NZ621037B2 - Genes and proteins for alkanoyl-coa synthesis - Google Patents
Genes and proteins for alkanoyl-coa synthesis Download PDFInfo
- Publication number
- NZ621037B2 NZ621037B2 NZ621037A NZ62103712A NZ621037B2 NZ 621037 B2 NZ621037 B2 NZ 621037B2 NZ 621037 A NZ621037 A NZ 621037A NZ 62103712 A NZ62103712 A NZ 62103712A NZ 621037 B2 NZ621037 B2 NZ 621037B2
- Authority
- NZ
- New Zealand
- Prior art keywords
- nucleic acid
- coa
- acid molecule
- cell
- cannabinoid
- Prior art date
Links
- 230000015572 biosynthetic process Effects 0.000 title claims description 51
- 230000002194 synthesizing Effects 0.000 title claims description 35
- 238000003786 synthesis reaction Methods 0.000 title claims description 28
- 102000004169 proteins and genes Human genes 0.000 title description 18
- 108090000623 proteins and genes Proteins 0.000 title description 18
- 230000002149 cannabinoid Effects 0.000 claims abstract description 83
- 229930003827 cannabinoid Natural products 0.000 claims abstract description 83
- 239000003557 cannabinoid Substances 0.000 claims abstract description 83
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 65
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 60
- 210000001519 tissues Anatomy 0.000 claims abstract description 46
- 150000001875 compounds Chemical class 0.000 claims abstract description 35
- 229920001184 polypeptide Polymers 0.000 claims abstract description 28
- 230000000694 effects Effects 0.000 claims abstract description 17
- 102000004190 Enzymes Human genes 0.000 claims description 49
- 108090000790 Enzymes Proteins 0.000 claims description 49
- 238000000034 method Methods 0.000 claims description 47
- 230000014509 gene expression Effects 0.000 claims description 41
- OEXFMSFODMQEPE-HDRQGHTBSA-N hexanoyl-CoA Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCSC(=O)CCCCC)O[C@H]1N1C2=NC=NC(N)=C2N=C1 OEXFMSFODMQEPE-HDRQGHTBSA-N 0.000 claims description 29
- QHXNJIMVPAFCPR-UHFFFAOYSA-N 5-(3,5-dihydroxyphenyl)pentanoic acid Chemical compound OC(=O)CCCCC1=CC(O)=CC(O)=C1 QHXNJIMVPAFCPR-UHFFFAOYSA-N 0.000 claims description 26
- 229920001850 Nucleic acid sequence Polymers 0.000 claims description 26
- 239000005516 coenzyme A Substances 0.000 claims description 26
- 229940093530 Coenzyme A Drugs 0.000 claims description 24
- 150000003881 polyketide derivatives Chemical class 0.000 claims description 21
- 229930001119 polyketides Natural products 0.000 claims description 21
- 101710019888 OLS Proteins 0.000 claims description 20
- 150000001732 carboxylic acid derivatives Chemical class 0.000 claims description 15
- 240000004808 Saccharomyces cerevisiae Species 0.000 claims description 13
- 230000037361 pathway Effects 0.000 claims description 12
- 230000001743 silencing Effects 0.000 claims description 11
- 108020004705 Codon Proteins 0.000 claims description 10
- 229920002676 Complementary DNA Polymers 0.000 claims description 9
- 230000001851 biosynthetic Effects 0.000 claims description 9
- 238000006243 chemical reaction Methods 0.000 claims description 9
- 238000000338 in vitro Methods 0.000 claims description 9
- 230000002018 overexpression Effects 0.000 claims description 9
- 244000005700 microbiome Species 0.000 claims description 8
- UVOLYTDXHDXWJU-NRFANRHFSA-N Cannabichromene Natural products C1=C[C@](C)(CCC=C(C)C)OC2=CC(CCCCC)=CC(O)=C21 UVOLYTDXHDXWJU-NRFANRHFSA-N 0.000 claims description 6
- 241000588724 Escherichia coli Species 0.000 claims description 6
- 108010075293 cannabidiolic acid synthase Proteins 0.000 claims description 6
- 239000002299 complementary DNA Substances 0.000 claims description 6
- WVOLTBSCXRRQFR-SJORKVTESA-N Cannabidiolic acid Natural products OC1=C(C(O)=O)C(CCCCC)=CC(O)=C1[C@@H]1[C@@H](C(C)=C)CCC(C)=C1 WVOLTBSCXRRQFR-SJORKVTESA-N 0.000 claims description 5
- 108010002861 cannabichromenic acid synthase Proteins 0.000 claims description 5
- WVOLTBSCXRRQFR-DLBZAZTESA-N cannabidiolic acid Chemical compound OC1=C(C(O)=O)C(CCCCC)=CC(O)=C1[C@H]1[C@H](C(C)=C)CCC(C)=C1 WVOLTBSCXRRQFR-DLBZAZTESA-N 0.000 claims description 5
- QHMBSVQNZZTUGM-MSOLQXFVSA-N Cannabidiol Natural products OC1=CC(CCCCC)=CC(O)=C1[C@@H]1[C@@H](C(C)=C)CCC(C)=C1 QHMBSVQNZZTUGM-MSOLQXFVSA-N 0.000 claims description 4
- QHMBSVQNZZTUGM-ZWKOTPCHSA-N Cannabidiol Chemical compound OC1=CC(CCCCC)=CC(O)=C1[C@H]1[C@H](C(C)=C)CCC(C)=C1 QHMBSVQNZZTUGM-ZWKOTPCHSA-N 0.000 claims description 4
- 229950011318 Cannabidiol Drugs 0.000 claims description 4
- 125000004432 carbon atoms Chemical group C* 0.000 claims description 4
- 230000001965 increased Effects 0.000 claims description 4
- HRHJHXJQMNWQTF-UHFFFAOYSA-N 5-hydroxy-2-methyl-2-(4-methylpent-3-enyl)-7-pentylchromene-6-carboxylic acid Chemical compound O1C(C)(CCC=C(C)C)C=CC2=C1C=C(CCCCC)C(C(O)=O)=C2O HRHJHXJQMNWQTF-UHFFFAOYSA-N 0.000 claims description 3
- 108060000514 aromatic prenyltransferase family Proteins 0.000 claims description 3
- SEEZIOZEUUMJME-VBKFSLOCSA-N Cannabigerolic acid Natural products CCCCCC1=CC(O)=C(C\C=C(\C)CCC=C(C)C)C(O)=C1C(O)=O SEEZIOZEUUMJME-VBKFSLOCSA-N 0.000 claims description 2
- GVVPGTZRZFNKDS-YFHOEESVSA-N Geranyl diphosphate Natural products CC(C)=CCC\C(C)=C/COP(O)(=O)OP(O)(O)=O GVVPGTZRZFNKDS-YFHOEESVSA-N 0.000 claims description 2
- GVVPGTZRZFNKDS-JXMROGBWSA-N Geranyl pyrophosphate Chemical compound CC(C)=CCC\C(C)=C\CO[P@](O)(=O)OP(O)(O)=O GVVPGTZRZFNKDS-JXMROGBWSA-N 0.000 claims description 2
- 102000013404 Geranyltranstransferase Human genes 0.000 claims description 2
- 108010026318 Geranyltranstransferase Proteins 0.000 claims description 2
- 101700083699 HIS6 Proteins 0.000 claims description 2
- SEEZIOZEUUMJME-FOWTUZBSSA-N cannabigerolic acid Chemical compound CCCCCC1=CC(O)=C(C\C=C(/C)CCC=C(C)C)C(O)=C1C(O)=O SEEZIOZEUUMJME-FOWTUZBSSA-N 0.000 claims description 2
- 230000003247 decreasing Effects 0.000 claims description 2
- 101710008935 hisHF Proteins 0.000 claims description 2
- SXFKFRRXJUJGSS-UHFFFAOYSA-N olivetolic acid Chemical compound CCCCCC1=CC(O)=CC(O)=C1C(O)=O SXFKFRRXJUJGSS-UHFFFAOYSA-N 0.000 claims description 2
- 241000218236 Cannabis Species 0.000 claims 6
- 125000003275 alpha amino acid group Chemical group 0.000 claims 4
- 239000007850 fluorescent dye Substances 0.000 claims 2
- 241000196324 Embryophyta Species 0.000 description 50
- 210000004027 cells Anatomy 0.000 description 46
- 241000638023 Cannabis sativa subsp. indica Species 0.000 description 26
- 229940088598 Enzyme Drugs 0.000 description 23
- 150000001413 amino acids Chemical group 0.000 description 21
- 230000037348 biosynthesis Effects 0.000 description 18
- 240000000218 Cannabis sativa Species 0.000 description 17
- 239000000758 substrate Substances 0.000 description 17
- 238000004166 bioassay Methods 0.000 description 15
- PEDCQBHIVMGVHV-UHFFFAOYSA-N glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 15
- 108090000364 Ligases Proteins 0.000 description 14
- 102000003960 Ligases Human genes 0.000 description 14
- OZAIFHULBGXAKX-UHFFFAOYSA-N precursor Substances N#CC(C)(C)N=NC(C)(C)C#N OZAIFHULBGXAKX-UHFFFAOYSA-N 0.000 description 14
- FAPWRFPIFSIZLT-UHFFFAOYSA-M sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 14
- 229940065144 cannabinoids Drugs 0.000 description 13
- 102100000060 ACSF3 Human genes 0.000 description 12
- 235000008697 Cannabis sativa Nutrition 0.000 description 12
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 12
- 108010089734 malonyl-CoA synthetase Proteins 0.000 description 12
- 239000002773 nucleotide Substances 0.000 description 12
- 239000007995 HEPES buffer Substances 0.000 description 11
- 125000003729 nucleotide group Chemical group 0.000 description 11
- 230000001131 transforming Effects 0.000 description 11
- RAXXELZNTBOGNW-UHFFFAOYSA-N Imidazole Chemical compound C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 10
- 238000004519 manufacturing process Methods 0.000 description 10
- 239000000047 product Substances 0.000 description 10
- 108020004999 Messenger RNA Proteins 0.000 description 9
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L MgCl2 Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 9
- 230000025458 RNA interference Effects 0.000 description 9
- QTBSBXVTEAMEQO-UHFFFAOYSA-N acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 9
- FUZZWVXGSFPDMH-UHFFFAOYSA-M caproate Chemical compound CCCCCC([O-])=O FUZZWVXGSFPDMH-UHFFFAOYSA-M 0.000 description 9
- 238000009396 hybridization Methods 0.000 description 9
- 229920002106 messenger RNA Polymers 0.000 description 9
- 230000035772 mutation Effects 0.000 description 9
- 230000002987 rna-interference Effects 0.000 description 9
- ZKHQWZAMYRWXGA-KQYNXXCUSA-N Adenosine triphosphate Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O ZKHQWZAMYRWXGA-KQYNXXCUSA-N 0.000 description 8
- 229920001439 Artificial microRNA Polymers 0.000 description 8
- 102000014961 Protein Precursors Human genes 0.000 description 8
- 108010078762 Protein Precursors Proteins 0.000 description 8
- 239000000203 mixture Substances 0.000 description 8
- UDWXLZLRRVQONG-UHFFFAOYSA-M sodium;hexanoate Chemical compound [Na+].CCCCCC([O-])=O UDWXLZLRRVQONG-UHFFFAOYSA-M 0.000 description 8
- 241000701489 Cauliflower mosaic virus Species 0.000 description 7
- 210000004671 Cell-Free System Anatomy 0.000 description 7
- JKMHFZQWWAIEOD-UHFFFAOYSA-N HEPES Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 7
- 238000004458 analytical method Methods 0.000 description 7
- 230000000692 anti-sense Effects 0.000 description 7
- 231100000350 mutagenesis Toxicity 0.000 description 7
- 239000011780 sodium chloride Substances 0.000 description 7
- 241000589158 Agrobacterium Species 0.000 description 6
- XEKOWRVHYACXOJ-UHFFFAOYSA-N acetic acid ethyl ester Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 6
- UIIMBOGNXHQVGW-UHFFFAOYSA-M buffer Substances [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 6
- 230000004927 fusion Effects 0.000 description 6
- 238000002703 mutagenesis Methods 0.000 description 6
- 239000011347 resin Substances 0.000 description 6
- 229920005989 resin Polymers 0.000 description 6
- 238000006467 substitution reaction Methods 0.000 description 6
- 230000028604 virus induced gene silencing Effects 0.000 description 6
- 229920000160 (ribonucleotides)n+m Polymers 0.000 description 5
- WBYWAXJHAXSJNI-VOTSOKGWSA-M .beta-Phenylacrylic acid Natural products [O-]C(=O)\C=C\C1=CC=CC=C1 WBYWAXJHAXSJNI-VOTSOKGWSA-M 0.000 description 5
- 241000219194 Arabidopsis Species 0.000 description 5
- WWZKQHOCKIZLMA-UHFFFAOYSA-N Caprylic acid Chemical compound CCCCCCCC(O)=O WWZKQHOCKIZLMA-UHFFFAOYSA-N 0.000 description 5
- ZNJFBWYDHIGLCU-HWKXXFMVSA-N Jasmonic acid Chemical compound CC\C=C/C[C@@H]1[C@@H](CC(O)=O)CCC1=O ZNJFBWYDHIGLCU-HWKXXFMVSA-N 0.000 description 5
- 239000002253 acid Substances 0.000 description 5
- 125000003822 aromatic polyketide group Chemical group 0.000 description 5
- 229930014544 aromatic polyketides Natural products 0.000 description 5
- 235000009120 camo Nutrition 0.000 description 5
- -1 carboxylic acid compounds Chemical class 0.000 description 5
- 150000001735 carboxylic acids Chemical class 0.000 description 5
- 235000005607 chanvre indien Nutrition 0.000 description 5
- 238000010367 cloning Methods 0.000 description 5
- 238000005755 formation reaction Methods 0.000 description 5
- 235000012765 hemp Nutrition 0.000 description 5
- 235000012766 marijuana Nutrition 0.000 description 5
- 239000002609 media Substances 0.000 description 5
- 201000001997 microphthalmia with limb anomalies Diseases 0.000 description 5
- 230000002829 reduced Effects 0.000 description 5
- 241000894007 species Species 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- UCONUSSAWGCZMV-OEMAIJDKSA-M (6aR)-2-carboxy-6,6,9-trimethyl-3-pentyl-6a,7,8,10a-tetrahydrobenzo[c]chromen-1-olate Chemical compound C([C@H]1C(C)(C)O2)CC(C)=CC1C1=C2C=C(CCCCC)C(C([O-])=O)=C1O UCONUSSAWGCZMV-OEMAIJDKSA-M 0.000 description 4
- 101700063671 ACOX2 Proteins 0.000 description 4
- 101710026040 ACSS2 Proteins 0.000 description 4
- 102100017399 ACSS2 Human genes 0.000 description 4
- 241000589155 Agrobacterium tumefaciens Species 0.000 description 4
- 241000219195 Arabidopsis thaliana Species 0.000 description 4
- GHVNFZFCNZKVNT-UHFFFAOYSA-N Decanoic acid Chemical compound CCCCCCCCCC(O)=O GHVNFZFCNZKVNT-UHFFFAOYSA-N 0.000 description 4
- 229920002760 Expressed sequence tag Polymers 0.000 description 4
- 101710025751 Msed_0394 Proteins 0.000 description 4
- 230000000295 complement Effects 0.000 description 4
- 229920003013 deoxyribonucleic acid Polymers 0.000 description 4
- 239000011487 hemp Substances 0.000 description 4
- OKKJLVBELUTLKV-UHFFFAOYSA-N methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 4
- 229920000023 polynucleotide Polymers 0.000 description 4
- 239000002157 polynucleotide Substances 0.000 description 4
- RMJPDRUNCDRUQC-MCDZGGTQSA-M sodium;[[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-hydroxyphosphoryl] hydrogen phosphate Chemical compound [Na+].C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)([O-])=O)[C@@H](O)[C@H]1O RMJPDRUNCDRUQC-MCDZGGTQSA-M 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- LENZDBCJOHFCAS-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 3
- 108010030215 Coenzyme A Ligases Proteins 0.000 description 3
- 102000005870 Coenzyme A Ligases Human genes 0.000 description 3
- 241000282326 Felis catus Species 0.000 description 3
- 229920000272 Oligonucleotide Polymers 0.000 description 3
- 210000002824 Peroxisome Anatomy 0.000 description 3
- 102000018120 Recombinases Human genes 0.000 description 3
- 108010091086 Recombinases Proteins 0.000 description 3
- 108020004459 Small Interfering RNA Proteins 0.000 description 3
- 229920001891 Small hairpin RNA Polymers 0.000 description 3
- 150000007513 acids Chemical class 0.000 description 3
- 125000003118 aryl group Chemical group 0.000 description 3
- 238000009835 boiling Methods 0.000 description 3
- 230000003197 catalytic Effects 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- CYQFCXCEBYINGO-IAGOWNOFSA-N delta1-THC Chemical compound C1=C(C)CC[C@H]2C(C)(C)OC3=CC(CCCCC)=CC(O)=C3[C@@H]21 CYQFCXCEBYINGO-IAGOWNOFSA-N 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 229960004242 dronabinol Drugs 0.000 description 3
- 238000010828 elution Methods 0.000 description 3
- 230000002255 enzymatic Effects 0.000 description 3
- BDAGIHXWWSANSR-UHFFFAOYSA-N formic acid Chemical compound OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 3
- 238000003209 gene knockout Methods 0.000 description 3
- 229910000041 hydrogen chloride Inorganic materials 0.000 description 3
- 238000001764 infiltration Methods 0.000 description 3
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 3
- 230000014759 maintenance of location Effects 0.000 description 3
- 230000001404 mediated Effects 0.000 description 3
- 229920001239 microRNA Polymers 0.000 description 3
- 239000002679 microRNA Substances 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- 230000000858 peroxisomal Effects 0.000 description 3
- 230000032361 posttranscriptional gene silencing Effects 0.000 description 3
- 238000003753 real-time PCR Methods 0.000 description 3
- 238000005215 recombination Methods 0.000 description 3
- 230000001105 regulatory Effects 0.000 description 3
- 239000000523 sample Substances 0.000 description 3
- 230000004960 subcellular localization Effects 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- 101700080266 AAE Proteins 0.000 description 2
- ZSLZBFCDCINBPY-ZSJPKINUSA-N Acetyl-CoA Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCSC(=O)C)O[C@H]1N1C2=NC=NC(N)=C2N=C1 ZSLZBFCDCINBPY-ZSJPKINUSA-N 0.000 description 2
- ZSLZBFCDCINBPY-ZZSFXRQLSA-N Acetyl-CoA Natural products S(C(=O)C)CCNC(=O)CCNC(=O)[C@H](O)C(CO[P@@](=O)(O[P@](=O)(OC[C@@H]1[C@@H](OP(=O)(O)O)[C@H](O)[C@@H](n2c3ncnc(N)c3nc2)O1)O)O)(C)C ZSLZBFCDCINBPY-ZZSFXRQLSA-N 0.000 description 2
- 102000007469 Actins Human genes 0.000 description 2
- 108010085238 Actins Proteins 0.000 description 2
- 235000011297 Brassica napobrassica Nutrition 0.000 description 2
- 240000002791 Brassica napus Species 0.000 description 2
- 235000011293 Brassica napus Nutrition 0.000 description 2
- FERIUCNNQQJTOY-UHFFFAOYSA-N Butanoic acid Chemical compound CCCC(O)=O FERIUCNNQQJTOY-UHFFFAOYSA-N 0.000 description 2
- 241000701502 Carnation etched ring virus Species 0.000 description 2
- 210000000805 Cytoplasm Anatomy 0.000 description 2
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 2
- 239000003155 DNA primer Substances 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N HCl Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- FUZZWVXGSFPDMH-UHFFFAOYSA-N Hexanoic acid Chemical compound CCCCCC(O)=O FUZZWVXGSFPDMH-UHFFFAOYSA-N 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 241000229754 Iva xanthiifolia Species 0.000 description 2
- SBUJHOSQTJFQJX-NOAMYHISSA-N Kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 2
- 125000003412 L-alanyl group Chemical group [H]N([H])[C@@](C([H])([H])[H])(C(=O)[*])[H] 0.000 description 2
- 125000003338 L-glutaminyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C([H])([H])C(=O)N([H])[H] 0.000 description 2
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 2
- 125000002707 L-tryptophyl group Chemical group [H]C1=C([H])C([H])=C2C(C([C@](N([H])[H])(C(=O)[*])[H])([H])[H])=C([H])N([H])C2=C1[H] 0.000 description 2
- 102100003515 LYZ Human genes 0.000 description 2
- POULHZVOKOAJMA-UHFFFAOYSA-N Lauric acid Chemical compound CCCCCCCCCCCC(O)=O POULHZVOKOAJMA-UHFFFAOYSA-N 0.000 description 2
- 239000005089 Luciferase Substances 0.000 description 2
- 108060001084 Luciferase family Proteins 0.000 description 2
- 108010014251 Muramidase Proteins 0.000 description 2
- TUNFSRHWOTWDNC-UHFFFAOYSA-N Myristic acid Chemical compound CCCCCCCCCCCCCC(O)=O TUNFSRHWOTWDNC-UHFFFAOYSA-N 0.000 description 2
- FBUKVWPVBMHYJY-UHFFFAOYSA-N Nonanoic acid Chemical compound CCCCCCCCC(O)=O FBUKVWPVBMHYJY-UHFFFAOYSA-N 0.000 description 2
- IRMPFYJSHJGOPE-UHFFFAOYSA-N Olivetol Chemical compound CCCCCC1=CC(O)=CC(O)=C1 IRMPFYJSHJGOPE-UHFFFAOYSA-N 0.000 description 2
- IPCSVZSSVZVIGE-UHFFFAOYSA-N Palmitic acid Chemical compound CCCCCCCCCCCCCCCC(O)=O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 description 2
- 108010033725 Recombinant Proteins Proteins 0.000 description 2
- 102000007312 Recombinant Proteins Human genes 0.000 description 2
- 241000589194 Rhizobium leguminosarum Species 0.000 description 2
- 235000003534 Saccharomyces carlsbergensis Nutrition 0.000 description 2
- 229940081969 Saccharomyces cerevisiae Drugs 0.000 description 2
- 101700000807 THCAS Proteins 0.000 description 2
- 241000723573 Tobacco rattle virus Species 0.000 description 2
- GSEJCLTVZPLZKY-UHFFFAOYSA-N Tris Chemical compound OCCN(CCO)CCO GSEJCLTVZPLZKY-UHFFFAOYSA-N 0.000 description 2
- 239000007983 Tris buffer Substances 0.000 description 2
- 229920004890 Triton X-100 Polymers 0.000 description 2
- NQPDZGIKBAWPEJ-UHFFFAOYSA-N Valeric acid Chemical compound CCCCC(O)=O NQPDZGIKBAWPEJ-UHFFFAOYSA-N 0.000 description 2
- WEVYAHXRMPXWCK-UHFFFAOYSA-N acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 2
- 230000003213 activating Effects 0.000 description 2
- 238000007792 addition Methods 0.000 description 2
- 125000001931 aliphatic group Chemical group 0.000 description 2
- 125000000539 amino acid group Chemical group 0.000 description 2
- 230000003321 amplification Effects 0.000 description 2
- 230000001488 breeding Effects 0.000 description 2
- CRFNGMNYKDXRTN-CITAKDKDSA-N butyryl-CoA Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCSC(=O)CCC)O[C@H]1N1C2=NC=NC(N)=C2N=C1 CRFNGMNYKDXRTN-CITAKDKDSA-N 0.000 description 2
- GHVNFZFCNZKVNT-UHFFFAOYSA-M caprate Chemical compound CCCCCCCCCC([O-])=O GHVNFZFCNZKVNT-UHFFFAOYSA-M 0.000 description 2
- 125000001589 carboacyl group Chemical group 0.000 description 2
- 229930016911 cinnamic acid Natural products 0.000 description 2
- 235000013985 cinnamic acid Nutrition 0.000 description 2
- 239000003814 drug Substances 0.000 description 2
- 239000012149 elution buffer Substances 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 150000002185 fatty acyl-CoAs Chemical class 0.000 description 2
- ZHNUHDYFZUAESO-UHFFFAOYSA-N formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 2
- 230000030279 gene silencing Effects 0.000 description 2
- 230000002068 genetic Effects 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 2
- 230000000415 inactivating Effects 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl β-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 2
- 229960000318 kanamycin Drugs 0.000 description 2
- 150000002596 lactones Chemical class 0.000 description 2
- 230000003902 lesions Effects 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 229960000274 lysozyme Drugs 0.000 description 2
- 239000004325 lysozyme Substances 0.000 description 2
- 235000010335 lysozyme Nutrition 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 150000004667 medium chain fatty acids Chemical class 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000006011 modification reaction Methods 0.000 description 2
- 230000000051 modifying Effects 0.000 description 2
- 238000003199 nucleic acid amplification method Methods 0.000 description 2
- 210000000056 organs Anatomy 0.000 description 2
- IPCSVZSSVZVIGE-UHFFFAOYSA-M palmitate Chemical compound CCCCCCCCCCCCCCCC([O-])=O IPCSVZSSVZVIGE-UHFFFAOYSA-M 0.000 description 2
- 230000036961 partial Effects 0.000 description 2
- 125000001147 pentyl group Chemical group C(CCCC)* 0.000 description 2
- 229930015704 phenylpropanoids Natural products 0.000 description 2
- OFOBLEOULBTSOW-UHFFFAOYSA-L propanedioate Chemical compound [O-]C(=O)CC([O-])=O OFOBLEOULBTSOW-UHFFFAOYSA-L 0.000 description 2
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 2
- 210000001938 protoplasts Anatomy 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 239000011541 reaction mixture Substances 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 238000000527 sonication Methods 0.000 description 2
- 239000012536 storage buffer Substances 0.000 description 2
- 150000007970 thio esters Chemical class 0.000 description 2
- 238000004704 ultra performance liquid chromatography Methods 0.000 description 2
- 239000011534 wash buffer Substances 0.000 description 2
- VHJLVAABSRFDPM-UHFFFAOYSA-N 1,4-dimercaptobutane-2,3-diol Chemical compound SCC(O)C(O)CS VHJLVAABSRFDPM-UHFFFAOYSA-N 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K 2qpq Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- GWYFCOCPABKNJV-UHFFFAOYSA-N 3-Methylbutanoic acid Chemical compound CC(C)CC(O)=O GWYFCOCPABKNJV-UHFFFAOYSA-N 0.000 description 1
- GWYFCOCPABKNJV-UHFFFAOYSA-M 3-Methylbutanoic acid Natural products CC(C)CC([O-])=O GWYFCOCPABKNJV-UHFFFAOYSA-M 0.000 description 1
- GHURLXDGHMZIGJ-UHFFFAOYSA-N 4-hydroxy-6-(2-oxoheptyl)pyran-2-one Chemical compound CCCCCC(=O)CC1=CC(O)=CC(=O)O1 GHURLXDGHMZIGJ-UHFFFAOYSA-N 0.000 description 1
- YIXLDRQOKWESBI-UHFFFAOYSA-N 4-hydroxy-6-pentylpyran-2-one Chemical compound CCCCCC1=CC(O)=CC(=O)O1 YIXLDRQOKWESBI-UHFFFAOYSA-N 0.000 description 1
- 101700076530 4CLL7 Proteins 0.000 description 1
- 101700034761 4CLL9 Proteins 0.000 description 1
- 101710025095 AAE7 Proteins 0.000 description 1
- 101700050332 ABRC Proteins 0.000 description 1
- 101710041057 AT2S4 Proteins 0.000 description 1
- 229920002287 Amplicon Polymers 0.000 description 1
- 229940064005 Antibiotic throat preparations Drugs 0.000 description 1
- 229940083879 Antibiotics FOR TREATMENT OF HEMORRHOIDS AND ANAL FISSURES FOR TOPICAL USE Drugs 0.000 description 1
- 229940042052 Antibiotics for systemic use Drugs 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- 229940042786 Antitubercular Antibiotics Drugs 0.000 description 1
- 241000972773 Aulopiformes Species 0.000 description 1
- 229920000195 Bacterial small RNA Polymers 0.000 description 1
- 238000009010 Bradford assay Methods 0.000 description 1
- 235000011303 Brassica alboglabra Nutrition 0.000 description 1
- 240000007124 Brassica oleracea Species 0.000 description 1
- 235000011302 Brassica oleracea Nutrition 0.000 description 1
- 238000009631 Broth culture Methods 0.000 description 1
- 102100009150 CLC Human genes 0.000 description 1
- 101700035010 COASY Proteins 0.000 description 1
- 102100004201 COASY Human genes 0.000 description 1
- 102000018208 Cannabinoid receptor family Human genes 0.000 description 1
- 108050007331 Cannabinoid receptor family Proteins 0.000 description 1
- 229960005091 Chloramphenicol Drugs 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N Chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 208000000094 Chronic Pain Diseases 0.000 description 1
- 229920001405 Coding region Polymers 0.000 description 1
- 210000000172 Cytosol Anatomy 0.000 description 1
- GZCGUPFRVQAUEE-KCDKBNATSA-N D-(+)-Galactose Natural products OC[C@@H](O)[C@H](O)[C@H](O)[C@@H](O)C=O GZCGUPFRVQAUEE-KCDKBNATSA-N 0.000 description 1
- 229960000633 Dextran Sulfate Drugs 0.000 description 1
- 108020004461 Double-Stranded RNA Proteins 0.000 description 1
- 206010015037 Epilepsy Diseases 0.000 description 1
- 241001198387 Escherichia coli BL21(DE3) Species 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 101700015998 FADD Proteins 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 101700002119 GAL Proteins 0.000 description 1
- 102100012694 GAL Human genes 0.000 description 1
- 101700014301 GALK1 Proteins 0.000 description 1
- 229940093922 Gynecological Antibiotics Drugs 0.000 description 1
- MNWFXJYAOYHMED-UHFFFAOYSA-N Heptanoic acid Chemical compound CCCCCCC(O)=O MNWFXJYAOYHMED-UHFFFAOYSA-N 0.000 description 1
- 108091006038 His-tagged proteins Proteins 0.000 description 1
- 229920002459 Intron Polymers 0.000 description 1
- 125000000570 L-alpha-aspartyl group Chemical group [H]OC(=O)C([H])([H])[C@]([H])(N([H])[H])C(*)=O 0.000 description 1
- 125000002059 L-arginyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C([H])([H])C([H])([H])N([H])C(=N[H])N([H])[H] 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- 125000000010 L-asparaginyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C(=O)N([H])[H] 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- 125000000415 L-cysteinyl group Chemical group O=C([*])[C@@](N([H])[H])([H])C([H])([H])S[H] 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- 125000002061 L-isoleucyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])[C@](C([H])([H])[H])([H])C(C([H])([H])[H])([H])[H] 0.000 description 1
- 125000003440 L-leucyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C(C([H])([H])[H])([H])C([H])([H])[H] 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- 125000001176 L-lysyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C([H])([H])C([H])([H])C([H])([H])C(N([H])[H])([H])[H] 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- 125000002435 L-phenylalanyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C1=C([H])C([H])=C([H])C([H])=C1[H] 0.000 description 1
- MTCFGRXMJLQNBG-REOHCLBHSA-N L-serine Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- 125000002842 L-seryl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])O[H] 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- 125000000769 L-threonyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])[C@](O[H])(C([H])([H])[H])[H] 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- 125000003798 L-tyrosyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C([H])([H])C1=C([H])C([H])=C(O[H])C([H])=C1[H] 0.000 description 1
- 125000003580 L-valyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(C([H])([H])[H])(C([H])([H])[H])[H] 0.000 description 1
- 101710010009 LS215_1332 Proteins 0.000 description 1
- 101710010014 LYS21 Proteins 0.000 description 1
- 239000005639 Lauric acid Substances 0.000 description 1
- LTYOQGRJFJAKNA-KKIMTKSISA-N Malonyl CoA Natural products S(C(=O)CC(=O)O)CCNC(=O)CCNC(=O)[C@@H](O)C(CO[P@](=O)(O[P@](=O)(OC[C@H]1[C@@H](OP(=O)(O)O)[C@@H](O)[C@@H](n2c3ncnc(N)c3nc2)O1)O)O)(C)C LTYOQGRJFJAKNA-KKIMTKSISA-N 0.000 description 1
- 230000036740 Metabolism Effects 0.000 description 1
- 235000021360 Myristic acid Nutrition 0.000 description 1
- 102100015077 NEUROD6 Human genes 0.000 description 1
- 101710008008 NEUROD6 Proteins 0.000 description 1
- 241001045988 Neogene Species 0.000 description 1
- 241000207746 Nicotiana benthamiana Species 0.000 description 1
- 240000008962 Nicotiana tabacum Species 0.000 description 1
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 1
- 210000003463 Organelles Anatomy 0.000 description 1
- 208000002193 Pain Diseases 0.000 description 1
- 235000021314 Palmitic acid Nutrition 0.000 description 1
- 240000004713 Pisum sativum Species 0.000 description 1
- 235000010582 Pisum sativum Nutrition 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 241000589776 Pseudomonas putida Species 0.000 description 1
- 229920000970 Repeated sequence (DNA) Polymers 0.000 description 1
- 210000003705 Ribosomes Anatomy 0.000 description 1
- 108010003581 Ribulose-Bisphosphate Carboxylase Proteins 0.000 description 1
- 241000256251 Spodoptera frugiperda Species 0.000 description 1
- 229940024982 Topical Antifungal Antibiotics Drugs 0.000 description 1
- HRXKRNGNAMMEHJ-UHFFFAOYSA-K Trisodium citrate Chemical compound [Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O HRXKRNGNAMMEHJ-UHFFFAOYSA-K 0.000 description 1
- 102000006668 UniProt protein families Human genes 0.000 description 1
- 108020004729 UniProt protein families Proteins 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 206010048038 Wound infection Diseases 0.000 description 1
- 101700035783 YM10 Proteins 0.000 description 1
- 240000008042 Zea mays Species 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 125000002252 acyl group Chemical group 0.000 description 1
- 230000001058 adult Effects 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229920002847 antisense RNA Polymers 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- VKOBVWXKNCXXDE-UHFFFAOYSA-M arachidate Chemical compound CCCCCCCCCCCCCCCCCCCC([O-])=O VKOBVWXKNCXXDE-UHFFFAOYSA-M 0.000 description 1
- 230000001580 bacterial Effects 0.000 description 1
- 238000010256 biochemical assay Methods 0.000 description 1
- 230000003115 biocidal Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000000903 blocking Effects 0.000 description 1
- FERIUCNNQQJTOY-UHFFFAOYSA-M butyrate Chemical compound CCCC([O-])=O FERIUCNNQQJTOY-UHFFFAOYSA-M 0.000 description 1
- 108010005026 butyryl-CoA synthetase Proteins 0.000 description 1
- 238000010805 cDNA synthesis kit Methods 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 244000213578 camo Species 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 1
- 150000007942 carboxylates Chemical class 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 230000024881 catalytic activity Effects 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 235000013339 cereals Nutrition 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 229940114081 cinnamate Drugs 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 239000002537 cosmetic Substances 0.000 description 1
- 230000001351 cycling Effects 0.000 description 1
- 230000005860 defense response to virus Effects 0.000 description 1
- 230000004059 degradation Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000001419 dependent Effects 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 201000009910 diseases by infectious agent Diseases 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 229940079593 drugs Drugs 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 238000007824 enzymatic assay Methods 0.000 description 1
- 230000005284 excitation Effects 0.000 description 1
- 238000010195 expression analysis Methods 0.000 description 1
- 101710009782 fadD11 Proteins 0.000 description 1
- 101710010463 fadD15 Proteins 0.000 description 1
- 101710010457 fadD17 Proteins 0.000 description 1
- 101710010449 fadD19 Proteins 0.000 description 1
- 101710009908 fadD21 Proteins 0.000 description 1
- 101710010378 fadD23 Proteins 0.000 description 1
- 101710009902 fadD25 Proteins 0.000 description 1
- 101700051677 fadK Proteins 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- KSEBMYQBYZTDHS-HWKANZROSA-M ferulate Chemical compound COC1=CC(\C=C\C([O-])=O)=CC=C1O KSEBMYQBYZTDHS-HWKANZROSA-M 0.000 description 1
- 229940114123 ferulate Drugs 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 235000019253 formic acid Nutrition 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037240 fusion proteins Human genes 0.000 description 1
- 101700051660 gal10 Proteins 0.000 description 1
- 238000004817 gas chromatography Methods 0.000 description 1
- 230000009368 gene silencing by RNA Effects 0.000 description 1
- 230000000762 glandular Effects 0.000 description 1
- 239000006481 glucose medium Substances 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- MNWFXJYAOYHMED-UHFFFAOYSA-M heptanoate Chemical compound CCCCCCC([O-])=O MNWFXJYAOYHMED-UHFFFAOYSA-M 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- DEDGUGJNLNLJSR-UHFFFAOYSA-N hydroxycinnamic acid group Chemical class OC(C(=O)O)=CC1=CC=CC=C1 DEDGUGJNLNLJSR-UHFFFAOYSA-N 0.000 description 1
- 235000010359 hydroxycinnamic acids Nutrition 0.000 description 1
- 229930005346 hydroxycinnamic acids Natural products 0.000 description 1
- 239000002117 illicit drug Substances 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 229940079866 intestinal antibiotics Drugs 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 230000000670 limiting Effects 0.000 description 1
- 238000004811 liquid chromatography Methods 0.000 description 1
- 238000001294 liquid chromatography-tandem mass spectrometry Methods 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 150000004668 long chain fatty acids Chemical class 0.000 description 1
- 235000009808 lpulo Nutrition 0.000 description 1
- 238000004020 luminiscence type Methods 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- LTYOQGRJFJAKNA-DVVLENMVSA-N malonyl-CoA Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCSC(=O)CC(O)=O)O[C@H]1N1C2=NC=NC(N)=C2N=C1 LTYOQGRJFJAKNA-DVVLENMVSA-N 0.000 description 1
- 108010083942 mannopine synthase Proteins 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000002503 metabolic Effects 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 230000035786 metabolism Effects 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 201000006417 multiple sclerosis Diseases 0.000 description 1
- 230000003505 mutagenic Effects 0.000 description 1
- 239000003471 mutagenic agent Substances 0.000 description 1
- 231100000707 mutagenic chemical Toxicity 0.000 description 1
- 239000005445 natural product Substances 0.000 description 1
- 229930014626 natural products Natural products 0.000 description 1
- 108010058731 nopaline synthase Proteins 0.000 description 1
- KQMZYOXOBSXMII-CECATXLMSA-N octanoyl-CoA Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCSC(=O)CCCCCCC)O[C@H]1N1C2=NC=NC(N)=C2N=C1 KQMZYOXOBSXMII-CECATXLMSA-N 0.000 description 1
- 229940005935 ophthalmologic Antibiotics Drugs 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 150000002995 phenylpropanoid derivatives Chemical class 0.000 description 1
- 125000001474 phenylpropanoid group Chemical group 0.000 description 1
- 230000037039 plant physiology Effects 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 125000000830 polyketide group Chemical group 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-M propionate Chemical compound CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 1
- 238000002731 protein assay Methods 0.000 description 1
- 239000012460 protein solution Substances 0.000 description 1
- 238000000575 proteomic Methods 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 238000007363 ring formation reaction Methods 0.000 description 1
- 235000019515 salmon Nutrition 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 150000004666 short chain fatty acids Chemical class 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 238000004885 tandem mass spectrometry Methods 0.000 description 1
- 150000003505 terpenes Chemical class 0.000 description 1
- NGSWKAQJJWESNS-ZZXKWVIFSA-M trans-4-coumarate Chemical compound OC1=CC=C(\C=C\C([O-])=O)C=C1 NGSWKAQJJWESNS-ZZXKWVIFSA-M 0.000 description 1
- 230000001052 transient Effects 0.000 description 1
- 239000011778 trisodium citrate Substances 0.000 description 1
- 229940038773 trisodium citrate Drugs 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- NQPDZGIKBAWPEJ-UHFFFAOYSA-M valerate Chemical compound CCCCC([O-])=O NQPDZGIKBAWPEJ-UHFFFAOYSA-M 0.000 description 1
- 229940070710 valerate Drugs 0.000 description 1
- 229940005605 valeric acid Drugs 0.000 description 1
- 150000004669 very long chain fatty acids Chemical class 0.000 description 1
- 238000011179 visual inspection Methods 0.000 description 1
- 101700037037 vraA Proteins 0.000 description 1
- 239000003643 water by type Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/52—Genes encoding for enzymes or proenzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8242—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
- C12N15/8243—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/1025—Acyltransferases (2.3)
- C12N9/1029—Acyltransferases (2.3) transferring groups other than amino-acyl groups (2.3.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/90—Isomerases (5.)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/93—Ligases (6)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P17/00—Preparation of heterocyclic carbon compounds with only O, N, S, Se or Te as ring hetero atoms
- C12P17/02—Oxygen as only ring hetero atoms
- C12P17/06—Oxygen as only ring hetero atoms containing a six-membered hetero ring, e.g. fluorescein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P7/00—Preparation of oxygen-containing organic compounds
- C12P7/40—Preparation of oxygen-containing organic compounds containing a carboxyl group including Peroxycarboxylic acids
- C12P7/42—Hydroxy-carboxylic acids
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02P—CLIMATE CHANGE MITIGATION TECHNOLOGIES IN THE PRODUCTION OR PROCESSING OF GOODS
- Y02P20/00—Technologies relating to chemical industry
- Y02P20/50—Improvements relating to the production of bulk chemicals
- Y02P20/52—Improvements relating to the production of bulk chemicals using catalysts, e.g. selective catalysts
Abstract
Discloses polypeptides having alkanoyl-CoA activity, nucleic acids encoding the same, and methods relating to altering levels or synthesising cannabinoid compounds in an organism, cell or tissue.
Description
GENES AND PROTEINS FOR ALKANOYL-COA SYNTHESIS
Cross-reference to Related Applications
This application claims the benefit of United States Provisional Application Serial
Number USSN 61/507,331 filed July 13, 2011, the entire contents of which is herein
incorporated by reference.
Field of the Invention
The present invention relates to nucleic acid molecules and proteins involved in
the synthesis of alkanoyl-CoA thioesters, and to uses of the nucleic acid molecules and
proteins for engineering cannabinoid biosynthesis in plants, micro-organisms or in cell-
free systems and for creating cannabis plants with enhanced or reduced cannabinoid
content.
Background of the Invention
Cannabis sativa L. (cannabis, hemp, marijuana) is one of the oldest and most
versatile domesticated plants, which today finds use as source of medicinal, food,
cosmetic and industrial products. It is also well known for its use as an illicit drug owing
to its content of psychoactive cannabinoids (e.g. -tetrahydrocannabinol, -THC) .
Cannabinoids and other drugs that act through mammalian cannabinoid receptors are
being explored for the treatment of diverse conditions such as chronic pain, multiple
sclerosis and epilepsy.
Cannabinoids have their biosynthetic origins in both polyketide and terpenoid
metabolism and are termed terpenophenolics or prenylated polyketides (P age J., Nagel J.
(2006) Biosynthesis of terpenophenolics in hop and cannabis. In JT Romeo, ed,
Integrative Plant Biochemistry, Vol. 40. Elsevier, Oxford, pp 179-210.). Cannabinoid
biosynthesis occurs primarily in glandular trichomes that cover female flowers at a high
density. Cannabinoids are formed by a three-step biosynthetic process:polyketide
formation, aromatic prenylation and cyclization (see Figure 1).
The first enzymatic step in cannabinoid biosynthesis is the formation of olivetolic
acid by a polyketide synthase enzyme that catalyzes the condensation of hexanoyl-
coenzyme A (CoA) with three molecules of malonyl-CoA. The major cannabinoids,
including -tetrahydrocannabinolic acid and cannabidiolic acid, are formed from the
precursor hexanoyl-CoA, which is a medium chain fatty acyl-CoA (see Figure 1). Other
cannabinoids with variant side-chains are formed from aliphatic-CoAs of different lengths
(e.g. -tetrahydrocannabivarinic acid is formed from an n-butyryl-CoA primer).
Hexanoyl-CoA and other acyl-CoA thioesters in plants are synthesized by acyl-
activating enzymes (AAEs, also called acyl-CoA synthetases) that catalyze the activation
of carboxylic acid substrates using ATP. These enzymes act on a variety of carboxylate
acids including short-, medium-, long- and very long-chain fatty acids, jasmonate
precursors, phenylpropanoid-derived acids (e.g. cinnamic acid) and other organic acids
such as malonate, acetate and citrate. Very few medium-chain acyl CoA synthetases
have been previously identified in nature. In plants, three enzymes from A. thaliana,
AAE7, At4g05160 and At5g63380 have been shown to form hexanoyl-CoA from
hexanoate (Schneider K et al. (2005) A new type of peroxisomal acyl-coenzyme A
synthetase from Arabidopsis thaliana has the catalytic capacity to activate biosynthetic
precursors of jasmonic acid. The Journal of Biological Chemistry 280:13962-72; Shockey
JM, Fulda MS, Browse J (2003) Arabidopsis contains a large superfamily of acyl-
activating enzymes. Phylogenetic and biochemical analysis reveals a new class of acyl-
coenzyme a synthetases. Plant Physiology 132:1065-76.) Acyl-CoA synthetases from
Pseudomonas spp. have been shown to act on medium-chain fatty acids such as
hexanoate (Fernandez-Valverde M, Reglero A, Martinez-Blanco H, Luengo JM (1993)
Purification of Pseudomonas putida acyl coenzyme A ligase active with a range of
aliphatic and aromatic substrates. Applied Environmental Microbiology 59:1149-1154.)
Cannabinoids are valuable natural products. Genes encoding enzymes involved
in cannabinoid biosynthesis will be useful in metabolic engineering of cannabis to
produce plants that contain very low levels, or zero levels, of THCA and other
cannabinoids via targeted mutagenesis (e.g. TILLING) or other gene knockout
techniques. Such genes may also prove useful for creation, via marker-assisted
selection, of specific cannabis varieties for the production of cannabinoid-based
pharmaceuticals, or for reconstituting cannabinoid biosynthesis in heterologous
organisms such as bacteria or yeast, or for producing cannabinoids in cell-free systems
that utilize recombinant proteins.
Genes encoding enzymes of cannabinoid biosynthesis can also be useful in
synthesis of cannabinoid analogs and synthesis of analogs of cannabinoid precursors.
Cannabinoid analogs have been previously synthesized and may be useful as
pharmaceutical products.
There remains a need in the art to identify enzymes, and nucleotide sequences
encoding such enzymes, that are involved in the synthesis of aromatic polyketides.
Summary of the Invention
Two novel genes from cannabis have now been found which encode previously
unknown alkanoyl-CoA synthetases. These two new alkanoyl Co-A synthetases are
referred to herein as Cannabis sativa hexanoyl-CoA synthetase 1 (CsHCS1) and
Cannabis sativa hexanoyl-CoA synthetase 2 (CsHCS2) .
Thus, in a first aspect of the invention, there is provided an isolated or purified
nucleic acid molecule comprising a nucleotide sequence having at least 75% sequence
identity to SEQ ID NO:1, or a codon degenerate sequence thereof.
In a second aspect of the invention, there is provided an isolated or purified
nucleic acid molecule comprising a nucleotide sequence having at least 75% sequence
identity to SEQ ID NO:3, or a codon degenerate sequence thereof.
In a third aspect of the invention, there is provided an isolated or purified
polypeptide comprising an amino acid sequence having at least 85% sequence identity to
SEQ ID NO:2, or a conservatively substituted amino acid sequence thereof.
In a fourth aspect of the invention, there is provided an isolated or purified
polypeptide comprising an amino acid sequence having at least 85% sequence identity to
SEQ ID NO:4, or a conservatively substituted amino acid sequence thereof.
In a fifth aspect of the invention, there is provided a vector, construct or
expression system comprising a nucleic acid molecule of the invention.
In a sixth aspect of the invention, there is provided a host cell transformed with a
nucleic acid molecule of the invention.
In a seventh aspect of the invention, there is provided a process of synthesizing
an alkanoyl-CoA in presence of an enzyme of the invention.
In an eighth aspect of the invention, there is provided a process of altering levels
of cannabinoid compounds in an organism, cell or tissue comprising using a nucleic acid
molecule of the present invention, or a part thereof, to silence in the organism, cell or
tissue a gene that encodes an enzyme that catalyzes synthesis of an alkanoyl-CoA.
In an ninth aspect of the invention, there is provided a process of altering levels of
cannabinoid compounds in an organism, cell or tissue comprising mutating genes in the
organism, cell or tissue, and using a nucleic acid molecule of the present invention to
select for organisms, cells or tissues containing mutants or variants of a gene that
encodes an enzyme that catalyzes synthesis of an alkanoyl-CoA.
In a tenth aspect of the invention, there is provided a process of altering levels of
cannabinoid compounds in an organism, cell or tissue comprising expressing or over-
expressing a nucleic acid molecule of the invention in the organism, cell or tissue in
comparison to a similar variety of organism, cell or tissue grown under similar conditions
but without the expressing or over-expressing of the nucleic acid molecule.
In an eleventh aspect of the invention, there is provided a process of altering
levels of cannabinoid compounds in an organism, cell or tissue comprising expressing or
over-expressing a nucleic acid molecule encoding a polypeptide of the invention in the
organism, cell or tissue in comparison to a similar variety of organism, cell or tissue grown
under similar conditions but without the expressing or over-expressing of the nucleic acid
molecule.
In a twelfth aspect of the invention, there is provided a process of synthesizing a
naturally-occurring cannabinoid compound or a non-naturally occurring analog of a
cannabinoid compound in an organism, cell or tissue comprising expressing a nucleic
acid molecule of the invention in the organism, cell or tissue in the presence of a
carboxylic acid and CoA.
In a thirteenth aspect of the present invention, there is provided a process of
synthesizing an alkanoyl-CoA in an in vitro cell-free reaction, said process comprising:
reacting a carboxylic acid with coenzyme A presence of an enzyme of the invention.
Polypeptides that are enzymes catalyzing the synthesis of alkanoyl-CoA, and
nucleotide sequences encoding such enzymes, have now been identified and
characterized. The nucleotide sequences may be used to create, through breeding,
selection or genetic engineering, cannabis plants that overproduce or under-produce
cannabinoid compounds, analogs of cannabinoid compounds or mixtures thereof. These
nucleotide sequences may also be used, alone or in combination with genes encoding
other steps in cannabinoid synthesis pathways, to engineer cannabinoid biosynthesis in
other plants or in microorganisms (e.g. yeast, bacteria, fungi) or other prokaryotic or
eukaryotic organisms or in cell-free systems. In addition, blocking or reducing the
expression of these genes in cannabis could be used to block cannabinoid biosynthesis
and thereby reduce production of cannabinoids.
Further features of the invention will be described or will become apparent in the
course of the following detailed description.
Brief Description of the Drawings
In order that the invention may be more clearly understood, embodiments thereof
will now be described in detail by way of example, with reference to the accompanying
drawings, in which:
Figure 1 depicts a proposed pathway leading to the main cannabinoid types in
Cannabis sativa. Abbreviations:THCA synthase is -tetrahydrocannabinolic acid
synthase; CBDA synthase is cannabidiolic acid synthase; CBCA synthase is
cannabichromenic acid synthase.
Figures 2A-2F depict liquid chromatography mass spectrometry/mass
spectrometry (LC-MS/MS) analysis of the enzymatic activity of Cannabis sativa hexanoyl-
CoA synthases. Each of Figures 2A-2F show ion abundance (m /z 866>359) on the
vertical axis and time (minutes) on the horizontal axis. Figure 2A and 2B depict the
retention time of an authentic hexanoyl-CoA standard. Figure 2C depicts an assay of
CsHCS1 protein, CoA, MgCl , sodium hexanoate, ATP, and HEPES buffer, in which
hexanoyl-CoA was produced and detected. Figure 2D depicts an assay of CsHCS2
protein, CoA, MgCl , sodium hexanoate, ATP, and HEPES buffer, in which hexanoyl-CoA
was produced. Figure 2E depicts an assay in which CsHCS1 protein had been previously
inactivated by boiling at 95°C for 15 minutes, CoA, sodium hexanoate, ATP, and HEPES
buffer, in which no hexanoyl-CoA was produced. Fig 2F depicts an assay in which
CsHCS2 protein had been previously inactivated by boiling at 95°C for 15 minutes, CoA,
sodium hexanoate, ATP, and HEPES buffer, in which no hexanoyl-CoA was produced.
Figure 3 depicts two graphs illustrating carboxylic acid substrates utilized by the
enzymes of the invention. Figure 3A depicts carboxylic acid substrates utilized by
CsHCS1. Figure 3B depicts carboxylic acid substrates utilized by CsHCS2.
Figure 4 depicts a high performance liquid chromatography analysis of the
products produced by a coupled enzymatic assay consisting of the Cannabis sativa
hexanoyl-CoA synthetase CsHCS2, malonyl-CoA synthetase ( MCS), Cannabis sativa
olivetol synthase/polyketide synthase, and Cannabis sativa olivetolic acid synthase.
Eluted compounds were detected by absorbance at 263 nm and identified both by having
the same retention times as isolated standards, and by their mass using a single
quadrapole mass detector. The detection of olivetol and olivetolic acid indicates that
CsHCS2 is capable of providing sufficient hexanoyl-CoA substrate for the synthesis of
olivetolic acid. Assays lacking CsHCS2, CoA, or hexanoate did not produce any
polyketide products. HTAL = hexanoyltriacetic lactone, PDAL = pentyldiacetic lactone, OA
= olivetolic acid, OL = olivetol.
Figure 5 depicts a graph showing olivetolic acid production in yeast cells
engineered to produce olivetolic acid by using CsHCS1 and CsHCS2 to synthesize
hexanoyl-CoA, and a fusion of the cannabis olivetol synthase/polyketide synthase (PKS)
and olivetolic acid synthase (O AS) to form olivetolic acid.
Figure 6 depicts qRT-PCR analysis of CsHCS1, CsHCS2 and CBDA Synthase
expression in different tissues of the hemp cultivar F inola. Gene expression values
relative to actin were plotted as fold differences compared to leaves, with leaf expression
assigned a value of 1. Insets depict gene expression in female flowers with and without
trichomes, with values also indicated as fold differences compared to leaves. R, roots; S,
stems; L, leaves; FF+, female flowers with trichomes; FF-, female flowers with trichomes
removed by the Beadbeater method; T, trichomes; MF, male flower. Values are mean ±
SD, n=3.
Description of Preferred Embodiments
A trichome-specific cDNA library deom cannabis was sequenced to produce 9157
express sequence tags ( ESTs) that assembled into 4113 unique sequences ( 1227
contigs, 2886 singletons). Unigenes were annotated by comparison to the UniProt
protein database using the online search and comparison tool called blastx. Cannabis
acyl-activating enzyme proteins were identified by utilizing Arabidopsis acyl-activating
enzyme sequences to query the assembled cannabis ESTs using the online search and
comparison tool called tblastn. Eleven acyl-activating enzymes were identified and named
according to their transcript abundance in the cDNA library. CsHCS1 was the most
abundant acyl-activating enzyme based on transcript levels (42 ESTs); CsHCS2 had
lower abundance (5 ESTs) Based on its high transcript levels in trichomes and the
localization of CsHCS1 to the cytoplasm, it is likely that this enzyme is the acyl-activating
enzyme involved in supplying hexanoyl-CoA to the cannabinoid pathway. CsHCS2, which
is localized to the peroxisome, is probably not involved in cannabinoid formation.
However, its kinetic properties make it a useful enzyme for synthesizing hexanoyl-CoA in
heterologous hosts or in cell-free systems.
The sequence of the CsHCS1 gene is as follows:
Cannabis sativa CsHCS1 2163 bp (SEQ ID NO:1)
ATGGGTAAGAATTACAAGTCCCTGGACTCTGTTGTGGCCTCTGACTTCATAGCCCTA
GGTATCACCTCTGAAGTTGCTGAGACACTCCATGGTAGACTGGCCGAGATCGTGTG
TAATTATGGCGCTGCCACTCCCCAAACATGGATCAATATTGCCAACCATATTCTGTCG
CCTGACCTCCCCTTCTCCCTGCACCAGATGCTCTTCTATGGTTGCTATAAAGACTTTG
GACCTGCCCCTCCTGCTTGGATACCCGACCCGGAGAAAGTAAAGTCCACCAATCTG
GGCGCACTTTTGGAGAAGCGAGGAAAAGAGTTTTTGGGAGTCAAGTATAAGGATCC
CATTTCAAGCTTTTCTCATTTCCAAGAATTTTCTGTAAGAAACCCTGAGGTGTATTGG
AGAACAGTACTAATGGATGAGATGAAGATAAGTTTTTCAAAGGATCCAGAATGTATAT
TGCGTAGAGATGATATTAATAATCCAGGGGGTAGTGAATGGCTTCCAGGAGGTTATC
TTAACTCAGCAAAGAATTGCTTGAATGTAAATAGTAACAAGAAATTGAATGATACAAT
GATTGTATGGCGTGATGAAGGAAATGATGATTTGCCTCTAAACAAATTGACACTTGAC
CAATTGCGTAAACGTGTTTGGTTAGTTGGTTATGCACTTGAAGAAATGGGTTTGGAG
AAGGGTTGTGCAATTGCAATTGATATGCCAATGCATGTGGATGCTGTGGTTATCTAT
CTAGCTATTGTTCTTGCGGGATATGTAGTTGTTTCTATTGCTGATAGTTTTTCTGCTC
CTGAAATATCAACAAGACTTCGACTATCAAAAGCAAAAGCCATTTTTACACAGGATCA
TATTATTCGTGGGAAGAAGCGTATTCCCTTATACAGTAGAGTTGTGGAAGCCAAGTC
TCCCATGGCCATTGTTATTCCTTGTAGTGGCTCTAATATTGGTGCAGAATTGCGTGAT
GGCGATATTTCTTGGGATTACTTTCTAGAAAGAGCAAAAGAGTTTAAAAATTGTGAAT
TTACTGCTAGAGAACAACCAGTTGATGCCTATACAAACATCCTCTTCTCATCTGGAAC
AACAGGGGAGCCAAAGGCAATTCCATGGACTCAAGCAACTCCTTTAAAAGCAGCTG
CAGATGGGTGGAGCCATTTGGACATTAGGAAAGGTGATGTCATTGTTTGGCCCACTA
ATCTTGGTTGGATGATGGGTCCTTGGCTGGTCTATGCTTCACTCCTTAATGGGGCTT
CTATTGCCTTGTATAATGGATCACCACTTGTTTCTGGCTTTGCCAAATTTGTGCAGGA
TGCTAAAGTAACAATGCTAGGTGTGGTCCCTAGTATTGTTCGATCATGGAAAAGTAC
CAATTGTGTTAGTGGCTATGATTGGTCCACCATCCGTTGCTTTTCCTCTTCTGGTGAA
GCATCTAATGTAGATGAATACCTATGGTTGATGGGGAGAGCAAACTACAAGCCTGTT
ATCGAAATGTGTGGTGGCACAGAAATTGGTGGTGCATTTTCTGCTGGCTCTTTCTTA
CAAGCTCAATCATTATCTTCATTTAGTTCACAATGTATGGGTTGCACTTTATACATACT
TGACAAGAATGGTTATCCAATGCCTAAAAACAAACCAGGAATTGGTGAATTAGCGCT
TGGTCCAGTCATGTTTGGAGCATCGAAGACTCTGTTGAATGGTAATCACCATGATGT
TTATTTTAAGGGAATGCCTACATTGAATGGAGAGGTTTTAAGGAGGCATGGGGACAT
TTTTGAGCTTACATCTAATGGTTATTATCATGCACATGGTCGTGCAGATGATACAATG
AATATTGGAGGCATCAAGATTAGTTCCATAGAGATTGAACGAGTTTGTAATGAAGTTG
ATGACAGAGTTTTCGAGACAACTGCTATTGGAGTGCCACCTTTGGGCGGTGGACCT
GAGCAATTAGTAATTTTCTTTGTATTAAAAGATTCAAATGATACAACTATTGACTTAAA
40 TCAATTGAGGTTATCTTTCAACTTGGGTTTACAGAAGAAACTAAATCCTCTGTTCAAG
GTCACTCGTGTTGTGCCTCTTTCATCACTTCCGAGAACAGCAACCAACAAGATCATG
AGAAGGGTTTTGCGCCAGCAATTTTCTCACTTTGAATGA
The sequence of the CsHCS2 gene is as follows:
Cannabis sativa CsHCS2 1547 bp (SEQ ID NO:3)
ATGGAGAAATCTTTTTCAGAAACTCATCTTCATACCCACAAAAGCCAGCTCTCATTGA
TTCCGAAACCAACCAAATACTCTCCTTTTCCCACTTCAAATCTACGGTTATCAAGGTC
TCCCATGGCTTTCTCAATCTGGGTATCAAGAAAAACGACGTCGTTCTCATCTACGCC
CCTAATTCTATCCACTTCCCTGTTTGTTTCCTGGGAATTATAGCCTCTGGAGCCATTG
CCACTACCTCAAATCCTCTCTACACAGTTTCCGAGCTTTCCAAACAGGTCAAGGATTC
CAATCCCAAACTCATTATCACCGTTCCTCAACTCTTGGAAAAAGTAAAGGGTTTCAAT
CTCCCCACGATTCTAATTGGTCCTGATTCTGAACAAGAATCTTCTAGTGATAAAGTAA
TGACCTTTAACGATTTGGTCAACTTAGGTGGGTCGTCTGGCTCAGAATTTCCAATTGT
TGATGATTTTAAGCAGAGTGACACTGCTGCGCTATTGTACTCATCTGGCACAACGGG
AATGAGTAAAGGTGTGGTTTTGACTCACAAAAACTTCATTGCCTCTTCTTTAATGGTG
ACAATGGAGCAAGACCTAGTTGGAGAGATGGATAATGTGTTTCTATGCTTTTTGCCA
ATGTTTCATGTATTTGGTTTGGCTATCATCACCTATGCTCAGTTGCAGAGAGGAAACA
CTGTTATTTCAATGGCGAGATTTGACCTTGAGAAGATGTTAAAAGATGTGGAAAAGTA
TAAAGTTACCCATTTGTGGGTTGTGCCTCCTGTGATACTGGCTCTGAGTAAGAACAG
TATGGTGAAGAAGTTTAATCTTTCTTCTATAAAGTATATTGGCTCCGGTGCAGCTCCT
TTGGGCAAAGATTTAATGGAGGAGTGCTCTAAGGTTGTTCCTTATGGTATTGTTGCTC
AGGGATATGGTATGACAGAAACTTGTGGGATTGTATCCATGGAGGATATAAGAGGAG
GTAAACGAAATAGTGGTTCAGCTGGAATGCTGGCATCTGGAGTAGAAGCCCAGATA
GTTAGTGTAGATACACTGAAGCCCTTACCTCCTAATCAATTGGGGGAGATATGGGTG
AAGGGGCCTAATATGATGCAAGGTTACTTCAATAACCCACAGGCAACCAAGTTGACT
ATAGATAAGAAAGGTTGGGTACATACTGGTGATCTTGGATATTTTGATGAAGATGGA
CATCTTTATGTTGTTGACCGTATAAAAGAGCTCATCAAATATAAAGGATTTCAGGTTG
CTCCTGCTGAGCTTGAAGGATTGCTTGTTTCTCACCCTGAAATACTCGATGCTGTTGT
GATTCCATTTCCTGACGCTGAAGCGGGTGAAGTCCCAGTTGCTTATGTTGTGCGCTC
TCCCAACAGTTCATTAACCGAAAATGATGTGAAGAAATTTATCGCGGGCCAGGTTGC
ATCTTTCAAAAGATTGAGAAAAGTAACATTTATAAACAGTGTCCCGAAATCTGCTTCG
GGGAAAATCCTCAGAAGAGAACTCATTCAGAAAGTACGCTCCAACATGTGA
CsHCS1 and CsHCS2 were PCR amplified as described in Example 1 and the
alkanoyl-CoA synthetase or CoA-ligase activity was measured as described in Example
2. As is shown in Figure 2, CsHCS1 and CsHCS2 catalyze the production of alkanoyl-
CoA from a carboxylic acid and CoA.
Some embodiments of the present invention relate to an isolated or purified
nucleic acid molecule having SEQ ID NO:1 or having at least 75%, at least 76%, least
77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%,
at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least
40 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%,
at least 97%, at least 98% or at least 99% identity to SEQ ID NO:1.
Some embodiments of the present invention relate to an isolated or purified
nucleic acid molecule having SEQ ID NO:3 or having at least 75%, at least 76%, least
77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%,
at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least
90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%,
at least 97%, at least 98% or at least 99% identity to SEQ ID NO:3.
Further included are nucleic acid molecules that hybridize to the above disclosed
nucleic acid sequences. Hybridization conditions may be stringent in that hybridization will
occur if there is at least a 90%, 95% or 97% sequence identity with the nucleic acid
molecule that encodes the enzyme of the present invention. The stringent conditions
may include those used for known Southern hybridizations such as, for example,
incubation overnight at 42 C in a solution having 50% formamide, 5x SSC (150 mM NaCl,
15 mM trisodium citrate), 50 mM sodium phosphate ( pH 7.6), 5x Denhardt's solution, 10%
dextran sulfate, and 20 micrograms/milliliter denatured, sheared salmon sperm DNA,
following by washing the hybridization support in 0.1x SSC at about 65°C. Other known
hybridization conditions are well known and are described in Sambrook et al., Molecular
Cloning:A Laboratory Manual, Third Edition, Cold Spring Harbor, N.Y. (2001) .
As will be appreciated by the skilled practitioner, slight changes in nucleic acid
sequence do not necessarily alter the amino acid sequence of the encoded polypeptide.
It will be appreciated by persons skilled in the art that changes in the identities of
nucleotides in a specific gene sequence that change the amino acid sequence of the
encoded polypeptide may result in reduced or enhanced effectiveness of the genes and
that, in some applications (e.g. anti-sense, co suppression, or RNAi) , partial sequences
often work as effectively as full length versions. The ways in which the nucleotide
sequence can be varied or shortened are well known to persons skilled in the art, as are
ways of testing the effectiveness of the altered genes. In certain embodiments,
effectiveness may easily be tested by, for example, conventional gas chromatography.
All such variations of the genes are therefore included as part of the present disclosure.
As will be appreciated by one of skill in the art, the length of the nucleic acid
molecule described above will depend on the intended use. For example, if the intended
use is as a primer or probe, for example for PCR amplification or for screening a library,
the length of the nucleic acid molecule will be less than the full length sequence, for
example, 15-50 nucleotides. In these embodiments, the primers or probes may be
substantially identical to a highly conserved region of the nucleic acid sequence or may
be substantially identical to either the 5' or 3' end of the DNA sequence. In some cases,
these primers or probes may use universal bases in some positions so as to be
'substantially identical' but still provide flexibility in sequence recognition. It is of note that
suitable primer and probe hybridization conditions are well known in the art.
The present invention also includes the enzyme CsHCS1. The amino acid sequence
of CsHCS1 (SEQ ID NO:2) is:
MGKNYKSLDSVVASDFIALGITSEVAETLHGRLAEIVCNYGAATPQTWINIANHILSPDLPF
SLHQMLFYGCYKDFGPAPPAWIPDPEKVKSTNLGALLEKRGKEFLGVKYKDPISSFSHF
QEFSVRNPEVYWRTVLMDEMKISFSKDPECILRRDDINNPGGSEWLPGGYLNSAKNCL
NVNSNKKLNDTMIVWRDEGNDDLPLNKLTLDQLRKRVWLVGYALEEMGLEKGCAIAIDM
PMHVDAVVIYLAIVLAGYVVVSIADSFSAPEISTRLRLSKAKAIFTQDHIIRGKKRIPLYSRV
VEAKSPMAIVIPCSGSNIGAELRDGDISWDYFLERAKEFKNCEFTAREQPVDAYTNILFSS
GTTGEPKAIPWTQATPLKAAADGWSHLDIRKGDVIVWPTNLGWMMGPWLVYASLLNGA
SIALYNGSPLVSGFAKFVQDAKVTMLGVVPSIVRSWKSTNCVSGYDWSTIRCFSSSGEA
SNVDEYLWLMGRANYKPVIEMCGGTEIGGAFSAGSFLQAQSLSSFSSQCMGCTLYILDK
NGYPMPKNKPGIGELALGPVMFGASKTLLNGNHHDVYFKGMPTLNGEVLRRHGDIFELT
SNGYYHAHGRADDTMNIGGIKISSIEIERVCNEVDDRVFETTAIGVPPLGGGPEQLVIFFV
LKDSNDTTIDLNQLRLSFNLGLQKKLNPLFKVTRVVPLSSLPRTATNKIMRRVLRQFSHFE
Some embodiments relate to an isolated or purified polypeptide having SEQ ID
NO. 2 or having at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at
least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least
96%, at least 97%, at least 98% or at least 99% identity to the amino acid sequence as
set forth in SEQ ID NO:2.
The present invention also includes the enzyme CsHCS2. The amino acid
sequence of CsHCS2 (SEQ ID NO:4) is:
MEKSGYGRDGIYRSLRPPLHLPNNNNLSMVSFLFRNSSSYPQKPALIDSETNQILSFSHF
KSTVIKVSHGFLNLGIKKNDVVLIYAPNSIHFPVCFLGIIASGAIATTSNPLYTVSELSKQVK
DSNPKLIITVPQLLEKVKGFNLPTILIGPDSEQESSSDKVMTFNDLVNLGGSSGSEFPIVD
DFKQSDTAALLYSSGTTGMSKGVVLTHKNFIASSLMVTMEQDLVGEMDNVFLCFLPMFH
VFGLAIITYAQLQRGNTVISMARFDLEKMLKDVEKYKVTHLWVVPPVILALSKNSMVKKFN
LSSIKYIGSGAAPLGKDLMEECSKVVPYGIVAQGYGMTETCGIVSMEDIRGGKRNSGSA
GMLASGVEAQIVSVDTLKPLPPNQLGEIWVKGPNMMQGYFNNPQATKLTIDKKGWVHT
GDLGYFDEDGHLYVVDRIKELIKYKGFQVAPAELEGLLVSHPEILDAVVIPFPDAEAGEVP
VAYVVRSPNSSLTENDVKKFIAGQVASFKRLRKVTFINSVPKSASGKILRRELIQKVRSNM
Some embodiments relate to an isolated or purified polypeptide having SEQ ID
NO. 4 or having at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at
least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least
96%, at least 97%, at least 98% or at least 99% identity to the amino acid sequence as
set forth in SEQ ID NO:4.
Some embodiments relate to a vector, construct or expression system containing
40 an isolated or purified polynucleotide having the sequence of SEQ ID NO:1 or SEQ ID
NO:3, or least 75%, at least 76%, least 77%, at least 78%, at least 79%, at least 80%, at
least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least
87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%,
at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%
identity to SEQ ID NO:1 or SEQ ID NO:3. As well, there is provided a method for
preparing a vector, construct or expression system including such a sequence, or a part
thereof, for introduction of the sequence or partial sequence in a sense or anti-sense
orientation, or a complement thereof, into a cell.
In some embodiments, the isolated and/or purified nucleic acid molecules, or
vectors, constructs or expression systems comprising these isolated and/or purified
nucleic acid molecules, may be used to create transgenic organisms or cells of organisms
that produce polypeptides which catalyze the synthesis of aromatic polyketides.
Therefore, one embodiment relates to transgenic organisms, cells or germ tissues of the
organism comprising an isolated and/or purified nucleic acid molecule having SEQ ID
NO:1 or SEQ ID NO:3 or having least 75%, at least 76%, least 77%, at least 78%, at least
79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%,
at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least
92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or
at least 99% identity to SEQ ID NO:1 or SEQ ID NO:3.
Preferably, the organism is a plant, microorganism or insect. Plants are preferably
of the genus Cannabis, for example Cannabis sativa L., Cannabis indica Lam. and
Cannabis ruderalis Janisch. Especially preferred is Cannabis sativa. Microorganisms are
preferably bacteria (e.g. Escherichia coli) or yeast (e.g. Saccharomyces cerevisiae).
Insect is preferably Spodoptera frugiperda.
Organisms, cells and germ tissues of this embodiment may have altered levels of
cannabinoid compounds. With reference to Figure 1, it will be appreciated by one skilled
in the art that expression or over-expression of the nucleic acid molecules of the invention
will result in expression or over-expression of the enzyme that catalyzes the synthesis of
hexanoyl-CoA which, in combination with other enzymes, may result in the production or
increased production of cannabinoid compounds such as cannabigerolic acid (C BGA), -
tetrahydrocannabinolic acid (T HCA), cannabidiolic acid (CBDA) , cannabichromenic acid
(CBCA), -tetrahydrocannabinol ( THC), cannabidiol (CBD), cannabichromene (CBC),
etc. Similarly, depending on the substrate used, expression or over-expression of the
nucleic acid molecules of the invention resulting in expression or over-expression of the
enzyme that catalyzes the synthesis of hexanoyl-CoA may result in the production or
increased production of analogs of cannabinoid compounds, or analogs of precursors of
such compounds.
Silencing of the gene in the organism, cell or tissue will result in under-expression
of the enzyme which may result in accumulation of precursors such as hexanoic acid (six
carbons), octanoic acid (eight carbons), nonanoic acid (nine carbons), valeric acid (f ive
carbons), heptanoic acid (seven carbons) or other carboxylic acids, and/or reduction of
cannabinoids such as THCA (the precursor of THC) or CBDA (the precursor of CBD).
The present invention includes a process of altering levels of cannabinoid
compounds in an organism, cell or tissue by expressing or over-expressing an exogenous
enzyme of the invention in the organism, cell or tissue, in comparison to a similar variety
of organism, cell or tissue grown under similar conditions but without an exogenous
enzyme of the invention being expressed or over-expressed.
Expression or over-expression of the nucleic acid molecules of the invention may
be done in combination with expression or over-expression of one or more other nucleic
acids that encode one or more enzymes in a cannabinoid biosynthetic pathway. Some
examples of other nucleic acids include those which encode:a type III polyketide
synthase, a polyketide cyclase, an aromatic prenyltransferase and a cannabinoid-forming
oxidocylase. Specific examples of these enzymes include olivetol synthase/polyketide
synthase, olivetolic acid synthase, a geranylpyrophosphate:olivetolate geranyltransferase,
a -tetrahydrocannabinolic acid synthase, a cannabidiolic acid synthase or a
cannabichromenic acid synthase. Synthesis of alkanoyl-CoA in the presence of an
enzyme polypeptide of the present invention may be accomplished in vivo or in vitro. As
previously mentioned, such syntheses in vivo may be accomplished by expressing or
over-expressing the nucleic acid molecule of the invention in an organism, cell or tissue.
Synthesis of alkanoyl-CoA in vitro can take place in a cell-free system. As part of
an in vitro cell-free system, the carboxylic acid and an enzyme of the present invention
may be mixed together in a suitable reaction vessel to effect the reaction.
In vitro, the polypeptides of the present invention may be used in combination with
other enzymes to effect a complete synthesis of a cannabinoid compound from a
precursor. For example, such other enzymes may be implicated in a cannabinoid
biosynthetic pathway as described in Figure 1 ( su ch as olivetol synthase/PKS , olivetolic
acid synthase, aromatic prenyltransferase, THCA synthase, CBDA synthase, CBCA
synthase).
The polypeptides of the present invention may be used, in vivo or in vitro, to
synthesize analogs of cannabinoid compounds which are not naturally occurring in the
host species. Such analogs can be produced using carboxylic acid compounds other
than those used to produce natural cannabinoid compounds in plants. For example,
acetic acid, butyric acid, octanoic acid, decanoic acid, lauric acid, myristic acid, palmitic
acid; branched chain acids such isovaleric acid; and hydroxycinnamic acids such a
cinnamic acid.
Terms:
In order to facilitate review of the various embodiments of the disclosure, the
following explanations of specific terms are provided:
Alkanoyl-CoA: An alkanoyl-CoA is an aliphatic carbonyl compound having
a coenzyme A moiety bonded to the carbon atom of the carbonyl group through a sulfide
bridge. Preferred alkanoyl-CoA compounds comprise from 2 to 10 carbon atoms in the
aliphatic carbonyl part of the compound. More preferably, the alkanoyl-CoA is CoA-S-
C(O)- (CH ) -CH , where n is an integer from 0 to 8. Some examples of alkanoyl-CoA
2 n 3
compounds are acetyl-CoA, butyryl-CoA, hexanoyl-CoA and octanoyl-CoA. Use of
acetyl-CoA provides a methyl side chain to the resulting aromatic polyketide; use of
butyryl-CoA provides a propyl side chain; and use of hexanoyl-CoA provides a pentyl side
chain. Hexanoyl-CoA is especially preferred. Cannabinoids with shorter side-chains
exist in cannabis (e.g. tetrahydrocannabivarinic acid having a propyl side-chain instead of
the pentyl side-chain of THCA).
Codon degeneracy: It will be appreciated that this disclosure embraces the
degeneracy of codon usage as would be understood by one of ordinary skill in the art and
as illustrated in Table 1.
Table 1 Codon Degeneracies
Amino Acid Codons
Ala/A GCT, GCC, GCA, GCG
Arg/R CGT, CGC, CGA, CGG, AGA, AGG
Asn/N AAT, AAC
Asp/D GAT, GAC
Cys/C TGT, UGC
Gln/Q CAA, CAG
Glu/E GAA, GAG
Gly/G GGT, GGC, GGA, GGG
His/H CAT, CAC
Ile/I ATT, ATC, ATA
Leu/L TTA, TTG, CTT, CTC, CTA, CTG
Lys/K AAA, AAG
Met/M ATG
Phe/F TTT, TTC
Pro/P CCT, CCC, CCA, CCG
Ser/S TCT, TCC, TCA, TCG, AGT, AGC
Thr/T ACT, ACC, ACA, ACG
Trp/W TGG
Tyr/Y TAT, TAC
Val/V GTT, GTC, GTA, GTG
START ATG
STOP TAG, TGA, TAA
Complementary nucleotide sequence: Complementary nucleotide sequence of a
sequence is understood as meaning any nucleic acid molecule whose nucleotides are
complementary to those of a sequence disclosed herein, and whose orientation is
reversed (anti-parallel sequence).
Conservative substitutions: It will be understood by one skilled in the art that
conservative substitutions may be made in the amino acid sequence of a polypeptide
without disrupting the three-dimensional structure or function of the polypeptide.
Accordingly, the present invention includes polypeptides comprising conservatively
substituted CsHCS1 and CsHCS2. Conservative substitutions are accomplished by the
skilled artisan by substituting amino acids with similar hydrophobicity, polarity, and R-
chain length for one another. Additionally, by comparing aligned sequences of
homologous proteins from different species, conservative substitutions may be identified
by locating amino acid residues that have been mutated between species without altering
the basic functions of the encoded proteins. Table 2 provides an exemplary list of
conservative substitutions.
Table 2 Conservative Substitutions
Type of Amino Acid Substitutable Amino Acids
Hydrophilic Ala, Pro, Gly, Glu, Asp, Gln, Asn, Ser, Thr
Sulphydryl Cys
Aliphatic Val, Ile, Leu, Met
Basic Lys, Arg, His
Aromatic Phe, Tyr, Trp
Degree or percentage of sequence homology: The term "degree or percentage of
sequence homology'' refers to degree or percentage of sequence identity between two
sequences after optimal alignment.
Homologous isolated and/or purified sequence: Homologous isolated and/or
purified sequence is unde rstood to mean an isolated and/or purified sequence having a
percentage identity with the bases of a nucleotide sequence, or the amino acids of a
polypeptide sequence, of at least about 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%,
83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
98%, 99%, 99.5%, 99.6%, or 99.7%. This percentage is purely statistical, and it is
possible to distribute the differences between the two nucleotide or amino acid
sequences at random and over the whole of their length. Sequence identity can be
determined, for example, by computer programs designed to perform single and multiple
sequence alignments.
Increasing, decreasing, modulating, altering or the like: As will be appreciated by
one of skill in the art, such terms refer to comparison to a similar variety or strain grown
under similar conditions but without the modification resulting in the increase, decrease,
modulation or alteration. In some cases, this may be an untransformed control, a mock
transformed control, or a vector-transformed control.
Isolated: As will be appreciated by one of skill in the art, isolated refers to
polypeptides or nucleic acids that have been isolated from their native environment.
Nucleotide, polynucleotide, or nucleic acid sequence: Nucleotide, polynucleotide,
or nucleic acid sequence will be understood as meaning both double -stranded or single-
stranded in the monomeric and dimeric (so-called in tandem) forms and the transcription
products thereof.
Sequence identity: Two amino acid or nucleotide sequences are said to be
"identical'' if the sequence of amino acids or nucleotides in the two sequences is the
same when aligned for maximum correspondence as described below. Percentage of
sequence identity (or degree of identity) is determined by comparing two optimally aligned
sequences over a comparison window, where the portion of the peptide or polynucleotide
sequence in the comparison window may comprise additions or deletions (i.e., gaps) as
compared to the reference sequence (which does not comprise additions or deletions) for
optimal alignment of the two sequences. The percentage is calculated by determining the
number of positions at which the identical amino acid residue or nucleic acid base occurs
in both sequences to yield the number of matched positions, dividing the number of
matched positions by the total number of positions in the window of comparison and
multiplying the result by 100 to yield the percentage of sequence identity.
Optimal alignment of sequences for comparison may be conducted by the local
homology algorithm of Smith and Waterman, Ad. App. Math 2:482 (1 981), by the
homology alignment algorithm of Needleman and Wunsch, J. Mol. Biol. 48:443 (1970), by
the search for similarity method of Pearson and Lipman, Proc. Natl. Acad. Sci. ( U.S.A.)
85:2444 (1988), by computerized implementation of these algorithms (G AP, BESTFIT,
FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer
Group (G CG), 575 Science Dr., Madison, Wis.), or by visual inspection.
The definition of sequence identity given above is the definition that would be
used by one of skill in the art. The definition by itself does not need the help of any
algorithm, said algorithms being helpful only to achieve the optimal alignments of
sequences, rather than the calculation of sequence identity.
From the definition given above, it follows that there is a well defined and only one
value for the sequence identity between two compared sequences which value
corresponds to the value obtained for the best or optimal alignment.
Stringent hybridization: Hybridization under conditions of stringency with a
nucleotide sequence is understood as meaning a hybridization under conditions of
temperature and ionic strength chosen in such a way that they allow the maintenance of
the hybridization between two fragments of complementary nucleic acid molecules.
Homologs of the novel genes described herein obtained from other organisms, for
example plants, may be obtained by screening appropriate libraries that include the
homologs, wherein the screening is performed with the nucleotide sequence of the
specific genes of the invention, or portions or probes thereof, or identified by sequence
homology search using sequence alignment search programs such as BLAST or FASTA.
Nucleic acid isolation and cloning is well established. Similarly, an isolated gene
may be inserted into a vector and transformed into a cell by conventional techniques
which are known to those of skill in the art. Nucleic acid molecules may be transformed
into an organism. As known in the art, there are a number of ways by which genes,
vectors, constructs and expression systems can be introduced into organisms, and a
combination of transformation and tissue culture techniques have been successfully
integrated into effective strategies for creating transgenic organisms. These methods,
which can be used in the invention, have been described elsewhere ( P otrykus I (1991)
Gene transfer to plants:Assessment of published approaches and results. Annu. Rev.
Plant Physiol. Plant Mol. Biol. 42:205-225; Vasil I K (1994) Molecular improvement of
cereals. Plant Mol. Biol. 25:925-937. Walden R, Wingender R (1995) Gene-transfer and
plant regeneration techniques. Trends in Biotechnology 13:324-331; Songstad DD,
Somers DA, Griesbach RJ ( 1995) Advances in alternative DNA delivery techniques. Plant
Cell Tissue Organ Cult. 40:1-15), and are well known to persons skilled in the art.
Suitable vectors are well known to those skilled in the art and are described in
general technical references such as Pouwels et al., Cloning Vectors. A Laboratory
Manual, Elsevier, Amsterdam (1986) . Particularly suitable vectors include the Ti plasmid
vectors. For example, one skilled in the art will certainly be aware that, in addition to
Agrobacterium mediated transformation of Arabidopsis by vacuum infiltration (Bechtold N,
Ellis J, Pelletier G (1993) In planta Agrobacterium-mediated gene transfer by infiltration of
adult Arabidopsis thaliana plants. C R Acad Sci Paris, Sciences de la vie/Life sciences
316:1194-1199.) or wound inoculation (Katavic V, Haughn GW, Reed D, Martin M, Kunst
L (1994) In planta transformation of Arabidopsis thaliana. Mol. Gen. Genet. 245:363-
370.) , it is equally possible to transform other plant species, using Agrobacterium Ti-
plasmid mediated transformation (e.g., hypocotyl (DeBlock M, DeBrouwer D, Tenning P
(1989) Transformation of Brassica napus and Brassica oleracea using Agrobacterium
tumefaciens and the expression of the bar and neo genes in the transgenic plants. Plant
Physiol. 91:694-701) or cotyledonary petiole (Moloney MM, Walker JM, Sharma KK
(1989) High efficiency transformation of Brassica napus using Agrobacterium vectors.
Plant Cell Rep. 8:238-242.) wound infection, particle bombardment/biolistic methods
(Sanford JC, Klein TM, Wolf ED, Allen N (1987) Delivery of substances into cells and
tissues using a particle bombardment process. J. Part. Sci. Technol. 5:27-37.) or
polyethylene glycol-assisted, protoplast transformation methods ( Rhodes CA, Pierce DA,
Mettler IJ, Mascarenhas D, Detmer JJ (1988) Genetically transformed maize plants from
protoplasts. Science 240:204-207).
As will also be apparent to persons skilled in the art, and as described elsewhere
(Meyer P ( 1995) Understanding and controlling transgene expression. Trends in
Biotechnology 13:332-337; Datla R, Anderson JW, Selvaraj G (1997) Plant promoters for
transgene expression. Biotechnology Annual Review 3:269-296.), it is possible to utilize
promoters operatively linked to the nucleic acid molecule to direct any intended up- or
down-regulation of transgene expression using unregulated (i.e. constitutive) promoters
(e.g., those based on CaMV35S) , or by using promoters which can target gene
expression to particular cells, tissues (e.g., napin promoter for expression of transgenes
in developing seed cotyledons), organs (e .g., roots), to a particular developmental stage,
or in response to a particular external stimulus (e.g., heat shock).
Promoters for use in the invention may be inducible, constitutive, or tissue-specific
or have various combinations of such characteristics. Useful promoters include, but are
not limited to constitutive promoters such as carnation etched ring virus promoter
(CERV), cauliflower mosaic virus (CaMV) 35S promoter, or more particularly the double
enhanced cauliflower mosaic virus promoter, comprising two CaMV 35S promoters in
tandem (referred to as a "Double 35S" promoter). It may be desirable to use a tissue-
specific or developmentally regulated promoter instead of a constitutive promoter in
certain circumstances. A tissue-specific promoter allows for over-expression in certain
tissues without affecting expression in other tissues.
The promoter and termination regulatory regions will be functional in the host cell
and may be heterologous (that is, not naturally occurring) or homologous (derived from
the host species) to the cell and the gene.
The termination regulatory region may be derived from the 3' region of the gene
from which the promoter was obtained or from another gene. Suitable termination
regions which may be used are well known in the art and include Agrobacterium
tumefaciens nopaline synthase terminator (T nos), A. tumefaciens mannopine synthase
terminator (T mas) and the CaMV 35S terminator (T 35S). Particularly preferred
termination regions for use in the present invention include the pea ribulose bisphosphate
carboxylase small subunit termination region ( TrbcS) or the Tnos termination region.
Gene constructs for use in the invention may suitably be screened for activity by, for
example, transformation into a host plant via Agrobacterium and screening for altered
cannabinoid levels.
The nucleic acid molecules of the invention, or fragments thereof, may be used to
block cannabinoid biosynthesis in organisms that naturally produce cannabinoid
compounds. Silencing using a nucleic acid molecule of the invention may be
accomplished in a number of ways generally known in the art, for example, RNA
interference ( RNAi) techniques, artificial microRNA techniques, virus-induced gene
silencing (VIGS) techniques, antisense techniques, sense co-suppression techniques and
targeted mutagenesis techniques.
RNAi techniques involve stable transformation using RNA interference (RNAi)
plasmid constructs (Helliwell CA, Waterhouse PM (2005) Constructs and methods for
hairpin RNA-mediated gene silencing in plants. Methods Enzymology 392:24-35). Such
plasmids are composed of a fragment of the target gene to be silenced in an inverted
repeat structure. The inverted repeats are separated by a spacer, often an intron. The
RNAi construct driven by a suitable promoter, for example, the Cauliflower mosaic virus
(CaMV) 35S promoter, is integrated into the plant genome and subsequent transcription
of the transgene leads to an RNA molecule that folds back on itself to form a double-
stranded hairpin RNA. This double-stranded RNA structure is recognized by the plant
and cut into small RNAs (about 21 nucleotides long) called small interfering RNAs
(siRNAs). The siRNAs associate with a protein complex (RISC) which goes on to direct
degradation of the mRNA for the target gene.
Artificial microRNA (amiRNA) techniques exploit the microRNA (miRNA)
pathway that functions to silence endogenous genes in plants and other eukaryotes
(Schwab R, Ossowski S, Riester M, Warthmann N, Weigel D ( 2006) Highly specific gene
silencing by artificial microRNAs in Arabidopsis. Plant Cell 18:1121-33; Alvarez JP,
Pekker I, Goldshmidt A, Blum E, Amsellem Z, Eshed Y (2006) Endogenous and synthetic
microRNAs stimulate simultaneous, efficient, and localized regulation of multiple targets
in diverse species. Plant Cell 18:1134-51). In this method, 21 nucleotide long fragments
of the gene to be silenced are introduced into a pre-miRNA gene to form a pre-amiRNA
construct. The pre-amiRNA construct is transferred into the organism genome using
transformation methods which would be apparent to one skilled in the art. After
transcription of the pre-amiRNA, processing yields amiRNAs that target genes which
share nucleotide identity with the 21 nucleotide amiRNA sequence.
In RNAi silencing techniques, two factors can influence the choice of length of the
fragment. The shorter the fragment the less frequently effective silencing will be
achieved, but very long hairpins increase the chance of recombination in bacterial host
strains. The effectiveness of silencing also appears to be gene dependent and could
reflect accessibility of target mRNA or the relative abundances of the target mRNA and
the hairpin RNA in cells in which the gene is active. A fragment length of between 100
and 800 bp, preferably between 300 and 600 bp, is generally suitable to maximize the
efficiency of silencing obtained. The other consideration is the part of the gene to be
targeted. 5 UTR, coding region, and 3 UTR fragments can be used with equally good
results. As the mechanism of silencing depends on sequence homology, there is
potential for cross-silencing of related mRNA sequences. Where this is not desirable, a
region with low sequence similarity to other sequences, such as a 5 or 3 UTR, should be
chosen. The rule for avoiding cross-homology silencing appears to be to use sequences
that do not have blocks of sequence identity of over 20 bases between the construct and
the non-target gene sequences. Many of these same principles apply to selection of
target regions for designing amiRNAs.
Virus-induced gene silencing (VIGS) techniques are a variation of RNAi
techniques that exploits the endogenous antiviral defenses of plants. Infection of plants
with recombinant VIGS viruses containing fragments of host DNA leads to post-
transcriptional gene silencing for the target gene. In one embodiment, a tobacco rattle
virus ( TRV) based VIGS system can be used with the nucleotide sequences of the
present invention.
Antisense techniques involve introducing into a plant an antisense oligonucleotide
that will bind to the messenger RNA (mRNA) produced by the gene of interest. The
"antisense" oligonucleotide has a base sequence complementary to the gene's
messenger RNA (mRNA), which is called the "sense" sequence. Activity of the sense
segment of the mRNA is blocked by the anti-sense mRNA segment, thereby effectively
inactivating gene expression. Application of antisense to gene silencing in plants is
described in more detail by Stam M, de Bruin R, van Blokland R, van der Hoorn RA, Mol
JN, Kooter JM (2000) Distinct features of post-transcriptional gene silencing by antisense
transgenes in single copy and inverted T-DNA repeat loci. Plant J. 21:27-42.
Sense co-suppression techniques involve introducing a highly expressed sense
transgene into a plant resulting in reduced expression of both the transgene and the
endogenous gene (D epicker A, Montagu MV ( 1997) Post-transcriptional gene silencing in
plants. Curr Opin Cell Biol. 9:373-82). The effect depends on sequence identity between
transgene and endogenous gene.
Targeted mutagenesis techniques, for example TILLING (T argeting Induced Local
Lesions IN Genomes) and delete -a-gene using fast -neutron bombardment, may be
used to knockout gene function in an organism ( Henikoff S, Till BJ, Comai L (2004)
TILLING. Traditional mutagenesis meets functional genomics. Plant Physiol 135:630-6; Li
X, Lassner M, Zhang Y. (2002) Deleteagene:a fast neutron deletion mutagenesis-based
gene knockout system for plants. Comp Funct Genomics. 3:158-60). TILLING involves
treating germplasm or individual cells with a mutagen to cause point mutations that are
then discovered in genes of interest using a sensitive method for single-nucleotide
mutation detection. Detection of desired mutations (e.g. mutations resulting in the
inactivation of the gene product of interest) may be accomplished, for example, by PCR
methods. For example, oligonucleotide primers derived from the gene of interest may be
prepared and PCR may be used to amplify regions of the gene of interest from organisms
in the mutagenized population. Amplified mutant genes may be annealed to wild-type
genes to find mismatches between the mutant genes and wild-type genes. Detected
differences may be traced back to the organism which had the mutant gene thereby
revealing which mutagenized organism will have the desired expression (e.g. silencing of
the gene of interest) . These organisms may then be selectively bred to produce a
population having the desired expression. TILLING can provide an allelic series that
includes missense and knockout mutations, which exhibit reduced expression of the
targeted gene. TILLING is touted as a possible approach to gene knockout that does not
involve introduction of transgenes, and therefore may be more acceptable to consumers.
Fast-neutron bombardment induces mutations, i.e. deletions, in organism genomes that
can also be detected using PCR in a manner similar to TILLING.
It will be understood by one of skill in the art that the processes of the invention
can also be carried out in a cell-free environment in the presence of one or more
carboxylic acids.
Embodiments of the invention are susceptible to various modifications and
alternative forms in addition to the specific examples included herein. Thus,
embodiments of the invention are not limited to the particular forms disclosed.
Examples:
Example 1:Amplification and Cloning of CsHCS1 and CsHCS2
CsHCS1 and CsHCS2 were PCR amplified from cDNA plasmid clones using the
primers listed in Table 3 and Phusion polymerase (Finnzymes). PCR products were
purified and cloned into the pCR8/GW/TOPO entry vector ( Invitrogen) . After
transformation into E. coli TOP10 cells ( I nvitrogen) , individual clones were verified by
sequencing. The CsHCS1 and CsHCS2 genes were recombined into the pHIS8/GW
destination vector using LR recombinase (I nvitrogen) . The LR reaction products were
transformed into TOP10 cells and verified by sequencing.
Table 3: Oligonucleotides
Name Sequence ( 5 -3)
CsHCS1 forward (SEQ ID NO:5) ATGGGTAAGAATTACAAGTCCCT
CsHCS1 reverse (SEQ ID NO:6) GAGCTCTCATTCAAAGTGAGAAAATTGCTG
CsHCS2 forward (SEQ ID NO:7) ATGGAGAAATCTGGGTATGGAAG
CsHCS2 reverse (SEQ ID NO:8) TCACATGTTGGAGCGTACTTTC
MCS forward (SEQ ID NO:9) ATGAGCAACCATCTTTTCGACG
MCS reverse (SEQ ID NO:10) TTACGTCCTGGTATAAAGATCGGC
pHIS8/GW-CsHCS1 and pHIS8/GW-CsHCS2 were transformed into E. coli
Rosetta 2 cells ( Merck). Individual colonies were used to inoculate small-scale cultures of
liquid LB medium containing chloramphenicol and kanamycin, which were used to
inoculate 500 mL of liquid LB medium without antibiotics. After growth to OD of 0.6,
expression was induced by the addition of IPTG to 0.2 µM. The CsHCS1 expressing
cultures were then grown at 12°C with shaking for 24 h, whereas the CsHCS2 cultures
were grown at 37°C for 16 h. Different temperatures were used because it was observed
that CsHCS1 did not produce soluble protein at the higher temperature.
Cells were harvested by centrifugation and resuspended in 10 mL His-tag lysis
buffer ( 50 mM Tris-HCl pH 7, 500 mM NaCl, 2.5 mM imidazole, 10% v/v glycerol, 10 mM
-mercaptoethanol, 1% v/v Tween 20, and 750 µg/mL lysozyme) . The resuspended
cells were incubated on ice for 1 h then lysed by sonication. After centrifugation for 20
min at 12,000 g at 4°C, the soluble protein fraction was added to 160 µL of Talon resin
( Clontech) that had previously been washed with His-tag wash buffer ( HWB; 50 mM Tris-
HCl pH 7, 500 mM NaCl, 2.5 mM imidazole, 10% glycerol, 10 mM -mercaptoethanol).
The samples were incubated with gentle rocking at 4°C, after which the resin was isolated
by centrifugation (700 g for 5 min). The resin was resuspended in HWB buffer and
washed with gentle rocking at 4°C then centrifuged. The wash step was then repeated
twice and the resuspended resin loaded onto a chromatography column and allowed to
drain. After washing the resin with 10 mL of HWB buffer, the His-tagged proteins were
eluted by the addition of 2.5 mL of His-tag elution buffer (50 mM Tris-HCl pH 7, 500 mM
NaCl, 250 mM imidazole, 10% v/v glycerol, 10 mM -mercaptoethanol). The eluates were
buffer exchanged into storage buffer (50 mM HEPES pH 9, 10% v/v glycerol, 2 mM
MgCl , and 2 mM dithiothreitol) using PD10 columns (Amersham Biosciences). The purity
of the isolated proteins was verified by SDS-PAGE, and the protein concentration was
determined by Bradford assay.
Example 2:Analysis of Hexanoyl-CoA Synthetase Activity
Hexanoyl-CoA synthetase activity was measured by incubating 0.1 µg of enzyme
in a 20 µL reaction mixture containing 50 mM HEPES pH 9, 8 mM ATP, 10 mM MgCl ,
0.5 mM CoA, and 4 mM sodium hexanoate. The reactions were incubated for 10 min at
40°C, terminated with 2 µL of 1 N HCl and stored on ice until analysis.
The reaction mixtures were diluted 1:100 with water and subsequently separated
using a Waters Acquity UPLC system fitted with an Acquity UPLC BEH C18 column (1.7
µm particle size, 2.1 x 50 mm column), and analyzed by MS/MS using a Micromass
Quattro Ultima triple-quadrupole mass spectrometer. The solvent system used was buffer
A:5 mM TEA and 3 mM acetic acid in water, and buffer B:5 mM TEA and 3 mM acetic
acid in 95:5 methanol:water. The flow program is shown in Table 4. The mass
spectrometer settings were:ESI positive mode, collision energy 27 V, cone 135 V,
scanning for 866>359 transitions.
Table 4: Flow Program for Liquid Chromatography
As shown in Figure 2, CsHCS1 and CsHCS2 catalyzed the formation of hexanoyl-
CoA from hexanoate and CoA. Figures 2A and 2B show the elution of authentic
hexanoyl-CoA standard. Figure 2C shows a complete assay comprising CsHCS1, 50 mM
HEPES pH 9, 8 mM ATP, 10 mM MgCl , 0.5 mM CoA, and 4 mM sodium hexanoate. A
compound with the same mass transitions and elution time as the authentic hexanoyl-
CoA standard can be seen at 9.25 minutes. Figure 2D shows a complete assay
comprising of CsHCS2, 50 mM HEPES pH 9, 8 mM ATP, 10 mM MgCl , 0.5 mM CoA,
and 4 mM sodium hexanoate. A compound with the same mass transitions and elution
time as the authentic hexanoyl-CoA standard can be seen at 9.25 minutes. Figures 2E
and 2F show negative controls with inactivated (boiled) CsHCS1 and CsHCS2 enzymes.
As can be seen in Figures 2E and 2F, these assays showed no hexanoyl-CoA synthesis.
Both CsHCS1 and CsHCS2 exhibited temperature and pH optima of 40°C and pH
9, respectively. In testing a range of divalent cations, CsHCS1 optimally used Mg and to
2+ 2+ 2+
a lesser extent Mn and Co . CsHCS2 activity was highest using Co , but was also
2+ 2+ 2+
observed to be high with Mg , Mn , and to a lesser extent Ca . The biological relevance
2+ 2+
of the high activity with Co is not clear and Mg was used for all further assays.
With hexanoate, CsHCS1 had a K of 6.1 ± 1.0 mM, a V of 15.6 ± 1.7 pKat and
m max
a k of 4.5 sec . CsHCS2 had a K of 320 nM, a V of 1.7 pKat, and a k of 57.6
cat m max cat
sec .
Example 3:Testing with Different Carboxylic Acids
To test the range of carboxylic acids that CsHCS1 and CsHCS2 can activate,
enzyme assays were performed with a broad range of carboxylic acids and limiting ATP.
The assay conditions used were similar to Schneider K et al. (2005). A new type of
peroxisomal acyl-coenzyme A synthetase from Arabidopsis thaliana has the catalytic
capacity to activate biosynthetic precursors of jasmonic acid. The Journal of Biological
Chemistry, 280:13962-72. Briefly, purified HCS enzyme (1 µg) was incubated with 500
µM carboxylic acid substrate and 100 µM CoA in an assay containing 100 mM HEPES pH
9, 250 µM MgCl , 50 µM ATP and 1 mM DTT. All carboxylic acid substrates were
dissolved in 2% v/v Triton X-100, leading to a final concentration 0.05% Triton X-100 in
the assay. After reacting for 3 h at 29°C, 10 µL aliquots of the reactions were transferred
to 96-well plates for a luciferin/luciferase based measurement of unconsumed ATP. The
plates were analyzed with a 1420 Multilabel counter (PerkinElmer). To each well, 90 µL of
a solution containing 100 mM Tris pH 7.8, 1 mM MgCl , 2.3 µg luciferin, and 0.5 µg of
luciferase was injected, and after shaking for 2 seconds the luminescence was measured
for 15 seconds without a filter in place. Lower readings, compared to the reactions with
no carboxylic acid substrate, indicate a higher amount of enzymatic activity and therefore
substrate utilization. The results are shown in Figure 3, wherein error bars represent the
percent error of the ratio, n=3.
As is shown in Figure 3A, CsHCS1 was observed to utilize hexanoate ( six
carbons), octanoate ( eight carbons), and nonanoate (nine carbons), and to a lesser
extent valerate (f ive carbons) and heptanoate (seven carbons), as substrates. In contrast,
as is shown in Figure 3B, CsHCS2 exhibited greater promiscuity, and is able to utilize a
broad range of substrates, ranging from propanoate (C3) to arachidoate (C20), and a
number of phenylpropanoids (cinnamate, ferulate, and to a lesser extent p-coumarate).
In a separate experiment, the kinetic properties of CsHCS1 and CsHCS3 were
more accurately measured for CoA and representative short (butanoate), medium
( hexanoate and decanoate), and long-chain (palmitate) fatty acids ( T able 5). High CoA
concentrations inhibited CsHCS1. Using a non-linear regression substrate inhibition
model, the K of CsHCS1 was estimated to be 5.101 ± 1.8 mM. CoA did not inhibit
CsHCS2 at the concentrations tested. Decanoic acid inhibited CsHCS2 (K = 120.8 ± 47.9
µM) and slightly inhibited CsHCS1 in concentrations above 4 mM (K not measured) .
These data show the same trends as the kinetic data presented above.
Table 5:Kinetic properties of CsHCS1 and CsHCS2.
Substrate CsHCS1 CsHCS2
K V ( pKat) K V ( pKat) k (s )
m max m max cat
CoA 0.26 ± 0.05 µM - 0.16 ± 0.01 µM - -
butanoate >10 mM - >10 mM - -
hexanoate 3.7 ± 0.7 mM 6.8 ± 0.7 261 ± 37 µM 1.8 ± 0.05 57.6
decanoate 1.7 ± 0.2 mM 1.8 ± 0.7 16.1 ± 5.8 µM 1.6 ± 0.1 10.0
palmitate n.d. - 1.3 ± 0.5 µM 0.4 ± 0.01 2.4
not determined due to lack of catalytic activity
Example 4:Synthesis of Olivetolic Acid using CsHCS2
CsHCS2 was used for the chemoenzymatic synthesis of the aromatic polyketide
olivetolic acid. Olivetolic acid is the first committed precursor for cannabinoid
biosynthesis. This in vitro synthesis made use of four recombinant enzymes:CsHCS2,
malonyl-CoA synthetase (MCS) from Rhizobium leguminosarum, olivetol
synthase/polyketide synthase from cannabis, and olivetolic acid synthase from cannabis.
Malonyl-CoA synthetase (MCS) was amplified from genomic DNA of Rhizobium
leguminosarum with the primers MCS forward and MCS reverse (see Table 3). The PCR
product was cloned into pCR8/GW/TOPO vector (Invitrogen) recombined into pHIS8/GW
vector. After verification by sequencing, the plasmid was transformed into the E. coli
Rosetta II (DE3). Recombinant MCS was expressed and purified as described for the
CsHCS enzymes.
The cloning, expression and purification of olivetol synthase/ polyketide synthase
and olivetolic acid synthase were done as follows. For expression in E. coli cells, the
open reading frames of polyketide synthase/olivetol synthase and olivetolic acid synthase
were amplified by PCR, cloned into pHIS8/GW for polyketide synthase/olivetol synthase
or pET100 ( I nvitrogen) for olivetolic acid synthase and transformed into E. coli BL21
(DE3) (Invitrogen) . Cloning was verified by sequencing.
Olivetolic acid synthase was expressed in 200 mL terrific broth culture while
polyketide synthase/olivetol synthase grown in a 1 L culture. Both cultures were
incubated at 30°C/150 rpm shaking, induced with 0.5 M IPTG and grown overnight. The
cultures were centrifuged at 16,000 g for 20 min, and the pellets lysed by treatment with
lysozyme and sonication. The cleared lysates were mixed with Talon resin (200 L for
olivetolic acid synthase, 1 mL for polyketide synthase/olivetol synthase; Clontech),
washed with 5 mL of His-tag Wash Buffer (50 mM Tris-HCl (pH 7), 150 mM NaCl, 20 mM
imidazole, 10 mM -mercaptoethanol) and the recombinant proteins eluted using His-tag
Elution Buffer (2 0 mM Tris HCl (pH 7), 150 mM NaCl, 100 mM imidazole, 10 mM -
mercaptoethanol). The eluate was concentrated using a YM10 concentrator and the
buffer exchanged to Storage Buffer (20 mM HEPES (pH 7.5), 25 mM NaCl, 10% glycerol,
mM DTT). The final protein solutions were quantified by using an RC/DC protein assay
kit (Bio-Rad) which found protein concentrations of 0.5 mg/mL (olivetolic acid synthase)
and 5.6 mg/mL (polyketide synthase/olivetol synthase). SDS-PAGE gel analysis
confirmed the purity of both proteins.
The ability to couple hexanoyl-CoA synthesis with aromatic polyketide synthesis
using inexpensive reagents was tested by performing enzyme assays consisting of 4 mM
hexanoate, 8 mM malonate, 0.4 mM CoA, 0.4 mM ATP, 5 mM MgCl , 2 mM DTT, 20 mM
HEPES pH 7.5, 0.3 µg CsHCS2, 12 µg MCS, 8 µg olivetol synthase/PKS and 10 µg
OAS. The reaction was incubated at room temperature for 16 h, acidified and extracted in
ethyl acetate. The polar fraction was recovered, evaporated to dryness and resuspended
in 50 µL of methanol. An aliquot ( 5 µL) was analyzed by LCMS, and products were
identified by their retention times and masses (see Figure 4).
Example 5:Synthesis of Olivetolic Acid in Yeast using CsHCS1 and CsHCS2
Yeast (Saccharomyces cerevisiae) was engineered to produce olivetolic acid by
using CsHCS1 and CsHCS2 to synthesize hexanoyl-CoA, and a fusion of the cannabis
olivetol synthase/polyketide synthase (PKS) and olivetolic acid synthase (O AS) to form
olivetolic acid.
OAS was cloned in frame with the olivetol synthase/PKS using a synthetic linker
sequence encoding the amino acids AATSGSTGSTGSTGSGRSTGSTGSTGSGRSHMV
(SEQ ID NO:11) in the pESC-Trp yeast expression vector (Stratagene) under control of
the GAL10 promoter. The open reading frame of CsHCS1 was cloned into the yeast
expression vector pYESDEST52-Ura ( I nvitrogen) using Gateway technology. The open
reading frame of CsHCS2 was cloned into pESC-Trp yeast expression vector
(Stratagene) under control of the GAL1 promoter.
Yeast cells (InVSc I, Invitrogen) were transformed with the above constructs
(OAS:olivetol synthase/PKS fusion alone, OAS:o livetol synthase/PKS fusion and
CsHCS1; OAS:olivetol synthase/PKS fusion and CsHCS2) and the transformants grown
on a SD-Trp plate for 3 days at 28°C. For each, a single colony was inoculated into 3 mL
of SD-Trp glucose medium and incubated with shaking at 28°C for 2 days. A 0.5 mL
aliquot of starter culture was used to inoculate 10 mL of SD-Trp galactose medium
containing 1 mM sodium hexanoate and incubated at 20°C for 4 days. The complete
culture was extracted with ethyl acetate, dried and the residue resuspended in 100 µL of
30% acetonitrile/70% water/0.05% formic acid. The products were analyzed using LCMS
( see Figure 5) .
Example 6:Role of CsHSC1 and CsHSC2 in Cannabinoid Biosynthesis in Plants
Through a sequence-based analysis of the trichome EST dataset and biochemical
assay of five AAEs, two that possess hexanoyl-CoA synthetase activity were identified
(CsHSC1 and CsHSC2). To determine which of these is likely to be involved in the
cannabinoid biosynthetic pathway, qRT-PCR and sub-cellular localization experiments
were performed.
qRT-PCR of CsHSC1 and CsHSC2 expression
F inola plants were grown from seed until mid -flowering stage. Roots, stems,
leaves, female flowers (w ith trichomes and after trichome isolation using the Beadbeater) ,
trichome cells and male flowers were sampled from three plants. Total RNA was isolated
as described above. RNA had an Abs :Abs of >1.9 and showed distinct ribosomal
260 280
bands on denaturing gel. First-strand cDNA were synthesized using 0.5 µg RNA with a
QuantiTect cDNA Synthesis kit ( Q iagen). Each 20 µL cDNA sample was diluted 1:4 with
water, and 1 µL used as a PCR template. Gene-specific primers were designed to
produce amplicons of 90-200 bp. PCR reactions (2 0 µL) were performed in 96-well plates
using a SYBR Green based assay ( Q uantiFast SYBR Green kit, Qiagen) with a StepOne
Plus instrument (Applied Biosystems). The cycling parameters used were 95°C for 5 min
followed by 40 cycles of 95°C for 10 s, 60°C for 30 s, and a standard dissociation protocol
(95°C 15 s, 60°C for 1 min, 60-95°C in 0.3°C increments for 15 s). Experiments were
performed using cDNAs from three plants with two technical replicates. Actin, which was
found to have stable expression in all tissues tested, was used as a reference gene. The
efficiencies for all primer pairs were 90-110% as calculated using the standard curve
method. C values were calculated using StepOne Software ( Applied Biosystems). The
Ct
2 method was used for relative gene expression analysis.
Subcellular localization of CsHSC1 and CsHSC2
YFP:CsHSC1 and YFP:CsHSC2 fusions were constructed by recombination into
pEARLYGATE104 (Earley, K.W., Haag, J.R., Pontes, O., Opper, K., Juehne, T., Song, K.
and Pikaard, C.S. (2006). Gateway-compatible vectors for plant functional genomics and
proteomics. Plant J. 45, 616-629.) using LR recombinase (I nvitrogen). To generate an
OLS:CFP construct, OLS lacking a stop codon was cloned into pCR8/GW/TOPO before
recombination into pEARLYGATE102 using LR recombinase. The peroxisome marker
PX-CK (Nelson, B.K., Cai, X. and Nebenführ, A. (2 007). A multicolored set of in vivo
organelle markers for co-localization studies in Arabidopsis and other plants. Plant J. 51,
1126-1136.) was from ABRC (www.arabidopsis.org) . Plasmids were transformed into
Agrobacterium tumefaciens GV3101 by electroporation and selected on LB plates
containing 10 µg/mL rifampacin and 50 µg/mL kanamycin. Leaves of two-week old
Nicotiana benthamiana plants were infiltrated with the Agrobacterium solution at an OD
of 0.02 (Sparkes, I.A., Runions, J., Kearns, A. and Hawes, C. ( 2006). Rapid, transient
expression of fluorescent fusion proteins in tobacco plants and generation of stably
transformed plants. Nat. Protocol. 1, 2019-2025.). Two days post-infiltration, leaf
epidermal cells were visualized using a Zeiss LSM510 confocal microscope. CFP was
visualized with excitation 458 nm and image collection with a 475-525 nm bandpass filter;
YFP at 514 nm with a 530-600 nm bandpass filter. Images were collected and analyzed
using the Zeiss LSM software package.
The data provides evidence that CsHSC1 is the enzyme involved in cannabinoid
biosynthesis. CsHSC1 was the most abundant transcript in the EST catalog, and qRT-
PCR data shows that its expression is over 100-fold higher in trichome cells compared to
other tissues (Figure 6). Furthermore, CsHSC1 is localized to the cytosol as evidenced by
the sub-cellular localization experiment, which is the same compartment where the
putative cannabinoid enzyme OLS is localized. The substrate preference of CsHSC1
provides additional evidence for its role in cannabinoid biosynthesis since it shows more
specificity for hexanoate and other short-chain fatty acyl CoAs than CsHSC2 (Figure 3).
Although CsHSC1 is the enzyme likely involved in cannabinoid biosynthesis in
plants, CsHSC2 is more efficient than CsHSC1 at synthesizing hexanoyl-CoA. However,
CsHSC2 is localized to the peroxisome and it is not clear how hexanoyl-CoA formed in
this compartment could be exported to the cytoplasm where the polyketide synthesis
phase of the cannabinoid pathway is located. CsHSC2 accepts a very broad range of
substrates, indicating that it is a more generalized acyl-CoA synthetase that may function
in peroxisomal -oxidation.
Both CsHSC1 and CsHSC2 are valuable industrial tools. Knocking out CsHSC1 in
cannabis plants could lead to a major reduction in cannabinoid levels in the plant, which
is very desirable for hemp breeders. Over-expression of CsHSC1 in cannabis could lead
to elevated cannabinoid levels, which is useful for pharmaceutical purposes. On the other
hand, CsHSC2 would be particular useful in reconstituting cannabinoid formation in
microorganisms or in an in vitro system.
Example 7:Generation of Mutants in the CsHSC1 and CsHSC2 genes using Targeted
Induced Local Lesions IN Genomes (TILLING)
Identification of cannabis plants with mutations in the CsHSC1 or CsHCS2 genes
can be accomplished using TILLING. A mutagenized population of cannabis plants is
screened using oligonucleotide primers and PCR in order to amplify the genes of interest.
Amplified mutant genes are annealed to wild-type genes to find mismatches between the
mutant genes and the wild-type genes. Detected differences are used to identify plants
that contain mutations in one of both of the CsHSC1 or CsHCS2 genes. Plants containing
mutations that lead to altered amino acids in positions that are essential for the stability or
alkanoyl-CoA synthetase activity of CsHSC1 or CsHCS2 proteins are unable to produce
alkanoyl-CoA precursors for cannabinoid biosynthesis. The resulting plants contain
reduced or altered levels cannabinoid products.
The present invention provides genes which encode two alkanoyl CoA synthetase
enzymes from cannabis. These genes could be used to create, through breeding,
targeted mutagenesis or genetic engineering, cannabis plants with enhanced cannabinoid
production. In addition, inactivating or silencing a gene of the invention in cannabis could
be used to block cannabinoid biosynthesis and thereby reduce production of
cannabinoids such as THCA, the precursor of THC, in cannabis plants (e.g. industrial
hemp). The genes of the present invention could be used, in combination with genes
encoding other enzymes in the cannabinoid pathway, to engineer cannabinoid
biosynthesis in other plants or in microorganisms or in cell-free systems, or to produce
analogs of cannabinoid compounds or analogs of cannabinoid precursors.
Throughout the present disclosure, reference is made to publications, contents of
the entirety of each of which are incorporated by this reference.
Other advantages that are inherent to the invention are obvious to one skilled in
the art. The embodiments are described herein illustratively and are not meant to limit
the scope of the invention as claimed. Variations of the foregoing embodiments will be
evident to a person of ordinary skill and are intended by the inventors to be encompassed
by the following claims.
Claims (29)
1. An isolated or purified nucleic acid molecule comprising a nucleotide sequence having at least 75% sequence identity to SEQ ID NO:1 or a codon degenerate nucleotide sequence thereof, wherein the nucleic acid molecule encodes a polypeptide having alkanoyl-CoA activity.
2. The nucleic acid molecule of Claim 1, wherein the nucleotide sequence is as set forth in SEQ ID NO:1 or a codon degenerate nucleotide sequence thereof.
3. An isolated or purified nucleic acid molecule comprising a nucleotide sequence having at least 75% sequence identity to SEQ ID NO:3 or a codon degenerate nucleotide sequence thereof, wherein the nucleic acid molecule encodes a polypeptide having alkanoyl-CoA activity.
4. The nucleic acid molecule of Claim 3, wherein the nucleotide sequence is as set forth in SEQ ID NO:3 or a codon degenerate nucleotide sequence thereof.
5. The isolated or purified nucleic acid molecule of any one of Claims 1 to 4, wherein the nucleic acid molecule is cDNA.
6. The isolated or purified nucleic acid molecule of any one of Claims 1 to 5, further comprising a label, optionally a fluorescent label.
7. An isolated or purified polypeptide comprising an amino acid sequence having at least 85% sequence identity to SEQ ID NO:2 or a conservatively substituted amino acid sequence thereof, wherein the polypeptide has alkanoyl-CoA activity.
8. An isolated or purified polypeptide comprising an amino acid sequence having at least 85% sequence identity to SEQ ID NO:4 or a conservatively substituted amino acid sequence thereof, wherein the polypeptide has alkanoyl-CoA activity.
9. The polypeptide of Claim 7 or 8, further comprising a label, optionally a fluorescent label.
10. A vector, construct or expression system comprising the nucleic acid molecule of any one of Claims 1 to 6.
11. A host cell transformed with the nucleic acid molecule of any one of Claims 1 to 6, wherein the host cell is not within a human body.
12. A process of synthesizing an alkanoyl-CoA comprising: reacting carboxylic acid with CoA in presence of the polypeptide of any one of Claims 7 to 9.
13. The process of Claim 12, wherein the carboxylic acid has from 2 to 10 carbon atoms.
14. The process of Claim 12, wherein the alkanoyl-CoA comprises hexanoyl-CoA.
15. A process of altering levels of cannabinoid compounds in a cannabis plant, cannabis cell or cannabis tissue comprising using the nucleic acid molecule of any one of Claims 1 to 6, or a part thereof, to silence in the cannabis plant, cannabis cell or cannabis tissue a gene that encodes an enzyme that catalyzes synthesis of an alkanoyl-CoA, in comparison to a similar variety of organism, cell or tissue grown under similar conditions but without the use of the nucleic acid molecule for silencing.
16. A process of altering levels of cannabinoid compounds in a non-human organism, cell or tissue comprising mutating genes in the non-human organism, cell or tissue, and using the nucleic acid molecule of any one of Claims 1 to 6 to select for organisms, cells or tissues containing mutants or variants of a gene that encodes an enzyme that catalyzes synthesis of an alkanoyl-CoA.
17. A process of altering levels of cannabinoid compounds in a non-human organism, cell or tissue comprising expressing or over-expressing an exogenous nucleic acid molecule of any one of Claims 1 or 6 in the non-human organism, cell or tissue, in comparison to a similar variety of organism, cell or tissue grown under similar conditions but without the expressing or over-expressing of the exogenous nucleic acid molecule.
18. A process of altering levels of cannabinoid compounds in a non-human organism, cell or tissue comprising expressing or over-expressing an exogenous nucleic acid molecule encoding the polypeptide of any one of Claims 7 to 9 in the non-human organism, cell or tissue, in comparison to a similar variety of organism, cell or tissue grown under similar conditions but without the expressing or over-expressing of the exogenous nucleic acid molecule.
19. The process of Claim 17 or 18, wherein the level of the cannabinoid compound is increased.
20. The process of Claim 17 or 18, wherein the level of the cannabinoid compound is decreased.
21. A process of synthesizing a naturally-occurring cannabinoid compound or a non- naturally occurring analog of a cannabinoid compound in a non-human organism, cell or tissue comprising introducing and expressing the nucleic acid molecule of any one of Claims 1 to 6 in the non-human organism, cell or tissue in the presence of a carboxylic acid and CoA.
22. The process of any one of Claims 17 to 21, wherein the non-human organism is a microorganism.
23. The process of Claim 22, wherein the microorganism is Saccharomyces cerevisiae yeast or E. coli.
24. The process of any one of Claims 17 to 23, wherein the nucleic acid molecule is expressed or over-expressed in combination with expression or over-expression of one or more other nucleic acids that encode one or more enzymes in a cannabinoid biosynthetic pathway.
25. The process of Claim 24, wherein the one or more enzymes in a cannabinoid biosynthetic pathway is one or more of an olivetolic acid synthase, a type III polyketide synthase, a polyketide cyclase, an aromatic prenyltransferase or a cannabinoid-forming oxidocylase.
26. The process of Claim 25, wherein the one or more enzymes in a cannabinoid biosynthetic pathway is one or more of a type III polyketide synthase/olivetol synthase, a geranylpyrophosphate:olivetolate geranyltransferase, a -tetrahydrocannabinolic acid synthase, a cannabidiolic acid synthase or a cannabichromenic acid synthase.
27. The process of any one of Claims 16 to 26, wherein the cannabinoid compound is one or more of cannabigerolic acid, -tetrahydrocannabinolic acid, cannabidiolic acid, cannabichromenic acid, -tetrahydrocannabinol, cannabidiol or cannabichromene or a cannabinoid compound analog thereof comprising a side-chain of 1 to 9 carbon atoms in length.
28. A process of synthesizing an alkanoyl-CoA in an in vitro cell-free reaction, said process comprising: reacting a carboxylic acid with coenzyme A through the action of the polypeptide of any one of Claims 7 to 9.
29. An isolated or purified nucleic acid molecule according to any one of Claims 1 to 6 substantially as herein described with reference to the
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201161507331P | 2011-07-13 | 2011-07-13 | |
US61/507,331 | 2011-07-13 | ||
PCT/CA2012/000656 WO2013006953A1 (en) | 2011-07-13 | 2012-07-13 | Genes and proteins for alkanoyl-coa synthesis |
Publications (2)
Publication Number | Publication Date |
---|---|
NZ621037A NZ621037A (en) | 2016-02-26 |
NZ621037B2 true NZ621037B2 (en) | 2016-05-27 |
Family
ID=
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US9546362B2 (en) | Genes and proteins for alkanoyl-CoA synthesis | |
US11306335B2 (en) | Genes and proteins for aromatic polyketide synthesis | |
CA2770774C (en) | Aromatic prenyltransferase from cannabis | |
EP2234474B1 (en) | Diacylglycerol acyltransferase 2 genes and proteins encoded thereby from algae | |
Liu et al. | Increasing seed mass and oil content in transgenic Arabidopsis by the overexpression of wri1-like gene from Brassica napus | |
NZ621037B2 (en) | Genes and proteins for alkanoyl-coa synthesis | |
CA2724995A1 (en) | Reduction of lyso-phosphatidylcholine acyltransferase activity | |
WO2010132988A1 (en) | Increased seed oil and abiotic stress tolerance mediated by plant chd3 protein |