functional roles that include, among others, blood pressure regulation, bronchodilatation, renal function, hormone ion, cell , differentiation, neurotransmission, and modulation of the immune response.

Moreover ADM plays a crucial role as autocrine factor during proliferation and regeneration of endothelial cells [for review see Garcia M.A., Martin-Santamaria S., de l-Teresa B., Ramos A., Julian M., Martinez A., Expert Opin flier Targets, 10(2), 303-317 ] There is an extensive body of evidence from the literature which shows that ADM is indispensable for an intact endothelial barrier function and that administration of ADM to supra-physiological levels exerts strong anti-edematous and anti-inflammatory functions in a y of inflammatory conditions in animal experiments ing sepsis, acute lung injury and inflammation of the intestine [for review see Temmesfeld—Wollbriick B., Hocke A.C., Suttorp N., Hippenstiel S., Thromb Haemost; 98, 944—951 (2007)] Clinical testing of ADM was so far conducted in cardiovascular indications with a measurable hemodynamic end point such as pulmonary hypertension, hypertension, heart failure and acute myocardial infarction. ADM showed hemodynamic effects in several studies in patients suffering from the aforementioned conditions. r, s were only short lasting and immediately ceasing after the end of administration. This findings correlated well with the known pharmacokinetic profile of ADM. Pharrnacodynamic effects sed among others lowering of systemic and pulmonary arterial blood pressure and increase of cardiac output [Troughton R.W., Lewis L.K., Yandle T.G., Richards A.M., Nicholls M.G., Hypertension, 36(4), 588-93 (2000); Nagaya N., Kangawa K., es,. 25(11), 2013-8 (2004); Kataoka Y., Miyazaki S., Yasuda S., Nagaya N., Noguchi T., Yamada N., Morii I., Kawamura A., Doi K., Miyatake K., Tomoike H., Kangawa K., J Cardiovasc Pharmacol, 56(4), 413-9 (2010)] In summary, based on evidence from a wealth of experimental data in animals and first clinical trials in man elevation of ADM to supraphysiological levels might be ered as a target mechanism for the treatment of a variety of disease conditions in man and animals. However, the major limitations of the use of ADM as eutic agent are the enient applicability of continuous infusion y which precludes its use for most of the potential indications and the potentially limited safety margins with respect to hypotension which may result from bolus strations of ADM.

The object of the present invention is to provide novel compounds which can be employed for the treatment of diseases, in particular cardiovascular, edematous and inflammatory disorders.

Many therapeutically active peptides or ns suffer from high clearance in vivo. Several approaches to form an injectable depot of such drugs exist that involve the use of olecules.

Polymer matrices that n a drug le in a non covalently bound state are well known.

These can also be injectable as hydro gels, micro particles or micelles. The release kinetics of such drug products can be quite unreliable with high inter patient variability. Production of such polymers can harm the sensitive drug substance or it can undergo side reactions with the polymer during its degradation (D.H. Lee et al., J. Contr. Rel., 2003, 92, 9).

Permanent PEGylation of peptides or proteins to enhance their lity, reduce immunogenicity and increase half live by reducing renal nce is a well known t since early 1980s (Caliceti P.,Veronese F.M., Adv. Drug Deliv. Rev.2003, 55, 1261-1277). For several drugs this has been used with success, but with many examples the PEGylation reduces efficacy of drug substance to an extent that this concept is not suitable any more (T. Peleg—Shulman et al., J. Med.

Chem., 2004, 47, 4897—4904).

A suitable alternative are polymer based prodrugs. The current definitions for prodrugs by the IUPAC state the following terms (International Union of Pure and Applied Chemistry and International Union of Biochemistry: GLOSSARY OF TERMS USED IN MEDICINAL WO 64508 CHEMISTRY (Recommendations 1998); in Pure & Appl. Chem. Vol 70, No. 5, 1998, p. 1129- 1 143): Prodrug: A g is any compound that undergoes biotransformation before exhibiting its pharmacological effects. Prodrugs can thus be viewed as drugs containing specialized non—toxic protective groups used in a transient manner to alter or to eliminate undesirable ties in the parent molecule.

Carrier-linked prodrug (Carrier prodrug): A carrier-linked prodrug is a prodrug that contains a ary linkage of a given active substance with a transient carrier group that produces improved physicochemical or pharmacokinetic properties and that can be easily removed in vivo, usually by a hydrolytic cleavage.

Cascade prodrug: A cascade g is a prodrug for which the ge of the r group becomes effective only after unmasking an activating group.

Several examples of PEG-based carrier prodrugs exist, most of them with the need for enzymatic activation of the linker between the active drug and the carrier, mostly initiated by enzymatic hydrolysis. Since esters are cleaved very readily and ictably in vivo, direct ester linkers for r pro drug have limitations to their usability (J. Rautio et al., Nature Reviews Drug discovery, 2008, 7 255—270).

Commonly used alternative approaches are cascading linkers attached to an amine functionality in the peptide or protein. In cascading linkers a masking group has to be removed as the rate limiting step in the cascade. This activates the linker to decompose in a second position to release the peptide or protein. Commonly the masking group can be removed by an enzymatic mechanism (R.B.Greenwald et al. in W02002/089789, Greenwald, et al., J. Med. Chem. 1999, 42, 3657-3667, F.M.H. DeGroot et al. in W02002/083l80 and W02004/043493, and D. Shabat et al. in W02004/019993).

An alternative not relying on enzymatic tion is the concept of U. Hersel et al. in W02005/099768. In their ch the masking group on a phenol is removed in a purely pH dependent manner by the attack of an internal nucleophile. This activates the linker for further decomposition.

As mentioned by U. Hersel et al. in W02005/099768, "The disadvantage in the abovementioned prodrug systems bed by Greenwald, t and Shabat is the release of ially toxic aromatic small molecule side products like quinone methides after cleavage of the temporary W0 2013/064508 linkage. The potentially toxic entities are released in a 1:1 stoichiometry with the drug and can assume high in vivo concentrations." The same problem holds true for the system by Hersel et al. as well.

For small organic molecules a plethora of different prodrug approaches exist (J. Rautio et al., Nature Reviews Drug ery, 2008, 7 255-270). The approach used by U. Hersel et al. as release mechanism for their masking group has been used as a prodrug approach for phenolic groups of small molecules since the late 1980s. (W.S. Saari in EP 0296 811 and W.S. Saari et al., J. Med. Chem. 1990, Vol 33, No 1, p 97-101).

Alternative amine based prodrug system are based on the slow hydrolysis of bis-hydroxyethyl e as a ing prodrug. The hydroxy groups of the droxyethyl glycine are masked by esters that are prone to hydrolysis by esterases (R. Greenwald et al., J. Med. Chem. 2004, 47, 726— 734 and D. Vetter et al. in W0 36586).

Labeled Adrenomedullin derivatives for use as imaging and also therapeutic agent are known (J.

Depuis et al. in CA 8 and W0 2008/138141). In these ADM derivatives a xating cage like molecular structure capable of binding radioactive isotopes was attached to the N terminus of ADM in a direct manner or via a spacer unit potentially also including short PEG spacers. The stic or therapeutic value of theses drugs arises from the targeted delivery of the radioactive molecule.

In st to the prodrug approaches listed above, which are all based on masking amine functionalities, the current invention is based on masking the phenolic group of a tyrosine in ADM. A carrier-linked prodrug is used, based on the internal nucleophile assisted cleavage of a carbamate on this phenolic group. The key advantage to other prodrug classes mentioned above is the toxicological harmlessness of the linker decomposition product, a cyclic urea permanently attached to the carrier. Furthermore, the decomposition of the prodrug is not dependent on enzymatic mechanisms that might cause a high inter patient variability of cleavage kinetics. The cleavage mechanism is solely pH dependent as an internal amine that is protonated at acidic pH gets activated at higher (neutral) pH to act as a nucleophile attacking the phenolic carbamate based on the ne.

In the context of the present invention, compounds are now described which act as slow release ADM-prodrugs with ed duration of pharmacological action as compared to ADM and which on the basis of this specific action mechanism - after parenteral administration — exert in vivo sustained anti—inflammatory and hemodynamic effects such as stabilization of endothelial barrier function, and reduction ofblood pressure, respectively.

The t invention provides compounds of the formula 0 R N "fN o HN/ s M /U\ H 0 O O N n o NH2 (1), 1 52 Y u—RQ3MNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY—NH2|—' in which n represents the number 0, l, 2 or 3, R1 ents hydrogen, methyl, ethyl, n—propyl or isopropyl, R2 represents linear or branched PEG ZOkDa to 80kDa endcapped with a methoxy—group, and salts thereof, solvates f and the solvates of salts thereof.

Compounds ing to the invention are the compounds of the formula (D and the salts thereof, solvates thereof and solvates of the salts thereof, the compounds which are embraced by formula (I) and are of the formulae specified below and the salts thereof, solvates thereof and solvates of the salts thereof, and the compounds which are embraced by formula (I) and are specified below as working examples and salts thereof, solvates thereof and solvates of the salts thereof, if the nds which are embraced by a (I) and are specified below are not already salts, solvates and solvates of the salts.

Depending on their structure, the compounds according to the invention may exist in stereoisomeric forms (enantiomers, diastereomers). The invention ore embraces the enantiomers or reomers and the particular mixtures thereof. The stereoisomerically homogeneous constituents can be isolated in a known manner from such mixtures of enantiomers and/or diastereomers.

When the compounds according to the invention can occur in tautomeric forms, the t invention embraces all tautomeric forms. 2012/071507 In the context of the present invention, preferred salts are physiologically acceptable salts of the compounds according to the invention. Also included are salts which are not suitable themselves for pharmaceutical applications, but, for example, can be used for the isolation or ation of the nds according to the invention.

Physiologically acceptable salts of the nds according to the invention include acid addition salts of mineral acids, carboxylic acids and sulfonic acids, for example salts of hydrochloric acid, hydrobromic acid, sulfuric acid, phosphoric acid, methanesulfonic acid, ethanesulfonic acid, toluenesulfonic acid, benzenesulfonic acid, naphthalenedisulfonic acid, acetic acid, trifluoroacetic acid, propionic acid, lactic acid, tartaric acid, maleic acid, citric acid, fumaric acid, maleic acid and benzoic acid.

Physiologically acceptable salts of the compounds according to the ion also include salts of customary bases, for example and with preference alkali metal salts (e.g. sodium and potassium salts), alkaline earth metal salts (e.g. calcium and magnesium salts) and ammonium salts derived from ammonia or organic amines having 1 to 16 carbon atoms, for example and with preference ethylamine, diethylamine, triethylamine, ethyldiisopropylamine, monoethanolamine, diethanolamine, triethanolamine, dicyclohexylamine, dimethylaminoethanol, procaine, dibenzylamine, N—methylmorpholine, arginine, , ethylenediamine and N—methylpiperidine.

In the t of the invention, es refer to those forms of the compounds according to the invention which, in the solid or liquid state, form a complex by nation with solvent molecules. Hydrates are a specific form of the solvates, in which the coordination is with water.

Preferred solvates in the context of the present invention are hydrates.

In the context of the invention endcapped with a y-group mentioned in R2 means that the polyethylene glycol (PEG) is substituted with a methoxy group at the end which is not bond to the oxygen, i.e. - PEG 40kDa-0Me.

Preference is given to compounds of the formula (I) in which n represents the number 1 or 2, R1 represents hydrogen or , R2 represents linear PEG 401(Da endcapped with a methoxy-group.

Preference is also given to compounds of the formula (I) in which n represents the number 1 or 2, R1 represents hydrogen, R2 represents linear PEG 40kDa endcapped with a methoxy-group.

Preference is also given to compounds of the formula (I) in which n represents the number 1.

Preference is also given to compounds of the a (I) in which R1 represents hydrogen.

Preference is also given to compounds of the formula (I) in which the carbon atom to which the -NI-IR1 tuent is bonded has S configuration.

Preference is also given to compounds of the formula (I) in which R2 represents linear PEG 40kDa endcapped with a methoxy—group.

Preference is also given to compounds of the formula (I) which have the structure of the a (13) fORZ (1a), 1 52 Y N—RQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY—NH2 in which R1 and R2 are each as defined above, and salts f, solvates thereof and the solvates of salts thereof.

The specific radical definitions given in the particular ations or preferred combinations of radicals are, irrespective of the particular combination of the radical specified, also replaced by any radical definitions of other combinations.

Very particular preference is given to combinations of two or more of the abovementioned preferred ranges. _ 3 _ The invention r provides a process for preparing the compounds of the formula (I), or salts thereof, solvates thereof or the solvates of salts thereof, wherein the compounds of the formula (II) o HN’ SH O N n o NH2 (11), 1 2 52 Y u—RQSMNNFQGLRSFGCRFGTCTVQKLAHC3!IYQFTDKDKDNVAPRSKISPQGY—NH2 in which n and R1 are each as defined above, are reacted with the nds of the formula (1H) in which R2 is as defined above.

The reaction is generally effected in inert solvents, preferably in a temperature range of 0°C to 50°C at standard pressure.

Inert solvents are, for example, citrate buffers, e-hydrochloride buffers, phthalate buffers or acetate buffers ofpH 3 to 5, ence being given to a citrate buffer ofpH 4.

The nd of the formula (III) is known or can be synthesized by known processes from the appropriate starting compounds.

The compounds of the formula (H) are known or can be prepared by reacting compounds of the formula (IV) CH3 O 0 CH3 A/R1 o o N 3 L H 0 NW H 0 o NH2 OH (IV), 3 0 NH H3C T CH3 0 in which n and R1 are each as defined above, in the first stage with the compound of the formula (V) r4 (V). u—TenlageFM-resin and in the second stage with an acid.

The reaction in the first stage is generally effected in inert ts, in the presence of a dehydrating reagent, optionally in the presence of a base, preferably in a temperature range from room ature to 70°C at standard re.

Inert solvents are, for example, halohydrocarbons such as romethane, trichloromethane or 1,2-dichloroethane, ethers such as dioxane, tetrahydrofuran or 1,2—dimethoxyethane, or other solvents such as acetone, dimethylformamide, dimethylacetamide, 2-butanone or acetonitrile. It is equally possible to use es of the solvents. Preference is given to dimethylformamide.

Suitable dehydrating reagents in this context are, for example, carbodiimides, for example N,N’- diethyl—, N,N’-dipropyl-, N,N’-diisopropyl-, MN—dicyclohexylcarbodiimide, N—(3-dimethylamino- isopropyl)—N’—ethylcarbodiimide hydrochloride (EDC), ohexylcarbodiimide-N‘— propyloxymethylpolystyrene (PS-carbodiimide), or carbonyl compounds such as carbonyldiimida— zole, or l,2-oxazolium compounds such as lphenyl-l,2-oxazolium 3-sulphate or 2—tert— butyl—S-methylisoxazolium perchlorate, or acylamino nds such as 2—ethoxy—l-ethoxy— carbonyl-l,Z-dihydroquinoline, or propanephosphonic anhydride, or isobutyl chloroformate, or bis— (2-oxooxazolidinyl)phosphoryl chloride or benzotriazolyloxytri(dimethylamino)phosphonium orophosphate, or 0—(benzot1iazol-l—yl)—N,MN',N’-tetramethyluronium hexafluorophosphate , benzotriazol-l-yl-N-tetramethyl-uronium tetrafluoroborate (TBTU), 2-(2—oxo-l-(2H)- pyridyl)—l,l,3,3-tetramethyluronium uoroborate (TPTU) or 0—(7-azabenzotriazol—l-yl)- N,N,N’, '—tetramethyluronium hexafluorophosphate (HATU), or oxybenzotriazole (HOBt), or benzotriazol—l-yloxytris(dimethylamino)phosphonium orophosphate (BOP), or benzotriazol—1-yloxytris(pyrrolidino)phosphonium hexafluorophosphate ), or N- hydroxysuccinimide, or mixtures of these with bases.

Bases are, for example, alkali metal carbonates, for example sodium carbonate or potassium carbonate, or sodium hydrogencarbonate or potassium hydrogencarbonate, or c bases such as trialkylamines, for example triethylamine, N—methylmorpholine, N—methylpiperidine, 4- dimethylaminopyridine or N,N—diisopropylethylamine, preference being given to N,N- diisopropylethylamine.

Preferably, the condensation is carried out with TBTU in the presence of N,N- diisopropylethylamine.

The second stage reaction is optionally ed in inert solvents, preferably in a temperature range from room temperature to 60°C at standard pressure.

Inert solvents are, for example, halohydrocarbons such as dichloromethane, trichloromethane, carbon tetrachloride or l,2-dichloroethane, or ethers such as tetrahydrofirran or dioxane, preference being given to dichloromethane.

Acids are, for example, trifluoroacetic acid or hydrogen chloride in dioxane, preference being given to concentrated trifluoroacetic acid. Concentrated trifluoroacetic acid can be used with addition of scavangers like water, phenol, thioanisole and l,2-ethanediol. Preference is given to l to 5% of each of these scavancers.

The compound of the formula (V) is known or can be synthesized by known processes from the appropriate starting compounds (example 14A).

The compounds of the formula (IV) are known or can be prepared by reacting compounds of the formula (VI) CH3 O 0 CH3 0 OAN/ 8 JL H o N .

H O o NH2 0 (v1), 3 0 NH "30 Y HI CH3 0 CH2 in which n and R1 are each as defined above, with a Palladium(0) source and a reducing agent.

The reaction is generally effected in inert solvents, optionally in the presents of a weak base, preferably in a temperature range of 0°C to 50°C at stande re.

Inert solvents are, for example, halohydrocarbons such as dichloromethane, trichloromethane or l,2-dichloroethane, ethers such as dioxane, tetrahydrofuran or 1,2-dimethoxyethane, or other solvents such as e, ylformamide, dimethylacetamide, 2-butanone or acetonitrile. It is equally possible to use mixtures of the solvents. Preference is given to tetrahydrofuran.

Palladium(0) sources are, for example, tetrakis(triphenylphosphin)palladium(0), tris(dibenzylideneacetone)dipalladium(0) or Palladium(II) sources that are reduced in situ to Palladium(0) during the reaction, ence being given to tetrakis(triphenylphosphin)— palladium(0).

Reducing agents are, for example, formic acid or triethyl silan, preference being given to formic acid.

Bases are, for example, triethylamine, N,N—diisopropylethylamine or potassium phosphate solution, preference being given to triethylamine.

The compounds of the formula (VI) are known or can be prepared by reacting compounds of the a (VII) 0 CH3 A,R1 O O N L 0H 0 N n O (VII), 3 0 NH "3‘3 T l CH3 0 CH2 in which n and R1 are each as defined above, with the compound of the formula (VIII) 0 NH2 The reaction is generally effected in inert solvents, in the ce of a dehydrating reagent, optionally in the presence of a base, preferably in a temperature range from room temperature to 70°C at standard pressure.

Inert solvents are, for example, drocarbons such as dichloromethane, trichloromethane or 1,2-dichloroethane, ethers such as dioxane, ydrofuran or 1,2-dimethoxyethane, or other solvents such as acetone, dimethylformamide, dimethylacetamide, 2-butanone or acetonitrile. It is equally possible to use mixtures of the solvents. Preference is given to dichloromethane.

Suitable dehydrating reagents in this context are, for example, iimides, for example N,N’- diethyl-, MN’—dipropy1—, N,N’-diisopropyl—, N,N—dicyclohexylcarbodiimide, imethylaminoisopropy1 )—N’-ethylcarbodiimide hydrochloride (EDC), N—cyclohexylcarbodiimide-N‘- propyloxymethylpolystyrene (PS-carbodiimide), or carbonyl compounds such as yldiimida— zole, or 1,2-oxazolium compounds such as 2-ethyl—5-phenyl-1,2-oxazolium 3-su1phate or 2-tert— butyl-S-methylisoxazolium perchlorate, or ino compounds such as 2-ethoxyethoxy— carbonyl-l,Z-dihydroquinoline, or propanephosphonic ide, or isobutyl chloroformate, or bis- (2—oxo-3—oxazolidinyl)phosphoryl chloride or benzotriazolyloxytn'(dimethylamino)phosphonium hexafluorophosphate, or 0—(benzotriazolyl)-N,N,N’, ’-tetramethyluronium hexafluorophosphate (HBTU), benzotriazol-l—yl-N—tetramethyl—uronium tetrafluoroborate (TBTU), 2-(2-oxo(2H)— pyridyl)-l,l,3,3-tetramethyluronium tetrafluoroborate (TPTU) or 0—(7-azabenzotriazol—l-yl)— N,MN’,N’-tetramethyluronium hexafluorophosphate (HATU), or l-hydroxybenzotriazole (HOBt), or benzotriazol-l-yloxytris(dimethylamino)phosphonium hexafluorophosphate (BOP), or benzotriazol—1-yloxytris(pyrrolidino)phosphonium orophosphate ), or N- hydroxysuccinimide, or mixtures of these with bases.

Bases are, for example, alkali metal carbonates, for example sodium carbonate or potassium carbonate, or sodium hydrogencarbonate or potassium encarbonate, or organic bases such as trialkylamines, for example triethylamine, N—methylmorpholine, N—methylpiperidine, 4- dimethylaminopyridine or N,N—diisopropylethylamine, preference being given to N,N— diisopropylethylamine.

Preferably, the condensation is carried out with HATU in the presence of N,N— diisopropylethylamine.

The compounds of the formula (VII) and (VIH) are known or can be synthesized by known processes from the appropriate starting compounds.

The preparation of the compounds according to the invention can be illustrated by the ing synthesis scheme: _ 14 _ o 9 WNW. . 01H 9H 9 \‘ 0 l J o)\o/\/ A / ~ \/ mew5 A Cl 0 A K/ o DIEA V DIEADMAP 0 Ky o . OH We \/\0 H3? 0 NH H39 0 vim l "39 rim ‘ H304: Y l n HacJ‘ Y n meg/01K \ l l l cH3 0 CH, 0 CH2 CH3 0 6H,l ‘ HC 3 39*": ave l 0AM, ‘ E i H,N/\/\H/OH0 CH /—\— (EH3 3 H Hc ‘ 3 >\ H30>l\ \ / A \/_> \ H3c>\\ \ / m / A CH3 cH 4\ ‘9 9 9 a x) Q CH3 *K K) § \ 9 CAN" 9 OAE‘" o OANH H "2"\/ ® ‘ )1‘\ /\/§YOH u z / \ H H s "\ l 7 OANW \‘/N Tetrakis / \ 0AM 0 N ‘ H _ oAN/VVN i H ii A 3 A a H 1 H A 0 CAN": 0 NH: A HATU [ 2 l\/‘ x} 1 v ’ Y/ l 9 1 R 3 \(K? , v0 H39 0 NH 3 ‘\ "30 OVNH H"? 0 NH K "39% Y H ;, rhea? Y 2H, 0 H CH, CH3 0 (EH, 5 CH, The compounds according to the invention show an unforeseeable useful spectrum of cological activity.

Accordingly they are suitable for use as ments for ent and/or prevention of diseases in humans and animals.

The compounds according to the invention are distinguished as specific adrenomedullin (ADM) releasing gs.

The present invention further provides for the use of the compounds according to the invention for treatment and/or tion of disorders, especially of cardiovascular, edematous and/or inflammatory disorders.

For the present invention, the term "treatment" or "treating" includes ting, delaying, relie— ving, mitigating, arresting, reducing, or causing the regression of a disease, er, condition, or state, the development and/or progression thereof, and/or the symptoms thereof. The term "prevention" or "preventing" includes reducing the risk of having, contracting, or experiencing, a disease, er, condition, or state, the development and/or progression thereof, and/or the symptoms thereof. The term prevention includes prophylaxis. Treatment or prevention of a disease, disorder, condition, or state may be partial or complete. 2012/071507 On the basis of their pharmacological properties, the compounds according to the invention can be employed for treatment and/or prevention of cardiovascular diseases, in particular heart failure, especially chronic and acute heart failure, diastolic and systolic (congestive) heart failure, acute decompensated heart failure, cardiac insufficiency, coronary heart disease, angina pectoris, dial tion, ischemia reperfusion injury, ischemic and hemorrhagic stroke, arteriosclerosis, atherosclerosis, hypertension, especially ial ension, malignant essential ension, secondary hypertension, renovascular hypertension and hypertension secondary to renal and endocrine disorders, hypertensive heart disease, hypertensive renal disease, pulmonary hypertension, especially secondary pulmonary hypertension, puhnonary hypertension following pulmonary embolism with and without acute cor pulrnonale, primary ary ension, and peripheral arterial occlusive disease.

The compounds according to the invention are furthermore suitable for treatment and/or prevention of gestational ancy-induced] edema and proteinuria with and without hypertension (pre—eclampsia).

The compounds according to the invention are furthermore suitable for treatment and/or prevention of pulmonary disorders, such as chronic obstructive pulmonary disease, asthma, acute and chronic pulmonary edema, allergic alveolitis and pneurnonitis due to inhaled organic dust and particles of fungal, actinomycetic or other origin, acute chemical bronchitis, acute and chronic chemical pulmonary edema (e.g. after inhalation of phosgene, nitrogen oxide), neurogenic pulmonary edema, acute and c pulmonary stations due to radiation, acute and chronic interstitial lung disorders (such as but not restricted to drug-induced interstitial lung disorders, e.g. secondary to Bleomycin treatment), acute lung injury/acute respiratory distress syndrome (ALI/ARDS) in adult or child including newborn, DS secondary to nia and sepsis, aspiration pneumonia and DS ary to aspiration (such as but not restricted to aspiration pneumonia due to regurgitated gastric content), DS secondary to smoke gas inhalation, transfusion-related acute lung injury (TRALI), ALI/ARDS or acute pulmonary iciency following surgery, trauma or burns, ventilator induced lung injury (VILI), lung injury following meconium aspiration, pulmonary fibrosis, and mountain sickness.

The compounds according to the invention are furthermore le for treatment and/or prevention of chronic kidney diseases (stages 1—5), renal insufficiency, diabetic nephropathy, hypertensive chronic kidney e, glomerulonephritis, y progressive and chronic nephritic syndrome, unspecific nephritic syndrome, nephrotic syndrome, hereditary nephropathies, acute and chronic tubulo—interstitial nephritis, acute kidney , acute kidney failure, posttraumatic kidney failure, traumatic and ocedural kidney injury, cardiorenal syndrome, and protection and functional improvement of kidney lants.

The compounds are moreover suitable for treatment and/or prevention of es mellitus and its consecutive symptoms, such as e.g. diabetic macro— and microangiopathy, diabetic nephropathy and neuropathy.

The compounds according to the invention can moreover be used for treatment and/or prevention of disorders of the central and peripheral nervous system such as Viral and bacterial meningitis and encephalitis (e.g. Zoster encephalitis), brain injury, primary or secondary [metastasis] malignant neoplasm of the brain and spinal cord, litis and polyradiculitis, Guillain-Barre syndrome [acute (post-)infective polyneuritis, Miller Fisher Syndrome], amyotrophic lateral sclerosis [progressive spinal muscle atrophy], Parkinson's disease, acute and chronic polyneuropathies, pain, cerebral edema, Alzheimer's disease, degenerative diseases of the nervous system and demyelinating diseases of the central nervous system such as but not restricted to multiple sclerosis.

The nds ing to the ion are furthermore suitable for treatment and/or prevention of portal hypertension and liver fibrosis [cirrhosis] and its sequelae such as geal varices and ascites, for the treatment and/or prevention of pleural effusions secondary to malignancies or ations and for the ent and/or prevention of lymphedema and of edema secondary to varices.

The compounds according to the invention are furthermore suitable for treatment and/or prevention of inflammatory disorders of the gastrointestinal tract such as atory bowel disease, Crohn's disease, tive colitis, and toxic and vascular disorders of the intestine.

The compounds according to the invention are furthermore suitable for treatment and/or prevention of sepsis, septic shock, ic atory response me (SIRS) of non- infectious origin, hemorrhagic shock, sepsis or SIRS with organ ction or multi organ failure (MOF), traumatic shock, toxic shock, anaphylactic shock, urticaria, insect sting and bite-related allergies, angioneurotic edema [Giant urticaria, Quincke‘s edema], acute laryngitis and tracheitis, and acute obstructive laryngitis [croup] and epiglottitis.

The compounds are rmore suitable for treatment and/or prevention of diseases of the rheumatic type and other disease forms to be counted as autoimmune diseases such as but not 3O restricted to polyarthritis, lupus erythematodes, scleroderma, purpura and vasculitis.

The compounds according to the invention are furthermore suitable for treatment of ocular hypertension (glaucoma), diabetic retinopathy and macular edema.

The compounds according to the invention can moreover be used for treatment and/or tion of operation-related states of ia and consecutive ms thereof after surgical interventions, in particular interventions on the heart using a heart-lung machine (e.g. bypass operations, heart valve implants), interventions on the carotid arteries, interventions on the aorta and interventions with mental opening or penetration of the skull cap.

The compounds are furthermore suitable for general treatment and/or prevention in the event of al interventions with the aim of accelerating wound healing and shortening the reconvalescence time. They are further suited for the promotion ofwound healing.

The compounds are furthermore suitable for treatment and/or prevention of disorders of bone density and structure such as but not restricted to osteoporosis, osteomalacia and hyperparathyroidism—related bone disorders.

The compounds are rmore suitable for treatment and/or prevention of sexual ctions, in particular male erectile dysfunction.

Preferable the compounds are suitable for treatment and/or tion of heart e, ry heart disease, ischemic and/or hagic stroke, hypertension, ary hypertension, eral arterial occlusive disease, pre-eclampsia, chronic obstructive puhnonary disease, asthma, acute and/or chronic pulmonary edema, allergic alveolitis and/or nitis due to inhaled organic dust and particles of fungal, actinomycetic or other origin, and/or acute chemical bronchitis, acute and/or chronic chemical pulmonary edema, neurogenic pulmonary edema, acute and/or chronic pulmonary manifestations due to radiation, acute and/or chronic interstitial lung disorders, acute lung injury/acute respiratory distress syndrome (ALI/ARDS) in adult or child including newborn, ALI/ARDS ary to pneumonia and sepsis, aspiration pneumonia and ALI/ARDS secondary to aspiration, ALI/ARDS secondary to smoke gas inhalation, transfusion- related acute lung injury (TRALI), ALI/ARDS and/or acute pulmonary insufficiency following surgery, trauma and/or burns, and/or ator induced lung injury (VILI), lung injury following meconium aspiration, puhnonary fibrosis, mountain sickness, c kidney diseases, glomerulonephritis, acute kidney injury, cardiorenal syndrome, lymphedema, inflammatory bowel disease, sepsis, septic shock, systemic inflammatory response syndrome (SIRS) of non-infectious origin, anaphylactic shock, inflammatory bowel disease and/or urticaria.

More preferable the compounds are suitable for ent and/or prevention of heart failure, hypertension, pulmonary ension, asthma, acute and/or chronic chemical puhnonary edema, acute lung /acute respiratory distress syndrome (ALI/ARDS) in adult or child including n, ALI/ARDS secondary to pneumonia and sepsis, aspiration nia and ALI/ARDS secondary to aspiration, ALI/ARDS ary to smoke gas inhalation, transfusion-related acute lung injury (TRALI), ALI/ARDS and/or acute pulmonary insufficiency following surgery, trauma and/or burns, and/or ventilator induced lung injury WILI), lung injury following meconium aspiration, sepsis, septic shock, systemic inflammatory response syndrome (SIRS) of noninfectious origin, anaphylactic shock, inflammatory bowel disease and/or urticaria.

The present invention further provides for the use of the compounds according to the ion for treatment and/or prevention of disorders, in particular the disorders mentioned above.

The present invention r provides for the use of the compounds according to the invention for ing a ment for treatment and/or prevention of disorders, in particular the disorders mentioned above.

The present invention further provides a method for treatment and/or prevention of disorders, in particular the disorders mentioned above, using an active amount of the compounds according to the invention.

The invention further provides medicaments comprising a nd according to the invention and one or more further active ingredients, in particular for treatment and/or prevention of the disorders mentioned above. Exemplary and preferred active ingredient combinations are: ACE tors, angiotensin receptor antagonists, beta-2 receptor agonists, phosphodiesterase inhibitors, glucocorticoid receptor agonists, diuretics, or recombinant angiotensin converting enzyme—2 or acetylsalicylic acid (aspirin).

In a preferred ment of the invention, the compounds according to the invention are stered in combination with an ACE inhibitor, such as, by way of example and preferably, enalapril, quinapril, captopril, lisinopril, ramipril, delapril, fosinopril, opril, cilazapril, imidapril, benazepril, moexipril, spirapril or trandopril.

In a preferred embodiment of the invention, the compounds according to the invention are administered in ation with an angiotensin receptor antagonist, such as, by way of example and preferably, losartan, candesartan, valsartan, artan or embusartan.

In a red embodiment of the invention, the compounds according to the invention are administered in combination with a beta—2 receptor agonist, such as, by way of example and preferably, salbutamol, pirbuterol, salmeterol, terbutalin, fenoterol, tulobuterol, clenbuterol, reproterol or formoterol.

In a preferred ment of the invention, the nds according to the invention are administered in combination with a phosphodiesterase O’DE) inhibitor, such as, by way of example and preferably, one, amrinone, pimobendan, cilostazol, sildenafil, vardenafil or tadalafil.

In a preferred embodiment of the invention, the compounds according to the invention are stered in combination with a glucocorticoid receptor t, such as, by way of example and preferably, cortiosol, cortisone, hydrocortisone, prednisone, methyl-prednisolone, prednylidene, cort, fluocortolone, triamcinolone, dexamethasone or betamethasone.

In a preferred embodiment of the invention, the compounds according to the invention are stered in combination with diuretics, such as, by way of example and preferably, furosemide, torasemide and hydrochlorothiazide.

The present invention further s to medicaments which se at least one compound according to the invention, normally together with one or more inert, nontoxic, pharmaceutically suitable excipients, and to the use f for the aforementioned purposes.

The compounds according to the invention can act systemically and/or locally. For this purpose, they can be administered in a suitable way, for example by the parenteral, ary, nasal, sublingual, l, buccal, dermal, transdermal, conjunctival, optic route or as implant or stent.

The nds according to the ion can be administered in administration forms suitable for these administration routes.

Parenteral administration can take place with avoidance of an absorption step (e.g. intravenous, intraarterial, intracardiac, intraspinal or intralumbar) or with inclusion of an absorption (e.g. intramuscular, subcutaneous, intracutaneous, percutaneous or intraperitoneal). Administration forms suitable for parenteral administration include preparations for injection and infusion in the form of solutions, suspensions, emulsions, lyophilizates or sterile powders.

Suitable for the other administration routes are, for example, pharmaceutical forms for inhalation (including powder rs, nebulizers), nasal drops, eye drops, solutions or sprays; films/wafers or aqueous suspensions (lotions, shaking es), lipophilic suspensions, ointments, creams, transdermal therapeutic systems (e.g. patches), milk, pastes, foams, dusting powders, implants or stents.

Parenteral administration is red, especially intravenous administration.

The compounds according to the invention can be converted into the stated administration forms.

This can take place in a manner known per se by mixing with inert, nontoxic, pharmaceutically suitable excipients. These excipients include carriers (for example microcrystalline cellulose, lactose, mannitol), solvents (e.g. liquid polyethylene glycols), emulsifiers and dispersants or g agents (for example sodium dodecylsulfate, polyoxysorbitan ), binders (for example polyvinylpyrrolidone), synthetic and natural rs (for example albumin), stabilizers (e.g. antioxidants, for e ascorbic acid), colors (e.g. inorganic pigments, for example iron oxides) and masking flavors and/or odors.

It has generally been found to be advantageous, in the case of parenteral administration, to administer amounts of about 0.001 to 5 mg/kg, preferably about 0.01 to 1 mg/kg, of body weight to achieve effective results.

It may nevertheless be necessary in some cases to deviate from the stated amounts, in ular as a function of the body weight, route of administration, individual response to the active ingredient, nature of the preparation and time or interval over which administration takes place. For instance, less than the aforementioned minimum amount may be sufficient in some cases, s in other cases the stated upper limit must be exceeded. In the case of stration of larger amounts, it may be advisable to divide these into a plurality of individual doses over the day.

The following working examples illustrate the invention. The invention is not restricted to the examples.

The percentages in the following tests and es are, unless stated otherwise, percentages by weight; parts are parts by weight. Solvent ratios, dilution ratios and concentration data for the /liquid solutions are each based on volume. _ 21 _ A. Examples Abbreviations AA amino acid Acm acetamidomethyl ADM adrenomedullin (human) ADM(2-52) Peptide sequence of ADM AA 2 to AA 52, including disulfide bond and C-terminal amide approx. approximately Boc tert—butyloxycarbonyl CDI carbonyldiimidazole (1 day(s), t (in NMR) TLC ayer chromatography DCI direct chemical ionization (in MS) dd doublet of ts (in NMR) DIEA N,N—diisopropylethylamine DMAP 4-dimethylaminopyridine DMF MN—dimethylformamide DMSO dimethyl sulfoxide of theory of theory (in yield) eq. equivalent(s) ESI electrospray ionization (in MS) Fmoc (9H—fluoren—9-ylmethoxy)carbonyl h ) HATU O-(7-azabenzotriazol— l -yl)-N,N,N‘,N‘-tetramethyluronium hexafluorophosphate HPLC high pressure, high performance liquid chromatography LC—MS liquid chromatography-coupled mass oscopy In multiplet (in NMR) min minute(s) MS mass spectroscopy NMR nuclear magnetic resonance spectroscopy pbf 2,2,4,6,7-pentamethyldihydrobenzofuran—5-sulfonyl PEG polyethylene glycol RP reversed phase (in HPLC) RT room temperature Rt retention time (in I-IPLC) s singulet (in NMR) TBTU benzotriazol— l -yl-N—tetramethyl-uronium tetrafluoroborate tBu tert—butyl TFA trifluoroacetic acid THF tetrahydrofuran Trt trityl lature of amino acids and peptide sequences is according to: International Union of Pure and Applied Chemistry and International Union of Biochemistry: Nomenclature and Symbolism for Amino Acids and Peptides mendations 1983). In: Pure & Appl. Chem. 56, Vol. 5, 1984, p. 595—624 Trivial Name Symbol One—letter Symbol Alanine Ala A Arginine Arg R gine Asn N ic acid Asp D Cysteine Cys C Glutamic acid Glu E Glutamine Gln Q Glycine Gly G Histidine His H Isoleucine Ile I Leucine Len L Lysine Lys K Methionine Met M Phenylalanine Phe F Proline Pro P Serine Ser S Threonine Thr T Tryptophan Trp W Tyrosine Tyr Y Valine Val V WO 64508 LC-MS and MS methods Method 1 (LC-MS): Instrument type: Waters ACQUITY SQD UPLC System; column: Waters y UPLC HSS T3 1.8 u 50 mm x 1 mm; mobile phase A: 1 1 water + 0.25 ml 99% strength formic acid, mobile phase B: 1 l acetonitrile + 0.25 ml 99% strength formic acid; gradient: 0.0 min 90% A —> 1.2 min 5% A —> 2.0 min 5% A; oven: 50°C; flow: 0.40 ml/min; UV-detection: 210 — 400 nm.

Method 2 (LC-MS): MS instrument: type: Waters (Micromass) Quattro Micro; HPLC instrument type: Agilent 1100 series; column: Thermo Hypersil GOLD 3 u 20 mm x 4 mm; mobile phase A: 1 1 water + 0.5 ml 50% strength formic acid, mobile phase B: l lacetonitrile + 0.5 ml 50% strength formic acid; gradient: 0.0 min 100% A —> 3.0 min 10% A —> 4.0 min 10% A; oven: 50°C; flow: 2.0 ml/min; UV-detection: 210 nm.

Method 3 (HPLC): Instrument type: HP 1200 Series; UV DAD; column: Phenomenex Luna 5 um C5 100A, 150 mm X 4.6 mm; mobile phase A: 1 1 water + 0.5 ml 50% strength formic acid, mobile phase B: 1 l acetonitrile + 0.5 ml 50% strength formic acid; gradient: 0.0 min 95%A —> 5 min 5% A; —> 5.8 min 95% A —> 6.2 min 95% A; flow rate: 2.5 ; oven: RT; UV detection: 210 Method 4 (HPLC): Instrument type: HP 1200 ; UV DAD; column: Merck Chromolith Fastgradient RPIS 50 mm X 2 mm; mobile phase A: 1 1 water + 0.5 ml 50% th formic acid, mobile phase B: 1 1 acetonitrile + 0.5 ml 50% th formic acid; gradient: 0.0 min 95%A —> 2.9 min 5% A —> 3.2 min 5% A; flow rate: 3 ml/min; oven: RT; UV detection: 210 nm.

Method 5 (DCI MS): Instrument type: Thenno Fisher-Scientific DSQ; chemical ionization; reactant ammonia gas; source temperature: 200°C; inonization energy 706V.

Method 6 (MALDI MS): Instrument type Kratos PC—Kompact SEQ V1.2.2 MALDI TOF MS, positive ionization mode, Linear high, Power: 75.

Microwave synthesizer: Biotage Emrys Initiator II synthesizer, with variable vial size up to 20 ml reaction volume and "Robot 60" sample processor pH 4 citrate buffer: Fluka No 82566; Citrate buffer pH 4, stabilized with sodium azide ition: citric acid, ~0.056 M; sodium azide, ~0.05%; sodium chloride, ~0.044 M; sodium hydroxide, ~0.068 M. 40kDa methoxy poly(ethylene glycol) maleimido propionamide (linear 40k mPEG maleimide); CAS No 724722—89-8; From Dr. Reddys 1110., Lot No 233101301; Weight average lar weight, MW (GPC) 40500 Da; Polydispersity (GPC) 1.08.

Starting compounds e 1A Allyl-N-(teIt-butoxycarbonyl)-O-[(4-nitrophenoxy)carbonyl]-L-tyrosinate 11,, (D/fl\0 00°N\_ H3C 0 NH H3C T % cH3 0 CH2 36.7 g (114.3 mmol) N—Boc-L—tyrosine allyl ester, 23.0 g (114.3 mmol) ophenyl formate, 17.5 ml (125.7 mmol) triethylamine and 1.40 g (11.4 mmol) 4—dimethylamino pyridine were combined in 1000 ml dichloromethane and stirred at room temperature for 2 h. The reation mixture was extracted with approx. 500 ml water and with approx. 250 ml brine and dried over approx. 100 g sodium sulfate. The solvent was removed by rotary evaporation (approx. 40°C, approx. 200 mbar, approx. 30 min.) and the product was dissolved in warm diethyl ether and crystallized over night at 4°C. The crystals were filtered of, washed with cold diethyl ether and dried in high vacuum (approx. 0.1 mbar, 18 h). The yield was 29.86 g, (59.6 mmol, 52% of ) of the desired product.

LC-MS (method 1): Rt = 1.23 min., m/z = 487 (M+H)Jr Example 2A (ZS)—4- { [(4- {(2S)—3-(Allyloxy)[(tert—butoxycarbonyl)amino] -3—oxopropyl}phenoxy)carbonyl] — amino} [(tert—butoxycarbonyl)amino]butanoic acid 0 CH3 0 oékgH JL 3 0 NW "30% T3 0 NH % CH3 0 CH2 4.0 g (8.22 mmol) of the compound from e 1A was dissolved in 60 ml dichloromethane. 1.795 (8.22 mmol) (ZS)Amino—2-[(tert—butoxycarbonyl)amino]butanoic acid and 1.43 ml (8.22 mmol) N,N—diisopropylethylamine were added. The reaction mixture was split into 3 portions. The ns were heated for 30 min in a sealed tube at 75°C in a microwave synthesizer. From the combined reaction mixture the solvent was removed by rotary evaporation x. 40°C, approx. 200 mbar, approx. 30 min.). The raw t was dissolved in dichloromethane and chromatographed over approx. 600 ml silica gel. Solvents used were romethane/ethyl acetate 4/1, dichloromethane/ethyl acetate 1/1, dichloromethane/methanol 4/1 and dichloromethane/ methanol 1/1. The product-containing fractions were combined and concentrated to dryness under reduced pressure. This gave 4.02 g (6.54 mmol, 80% of theory) of the desired product.

LC—MS (method 1): Rt = 1.07 min., m/z = 564 (M-H)‘ Example 3A Allyl O-({(3S)—4— amino— 1 —oxo-3 -(tritylsulfanyl)propan—2-yl]amino} -3—[(tert—butoxy— carbonyl)amino]—4—oxobutyl} carbamoyl)-N-(tert—butoxycarbonyl)-L-tyrosinate 3 o NH H3C \H/ | CH3 0 CH2 2.50 g (4.42 mmol) of the compound from example 2A was dissolved in 100 ml dichloromethane. 1.602 g (4.42 mmol) S-Trityl—L—cysteinamide, 0.77 ml (4.42 mmol) N,N—diisopropylethylamine and 1.68 g (4.42 mmol) HATU were added. The on mixture was split into 5 portions. The portions were heated for 30 min in a sealed tube at 60°C in a microwave synthesizer. From the combined reaction mixture the solvent was removed by rotary evaporation (approx. 40°C, approx. 200 mbar, approx. 30 min.). The raw product was dissolved in dichloromethane and chromatographed over approx. 600 ml silica gel. ts used were dichloromethane/ethyl acetate 2/1 dichloromethane/ethyl e 1/1, dichloromethane/methanol 20/1 and dichloromethane/methanol 10/1. The product-containing fractions were combined and concentrated to dryness under reduced re. This gave 4.12 g (3.30 mmol, 75% of theory, 73% purity) of the desired product.

LC-MS (method 1): Rt = 1.36 min., m/z = 911 (M+H)+ Example 4A O-({(3 S)—4— { [(2R)- 1-Amino— 1 —oxo—3—(tritylsu1fanyl)propan—2—yl]amino} -3 -[(tert—butoxycarbonyl)— amino]oxobutyl} carbamoyl)—N—(tert—butoxycarbonyl)-L-tyrosine o 0 NH 8 JL H - N 0 NW H D o NH2 3 o NH H3C \H/ CH30 4.14 g (4.55 mmol) of the compound from example 3A was dissolved in 90 ml tetrahydrofuran. 3.17 ml (22.8 mmol) triethylamine, 0.86 ml (22.8 mmol) formic acid and 0.526 g (0.455 mmol) tetrakis(triphenylphosphin)palladium(0) were added. The reaction e was stirred over night at room temperature. The reaction was diluted with approx. 100 ml water, and twice ted with approx. 100 ml romethane. The combined c phases were extracted with brine, dried over sodium sulfate and concentrated to dryness under reduced pressure. The raw product was dissolved in dichloromethane and chromatographed over approx. 500 ml silica gel. Solvents used were dichloromethane, dichloromethane/methanol 20/1 and dichloromethane/methanol 1/ 1. The product-containing fractions were combined and concentrated to dryness under reduced pressure.

This gave 2.62 g raw product of 94.5% . The t was further purified by preparative RP- HPLC on a C18 with a water/methanol gradient to yield 2.35 g (2.70 mmol, 59% of theory) pure product.

LC-MS (method 1): Rt = 1.22 min., m/z = 871 (M+H)+ 1H—NMR (400 MHz, DMSO-da, 5/ppm): a = 7.92 (d, 1H), 7.65 (t, 1H), 7.28-7.35 (m, 12H), 7.25— 7.28 (t, 3H), 7.15-7.20 (m, 4H), 6.95 (d, 2H), 4.29 (q, 1H), 4.00 (m, 1H), 3.92 (m, 1H), 3.11 (m, 3H), 2.90 (m, 1H), 2.36 (m, 2H), 1.84 (m, 1H), 1.68 (m, 1H), 1.34 (d, 18H).

Example 5A tert-Butyl—methyl(2-oxotetrahydrofilran-3—y1)carbamate 0 0740 o N\ The compound was synthesized according to Alberico, Dino; Paquin, Jean-Francois; Lautens, Mark; Tetrahedron, 2005, vol. 61, p. 6283 - 6297. .18 g (25.7 mmol) tert—Butyl(tetrahydro—2-oxo—3-furanyl)carbamate, 4.81 ml (77.2 mmol) iodomethane were dissolced in 100 ml of dry dimethyl de. The solution was cooled to 0°C and 1.34 g (60% in mineral oil, 33.5 mmol) sodium hydride was added. The reaction was warmed to room temperature and stirred over night. The reaction mixture was added to approx. 400 ml water and the mixture was extracted three times with approx. 300 ml ethyl acetate. The combined organic phases were dried over sodium e and concentrated to dryness under reduced pressure.

This gave 8.70 g (25.7 mmol, 100% of theory, 63% purity) of the desired product.

The analytic data was in accordance with the literature. The t was used in the next synthetic step without further purification.

Example 6A 2—[(tert—Butoxycarbonyl)(methyl)amino]( 1 ,3-dioxo— 1 ,3-dihydro-2H—isoindolyl)butanoic acid O OH N N ~ CH3 0 CH3 0 O+CH3 8.70 g (approx. 25 mmol, approx. 63% purity) of the compound from example 5A was dissolved in 560 ml dimethyl formamide. 8.23 g (44.4 mmol) potassium ophtalimide were added and the reaction mixture was heated to 150°C for 7 h. Approx. 400 ml of he t was removed by rotary evaporation (approx. 60°C, approx. 10 mbar, approx. 30 min.). The reaction mixture was poured onto a mixture of approx. 100 ml water, 200 g ice and 15 ml acetic acid. After melting of the remaining ice the on mixture was filtered and the e was ted 3 times with approx. 100 ml dichloromethane. The combined organic phases were dried over sodium sulfate and concentrated to dryness under reduced pressure. The raw product was dissolved in dichloromethane and chromatographed over approx. 70 ml silica gel. Solvents used were dichloromethane/ethyl acetate 9/1 to dichloromethane/ethyl acetate 6/4. The product-containing fractions were combined and concentrated to dryness under reduced pressure. This gave 2.39 g (6.04 mmol, 24% of theory) product.

Lc—Ms (method 1); Rt = 0.92 min., m/z = 363 (M+H)+ Example 7A 4-An1ino-2—[(tert—butoxycarbonyl)(methyl)amino]butanoic acid H2N N~CH3 0 CH3 O+CH3 11.8 g (32.6 mmol) of the compound from example 6A was dissolved in approx. 640 ml l and 23.8 ml (488 mmol) hydrazine hydrate was added to the reaction mixture. After stirring over night, the reaction e was filtered and the filtrate was concentrated to s under reduced re. The raw product was dissolved in l and approx. 50 g silica gel was added, the solvent was removed under reduced pressure. The ing solid was added onto a approx. 500 g silica gel column and chromatographed. Solvents used were dichloromethane/methanol 9/1 to dichloromethane/methanol 1/1. The product-containing fractions were combined and concentrated to dryness under reduced pressure. This gave 2.98 g (12.8 mmol, 39% of theory) product.

LC-MS (method 2): Rt = 0.21 min., m/z = 233 (M+H)‘r DCI MS (method 5): m/z = 233 (M+H)+ Example 8A 4— { [(4— 3 -(Allyloxy)—2-[(tert-butoxycarbonyl)amino]oxopropyl}phenoxy)carbonyl] — amino} [(tert-butoxycarbonyl)(methyl)amino]butanoic acid 0 CH3 A/<:H. "30% T3 0 NH % CH3 0 CH2 0.931 g (1.92 mmol) of the compound from example 1A was dissolved in 30 ml dichloromethane. 0.455 g (1.92 mmol) of the compound from example 7A was added. The reaction mixture was split into 2 portions. The portions were heated for 30 min in a sealed tube at 80°C in a microwave synthesizer. From the combined reaction mixture the solvent was removed under d pressure.

The raw product was purified by ative RP-HPLC on a C18 column with a water methanol gradient from 9/1 to 1/9. The product-containing fractions were combined and trated to dryness under reduced pressure. This gave 0.523 g (0.85 mmol, 44% of theory) of the desired product as a mixture of 2 diastereomers.

LC-MS (method 1): Rt = 1.08 and 1.11 min., m/z = 578 (M-H)’ Example 9A Allyl O-[(4— { [(2R)— 1 -amino— 1 -(trity1su1fany1)propan—2-yl]amino} -3 -[(tert—butoxycarbonyl)— (methyl)amino]oxobutyl)carbamoyl]-N-(tert—butoxycarbonyl)—L—tyrosinate /CH3 0 o N s /U\ WhizN o N H O o NH2 3 0 NH "30 Y | CH3 0 CH2 2.24 g (3.86 mmol) of the compound from example 8A was dissolved in 100 m1 dichloromethane. 1.401 g (3.86 mmol) S—Trityl—L—cysteinamide, 0.67 ml (3.86 mmol) N,N-diisopropylethylamine and 1.47 g (3.86 mmol) HATU were added. The reaction mixture was split into 5 portions. The portions were heated for 30 min in a sealed tube at 60°C in a microwave synthesizer. From the combined reaction mixture the solvent was removed by rotary evaporation (approx. 40°C, . 200 mbar, approx. 30 min.). The raw product was purified by preparative RP-HPLC on a C18 column with a water methanol gradient from 9/1 to 1/9. The product-containing ons were combined and concentrated to dryness under reduced re. This gave 3.26 g (2.75 mmol, 71% of theory, 78% purity) of the desired product as a mixture of diastereomers.

LC-MS (method 1): Rt = 1.41 and 1.43 min., m/z = 924 ('M+H)+ Example 10A 0-[(4— { [(2R)— 1 -Aminooxo-3 -(tritylsulfanyl)propan—2—yl]amino} -3 -[(tert—butoxycarbonyl)— (methyl)amino]oxobutyl)carbamoyl]-N-(tert—butoxycarbonyl)—L—tyrosine CH3 O 0 CH3 A2:11, o o N S JL W"H o N H O o NH2 3 0 NH H3C \H/ CH3 0 2.2 g (2.38 mmol) of the compound from example 9A was dissolved in 48 ml tetrahydrofuran. 1.66 ml (11.9 mmol) triethylamine, 0.45 ml (11.9 mmol) formic acid and 0.275 g (0.238 mmol) tetrakis(triphenylphosphin)palladium(0) were added. The reaction mixture was stirred over night at room temperature. The reaction was diluted with approx. 50 ml water and twice extracted with approx. 50 ml dichloromethane. The combined organic phases were extracted with brine, dried over sodium e and concentrated to dryness under reduced pressure. The raw product was ved in dichloromethane and chromatographed over approx. 100 g silica gel. ts used were dichloromethane, dichloromethane/methanol 50/1 and romethane/methanol 4/1. The product-containing fractions were combined and concentrated to s under reduced pressure.

This gave 1.44 g (1.61 mmol, 68% of theory) product as a mixture of diastereomers.

LC-MS (method l): R: = 1.20 and 1.24 min., m/z = 884 OVI+H)+ 1H—NMR (400 MHz, DMSO-ds, 5/ppm); 5 = 8.00 (m, 1H), 7.65-7.90 (m, 4H), 7.18-7.35 (m, 18H), 7.10 (m, 2H), 6.96 (m, 4H), 4.60 (m, 1H), 4.46 (m, 1H), 4.30 (m, 2H), 4.05 (m, 2H), 3.00 (m, 4H), 2.75 (m, 6H), 2.36 (m, 3H), 2.00 (m, 2H), 1.82 (m, 2H), 1.40 (m, 3H), 1.35 (s, 18H). 2012/071507 Example 11A N5-[(4- {(2S)—3-(Allyloxy)[(tert—butoxycarbonyl)amino] -3—oxopropyl}phenoxy)carbonyl]-N2- (tert—butoxycarbonyl)-L-ornithine 11WWO OOYN0 I CH3 3 CH3 W11CH3 6.00 g (12.33 mmol) of the compound from example 1A was dissolved in 120 ml dichloromethane. 2.57 g (12.33 mmol) NZ-(tert-Butoxycarbonyl)—L—ornithine was added. The reaction mixture was split into 6 portions. The portions were heated for 90 min in a sealed tube at 75°C in a microwave synthesizer. The combined reaction mixture was extracted with approx. 100 ml saturated ammonium chloride solution. The aqueous phase was twice back extracted with . 30 ml dichloromethane each. The combined organic phases were extracted with approx. 50 ml brine and dried over sodium e. The t was d under reduced pressure. The raw product was dissolved in dichloromethane and chromatographed over approx. 600 ml silica gel. Solvents used were dichloromethane, dichloromethane/methanol 40/1 to dichloromethane/methanol 1/ 1. The product-containing fractions were combined and concentrated to dryness under reduced pressure.

This gave 2.63 g (4.06 mmol, 33% of theory, 89% purity) of the desired product.

LC—MS (method 1): R = 1.03 min., m/z = 578 (M-H)‘ Example 12A N5-[(4- {(2S)—3-(Allyloxy)[(tert—butoxycarbonyl)amino] -3—oxopropyl}phenoxy)carbonyl]-N2- (tert—butoxycarbonyl)-L-ornithyl-S-trityl-L—cysteinamjde ii ° 0 N OYNH 0 CH 0 >( 3 "30 CH3 "30% T3 0 NH % CH3 0 CH2 1.20 g (2.07 mmol) of the compound from example 11A was dissolved in 48 ml dichloromethane. 0.750 g (2.07 mmol) S-Trityl-L—cysteinamide, 0.36 ml (2.07 mmol) N,N-diisopropylethylamine and 0.787 g (2.07 mmol) HATU were added. The reaction mixture was split into 3 portions. The portions were heated for 30 min in a sealed tube at 60°C in a microwave synthesizer. From the combined reaction e the t was removed by rotary evaporation (approx. 40°C, approx. 200 mbar, approx. 30 min.). The raw product was dissolved in dichloromethane and chromatographed over approx. 400 ml silica gel. Solvents used were dichloromethane/ethyl acetate 2/1, dichloromethane/ethyl e 1/ 1. The product—containing fractions were combined and concentrated to dryness under reduced pressure. This gave 1.30 g (1.5 mmol, 56% of theory, 82% purity) of the d t.

LC-MS (method 1); Rt = 1.35 min., m/z = 924 (M+H)+ 2012/071507 Example 13A NZ-(tert-Butoxycarbonyl)-N5-[(4— {(2S)—2—[(tert—butoxycarbonyl)amino]-2—carboxyethyl}phenoxy)— carbonyl]-L-ornithyl—S-trityl—L—cysteinamide CH3 0 3.06 g (2.33 mmol) of the compound from example 12A was ved in 46 ml tetrahydrofuran. 1.63 ml (11.6 mmol) triethylamine, 0.44 ml (11.6 mmol) formic acid and 0.265 g (0.233 mmol) tetrakis(triphenylphosphin)palladium(0) were added. The reaction mixture was stirred over night at room temperature. The reaction was diluted with approx. 50 ml water and twice ted with approx. 50 ml dichloromethane. The combined organic phases were extracted with brine, dried over sodium sulfate and concentrated to dryness under reduced pressure. The raw product was dissolved in dichloromethane and chromatographed over approx. 500 ml silica gel. Solvents used were dichloromethane, dichloromethane/methanol 40/1 and dichloromethane/methanol 1/ 1. The product-containing fractions were combined and concentrated to s under reduced pressure.

This gave 1.40 g raw product of 86% purity. The product was further purified by preparative RP- HPLC on a C18 column with a water/methanol gradient to yield 2 fractions: 0.93 g product (45% of theory).

LC-MS (method 1): Rt = 1.18 min., m/z = 885 r ‘H-NMR (400 MHz, DMSO-dé, 5/ppm): 8 = 7.89 (d, 1H), 7.65 (t, 1H), 7.25—7.35 (m, 12H), 7.20— 7.25 (m, 6H), 7.10—7.20 (m, 3H), 6.95 (d, 2H), 4.29 (m, 1H), 4.05 (m, 1H), 3.88 (m, 1H), 3.11 (d, 1H), 3.00 (m, 4H), 2.75 (m, 2H), 2.36 (m, 3H), 1.64 (m, 1H), 1.51 (m, 3H), 1.36 (s, 9H), 1.32 (s, 9H).

Example 14A Tentagel based amide resin bound ADM (2-52) [CH3 I :0 2 52 ueTentagelTM—resin H- RQSMNNFQGLRSFGERFGTCTVQKLAHQIYQFTDKDKDNVAPRSKlSPQGY—u The peptide was assembled stepwise on a Tentagel based amide resin on an automated peptide synthesizer (Protein Technologies Inc. Symphony). 8 poly-propylene reaction s were used in el performing the identical chemistry. Each vessel was loaded with 0.05 mmol Tentagel based Rink resin for a total batch size of 0.4 mmol.

Each amino acid is added in 8 fold molar access with regard to the loading of the resin. The amino acids were Fmoc protected as the N—terminal protecting group and the protecting groups indicated below were used for side chain onalities. Also 188 mg (0.59 mmol, 7.8 eq.) TBTU and 0.21 ml (1.2 mmol, 16 eq.) DIEA were added. Reactions were performed in DMF as solvent, whereas DMF was used in an amount sufficient to swell the resin and agitate it . Reaction time per amino acid was approx. 1 hour. Cleavage of the Fmoc protecting groups was achieved using 20% piperidine/DMF, s 20% piperidine/DMF was used in an amount sufficient to swell the resin and agitate it freely.

The coupling sequence was as follows: 1. Tyr(tBu) (Tyr = Y = AA 52 of human ADM) 2. Gly (Gly = G = AA 51 n ADM) 3. Gln(Trt) (Gln = Q = AA 50 ofhuman ADM) 4. Pro (Pro = P = AA 49 of human ADM) . Ser(tBu) (Ser = S = AA 48 ofhuman ADM) 6. Ile (Ile = I = AA 47 of human ADM) 7. Lys(Boc) (Lys = K = AA 46 ofhuman ADM) 8. Ser(tBu) (Ser = S = AA 45 ofhuman ADM) Arg(pbf) (Arg = R = AA 44 ofhuman ADM) . Pro (Pro = P = AA 43 n ADM) 11. Ala (Ala = A = AA 42 n ADM) 12. Val (Val = V = AA 41 ofhuman ADM) . Asn(Trt) (Asn = N = AA 40 ofhuman ADM) 14. Asp(OtBu) (Asp = D = AA 39 ofhuman ADM) . Lys(Boc) (Lys = K = AA 38 ofhuman ADM) 16. Asp(OtBu) (Asp = D = AA 37 ofhuman ADM) 17. Lys(Boc) (Lys = K = AA 36 ofhuman ADM) 18. Asp(OtBu) (Asp = D = AA 35 ofhuman ADM) 19. Thr(tBu) (Thr = T = AA 34 ofhuman ADM) . Phe (Phe = F = AA 33 ofhuman ADM) 21. Gln(Trt) (Gln = Q = AA 32 ofhuman ADM) 22. Tyr(tBu) (Tyr=Y=AA31 nADM) 23. Ile (116 = I = AA 30 of human ADM) 24. Gln(Trt) =AA29 ofhumanADM) . His(T1't) (His = H = AA 28 of human ADM) 26. Ala (Ala = A = AA 27 ofhuman ADM) 27. Leu (Leu = L = AA 26 of human ADM) 28. Lys(Boc) (Lys = K = AA 25 ofhuman ADM) 29. Gln(Txt) (Gln=Q=AA24ofhumanADM) . Val (Val = V = AA 23 ofhuman ADM) 31. Thr(tBu) (Thr = T = AA 22 of human ADM) 32. Cys(Trt) (Cys = C = AA 21 ofhuman ADM) 33. u) (Thr = T = AA 20 of human ADM) 34. Gly (Gly = G = AA 19 ofhuman ADM) . Phe (Phe=F=AA 18 ofhuman ADM) 36. Arg(pbf) (Arg = R = AA 17 ofhuman ADM) 37. Cys(Acm) (Cys = C = AA 16 ofhuman ADM) 38. Gly (Gly = G = AA 15 ofhuman ADM) 39. Phe (Phe = F = AA 14 ofhuman ADM) 40. Ser(tBu) (Ser = S = AA 13 n ADM) 41. Arg(pbi) (Arg = R = AA 12 ofhuman ADM) 42. Leu (Leu = L = AA 11 of human ADM) 43. Gly (Gly = G = AA 10 n ADM) 44. Gln(Trt) (Gln = Q = AA 9 of human ADM) 45. Phe (Phe = F = AA 8 of human ADM) 46. Asn(Trt) (Asn = N = AA 7 ofhuman ADM) 47. Asn(Trt) (Asn = N = AA 6 ofhuman ADM) 48. Met (Met = M = AA 5 ofhuman ADM) 49. Ser(tBu) (Ser = S = AA 4 of human ADM) 50. G1n(T1’t) (Gln = Q = AA 3 of human ADM) 51. Arg(pbf) (Arg = R = AA 2 ofhuman ADM) On—resin oxidation was achieved using Cys(Trt) and m) protection with concomitant cleavage of protecting groups and oxidation to a disulfide bond using Iodine (8 equivalents of Iodine plus 8 equivalents of DIEA with a reaction time of 30 minutes). Oxidation was confirmed by sample cleavage and analysis using HPLC and MALDI—MS.

The 8 batches were pooled for further use. 2012/071507 Example 15A 0- { [(3 S)—3-Amino—4— { [(ZR)— 1 -amino— 1 -sulfanylpropan—2—yl]amino} —4—oxobutyl]— carbamoyl} -L-tyrosy1-adrenomedullin(2-52) 0 NH, SH /U\ E H ' N 0 NW 0 NH2 1 2 52 Y "ERQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 To 0.075 mmol of the compound of example 14A 520 mg (0.6 mo], 8 eq.) of the compound of example 4A were added. Also 188 mg (0.59 mmol, 7.8 eq.) TBTU and 0.21 ml (1.2 mmol, 16 eq.) DIEA were added. The reaction was performed with DMF as solvent, whereas DMF was used in an amount sufficient to swell the resin and agitate it freely. Reaction time was approx. 1 hour at room temperature. The peptide was cleaved from the resin with concomitant global deprotection using concentrated TFA in an amount sufficient to swell the resin and agitate it freely, s TFA contains scavengers (l- 5% each of water, phenol, thioanisole and 1,2-ethanediol), with a reaction time of 2 1/2 hrs. The crude product was lyophilised and purified by RP—chromatography using 0.1% TFA in water and 0.1% TFA in itrile as mobile phases to ensure that the pH remains below 4 at all times during the purification and lisation process. All fractions containing the correct ion by MALDI—MS analysis were . The yield was 44.0 mg of partially ed peptide (approx. 0.0035 mmol, approx. 4.7% of theory; estimated purity: approx. 50%, main impurity: ADM (2-52)).

MALDI MS (method 6): m/z = 6275(M+H)+ and 5866 (impurity: (ADM(2-52)+H)+) Example 16A 0- { [4- { [(2R)— 1 -Amino-1 -oxo—3 -su1fanylpropan—2—yl]amino} (methylamino)—4—oxobutyl]- carbamoyl} -L-tyrosy1-adrenomedullin(2-52) o HN" 3 SH o N o NH2 1 2 52 Y N——RQSMNNFQGLRsFGCRFGTCTVQKLMQIYQFTDKDKDNVAPRSMSPQGY-NH2 H L—‘—J To 0.075 mmol of the compound of example 14A 530 mg (0.6 mmol, 8eq.) of the compound of e 10A were added. Also 188 mg (0.59 mmol, 7.8 eq.) TBTU and 0.21 ml (1.2 mmol, 16 eq.) DIEA were added. The reaction was performed with DMF as solvent, whereas DMF was used in an amount sufficient to swell the resin and agitate it . on time was approx. 1 hour at room temperature. The peptide was d fl'om the resin with concomitant global deprotection using concentrated TFA in an amount sufficient to swell the resin and agitate it freely, whereas TFA contains scavengers (l- 5% each of water, phenol, thioanisole and 1,2-ethanediol), with a reaction time of 2 V2 hrs. The crude t was lised and purified by RP—chromatography using 0.1% TFA in water and 0.1% TFA in acetonitrile as mobile phases to ensure that the pH remains below 4 at all times during the purification and lyophilisation process. All fractions containing the correct ion by MALDI—MS is were pooled. The yield was 34.0 mg of partially purified peptide (approx. 0.0026 mmol, approx. 3.5% of theory; estimated purity: approx. 50%, main impurity: ADM (2-52)).

MALDI MS (method 6): m/z = 6289(M+H)+ and 5866 (impurity: (ADM(2-52)+H)+) Example 17A 0- {[(4R)—4-Amino { [(2R)— 1 -amino- 1-oxosulfanylpropan—2-yl]amino} oxopentyl]- carbamoyl} —L—tyrosyl—adrenomedullin(2—52) 0 NH2 )1 ° 7 0 "Wu"mil 1 2 52 Y "#RQSMNNFQGLRSFGCRFGlCJITVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 To 0.075 mmol of the compound of example 14A 530 mg (0.6 mmol, 8eq.) of the compound of example 13A were added. Also 188 mg (0.59 mmol, 7.8 eq.) TBTU and 0.21 ml (1.2 mmol, 16 eq.) DIEA were added. The on was performed with DN[F as solvent, whereas DMF was used in an amount sufficient to swell the resin and agitate it freely. Reaction time was approx. 1 hour at room temperature. The peptide was d from the resin with concomitant global deprotection using concentrated TFA in an amount sufficient to swell the resin and agitate it freely, whereas TFA contains scavengers (1- 5% each of water, phenol, isole and 1,2—ethanediol), with a reaction time of 2 1/2 hrs. The crude product was lyophilised and purified by RP—chromatography using 0.1% TFA in water and 0.1% TFA in acetonitrile as mobile phases to ensure that the pH remains below 4 at all times during the purification and lyophilisation s. All fractions containing the correct ion by MALDl-MS analysis were pooled. The yield was 47 mg of partially purified peptide (approx. 0.0037 mmol, . 5.0% of ; estimated purity: approx. 50%, main impurity: ADM (2-52)).

MALDI MS (method 6): m/z = 6289(M+H)+ and 5866 (impurity: (ADM(2-52)+H)+) Working examples Example 1 O- { [(3 S)—3—Amino—4-({(2R)- 1 —amino—3 -[(2,5-dioxo- l — {3-oxo—3 -[(2— {m-methoxy—poly— oxyethylen[40kDa] } ethyl)amino]propyl}pyrrolidin—3-yl)sulfanyl] oxopropan-2—yl} amino)—4— oxobutyl]carbamoyl}-L—tyrosyl-adrenomedullin(2—52) 0 PEG 40kDa -OCH3 QM / j]: IgIHz H = 0M0 O uW 1 52 Y NHRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 44 mg of the crude peptide of example 15A were stirred with 426 mg (10.5 umol, 1.5 eq, sourced from Dr. Reddys) 40 kDa methoxy poly(ethylene glycol) maleimido propionamide in 9 ml citrate buffer of pH 4 over night at room ature. The crude reaction mixture was injected in two portions onto a ative HPLC system with a enex Luna 10p Proteo C5 100A AXIA 250 mm x 21.2 mm column and chromatographed with a water/acetonitrile (both with 0.1% TFA) gradient. The fractions were collected in test tubes of 20 ml on an automated fraction collector. To ensure sufficient acidity each vial was filled with 0.5 ml acetic acid prior to collection.

ADM(2-52), which is the side product of example 15A and which did not undergo PEGylation in this reaction, as well as unreacted PEG were removed tely.

All fractions ning example 1 were combined. itrile was partially removed on a rotary evaporator at 30°C water bath temperature and approx. 50 mbar for approx. 30 min.

After addition of 0.5 ml acetic acid, the remaining on was lyophilized. The total yield of example 1 was 109 mg (2.35 umol, 33% of theory).

HPLC (method 3): Rt = 4.23 — 4.30 min Example 2 O- { [(3 -N-Methyl-amino( {(2R)— 1 —amino—3-[(2,5-dioxo— 1 - {3 -oxo-3—[(2— {m-methoxy—poly— oxyethylen[40kDa] } amino]propyl}pyrrolidinyl)sulfanyl]-1 opan-2—yl} amino)-4— oxobutyl]carbamoyl}-L-tyrosyl-adrenomedullin(2-52) :fw‘ ALA/km: 1 52 Y N_RQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY—NH2 mg of the crude peptide of e 16A were stirred with 145 mg (3.58 umol, 1.5 eq, sourced from Dr. Reddys) 40 kDa methoxy poly(ethylene glycol) maleimido propionamide in 5 ml citrate buffer of pH 4 over night at room temperature. The crude reaction mixture was injected onto a preparative HPLC system with a Phenomenex Jupiter 1011 C18 300A 250 mm x 21.2 mm column and chromatographed with a water/acetonitrile (both with 0.1% TFA) gradient. The fractions were collected in test tubes of 20 ml on an automated on collector. To ensure sufficient acidity each Vial was filled with 0.5 ml acetic acid prior to collection.

ADM(2-52), which is the side product of example 16A and which did not undergo PEGylation in this reaction, as well as unreacted PEG were removed completely.

All fractions containing example 2 were combined. Acetonitrile was partially removed on a rotary evaporator at 30°C water bath temperature and approx. 50 mbar for . 30 min.

After addition of 0.5 ml acetic acid, the remaining solution was lyophilized. The total yield of example 2 was 50 mg (1.08 umol, 43% of theory).

HPLC (method 4): Rt = 2.02 — 2.08 min Example 3 O-{[(4S)—4-Amino({(2R)—1-amino—3-[(2,5-dioxo-1 — {3—oxo—3 -[(2— {m—methoxy—poly— oxyethylen[40kDa] } ethyl)amino]propyl}pyrrolidinyl)sulfanyl] - 1 —oxopropan-2—yl} amino)—5— oxopentyl]carbamoy1} -L-tyrosyl—adrenomedullin(2—52) O/lLNM"Ojj’NHZ fl; /PEG 40kDa -OCH3 1 Rf 52 Y N—RQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY—NH2 mg of the crude peptide of example 17A were stirred with 145 mg (3.58 umol, 1.5 eq, sourced from Dr. Reddys) 40 kDa methoxy poly(ethylene glycol) maleimido namide in 5 ml citrate buffer of pH 4 over night at room temperature. The crude reaction mixture was injected onto a preparative HPLC system with a Phenomenex Jupiter 10p, Proteo 90A AXlA 250 mm x 21.2 mm column and chromatographed with a water/acetonitrile (both with 0.1% TFA) gradient. The fractions were collected in test tubes of 20 ml on an automated on tor. To ensure sufficient acidity each vial was filled with 0.5 ml acetic acid prior to collection. 52), which is the side product of example 17A and which did not undergo tion in this reaction, as well as unreacted PEG were removed completely.

All fractions containing example 3 were combined. Acetonitrile was lly d on a rotary evaporator at 30°C water bath temperature and approx. 50 mbar for approx. 30 min.

After addition of 0.5 ml acetic acid, the remaining solution was lyophilized. The total yield of example 3 was 19.5 mg (0.42 umol, 17% of theory).

HPLC (method 4): Rt = 2.02 — 2.08 min WO 64508 B. Assessment of pharmacological activity The suitability of the compounds according to the invention for treatment of diseases can be demonstrated using the following assay systems: 1) Test descriptions {in vitro) la) Tests on a recombinant adrenomedullin-receptor reporter cell The activity of the compounds according to the invention is quantified with the aid of a recombinant Chinese hamster ovary (CHO) cell line that carries the human adrenomedullin- receptor. tion of the receptor by ligands can be measured by in luminescence.

Construction of the cell line and measurement procedure has been described in detail [Wunder F., n A., Geerts A, and Kalthof B., Mol Pharmacol, 73, 123 5—1243 (2008)]. In brief: Cells are seeded on opaque 384-well microtiter plates at a density of 4000 cells/well and are grown for 24 h.

After removal of e medium, cells are loaded for 3 h with 0.6 ug/ml coelenterazine in Ca2+- free Tyrode solution (130 mM sodium chloride, 5 mM potassium chloride, 20 mM S (4—(2— hydroxyethyl)—1-piperazineethanesulfonic acid), 1 mM magnesium chloride, and 4.8 mM sodium hydrogen carbonate, pH 7.4) mented with 0.2 mM utyl-l-methylxanthine (IBMX) in a cell culture incubator. Compounds are added for 6 min in calciumztfree Tyrode solution containing 0.1% bovine serum albumin. Immediately before adding calcium2+ to a final concentration of 3 mM measurement of the aequorin luminescence is started by use of a suitable luminometer. Luminescence is measured for 60 s. In a typical experiment compounds are tested in a concentration range of l x 10'13 to 3 x 10'6 M.

In order to determine the release of active adrenomedullin from compounds according to the invention, compounds are incubated at different trations for different time spans up to 24 h in Tyrode solution supplemented with fetal calf serum, cell culture medium or plasma from different species at pH 7.4. Calcium2+ content of the tive incubation media is buffered by addition of 4 mM EDTA (ethylene diamine tetraacetic acid) before adding samples to the adrenomedullin-receptor reporter cell.

After appropriate preincubation, the embodiment es activate the adrenomedullin-receptor reporter cell more potently than before preincubation. This is indicated by the fact that ECso values are ined by a factor of up to 10 smaller after preincubation than before and is explainable by the relase of active adrenomedullin from the compounds.

Representative ECso values for the ment examples before and after incubation for 24 h in buffer supplemented with 2.5% fetal calf serum are given in the following Table 1: Table l Example no. EC50 T = 0 h [nM] ECso T = 24 h [nM] 0.5 2.5 110 8.4 > 1000 161 124 I 12.3 1b) Transcellular electrical resistance assays in endothelial cells The activity of the compounds according to the invention is terized in in permeability assays in human umbilical venous cells (HUVEC, Lonza). By use of the ECIS apparatus (ECIS: ic Cell—substrate Impedance Sensing; Applied Biophysics Inc; Troy, NY) changes of transendothelial electrical resistance (TEER) over an endothelial monolayer are continuously ed by use of a small gold electrode on which the cells have been seeded. I-IUVEC are grown on the 96-well sensor electrode plates (96W1E, Ibidi GmbH, Martinsried) to confluent monolayers and hyperpermeability can be induced by inflammatory stimuli such as Thrombin, TNF-(x, IL-lB, VEGF, Histamine and hydrogen peroxide which all have been demonstrated to cause break down of elial cell contacts and reduction of TEER. Thrombin is used at a final concentration of 0.5 U/ml. Test compounds are added before or after addition of thrombin. In a typical experiment compounds are tested in a concentration range of l X 10'10 to 1 x 10'6 M.

The embodiment examples inhibit the thrombin d hyperpermeability in this test at concentrations of S 10'6 M. 1c) In vino-permeability assays in endothelial cells In another in vitro model of endothelial hyperpermeability the activity of compounds according to the invention is examined with respect to modulation of olecular permeability. Human umbilical vein endothelial cells (HUVECS) are grown to ency on fibronectin-coated Transwell® filter membranes ll plates, 6.5 mm—inserts with 0.4 uM polycarbonate membrane; Costar #3413) which separate an upper from a lower tissue culture chamber with endothelial cells growing on the bottom of the upper chamber. The medium of the upper chamber is supplemented with 250 ug/ml of 40 kDa FlTC—Dextran (lnvitrogen, D1844). Hyperperrneability of the yer is induced by on of thrombin to a final concentration of 0.5 U/ml. Medium samples are collected from the lower chamber every 30 min and relative fluorescence as a parameter for changes of macromolecular permeability over time is measured in a suitable fluorimeter. Thrombin challenge induces almost a doubling of FITC-dextran transition across the elial monolayers. In a typical experiment compounds are tested in a concentration range of l x 10'10 to 1x 10'6 M.

The embodiment examples inhibit the thrombin induced hyperpermeability in this test at concentrations of S 10'6 M. 2. Test descriptions {in viva) 2a) Measurement of blood pressure and heart rate in telemetered, normotensive Wistar rats The cardiovascular effects induced by nds ing to the invention are investigated in freely moving conscious female Wistar rats (body weight > 200 g) by radiotelemetric measurement of blood pressure and heart rate. , the telemetric system (DSI Data Science International, MN, USA) is composed on 3 basic elements: implantable transmitters (TAl lPA—C40), receivers (RA1010) and a computer-based acquisition software (DataquestTM A.R.T. 4.1 for Windows). Rats are instrumented with pressure ts for chronic use at least 14 days prior to the experiments.

The sensor er is tied with 4—0 suture several times to produce a stopper 0.5 cm from the tip of the catheter. During catheter implantation rats are anesthetized with pentobabital tal, Sanofi: 50 mg/kg i.p.). After shaving the abdominal skin, a midline abdominal incision is made, and the illed sensor catheter is ed upstream into the exposed descending aorta between the iliac bifurcation and the renal es. The catheter is tied several times at the stopper. The tip of the telemetric catheter is located just caudal to the renal es and secured by tissue adhesive.

The transmitter body is affixed to the inner peritoneal wall before closure of abdomen. A two-layer closure of the abdominal incision is used, with individual suturing of the peritoneum and the muscle wall followed by closure of the outer skin. For postsurgical protection against infections and pain a single dosage of an antibiotic (Oxytetracyclin 10% R, 5.0 ml/kg s.c., beta-pharma GmbH&Co, Germany) and analgesic is injected (Rimadyl R, 5.0 ml/kg s.c., , y). The hardware uration is equipped for 24 animals. Each rat cage is positioned on top of an individual receiver platform. After activation of the implanted transmitters, an on-line data acquisition system, samples data and converts telemetric pressure signals to mm Hg. A barometric 2012/071507 pressure reference allows for relation of te pressure (relative to vacuum) to ambient atmospheric pressure. Data acquisition software is predefined to sample hemodynamic data for 10— s intervals every 5 minutes. Data collection to file is started 2 hours before administration of test compounds and finished after completion of 24-h . In a typical experiment test compounds are administered as bolus either subcutaneously or intravenously at does of 1 to 1000 jig/kg body weight (as ed to the peptide component).

Wild type adrenomedullin (Bachem, H—2932) induces blood re reduction in this test with on ofS 4 h when tested at doses of S 300 ug/kg body weight [Figure 1].

Figge 1: 24 hour s of mean arterial blood pressure (MABP) recorded from telemeterd normotensive female Wistar rats after subcutaneous stration ofADM or vehicle as indicated (dotted line). Data points were plotted as means :t SEM of averaged 30 min intervals from 4 animals per group. One hour after administration animals d with ADM showed a mean reduction of MABP of almost 20% at peak (filled circles). After about 3.5 hours MABP had returned to base line levels and was in the range of that of vehicle treated animals (open circles).

In this test substances according to the present invention induce blood pressure reduction of up to h at doses of S 500 ug/kg body weight (as referred to the peptide component) [Figure 2].

Figge 2: 24 hour s of mean arterial blood pressure (MABP) recorded from telemeterd norrnotensive female Wistar rats after subcutaneous administration of example 1 or vehicle as indicated (dotted line). Data points were plotted as means :1: SEM of averaged 30 min intervals from 6 animals per group. Administration of example 1 at a dose of 150 jig/kg (as referred to the peptide ent) reduced MABP by about 15 to 19% until 6 h after administration (filled circles). Between 6 h and 14 h after administration MABP gradually returned to baseline values and finally was in the range of that of vehicle treated animals. 2b) Skin ar leak assay in Wistar rats An intracutaneous histamine challenge test is employed to assess the effect of compounds according to the invention on vascular barrier function in healthy animals. Male Sprague Dawley rats (body weight >200 g) are anesthetized with isoflurane (2%-3% in ambient air) and brought into supine on. The abdomen is shaved and a catheter is inserted into the femoral vein.

Vehicle only (05an PBS + 0.1% bovine serum albumin) or test compounds at appropriate doses are administered as i.v. bolus injections. After 15 min a second injection of 100 Ill/kg 2% Evans blue (Sigma) solution is administered and immediately thereafter 100 pl of histamine solutions of appropriate concentrations (for example 0 — 2.5 — 5 — 10 — 20 — 40 ug/ml) are injected WO 64508 intracutaneously into the abdominal skin. Evans blue is a highly plasma protein bound dye and therefore used as an tor for protein-rich fluid extravasation and ar leakage. 30 min after this procedure the rats are sacrificed by an overdose of isoflurane and subsequent neck dislocation and the abdominal skin is excised. The wheals are excised by use of an 8 mm biopsy punch, the tissue samples are ed and transferred to formamide for 48 h in order to extract the Evans blue. Samples are measured at 620 nM and 750 nM wavelength on a suitable photometer and Evans blue content of the samples is corrected for heme pigments according to the formula A620 (corrected) = A620 - (1.426 X A750 + 0.030) and calculated against a standard curve. [method adapted from Wang L.F., Patel M., Razavi H.M., r S., Joseph M.G., ack D.G., Mehta 8., Am . Respir Crit Care Med, 165(12), 1634-9 ].

Substances according to the present invention reduce extravasation of protein rich plasma fluid induced by histamine nge in this test. 2c) Intra-tracheal instillation of LPS in mice An intra—tracheal nge with lipopolysaccharide (LPS) is employed to examine the effects of compounds according to the invention on acute lung injury. Male BALB/c mice (average animal weight 20-23 g) are anesthetized with isoflurane (7%) and LPS from E. coli (e.g. serotype 055:35; Sigma) is instilled in 100 pl saline by use of a micropipette. Typical doses of LPS used for challenge are in the range of l to 10 mg/kg body weight. At different time points before and after instillation test compounds are administered by the subcutaneous route. Typical doses are in the range of l to 300 ug/kg body weight. In this test typical time points of administration of test compounds are 15 min before or 1 h after LPS challenge. 48 hours after instillation of LPS mice are deeply anesthetized with isoflurane and sacrificed by dislocation of the neck. After cannulation of the trachea lavage of the bronchoalveolar space with 0.5 ml ice-cold saline is performed. Lungs are prepared and weighted. Cells in the bronchoalveolar lavage fluid (BALF) are counted on a cell counter (Cell Dyn 3700, Abbott). In this test lung weight as a measure for lung edema is reproducibly found to be increased by about 50% or more over sham controls 48 hours after LPS challenge. As lung s show only very low variability in the groups, the absolute lung weight is used as parameter. The counts for white blood cells are always found to be significantly increased over control in the BALF after LPS challenge.

Administration of substances according to the present invention resulted in icantly reduced lung weight and white blood cell counts in the BALF after 48 h when administered as bolus at doses 5 300 ug/kg body weight (as referred to the e component). 2d) Induction of acute lung injury in mini pigs Acute lung injury is induced in anesthetized mini pigs by use of lipopolysaccharide (LPS) or oleic acid as challenges. In detail: female Gettingen minipigs of ca. 3.5 to 5.5 kg body weight (Ellegaard, Denmark) are kept anesthetized by an continuous i.v.-infusi0n of Ketavet®, Dormicum® and Pancuronium® after premedication with an intramuscular injection of Ketavet®/ Stresnil®. After intratracheal intubation animals are artificially ventilated using a pediatric respirator (Sulla 808V; Drager, Germany) with an oxygen air e at a tidal volume of 30 to 50 ml and constant frequency of 25 min]. Arterial PaCOZ is adjusted to about 40 mmHg by regulating the fraction of inspired oxygen (FiOz) via the ratio of oxygen air mixture. Routinely the ing cardiovascular and respiratory parameters are measured after placement of necessary probes and catheters fitted to appropriate pressure transducers and recording equipment: central venous pressure (Via left jugular vein), arterial blood pressure and heart rate (BP and HR; via left carotid artery), left ventricular pressure (LVP; using a Millar er [FMI, Mod.:SPC-34OS, REF: 800- 2019-1, 4F] introduced into the left ventricle Via right carotid artery), pulmonary arterial pressure (PAP; using ARROW Berman angiographic balloon catheter [REF.: AI—07134 4 Fr. 500m] placed into the pulmonary artery via left jugular vein), c output (CO) and extravascular lung water index ) by use of the PiCCO system (Pulsion, y) ted to a Pulsion 4F Thermodilution—catheter (PV2014L08N) placed into the right femoral artery. Catheters for measurement of CVP, BP, HR, LVP, and PAP are fitted to a Ponemah recording system. Arterial blood gas analysis is performed to ine the Pa02/F102. According to the American-European Consensus Conference on ARDS a i02 < 300 mmHg is considered as indicative for the presence of acute lung injury. Dependent on the d protocol duration of ments varied n 4 and 5 hours after administration of lung injury inducing challenge. At the end of experimentation pigs are sacrificed by exsanguination and bronchoalveolar lavage fluid (BALF) is collected from lungs. Cellular content of BALF is determined by use of a blood cell counter (Cell DYN 3700).

In a typical setting acute lung injury is induced by intratracheal lation of Lipopolysaccharide (LPS; E. coli 0111:B4; Sigma L2630) in saline at a dose of 5mg/kg body weight into each lung Via the endotracheal tube. PAP and EVWLI increased while i02 decreased below 300 mran in response to the challenge. The cellular content of BALF is significantly increased. Administration of compound 1 of this ion as olus 15 min before the LPS challenge ameliorated or prevented the LPS induced changes.

In an other protocol oleic acid (0A; Sigma-Aldrich, 01008) diluted with ethanol (1:1) is infused i.v. over 15 min at a final dose of 100 mg/kg body weight. Challenge with GA led to increase of PAP and EVLWI and decrease of PaOz/Fi02 below 300 mmHg. Changes are ameliorated or prevented by administration of compound 1 of this invention 15 min before start of the OA infusion.

Doses of example 1 S 30 ug/kg body weight (as referred to the e component) were found to be active in the described test systems.

C. Exemplary embodiments of pharmaceutical compositions The compounds according to the invention can be converted into pharmaceutical preparations in the following ways: i.v. solution: A nd according to the invention is dissolved at a concentration below saturation solubility in a physiologically acceptable solvent (for example s of pH 4 to pH 7, isotonic sodium chloride solution, glucose solution 5% and/or PEG 400 solution 30%). The solution is sterilized by filtration and filled into sterile and pyrogen—free injection containers. s.c. solution: A nd according to the invention is dissolved at a concentration below saturation solubility in a physiologically able solvent (for example for example buffers of pH 4 to pH 7, isotonic sodium chloride solution, glucose solution 5% and/or PEG 400 solution 30%). The solution is sterilized by ion and filled into sterile and pyrogen—free injection containers.

Claims (12)

1.Claims

2.A compound of the formula 0 R2 N Nf N n 0 NH2 (I), 1 2 Y ”—RQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH21 in which 5 n represents the number 0, 1, 2 or 3, R1 represents hydrogen, , ethyl, n-propyl or isopropyl, R2 represents linear or branched PEG 20kDa to 80kDa endcapped with a methoxy— group, or one of the salts f, solvates thereof or the es of salts thereof. 10 2. A compound as claimed in claim 1, characterized in that n represents the number 1 or 2, R1 represents en or methyl, R2 represents linear PEG 40kDa endcapped with a methoxy-group.

3. A compound as claimed in either of claims 1 and 2, characterized in that 15 n represents the number 1 or 2, R1 represents hydrogen, R2 represents linear PEG 40kDa endcapped with a methoxy—group.

4. A process for preparing a nd of the formula (I) or one of the salts thereof, solvates thereof or the solvates of salts thereof as claimed in claim 1, characterized in that a compound of the formula (II) i HN’ H MM”H“H 0 NH2 (H), 1 2 52 Y N~RQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 H L__J in which n and R1 are each as defined in claim 1, is reacted with a compound of the a (H1) in which R2 is as defined in claim 1.

5.A compound as claimed in any of claims 1 to 3 for ent and/or prevention of diseases.

6.The use of a compound as claimed in any of claims 1 to 3 for producing a medicament for treatment and/or prevention of diseases.

7.The use of a compound as claimed in any of claims 1 to 3 for producing a medicament for ent and/or tion of cardiovascular, edematous and/or inflammatory disorders.

8.A medicament comprising a compound as claimed in any of claims 1 to 3 in combination 15 with an inert nontoxic pharmaceutically suitable excipient.

9.A medicament comprising a compound as d in any of claims 1 to 3 in combination with a further active ingredient.

10. The medicament as claimed in claim8 or 9 for treatment and/or prevention of cardiovascular, edematous and/or inflammatory disorders.

11.ll. The use of a compound as claimed in any of claims 1 to 3 for ing a medicament for treatment and/or prevention of heart e, ry heart e, ischemic and/or hemorrhagic stroke, hypertension, pulmonary hypertension, peripheral arterial occlusive disease, pre-eclampsia, chronic obstructive pulmonary disease, asthma, acute and/or chronic pulmonary edema, allergic alveolitis and/or pneumonitis due to inhaled organic dust and particles of fungal, mycetic or other origin, and/or acute chemical bronchitis, acute and/or chronic chemical pulmonary edema, neurogenic pulmonary edema, acute and/or chronic pulmonary manifestations due to radiation, acute and/or 10 chronic interstitial lung disorders, acute lung injury/acute respiratory distress syndrome (ALI/ARDS) in adult or child including newborn, ALI/ARDS secondary to pneumonia and sepsis, aspiration pneumonia and DS ary to aspiration, ALI/ARDS secondary to smoke gas inhalation, transfusion-related acute lung injury (TRALI), ALI/ARDS and/or acute pulmonary insufficiency following surgery, trauma and/or burns, 15 and/or ventilator d lung injury (VILI), lung injury following meconiurn aspiration, pulmonary fibrosis, in sickness, chronic kidney diseases, glomerulonephritis, acute kidney injury, cardiorenal syndrome, lyrnphedema, atory bowel disease, sepsis, septic shock, systemic inflammatory response me (SIRS) of non-infectious origin, anaphylactic shock, inflammatory bowel e and/or urticaria. 20

12. A compound as defined in any of claims 1 to 3 for use in a process for treatment and/or prevention of cardiovascular, edematous and/or inflammatory disorders. -