NZ613162B2 - Methods of preparation of conjugates - Google Patents
Methods of preparation of conjugates Download PDFInfo
- Publication number
- NZ613162B2 NZ613162B2 NZ613162A NZ61316212A NZ613162B2 NZ 613162 B2 NZ613162 B2 NZ 613162B2 NZ 613162 A NZ613162 A NZ 613162A NZ 61316212 A NZ61316212 A NZ 61316212A NZ 613162 B2 NZ613162 B2 NZ 613162B2
- Authority
- NZ
- New Zealand
- Prior art keywords
- carbon atoms
- group
- optionally substituted
- linear
- branched
- Prior art date
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/55—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
- A61K31/551—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole having two nitrogen atoms, e.g. dilazep
- A61K31/5513—1,4-Benzodiazepines, e.g. diazepam or clozapine
- A61K31/5517—1,4-Benzodiazepines, e.g. diazepam or clozapine condensed with five-membered rings having nitrogen as a ring hetero atom, e.g. imidazobenzodiazepines, triazolam
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
- A61K47/545—Heterocyclic compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6867—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from a cell of a blood cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D487/00—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00
- C07D487/02—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00 in which the condensed system contains two hetero rings
- C07D487/04—Ortho-condensed systems
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D519/00—Heterocyclic compounds containing more than one system of two or more relevant hetero rings condensed among themselves or condensed with a common carbocyclic ring system not provided for in groups C07D453/00 or C07D455/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Abstract
method for preparing a conjugate comprising a cell-binding agent (CBA) conjugated to a cytotoxic compound with a linking group, the method comprising reacting a modified cytotoxic compound with a modified CBA at a pH of about 4 to about 9, wherein: a) the modified CBA comprises a residue of a bifunctional crosslinking agent bonded to the CBA, and the residue comprises the linking group and a thiolreactive group; and b) the modified cytotoxic compound comprises a thiol group, and is produced by reacting an imine-containing cytotoxic compound bearing the thiol group with an imine reactive reagent, and wherein the imine-containing cytotoxic compound is represented by one of the compounds in the abstract image. The disclose also relates to methods of preparing similar conjugates using a variety of methods. nctional crosslinking agent bonded to the CBA, and the residue comprises the linking group and a thiolreactive group; and b) the modified cytotoxic compound comprises a thiol group, and is produced by reacting an imine-containing cytotoxic compound bearing the thiol group with an imine reactive reagent, and wherein the imine-containing cytotoxic compound is represented by one of the compounds in the abstract image. The disclose also relates to methods of preparing similar conjugates using a variety of methods.
Description
METHODS OF PREPARATION OF ATES
REFERENCE TO D APPLICATIONS
This application claims priority from U.S. Provisional Application No. ,062,
filed on February 15, 2011, U.S. Provisional Application No. 61/483,499, filed on May 6,
2011, and U.S. Provisional Application No. 61/443,092, filed on February 15, 2011, the
entire contents of which, including all drawings, formulae, specifications, and claims, are
incorporated herein by reference.
FIELD OF THE INVENTION
This invention bes the use of imine reactive reagents for the preparation of
conjugates of cell-binding agents with DNA-binding cytotoxic drugs containing one or
more imine functional groups.
BACKGROUND OF THE INVENTION
Monoclonal antibodies are increasingly being ed as therapeutic agents
against cancer. Several onal antibodies against cancer cell- surface antigens have
already been approved for cancer ent, such as mab for dgkin's
lymphoma, trastuzumab for breast cancer, cetuximab for head and neck and colorectal
, cetuximab, mumab, and bevacizumab for colorectal cancer, and alemtuzumab
for chronic lymphocytic leukemia (Strome, S. E., Sausville, E. A., and Mann, D., 2007,
The Oncologist, 12, 1084-1095). However, the xic activity of a "naked" antibody can
be limited to the isms of receptor function inhibition, complement-dependent
cytotoxicity (CDC), and antibody-dependent cell-mediated cytotoxicity (ADCC).
An approach to enhance the cytotoxic activity of antibody toward target cancer
cells is by linking antibody with cytotoxic effectors (A. D. Ricart, and A. W. Tolcher,
2007, Nat. Clin. Pract. Oncol. 4, 245-255; Lambert, J., 2010, Drugs of the Future 35, 471-
480). The antibody-cytotoxic drug conjugate (ADC) binds specifically to cancer cells,
followed by conjugate internalization and degradation, which results in the intracellular
release of the toxic drug and ultimately to the death of the cancer cells. The cytotoxic drugs
that have been employed in linkage with antibodies include antitubulin drugs such as
maytansinoids and auristatins, DNA-binding drugs such as calicheamicin that causes
sequence- specific double-stranded DNA cleavage. Another class of DNA- binding
cytotoxic drugs includes imine-containing pyrrolobenzodiazepines (PBD) such as N
imidazolyl alkyl substituted 1,2,5-benzothiadiazepine- 1, 1 -dioxide, U.S. Pat. No. 6,
156,746), benzo-pyrido or dipyrido thiadiazepine (), pyrrolo [1,2-b]
[1,2,5] benzothiadiazepines and pyrrole [1,2-b] [1,2,5] benzodiazepine derivatives
(WO2007/015280), tomaymycin derivatives (e.g. , pyrrolo[l,4]benzodiazepines), such as
those described in WO 00/12508, WO2005/085260, WO2007/085930, EP 2019104, and
US patent No. 6,156,746). Other DNA-binding benzodiazepine drugs are described in US
Patent Publication No. 2010/0203007A1. These benzodiazepine drugs containing imine
bonds bind to the minor groove of DNA and interfere with DNA function, ing in cell
death.
There is a need for new methods for preparing conjugates of cell-binding agent and
cytotoxic drugs bearing an imine group.
BRIEF SUMMARY OF THE INVENTION
The present invention describes the use of imine-reactive reagents for treating an
containing drug, which resulted in an unexpected improvement in its conjugation
on with cell binding agents (CBA) such as antibodies. The reagents are such that the
cell killing properties of the drug are not diminished and the integrity of the CBA
(antibody) is fully maintained.
[06a] In one aspect, the present ion provides a method for preparing a conjugate
sing a cell-binding agent (CBA) conjugated to a cytotoxic compound with a linking
group, the method comprising reacting a ed cytotoxic compound with a ed
CBA at a pH of about 4 to about 9, wherein:
a) the modified CBA comprises a residue of a bifunctional crosslinking agent bonded
to the CBA, and the residue comprises the linking group and a thiol-reactive group; and
b) the modified cytotoxic nd comprises a thiol group, and is ed by
ng an imine-containing cytotoxic compound bearing the thiol group with an imine
reactive reagent, and wherein the imine-containing cytotoxic compound is represented by
one of the following formulae:
or a pharmaceutically acceptable salt thereof, wherein:
X’ is selected from -H, an amine-protecting group, an optionally substituted linear,
ed or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a
polyethylene glycol unit -(CH2CH2O)n-Rc, an optionally substituted aryl having 6 to 18
carbon atoms, an optionally substituted 5- to 18-membered heteroaryl ring containing one
or more heteroatoms independently selected from nitrogen, oxygen, and sulfur, and an
ally substituted 3- to bered heterocyclic ring containing 1 to 6 heteroatoms
independently ed from O, S, N and P;
Y’ is selected from -H, an oxo group, an optionally substituted linear, branched or
cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, an optionally substituted
6- to 18-membered aryl, an optionally substituted 5- to 18-membered heteroaryl ring
containing one or more heteroatoms independently selected from nitrogen, , and
sulfur, an optionally substituted 3 to 18-membered heterocyclic ring having 1 to 6
heteroatoms;
Rc is -H or a substituted or unsubstituted linear or branched alkyl having 1 to 4
carbon atoms;
R1, R2, R3, R4, R1’, R2’, R3’ and R4’ are each independently selected from the group
consisting of -H, an ally substituted linear, branched or cyclic alkyl, l or
alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(OCH2CH2)n-Rc,
halogen,guanidinium [-NH(C=NH)NH2], -OR, -NR’R’’, -NO2, -NCO, -NR’COR’’, -SR, a
sulfoxide ented by -SOR’, a sulfone represented by -SO2R’, a sulfonate -SO3-M+, a
e -OSO3-M+, a sulfonamide represented by -SO2NR’R’’, cyano, an azido, -COR’, -
OCOR’, -OCONR’R’’;
R, for each occurrence, is independently selected from the group consisting of -H,
an ally substituted linear, branched or cyclic alkyl, l or alkynyl having from 1
to 10 carbon atoms, a polyethylene glycol unit -(CH2CH c, an ally substituted
2O) n-R
aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18-membered heteroaryl
ring containing one or more heteroatoms independently selected from nitrogen, oxygen,
and sulfur, or an optionally substituted 3- to 18-membered heterocyclic ring ning 1
to 6 heteroatoms independently selected from O, S, N and P;
R’ and R’’ are each independently selected from -H, -OH, -OR, -NHR, -NR2, -
COR, an optionally substituted linear, branched or cyclic alkyl, l or alkynyl having
from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH2CH c, and an optionally
2O) n-R
substituted 3membered heterocyclic ring having 1 to 6 heteroatoms ndently
selected from O, S, N and P;
n is an integer from 1 to 24;
W is selected from C=O, C=S, CH2, BH, SO and SO2;
R6 is -H, -R, -OR, -SR, -NR’R’’, -NO2, or, n;
Z and Z’ are independently selected from -(CH2)n’ -, -(CH2)n’ -CR 7R8-(CH 2)na’ -, -
(CH 2)n’ -NR 9-(CH 2)na’ -, -(CH2)n’ -O-(CH 2)na’ - and -(CH2)n’ –S-(CH 2)na’ -;
n’ and na’ are the same or ent, and are ed from 0, 1, 2 and 3;
R7 and R8 are the same or different, and are each independently selected from -H, -
OH, -SH, -COOH, -NHR’, a polyethylene glycol unit -(OCH 2CH 2)n-, an amino acid, a
peptide unit bearing 2 to 6 amino acids, an optionally substituted linear, branched or cyclic
alkyl having from 1 to 10 carbon atoms;
R9 is independently selected from -H, an optionally substituted linear, branched or
cyclic alkyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(OCH2CH 2)n-;
A and A’ are the same or different, and are independently selected from -O-, oxo (-
C(=O)-), -CRR’O-, , -S-, -CRR’S-, -N(R5)- and -CRR’N(R5)-,
R5 for each occurrence is independently -H or an optionally substituted linear or
branched alkyl having 1 to 10 carbon atoms;
D and D’ are the same or different, and are ndently absent or selected from
the group consisting of an optionally substituted linear, branched or cyclic alkyl, alkenyl or
alkynyl having 1 to 10 carbon atoms, an amino acid, a peptide bearing 2 to 6 amino acids,
and a polyethylene glycol unit (-OCH2CH 2)n-; and
L is absent, or when present, comprises the thiol group, or is a polyethylene glycol
unit (-OCH2CH 2)n-, a linear, branched or cyclic alkyl or alkenyl having 1 to 10 carbon
atoms, a phenyl group, a 3- to 18-membered heterocyclic ring or a 5- to 18-membered
heteroaryl ring having 1 to 6 atoms independently selected from O, S, N and P,
wherein the alkyl, alkenyl, phenyl, or heterocyclic or heteroaryl ring is optionally
substituted; and
the imine reactive reagent is selected from the group consisting of sulfites (H2SO 3,
H2SO -, SO 2- or HSO - formed with a cation), metabisulfite (H
2 or a salt of HSO3 3 2 2S2O5 or a
salt of S2O52- formed with a cation), mono, di, tri, and tetra- thiophosphates (PO3SH 3,
PO 3-, PO 3-, POS 3- or PS 3- formed with a
2S2H3, POS3H3, PS4H3 or a salt of PO3S 2S2 3 4
cation), thio phosphate esters ((RiO) i), RiSH, RiSOH, RiSO iSO
2PS(OR 2H, R 3H), s
amines (hydroxyl amine (e.g. , NH2OH), hydrazine (e.g. , NH2NH i, Ri’NH-Ri,
2), NH2O-R
NH i), NH , thiosulfate (H 2- formed
2-R 2-CO-NH 2, NH2-C(=S)-NH 2 2S2O3 or a salt of S2O3
with a cation), dithionite (H2S2O4 or a salt of S2O42- formed with a cation),
phosphorodithioate (P(=S)(ORk)(SH)(OH) or a salt thereof formed with a cation),
hydroxamic acid (RkC(=O)NHOH or a salt formed with a cation), hydrazide
(R kCONHNH - formed
2), formaldehyde sulfoxylate (HOCH2SO 2H or a salt of HOCH2SO 2
with a cation, such as O -Na +), glycated nucleotide (such as GDP-mannose),
fludarabine or a mixture thereof, wherein Ri and Ri’ are each ndently a linear or
branched alkyl having 1 to 10 carbon atoms and are substituted with at least one
substituent ed from -N(Rj)2, -CO2H, -SO3H, and -PO3H; Ri and Ri’ can be r
optionally substituted with a tuent for an alkyl described herein; Rj is a linear or
branched alkyl having 1 to 6 carbon atoms; Rk is a linear, branched or cyclic alkyl, l
or alkynyl having 1 to 10 carbon atoms, aryl, heterocyclyl or heteroaryl.
[06b] In another aspect, the present invention provides a method for preparing a
ate comprising a cell-binding agent (CBA) conjugated to a cytotoxic nd
with a linking group, the method comprising reacting the CBA with an imine-containing
cytotoxic compound, an imine reactive reagent, and a bifunctional crosslinking agent
comprising the linking group to form the conjugate, wherein the imine-containing
cytotoxic compound is represented by any one of the following formulas, or a
pharmaceutically able salt thereof:
wherein:
X’ is selected from -H, an amine-protecting group, an optionally substituted linear,
branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a
polyethylene glycol unit -(CH2CH2O)n-Rc, an optionally substituted aryl having 6 to 18
carbon atoms, an optionally substituted 5- to 18-membered heteroaryl ring containing one
or more atoms independently selected from nitrogen, oxygen, and , and an
ally substituted 3- to 18-membered heterocyclic ring containing 1 to 6 heteroatoms
independently selected from O, S, N and P;
Y’ is selected from -H, an oxo group, an optionally tuted linear, branched or
cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, an optionally substituted
6- to 18-membered aryl, an optionally substituted 5- to 18-membered heteroaryl ring
containing one or more heteroatoms ndently selected from nitrogen, oxygen, and
sulfur, an optionally substituted 3 to 18-membered heterocyclic ring having 1 to 6
heteroatoms;
Rc is -H or a substituted or tituted linear or branched alkyl having 1 to 4
carbon atoms;
R1, R2, R3, R4, R1’, R2’, R3’ and R4’ are each independently selected from the group
consisting of -H, an optionally substituted linear, branched or cyclic alkyl, alkenyl or
alkynyl having from 1 to 10 carbon atoms, a hylene glycol unit -(OCH2CH2)n-Rc,
halogen,guanidinium [-NH(C=NH)NH2], -OR, -NR’R’’, -NO2, -NCO, -NR’COR’’, -SR, a
sulfoxide represented by -SOR’, a sulfone represented by -SO2R’, a sulfonate -SO3-M+, a
e -OSO3-M+, a sulfonamide represented by -SO2NR’R’’, cyano, an azido, -COR’, -
OCOR’, -OCONR’R’’ and the linking group;
R, for each occurrence, is independently selected from the group consisting of -H,
an ally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1
to 10 carbon atoms, a polyethylene glycol unit -(CH2CH c, an optionally substituted
2O) n-R
aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18-membered heteroaryl
ring containing one or more heteroatoms independently ed from nitrogen, ,
and sulfur, or an optionally substituted 3- to 18-membered heterocyclic ring containing 1
to 6 heteroatoms independently selected from O, S, N and P;
R’ and R’’ are each independently selected from -H, -OH, -OR, -NHR, -NR2, -
COR, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having
from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH2CH c, and an optionally
2O)n-R
substituted 3membered heterocyclic ring having 1 to 6 heteroatoms independently
selected from O, S, N and P;
n is an r from 1 to 24;
W is selected from C=O, C=S, CH2, BH, SO and SO2;
R6 is -H, -R, -OR, -SR, -NR’R’’, -NO2, or halogen;
Z and Z’ are independently selected from -(CH2)n’ -, -(CH2)n’ -CR 7R8-(CH 2)na’ -, -
(CH 2)n’ -NR 9-(CH 2)na’ -, n’ -O-(CH 2)na’ - and -(CH2)n’ –S-(CH 2)na’ -;
n’ and na’ are the same or different, and are selected from 0, 1, 2 and 3;
R7 and R8 are the same or ent, and are each independently selected from -H, -
OH, -SH, -COOH, -NHR’, a polyethylene glycol unit -(OCH 2CH 2)n-, an amino acid, a
peptide unit bearing 2 to 6 amino acids, an optionally substituted linear, branched or cyclic
alkyl having from 1 to 10 carbon atoms;
R9 is independently selected from -H, an optionally substituted linear, branched or
cyclic alkyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(OCH2CH 2)n-;
A and A’ are the same or different, and are ndently selected from -O-, oxo (-
C(=O)-), -CRR’O-, -CRR’-, -S-, -CRR’S-, -N(R5)- and -CRR’N(R5)-,
R5 for each occurrence is ndently -H or an optionally substituted linear or
branched alkyl having 1 to 10 carbon atoms;
D and D’ are the same or different, and are independently absent or selected from
the group consisting of an optionally substituted linear, branched or cyclic alkyl, alkenyl or
l having 1 to 10 carbon atoms, an amino acid, a peptide g 2 to 6 amino acids,
and a hylene glycol unit (-OCH2CH 2)n-; and
L is absent, or when present, comprises the thiol group, and is a polyethylene
glycol unit (-OCH2CH 2)n-, a linear, branched or cyclic alkyl or alkenyl having 1 to 10
carbon atoms, a phenyl group, a 3- to 18-membered cyclic ring or a 5- to 18-
ed heteroaryl ring having 1 to 6 heteroatoms independently selected from O, S, N
and P, wherein the alkyl, l, phenyl, or heterocyclic or aryl ring is optionally
substituted; and the imine reactive reagent is selected from the group consisting of sulfites
(H -, SO 2- or HSO - formed with a cation), metabisulfite
2SO 3, H2SO 2 or a salt of HSO3 3 2
(H 2- formed with a cation), mono, di, tri, and tetra- osphates
2S2O5 or a salt of S2O5
(PO 3-, PO 3-, POS 3- or PS 3- formed
3SH 3, PO2S2H3, POS3H3, PS4H3 or a salt of PO3S 2S2 3 4
with a cation), thio phosphate esters ((RiO) i), RiSH, RiSOH, RiSO iSO
2PS(OR 2H, R 3H),
s amines (hydroxyl amine (e.g. , NH2OH), hydrazine (e.g. , NH2NH i,
2), NH2O-R
Ri’NH-Ri, NH2-Ri), NH2-CO-NH , thiosulfate (H 2-
2, NH2-C(=S)-NH 2 2S2O3 or a salt of S2O3
formed with a cation), dithionite (H2S2O4 or a salt of S2O42- formed with a cation),
phosphorodithioate (P(=S)(ORk)(SH)(OH) or a salt thereof formed with a cation),
hydroxamic acid (RkC(=O)NHOH or a salt formed with a cation), hydrazide
(R kCONHNH - formed
2), dehyde sulfoxylate (HOCH2SO 2H or a salt of HOCH2SO 2
with a , such as HOCH2SO -Na +), glycated nucleotide (such as nnose),
fludarabine or a mixture thereof, wherein Ri and Ri’ are each independently a linear or
branched alkyl having 1 to 10 carbon atoms and are substituted with at least one
substituent selected from -N(Rj)2, -CO2H, -SO3H, and -PO3H; Ri and Ri’ can be further
optionally substituted with a substituent for an alkyl described ; Rj is a linear or
branched alkyl having 1 to 6 carbon atoms; Rk is a linear, branched or cyclic alkyl, alkenyl
or alkynyl having 1 to 10 carbon atoms, aryl, heterocyclyl or aryl.
[06c] In a further aspect, the present invention provides a method for preparing a
conjugate comprising a cell-binding agent (CBA) conjugated to a xic compound
with a linking group, the method comprising:
a) reacting a modified cytotoxic compound with a bifunctional crosslinking agent
comprising the linking group, a group reactive with the CBA (such as a thiol group, a
maleimide group, a haloacetamide group, or an amine group), and a group reactive with
the ed cytotoxic compound, to form a second modified cytotoxic compound
covalently bonded to a residue of the bifunctional crosslinking agent, wherein the residue
comprises the linking group and the group reactive with the CBA;
wherein the modified cytotoxic compound is produced by reacting an iminecontaining
cytotoxic compound with an imine reactive reagent, wherein the imine-
containing cytotoxic nd is represented by one of the ing as, or a
pharmaceutically acceptable salt thereof:
X’ is selected from -H, an amine-protecting group, an optionally substituted linear,
branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a
polyethylene glycol unit -(CH2CH2O)n-Rc, an optionally substituted aryl having 6 to 18
carbon atoms, an optionally substituted 5- to 18-membered heteroaryl ring containing one
or more heteroatoms independently selected from nitrogen, , and sulfur, and an
optionally substituted 3- to 18-membered heterocyclic ring containing 1 to 6 heteroatoms
independently selected from O, S, N and P;
Y’ is selected from -H, an oxo group, an optionally substituted linear, branched or
cyclic alkyl, l or alkynyl having from 1 to 10 carbon atoms, an optionally substituted
6- to 18-membered aryl, an optionally substituted 5- to 18-membered heteroaryl ring
containing one or more heteroatoms independently selected from nitrogen, , and
sulfur, an optionally substituted 3 to 18-membered heterocyclic ring having 1 to 6
atoms;
Rc is -H or a substituted or unsubstituted linear or branched alkyl having 1 to 4
carbon atoms;
R1, R2, R3, R4, R1’, R2’, R3’ and R4’ are each independently selected from the group
consisting of -H, an optionally substituted linear, branched or cyclic alkyl, alkenyl or
alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(OCH2CH2)n-Rc,
halogen,guanidinium [-NH(C=NH)NH2], -OR, -NR’R’’, -NO2, -NCO, -NR’COR’’, -SR, a
ide represented by -SOR’, a sulfone represented by -SO2R’, a sulfonate -SO3-M+, a
sulfate -OSO3-M+, a sulfonamide represented by -SO2NR’R’’, cyano, an azido, -COR’, -
OCOR’, -OCONR’R’’;
R, for each ence, is independently selected from the group consisting of -H,
an optionally substituted , branched or cyclic alkyl, alkenyl or alkynyl having from 1
to 10 carbon atoms, a polyethylene glycol unit -(CH2CH c, an optionally substituted
2O) n-R
aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18-membered heteroaryl
ring containing one or more heteroatoms independently selected from nitrogen, oxygen,
and sulfur, or an optionally substituted 3- to 18-membered heterocyclic ring containing 1
to 6 heteroatoms independently selected from O, S, N and P;
R’ and R’’ are each independently selected from -H, -OH, -OR, -NHR, -NR2, -
COR, an optionally substituted linear, ed or cyclic alkyl, alkenyl or alkynyl having
from 1 to 10 carbon atoms, a polyethylene glycol unit H c, and an optionally
2O) n-R
tuted 3membered heterocyclic ring having 1 to 6 heteroatoms independently
selected from O, S, N and P;
n is an integer from 1 to 24;
W is selected from C=O, C=S, CH2, BH, SO and SO2;
R6 is -H, -R, -OR, -SR, -NR’R’’, -NO2, or, halogen;
Z and Z’ are ndently selected from -(CH2)n’ -, -(CH2)n’ -CR 7R8-(CH 2)na’ -, -
(CH 2)n’ -NR 9-(CH 2)na’ -, -(CH2)n’ -O-(CH 2)na’ - and -(CH2)n’ –S-(CH 2)na’ -;
n’ and na’ are the same or different, and are selected from 0, 1, 2 and 3;
R7 and R8 are the same or different, and are each ndently selected from -H, -
OH, -SH, -COOH, -NHR’, a polyethylene glycol unit -(OCH 2CH 2)n-, an amino acid, a
peptide unit bearing 2 to 6 amino acids, an optionally substituted linear, branched or cyclic
alkyl having from 1 to 10 carbon atoms;
R9 is ndently selected from -H, an optionally tuted linear, branched or
cyclic alkyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(OCH2CH 2)n-;
A and A’ are the same or different, and are independently selected from -O-, oxo (-
C(=O)-), -CRR’O-, -CRR’-, -S-, -, -N(R5)- and -CRR’N(R5)-,
R5 for each occurrence is independently -H or an optionally substituted linear or
branched alkyl having 1 to 10 carbon atoms;
D and D’ are the same or different, and are independently absent or selected from
the group consisting of an optionally substituted linear, branched or cyclic alkyl, alkenyl or
alkynyl having 1 to 10 carbon atoms, an amino acid, a peptide bearing 2 to 6 amino acids,
and a polyethylene glycol unit (-OCH2CH 2)n-;
L is , or when present, comprises the thiol group, or is a polyethylene glycol unit (-
OCH 2CH 2)n-, a linear, branched or cyclic alkyl or alkenyl having 1 to 10 carbon atoms, a
phenyl group, a 3- to 18-membered heterocyclic ring or a 5- to 18-membered heteroaryl
ring having 1 to 6 heteroatoms independently selected from O, S, N and P, wherein the
alkyl, alkenyl, phenyl, or heterocyclic or heteroaryl ring is optionally substituted; and,
n the imine reactive reagent is ed from the group consisting of sulfites (H2SO 3,
H2SO -, SO 2- or HSO - formed with a ), metabisulfite (H
2 or a salt of HSO3 3 2 2S2O5 or a
salt of S2O52- formed with a cation), mono, di, tri, and tetra- thiophosphates (PO3SH 3,
PO 3-, PO 3-, POS 3- or PS 3- formed with a
2S2H3, POS3H3, PS4H3 or a salt of PO3S 2S2 3 4
), thio phosphate esters ((RiO) i), RiSH, RiSOH, RiSO iSO
2PS(OR 2H, R 3H), various
amines (hydroxyl amine (e.g. , , hydrazine (e.g. , NH2NH i, Ri’NH-Ri,
2), NH2O-R
NH i), NH , thiosulfate (H 2- formed
2-R 2-CO-NH 2, NH2-C(=S)-NH 2 2S2O3 or a salt of S2O3
with a cation), dithionite (H2S2O4 or a salt of S2O42- formed with a cation),
phosphorodithioate (P(=S)(ORk)(SH)(OH) or a salt thereof formed with a cation),
hydroxamic acid (RkC(=O)NHOH or a salt formed with a cation), hydrazide
(R kCONHNH - formed
2), formaldehyde sulfoxylate (HOCH2SO 2H or a salt of HOCH2SO 2
with a cation, such as HOCH2SO -Na +), glycated nucleotide (such as GDP-mannose),
fludarabine or a mixture thereof, wherein Ri and Ri’ are each independently a linear or
branched alkyl having 1 to 10 carbon atoms and are substituted with at least one
substituent selected from -N(Rj)2, -CO2H, -SO3H, and -PO3H; Ri and Ri’ can be further
optionally substituted with a substituent for an alkyl described herein; Rj is a linear or
branched alkyl having 1 to 6 carbon atoms; Rk is a linear, branched or cyclic alkyl, alkenyl
or alkynyl having 1 to 10 carbon atoms, aryl, heterocyclyl or aryl; and
b) ng the second modified cytotoxic compound with the CBA through the group
reactive with the CBA, at a pH of about 4 to about 9, to form the ate.
[06d] In another aspect, the present invention es a method for preparing a
conjugate sing a cell-binding agent (CBA) conjugated to a cytotoxic compound
with a linking group, the method comprising reacting a second modified cytotoxic
nd with the CBA at a pH of about 4 to about 9, wherein the second modified
cytotoxic compound comprises:
a residue of a bifunctional crosslinking agent bonded to the cytotoxic compound,
and the residue comprises the linking group and a reactive group selected from a ve
ester and a thiol-reactive group, and, is produced by ng an imine reactive reagent
with an imine-containing cytotoxic compound bearing the linking group and the reactive
group, wherein the imine-containing cytotoxic compound is represented by one of the
following formulae:
, or
or a pharmaceutically able salt thereof,
wherein:
X’ is selected from -H, -OH, an amine-protecting group, the linking group with the
reactive group bonded thereto, an optionally tuted linear, branched or cyclic alkyl,
alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -
(CH2CH2O)n-Rc, an optionally substituted aryl having 6 to 18 carbon atoms, an optionally
substituted 5- to bered aryl ring containing one or more heteroatoms
independently selected from nitrogen, oxygen, and sulfur, and an optionally substituted 3-
to 18-membered heterocyclic ring containing 1 to 6 heteroatoms independently ed
from O, S, N and P;
Y’ is selected from -H, an oxo group, the g group with the reactive group
bonded thereto, an optionally substituted linear, branched or cyclic alkyl, alkenyl or
alkynyl having from 1 to 10 carbon atoms, an optionally substituted 6- to bered
aryl, an optionally substituted 5- to 18-membered heteroaryl ring containing one or more
heteroatoms independently selected from nitrogen, oxygen, and sulfur, an optionally
substituted 3- to 18-membered heterocyclic ring having 1 to 6 heteroatoms;
Rc is -H or a substituted or unsubstituted linear or branched alkyl having 1 to 4
carbon atoms, or the linking group with the reactive group bonded thereto;
R1, R2, R3, R4, R1’, R2’, R3’ and R4’ are each independently selected from the group
consisting of -H, an optionally substituted linear, branched or cyclic alkyl, alkenyl or
l having from 1 to 10 carbon atoms, a polyethylene glycol unit -(OCH2CH c,
2)n-R
halogen, guanidinium [-NH(C=NH)NH2], -OR, -NR’R’’, -NO2, -NCO, -NR’COR’’, -SR, a
sulfoxide represented by -SOR’, a sulfone represented by -SO2R’, a sulfonate -SO3-M+, a
sulfate -OSO3-M+, a sulfonamide represented by ’R’’, cyano, an azido, -COR’, -
OCOR’, -OCONR’R’’, and the linking group with the ve group bonded thereto;
R, for each occurrence, is independently selected from the group consisting of -H,
an optionally substituted , branched or cyclic alkyl, alkenyl or alkynyl having from 1
to 10 carbon atoms, a polyethylene glycol unit -(CH2CH c, an optionally substituted
2O) n-R
aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18-membered heteroaryl
ring containing one or more heteroatoms ndently selected from en, oxygen,
and sulfur, or an optionally substituted 3- to 18-membered cyclic ring containing 1
to 6 heteroatoms independently ed from O, S, N and P;
R’ and R’’ are each independently selected from -H, -OH, -OR, -NHR, -NR2, -
COR, an ally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having
from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH2CH c, and an optionally
2O) n-R
substituted 3- to 18-membered heterocyclic ring having 1 to 6 heteroatoms independently
selected from O, S, N and P;
n is an integer from 1 to 24;
W is selected from C=O, C=S, CH2, BH, SO and SO2;
R6 is -H, -R, -OR, -SR, -NR’R’’, -NO2, halogen or the g group with the
reactive group bonded o;
Z and Z’ are independently selected from -(CH2)n’ -, -(CH2)n’ -CR 7R8-(CH 2)na’ -, -
(CH 2)n’ -NR 9-(CH 2)na’ -, -(CH2)n’ -O-(CH 2)na’ - and -(CH2)n’ –S-(CH 2)na’ -;
n’ and na’ are the same or different, and are selected from 0, 1, 2 and 3;
R7 and R8 are the same or different, and are each independently selected from -H, -
OH, -SH, -COOH, -NHR’, a polyethylene glycol unit -(OCH 2CH 2)n-, an amino acid, a
peptide unit bearing 2 to 6 amino acids, an ally substituted linear, branched or cyclic
alkyl having from 1 to 10 carbon atoms;
R9 is independently selected from -H, an optionally substituted linear, branched or
cyclic alkyl having from 1 to 10 carbon atoms, a hylene glycol unit -(OCH2CH 2)n-;
A and A’ are the same or different, and are independently selected from -O-, oxo (-
C(=O)-), -CRR’O-, -CRR’-, -S-, -CRR’S-, -NR5 and -CRR’N(R5)-;
R5 for each occurrence is ndently -H or an optionally substituted linear or
branched alkyl having 1 to 10 carbon atoms;
D and D’ are the same or different, and are independently absent or selected from
the group consisting of an optionally substituted linear, branched or cyclic alkyl, alkenyl or
alkynyl having 1 to 10 carbon atoms, an amino acid, a peptide bearing 2 to 6 amino acids,
and a polyethylene glycol unit (-OCH2CH 2)n-;
L is absent, the linking group with the reactive group bonded thereto, a
polyethylene glycol unit (-OCH2CH 2)n-, a linear, branched or cyclic alkyl or alkenyl
having 1 to 10 carbon atoms, a phenyl group, a 3 to 18-membered heterocyclic ring or a 5-
to 18-membered heteroaryl ring having 1 to 6 heteroatoms ndently ed from O,
S, N and P, wherein the alkyl or alkenyl is optionally substituted with the linking group
with the reactive group bonded thereto; phenyl or heterocyclic or heteroaryl ring can be
optionally tuted, wherein the substituent can be the linking group with the reactive
group bonded thereto; and
wherein the imine ve reagent is selected from the group consisting of sulfites
(H -, SO 2- or HSO - formed with a cation), sulfite
2SO 3, H2SO 2 or a salt of HSO3 3 2
(H 2- formed with a cation), mono, di, tri, and tetra- thiophosphates
2S2O5 or a salt of S2O5
(PO 3-, PO 3-, POS 3- or PS 3- formed
3SH 3, PO2S2H3, POS3H3, PS4H3 or a salt of PO3S 2S2 3 4
with a cation), thio phosphate esters ((RiO) i), RiSH, RiSOH, RiSO iSO
2PS(OR 2H, R 3H),
various amines (hydroxyl amine (e.g. , NH2OH), hydrazine (e.g. , NH2NH i,
2), NH2O-R
Ri’NH-Ri, NH2-Ri), NH2-CO-NH , thiosulfate (H 2-
2, NH2-C(=S)-NH 2 2S2O3 or a salt of S2O3
formed with a cation), dithionite (H2S2O4 or a salt of S2O42- formed with a cation),
orodithioate (P(=S)(ORk)(SH)(OH) or a salt thereof formed with a cation),
hydroxamic acid (RkC(=O)NHOH or a salt formed with a ), hydrazide
(R kCONHNH - formed
2), formaldehyde sulfoxylate (HOCH2SO 2H or a salt of O 2
with a cation, such as HOCH2SO -Na +), glycated nucleotide (such as GDP-mannose),
fludarabine or a mixture thereof, wherein Ri and Ri’ are each ndently a linear or
branched alkyl having 1 to 10 carbon atoms and are substituted with at least one
substituent selected from -N(Rj)2, -CO2H, -SO3H, and -PO3H; Ri and Ri’ can be further
ally substituted with a substituent for an alkyl described herein; Rj is a linear or
ed alkyl having 1 to 6 carbon atoms; Rk is a linear, branched or cyclic alkyl, alkenyl
or l having 1 to 10 carbon atoms, aryl, heterocyclyl or heteroaryl.
[06e] In a further aspect, the present invention provides a method for preparing a
conjugate of the following formula:
, or
or a pharmaceutically acceptable salt thereof, the method comprising reacting a
modified cytotoxic compound of the following formula,
or a pharmaceutically acceptable salt thereof, with a modified inding agent
(CBA) of the following formula, respectively, at a pH of about 4 to about 9,
wherein:
r is an r from 1 to 10;
Y is -SO3M; and
M is -H or a pharmaceutically acceptable cation.
In another embodiment, the present invention is directed to a method for preparing
a conjugate comprising a cell-binding agent (CBA) conjugated to a cytotoxic compound
with a linking group, the method comprising reacting a cytotoxic compound with a
modified CBA at a pH of about 4 to about 9, wherein:
a) the modified CBA comprises a residue of a bifunctional crosslinking agent
bonded to the CBA, and the e ses the linking group and a thiolreactive
group; and
b) the xic compound comprises a thiol group, and a group represented
wherein:
Y is a leaving group, and is a sulfite (HSO 3, HS0 2 or a salt of HSO 3 ,
SO3 or HS0 2 formed with a cation), metabisulfite (H2S20 5 or a salt of S20 5
formed with a cation), mono-, di-, tri-, and tetra- thiophosphate (PO 3SH3,
P0 2S2H2, POS3H2, PS4H2 or a salt of PO3S3 , P0 2S23 , POS33 or PS43 formed
with a cation), thio phosphate ester (P O PS OR ), P S-, R^O, 0 2, S0 ,
thiosulfate (HS 2O3 or a salt of S2O3 formed with a cation), dithionite (HS20 4 or
a salt of S20 42 formed with a cation), phosphorodithioate (P(=S)(ORk')(S)(OH)
or a salt thereof formed with a cation), hydroxamic acid (Rk OH or a salt
formed with a cation), formaldehyde sulfoxylate (HOCH2S0 2 or a salt of
HOCH2S0 2 formed with a , such as HOCH2S0 2 Na+) or a mixture thereof,
n R1is a linear or branched alkyl having 1 to 10 carbon atoms and is
substituted with at least one substituent selected from -N(R )2, -C0 2H, -SO 3H ,
and -PO 3H ; R1can be further optionally substituted with a substituent for an alkyl
described herein; R is a linear or branched alkyl having 1 to 6 carbon atoms; Rk
is a linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon
atoms, aryl, heterocyclyl or heteroaryl.
In certain embodiments, the cytotoxic compound is produced by reacting an
containing xic compound bearing the thiol group with an imine reactive
reagent.
In another embodiment, the present invention is directed to a method for
preparing a conjugate comprising a cell-binding agent (CBA) conjugated to a cytotoxic
nd with a linking group, the method comprising reacting the CBA with an
imine-containing cytotoxic nd, an imine reactive t, and a bifunctional
crosslinking agent sing the linking group to form the conjugate.
In another embodiment, the present invention is directed to a method for
preparing a conjugate comprising a cell-binding agent (CBA) ated to a cytotoxic
compound with a g group, the method comprising:
a) reacting a cytotoxic compound with a bifunctional crosslinking agent
comprising the linking group, a group reactive with the CBA (such as a
thiol group, a maleimide group, a haloacetamide group, or an amine
group), and a group reactive with the xic compound, to form a
modified cytotoxic compound covalently bonded to a residue of the
bifunctional crosslinking agent, wherein the residue comprises the linking
group and the group reactive with the CBA;
wherein the cytotoxic compound is represented by one of the following as,
or a pharmaceutically acceptable salt f:
wherein:
Y is a leaving group, and is a sulfite (HSO 3, HS0 2 or a salt of HSO 3 ,
SO3 or HSO 2 formed with a cation), sulfite (H2S2O5 or a salt of S2O5
formed with a cation), mono-, di-, tri-, and tetra- thiophosphate (PO 3SH3,
PO2S2H2, POS3H2, PS4H2 or a salt of PO3S3 , P0 3 , POS 3
2S2 3 or PS4 formed
with a ), thio phosphate ester (R O)2PS(OR ), R S-, R SO, R S0 2, S0 ,
thiosulfate (HS 2O3 or a salt of S2O3 formed with a cation), dithionite (HS 20 4 or
a salt of S20 42 formed with a cation), phosphorodithioate (P(=S)(ORk')(S)(OH)
or a salt thereof formed with a cation), hydroxamic acid (Rk C(=0)NOH or a salt
formed with a cation), formaldehyde sulfoxylate (HOCH 2SO2 or a salt of
HOCH +) or a mixture thereof,
2SO2 formed with a cation, such as HOCH 2SO2 Na
wherein R1is a linear or branched alkyl having 1 to 10 carbon atoms and is
substituted with at least one substituent selected from -N(R )2, -CO 2H , -SO 3H ,
and -PO 3H ; R1can be r optionally substituted with a substituent for an alkyl
described herein; R is a linear or ed alkyl having 1 to 6 carbon atoms; Rk
is a linear, branched or cyclic alkyl, l or alkynyl having 1 to 10 carbon
atoms, aryl, heterocyclyl or heteroaryl;
X' is selected from -H, an amine-protecting group, an optionally
substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to
carbon atoms, a polyethylene glycol unit -(CH2CH20 ) -R , an optionally
substituted aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18-
membered heteroaryl ring containing one or more heteroatoms independently
selected from nitrogen, oxygen, and sulfur, and an optionally substituted 3- to
18-membered heterocyclic ring containing 1 to 6 heteroatoms independently
selected from O, S, N and P ;
Y' is selected from -H, an oxo group, an optionally substituted linear,
branched or cyclic alkyl, alkenyl or l having from 1 to 10 carbon atoms,
an optionally substituted 6- to 18-membered aryl, an ally tuted 5- to
18-membered heteroaryl ring containing one or more heteroatoms independently
selected from nitrogen, oxygen, and sulfur, an optionally substituted 3 to 18-
membered heterocyclic ring having 1 to 6 heteroatoms;
R is -H or a substituted or tituted linear or branched alkyl having
1 to 4 carbon atoms;
R R2, R3, R4, Ri', R2', R3' and R4' are each independently selected from
the group consisting of -H, an optionally substituted linear, branched or cyclic
alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene
glycol unit -(OCH2CH2) -R , halogen, guanidinium [-NH(C=NH)NH2], -OR, -
NR'R", -NO 2, -NCO, -NR'COR", -SR, a sulfoxide represented by -SOR', a
sulfone represented by -S0 2R', a sulfonate -S0 3 M+, a sulfate -OS0 3 M+, a
sulfonamide represented by -S0 2NR'R", cyano, an azido, -COR', -OCOR', -
OCONR'R";
R, for each occurrence, is independently selected from the group
consisting of -H, an optionally substituted linear, branched or cyclic alkyl,
alkenyl or alkynyl having from 1 to 10 carbon atoms, a hylene glycol unit -
(CH2CH20 ) -R , an optionally substituted aryl having 6 to 18 carbon atoms, an
optionally substituted 5- to 18-membered heteroaryl ring containing one or more
heteroatoms independently selected from en, oxygen, and sulfur, or an
optionally substituted 3- to 18-membered heterocyclic ring containing 1 to 6
heteroatoms ndently selected from O, S, N and P ;
R' and R'' are each independently selected from -H, -OH, -OR, -NHR, -
NR2, -COR, an optionally substituted linear, branched or cyclic alkyl, alkenyl or
l having from 1 to 10 carbon atoms, a polyethylene glycol unit -
) -R , and an ally substituted 3membered heterocyclic ring
having 1 to 6 atoms independently selected from O, S, N and P ;
n is an integer from 1 to 24;
W is selected from C=0, C=S, CH2, BH, SO and S0 2;
R6 is -H, -R, -OR, -SR, -NR'R", -N0 2, or, halogen;
Z and Z' are independently selected from -(CH2) - , -(CH2) -CR7R -
(CH2) - , -(CH2) NR9-(CH2) , -(CH2) (CH 2) -S-(CH
a a - and -(CH2)
a 2) ;
n' and na' are the same or different, and are selected from 0, 1, 2 and 3;
R7 and R are the same or different, and are each independently selected
from -H, -OH, -SH, -COOH, -NHR', a polyethylene glycol unit -(OCH2CH2) -,
an amino acid, a peptide unit bearing 2 to 6 amino acids, an optionally
substituted linear, branched or cyclic alkyl having from 1 to 10 carbon atoms;
R9 is independently selected from -H, an optionally substituted linear,
branched or cyclic alkyl having from 1 to 10 carbon atoms, a polyethylene glycol
A and A' are the same or different, and are independently selected from -
0-, oxo (-C(=0)-), -CRR'O-, -CRR'-, -S-, -CRR'S-, -N(R5)- and -CRR'N(R5)-,
R5 for each occurrence is independently -H or an optionally substituted
linear or branched alkyl having 1 to 10 carbon atoms;
D and D' are the same or different, and are independently absent or
selected from the group consisting of an optionally substituted linear, branched
or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms, an amino acid, a
e bearing 2 to 6 amino acids, and a hylene glycol unit (-OCH2CH2) -
L is , or when t, comprises the thiol group, or is a
polyethylene glycol unit (-OCH2CH2) -, a linear, branched or cyclic alkyl or
alkenyl having 1 to 10 carbon atoms, a phenyl group, a 3- to 18-membered
cyclic ring or a 5- to 18-membered heteroaryl ring having 1 to 6
atoms independently selected from O, S, N and P, wherein the alkyl,
alkenyl, phenyl, or heterocyclic or heteroaryl ring is optionally substituted; and,
b) reacting the modified cytotoxic nd with the CBA through the
group reactive with the CBA, at a pH of about 4 to about 9, to form the
conjugate.
In any of the above embodiments, the imine-containing xic compound may
be represented by any one of the following as, or a pharmaceutically acceptable
salt thereof:
wherein:
X' is ed from -H, an amine-protecting group, an optionally
substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to
carbon atoms, a polyethylene glycol unit -(CH2CH20 ) -R , an optionally
substituted aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18-
membered heteroaryl ring containing one or more heteroatoms independently
selected from nitrogen, oxygen, and sulfur, and an optionally substituted 3- to
18-membered heterocyclic ring containing 1 to 6 heteroatoms ndently
selected from O, S, N and P ;
Y' is selected from -H, an oxo group, an optionally substituted linear,
branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms,
an optionally substituted 6- to 18-membered aryl, an optionally substituted 5- to
18-membered heteroaryl ring containing one or more heteroatoms independently
selected from en, oxygen, and , an optionally substituted 3 to 18-
membered heterocyclic ring having 1 to 6 heteroatoms;
R is -H or a substituted or unsubstituted linear or branched alkyl having
1 to 4 carbon atoms;
R R2, R3,
1 R4, R , R2', R3' and R4' are each independently selected from
the group consisting of -H, an optionally tuted linear, branched or cyclic
alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene
glycol unit -(OCH2CH2) -R , n, guanidinium [-NH(C=NH)NH2], -OR, -
NR'R", -N0 2, -NCO, -NR'COR", -SR, a sulfoxide represented by -SOR', a
sulfone represented by -S0 2R', a sulfonate -S0 M+, a sulfate -OS0 M+, a
sulfonamide represented by -S0 2NR'R", cyano, an azido, -COR', , -
R" and the linking group;
R, for each occurrence, is independently selected from the group
consisting of -H, an optionally substituted linear, branched or cyclic alkyl,
alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -
(CH2CH20 ) -R , an optionally substituted aryl having 6 to 18 carbon atoms, an
optionally substituted 5- to 18-membered heteroaryl ring containing one or more
heteroatoms independently ed from nitrogen, oxygen, and , or an
optionally substituted 3- to bered cyclic ring containing 1 to 6
heteroatoms independently selected from O, S, N and P;
R' and R'' are each independently ed from -H, -OH, -OR, -NHR, -
NR2, -COR, an optionally substituted linear, branched or cyclic alkyl, l or
alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -
(CH2CH20 ) -R , and an optionally substituted 3membered heterocyclic ring
having 1 to 6 heteroatoms independently selected from O, S, N and P;
n is an integer from 1 to 24;
W is selected from C=0, C=S, CH2, BH, SO and S0 2;
R6 is -H, -R, -OR, -SR, -NR'R", -N0 2, or halogen;
Z and Z ' are independently selected from -(CH2) - , -(CH2) --CR R8-
, -(CH2)„ -NR 9-(CH2)
a - , -(CH2) -0 -(CH2)„a - and -(CH2)„ - S-(CH2)
a - ;
n' and na' are the same or different, and are selected from 0, 1, 2 and 3;
R7 and R are the same or different, and are each independently selected
from -H, -OH, -SH, -COOH, -NHR', a polyethylene glycol unit -(OCH 2CH2) -,
an amino acid, a peptide unit g 2 to 6 amino acids, an optionally
substituted linear, branched or cyclic alkyl having from 1 to 10 carbon atoms;
R 9 is independently selected from -H, an optionally substituted linear,
branched or cyclic alkyl having from 1 to 10 carbon atoms, a polyethylene glycol
unit -(OCH 2CH2) -;
A and A' are the same or different, and are independently selected from -
0-, oxo (-C(=0)-), -CRR'O-, -CRR'-, -S-, -CRR'S-, -N(R5)- and -CRR'N(R 5)-,
R 5 for each ence is independently -H or an optionally substituted
linear or branched alkyl having 1 to 10 carbon atoms;
D and D' are the same or different, and are independently absent or
selected from the group ting of an optionally substituted linear, branched
or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms, an amino acid, a
peptide bearing 2 to 6 amino acids, and a polyethylene glycol unit (-OCH2CH2)n-
L is , or when present, comprises the thiol group, and is a
polyethylene glycol unit (-OCH2CH2) -, a linear, branched or cyclic alkyl or
alkenyl having 1 to 10 carbon atoms, a phenyl group, a 3- to 18-membered
heterocyclic ring or a 5- to 18-membered heteroaryl ring having 1 to 6
heteroatoms independently selected from O, S, N and P, wherein the alkyl,
alkenyl, phenyl, or heterocyclic or heteroaryl ring is optionally substituted.
In yet another embodiment, the present invention is directed to a method for
preparing a conjugate comprising a inding agent (CBA) conjugated to a cytotoxic
compound with a g group, the method comprising reacting a modified xic
compound with the CBA at a pH of about 4 to about 9, wherein the modified cytotoxic
compound comprises:
a) a residue of a tional crosslinking agent bonded to the cytotoxic
compound, and the residue comprises the linking group and a reactive
group selected from a reactive ester and a thiol-reactive group, and,
b) a group represented by:
wherein:
Y is a leaving group, and is a e (HS0 3, HS0 2 or a salt of HSO 3 ,
SO3 or HS0 2 formed with a ), metabisulfite (H2S20 5 or a salt of S20 5
formed with a cation), mono-, di-, tri-, and tetra- thiophosphate (PO 3SH3,
P0 2S2H2, POS3H2, PS4H2 or a salt of P0 3S3 , P0 2S23 , POS33 or PS43 formed
with a cation), thio phosphate ester (P O PS OR ), P S-, P SO, R S0 2, P SOs,
thiosulfate (HS2C"3 or a salt of S2C"3 formed with a cation), dithionite (HS20 4 or
a salt of S20 42 formed with a cation), phosphorodithioate (ORk')(S)(OH)
or a salt thereof formed with a cation), hydroxamic acid (Rk C(=0)NOH or a salt
formed with a cation), formaldehyde sulfoxylate (HOCH2S0 2 or a salt of
HOCH2S0 2 formed with a cation, such as HOCH2S0 2 Na+) or a mixture f,
wherein R1is a linear or branched alkyl having 1 to 10 carbon atoms and is
substituted with at least one substituent selected from -N(R )2, -C0 2H, -SO 3H ,
and -PO 3H ; R1can be further optionally substituted with a substituent for an alkyl
described herein; P is a linear or branched alkyl having 1 to 6 carbon atoms; Rk
is a linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon
atoms, aryl, heterocyclyl or heteroaryl.
In certain embodiments, the modified cytotoxic compound is ed by
reacting an imine reactive reagent with an imine-containing cytotoxic compound bearing
the linking group and the reactive group.
In any of the above embodiments, the modified cytotoxic compound is
represented by any one of the following formulas:
or a pharmaceutically acceptable salt f, wherein:
Y is a sulfite (HS0 2
3, HS0 2 or a salt of HS0 3 , S0 3 or HS0 2 formed
with a cation), metabisulfite (H2S2O5 or a salt of S2O5 formed with a cation),
mono-, di-, tri-, and tetra- thiophosphate (P0 3SH3, P0 2S2H2, POS3H2, PS4H2 or a
salt of P0 3S3 , PO2S23 , POS33 or PS43 formed with a cation), thio phosphate
ester ( O PS OR ), P S-, P SO, P SC , P SO , thiosulfate (HS20 3 or a salt of
S20 32- formed with a ), nite (HS20 4 or a salt of S20 42- formed with a
cation), phosphorodithioate (P(=S)(ORk )(S)(OH) or a salt thereof formed with a
cation), hydroxamic acid (Rk C(=0)NOH or a salt formed with a cation),
formaldehyde sulfoxylate (HOCH2S0 2 or a salt of HOCH2S0 2 formed with a
cation, such as HOCH2S0 2 Na+) or a e thereof, wherein R1is a linear or
branched alkyl having 1 to 10 carbon atoms and is substituted with at least one
tuent selected from -N(R )2, -C0 2H, -S0 3H, and -P0 3H; R can be further
optionally substituted with a tuent for an alkyl described herein; R is a
linear or branched alkyl having 1 to 6 carbon atoms; Rk is a linear, branched or
cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms, aryl, heterocyclyl or
heteroaryl;
X' is selected from -H, an protecting group, the linking group with
the reactive group bonded thereto, an optionally substituted linear, branched or
cyclic alkyl, l or alkynyl having from 1 to 10 carbon atoms, a polyethylene
glycol unit -(CH2CH20 ) -R , an optionally substituted aryl having 6 to 18 carbon
atoms, an optionally substituted 5- to 18-membered heteroaryl ring containing
one or more heteroatoms independently selected from nitrogen, oxygen, and
sulfur, and an optionally substituted 3- to 18-membered heterocyclic ring
containing 1 to 6 heteroatoms independently selected from O, S, N and P ;
Y' is selected from -H, an oxo group, the linking group with the reactive
group bonded thereto, an optionally substituted linear, branched or cyclic alkyl,
l or l having from 1 to 10 carbon atoms, an optionally substituted 6-
to 18-membered aryl, an optionally substituted 5- to 18-membered heteroaryl
ring containing one or more atoms independently selected from nitrogen,
oxygen, and sulfur, an ally substituted 3- to 18-membered heterocyclic
ring having 1 to 6 heteroatoms;
R is -H or a tuted or unsubstituted linear or branched alkyl having
1 to 4 carbon atoms, or the linking group with the reactive group bonded o;
R R2, R3,
1 R4, Ri', R2', R3' and R4' are each independently selected from
the group consisting of -H, an optionally substituted linear, branched or cyclic
alkyl, alkenyl or l having from 1 to 10 carbon atoms, a polyethylene
glycol unit -(OCH2CH2) -R , halogen, guanidinium [-NH(C=NH)NH2], -OR, -
NR'R", -N0 2, -NCO, -NR'COR", -SR, a sulfoxide represented by -SOR', a
sulfone represented by -S0 2R', a sulfonate -S0 3 M+, a sulfate -OS0 3 M+, a
sulfonamide represented by -S0 , cyano, an azido, -COR', -OCOR', -
R", and the linking group with the reactive group bonded thereto;
R, for each occurrence, is independently selected from the group
consisting of -H, an optionally tuted linear, branched or cyclic alkyl,
alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -
(CH2CH20 ) -R , an optionally substituted aryl having 6 to 18 carbon atoms, an
optionally tuted 5- to 18-membered aryl ring containing one or more
heteroatoms independently selected from nitrogen, oxygen, and sulfur, or an
optionally substituted 3- to 18-membered heterocyclic ring containing 1 to 6
heteroatoms independently selected from O, S, N and P ;
R' and R'' are each independently selected from -H, -OH, -OR, -NHR, -
NR2, -COR, an optionally substituted linear, branched or cyclic alkyl, alkenyl or
alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -
(CH2CH20 ) -R , and an optionally tuted 3- to 18-membered heterocyclic
ring having 1 to 6 heteroatoms independently selected from O, S, N and P;
n is an integer from 1 to 24;
W is selected from C=0, C=S, CH2, BH, SO and S0 2;
R6 is -H, -R, -OR, -SR, -NR'R", -N0 2, halogen or the linking group with
the reactive group bonded thereto;
Z and Z ' are independently selected from -(CH2) - , -(CH2) --CR R8-
(CH2 -, -(CH2V-NR 9-(CH2) , -(CH ) (CH ) and -(CH ) -S-(CH ) ;
a a a
n' and na' are the same or different, and are selected from 0, 1, 2 and 3;
R7 and R are the same or ent, and are each independently selected
from -H, -OH, -SH, -COOH, -NHR', a polyethylene glycol unit -(OCH2CH2) -,
an amino acid, a peptide unit bearing 2 to 6 amino acids, an optionally
tuted linear, branched or cyclic alkyl having from 1 to 10 carbon atoms;
R 9 is independently selected from -H, an optionally substituted linear,
branched or cyclic alkyl having from 1 to 10 carbon atoms, a polyethylene glycol
unit -(OCH2CH2) -;
A and A' are the same or different, and are independently selected from -
0-, oxo (-C(=0)-), -, -CRR'-, -S-, -CRR'S-, -NR5 and -CRR'N(R 5)-;
R 5 for each occurrence is independently -H or an optionally substituted
linear or branched alkyl having 1 to 10 carbon atoms;
D and D' are the same or different, and are independently absent or
selected from the group consisting of an optionally substituted , branched
or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms, an amino acid, a
peptide bearing 2 to 6 amino acids, and a polyethylene glycol unit (-OCH2CH2) -;
L is absent, the g group with the reactive group bonded thereto, a
polyethylene glycol unit (-OCH2CH2) -, a linear, branched or cyclic alkyl or
alkenyl having 1 to 10 carbon atoms, a phenyl group, a 3 to 18-membered
heterocyclic ring or a 5- to 18-membered heteroaryl ring having 1 to 6
atoms independently ed from O, S, N and P, wherein the alkyl or
alkenyl is optionally substituted with the linking group with the ve group
bonded thereto; phenyl or heterocyclic or heteroaryl ring can be optionally
substituted, wherein the substituent can be the linking group with the reactive
group bonded thereto.
In any of the above embodiments, the cytotoxic nd and the linking group
of the conju ate is represented by any one of the following formulas:
or a pharmaceutically acceptable salt f, wherein:
Y is a leaving group, and is a sulfite (HS0 3, HS0 2 or a salt of HSO 3 ,
SO3 or HS0 2 formed with a ), metabisulfite (H2S20 5 or a salt of S20 5
formed with a cation), mono-, di-, tri-, and tetra- thiophosphate (PO 3SH3,
P0 2S2H2, POS3H2, PS4H2 or a salt of PO3S3 , P0 2S23 , POS33 or PS43 formed
with a cation), thio phosphate ester (P O PS OR ), P S-, P SO, P SC , S0 ,
thiosulfate (HS2C"3 or a salt of S2C"3 formed with a cation), dithionite (HS20 4 or
a salt of S20 42 formed with a cation), phosphorodithioate (P(=S)(ORk')(S)(OH)
or a salt thereof formed with a cation), hydroxamic acid (Rk C(=0)NOH or a salt
formed with a cation), formaldehyde sulfoxylate (HOCH2S0 2 or a salt of
HOCH2S0 2 formed with a cation, such as HOCH2S0 2 Na+) or a mixture f,
wherein R1is a linear or branched alkyl having 1 to 10 carbon atoms and is
substituted with at least one substituent ed from -N(R )2, -C0 2H, -SO 3H ,
and -PO 3H ; R1can be further optionally substituted with a substituent for an alkyl
described ; R is a linear or branched alkyl having 1 to 6 carbon atoms; Rk
is a linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon
atoms, aryl, heterocyclyl or heteroaryl;
X' is selected from -H, an amine-protecting group, the linking group, an
optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having
from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH2CH20 ) -R , an
ally substituted aryl having 6 to 18 carbon atoms, an optionally substituted
- to 18-membered heteroaryl ring containing one or more heteroatoms
independently selected from nitrogen, oxygen, and sulfur, and an optionally
substituted 3- to 18-membered cyclic ring containing 1 to 6 heteroatoms
independently ed from O, S, N and P ;
Y' is selected from -H, an oxo group, the linking group, an optionally
substituted linear, ed or cyclic alkyl, alkenyl or alkynyl having from 1 to
carbon atoms, an optionally substituted 6- to 18-membered aryl, an optionally
substituted 5- to 18-membered heteroaryl ring ning one or more
heteroatoms independently selected from nitrogen, oxygen, and , an
optionally substituted 3- to 18-membered heterocyclic ring having 1 to 6
heteroatoms;
R is -H or a substituted or unsubstituted linear or branched alkyl having
1 to 4 carbon atoms, or the linking group;
R R2, R3, R4, Ri', R2', R3' and R4' are each independently selected from
the group consisting of -H, an optionally substituted linear, branched or cyclic
alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene
glycol unit -(OCH2CH2) -R , halogen, guanidinium [-NH(C=NH)NH2], -OR, -
NR'R", -N0 2, -NCO, -NR'COR", -SR, a sulfoxide represented by -SOR', a
e represented by -S0 2R', a ate -S0 M+, a sulfate -OS0 M+, a
sulfonamide ented by -S0 2NR'R", cyano, an azido, -COR', -OCOR', -
R" and the linking group;
M is -H or a pharmaceutically acceptable cation, such as Na+;
R, for each ence, is independently selected from the group
consisting of -H, an optionally substituted linear, branched or cyclic alkyl,
alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -
(CH2CH20 ) -R , an optionally substituted aryl having 6 to 18 carbon atoms, an
optionally substituted 5- to 18-membered heteroaryl ring containing one or more
heteroatoms independently selected from nitrogen, oxygen, and sulfur, or an
optionally substituted 3- to 18-membered heterocyclic ring containing 1 to 6
heteroatoms independently selected from O, S, N and P ;
R' and R'' are each independently ed from -H, -OH, -OR, -NHR, -
NR2, -COR, an ally substituted linear, branched or cyclic alkyl, alkenyl or
alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -
(CH2CH20 ) -R , and an optionally substituted 3membered heterocyclic ring
having 1 to 6 heteroatoms independently selected from O, S, N and P ;
n is an integer from 1 to 24;
W is ed from C=0, C=S, CH2, BH, SO and S0 2;
R6 is -H, -R, -OR, -SR, -NR'R", -N0 2, halogen or the linking group;
Z and Z ' are independently selected from -(CH2) - , -(CH2) -CR7R -
(CH2) , -(CH2) NR9-(CH2) , -(CH2V-CHCH2 - and -(CH2V -S-(CH
a a 2) a - ;
n' and na' are the same or ent, and are selected from 0, 1, 2 and 3;
R7 and R are the same or different, and are each independently selected
from -H, -OH, -SH, -COOH, -NHR', a polyethylene glycol unit -(OCH2CH2) -,
an amino acid, a peptide unit bearing 2 to 6 amino acids, an optionally
substituted linear, branched or cyclic alkyl having from 1 to 10 carbon atoms;
R9 is independently selected from -H, an optionally substituted linear,
branched or cyclic alkyl having from 1 to 10 carbon atoms, a polyethylene glycol
unit -(OCH2CH2)n-;
A and A' are the same or different, and are independently selected from -
0-, oxo )-), -, -CRR'-, -S-, -CRR'S-, -N(R5)- and -CRR'N(R 5)-,
R 5 for each occurrence is independently -H or an optionally substituted
linear or branched alkyl having 1 to 10 carbon atoms;
D and D' are the same or different, and are independently absent or
selected from the group consisting of an optionally substituted linear, branched
or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms, an amino acid, a
e bearing 2 to 6 amino acids, and a polyethylene glycol unit (-OCH2CH2) -;
L is absent, the linking group, a polyethylene glycol unit (-OCH2CH2)n-,
an optionally substituted linear, branched or cyclic alkyl or alkenyl having 1 to
carbon atoms, a phenyl group, a 3- to 18-membered cyclic ring or a 5-
to 18-membered heteroaryl ring having 1 to 6 heteroatoms independently
selected from O, S, N and P, wherein the alkyl or alkenyl is optionally
tuted with the linking group; phenyl or heterocyclic or heteroaryl ring can
be ally substituted, wherein the substituent can comprise the linking group.
Several preferred conjugates that may be produced according to any of the
methods of the ion include:
wherein CBA is a cell binding agent, such as an antibody, and r is an
r between 1-20, preferably between 1-10 or 1-5.
As used herein, when referring to a group (e.g., R , L, X ' etc.) "is/be" (or "is
not") the linking group or the linking group with the reactive group bounded thereto, it is
meant that the group "comprises" (or "does not se") the linking group or the
linking group with the reactive group bounded o.
BRIEF DESCRIPTION OF THE FIGURES
shows mass spectra of deglycosylated huMy9-6 -2 conjugates prepared
without and with ite, containing 1.4 DAR (A) and 3.1 DAR (B), respectively.
DAR: drug antibody ratio.
shows similar in vitro cytotoxicity of HuMy9Drug 2 conjugates
prepared without and with sodium bisulfite against CD33-antigen expressing HL60
cells.
shows similar in vitro xicity of anti-CD22 Ab-Drug 2 conjugates
prepared without and with sodium bisulfite against CD22-antigen expressing BJAB
cells.
shows reverse phase HPLC analysis of drug 2 and sodium bisulfite-
treated drug 2 .
shows MS analysis of deglycosylated huMy9SPDB-drug 1 prepared
with and without sodium bisulfite using 7 molar equivalents of 1 per antibody. A)
Conjugate prepared without sodium bisulfite with e 1.4 drug 1/Ab and antibody
species with up to three linked drug 1 molecules. B) Conjugate prepared with sodium
ite with average of 2.5 1/Ab and antibody species with up to seven linked drug 1
molecules.
shows that addition of sodium bisulfite conjugation reaction of drug 1 did
not result in fragmentation of antibody (non-reducing SDS-PAGE; gel chip analysis).
FIGs. 7-11 show exemplary methods of the present invention for preparing a
cell-binding agent-drug ate.
shows Mass Spectrometry (MS) analysis of deglycosylated My9
SPDB-1 made by conjugating an NHS ester containing compound 1 (one-step reagent
method) ly to antibody lysines, or conjugating compound Id to a dithiopyridine
modified antibody (two step method).
shows MS data for My9sulfo-SPDB-l made using a two-step method
under different pH conditions. Increased reaction time appears to be correlated with
sed CD33-antigen-independent in vitro cytotoxicity measured on HL60-QC cells
pretreated with 1 mM unconjugate huMy9-6. Antigen-dependent g for all
conjugates was similarly high (~4 pM IC ) . Short reaction time (1-3 h) is preferred to
minimize antibody ntation and in vitro non-specific cell killing for My9sulfo-
SPDB-1.
shows MS data for chKTI-sulfo-SPDB -1 made using a two-step method
with different compound Id / linker .
shows the use of covalent imine reactants to improve Ab-drug conjugate
specifications ( monomer and drug load).
shows the scheme for the two-step synthesis of the entative
antibody-drug conjugates.
shows the in vitro cytotoxicity and specificity of the huMy9SPDB -lf
conjugates against various cell lines. Note that sodium bisulfite was added to the
conjugation reaction for making the conjugate.
shows ation of dimer does not reduce binding affinity of antibody.
Note that sodium bisulfite was added to the conjugation reaction for making the
conjugate.
shows the in vivo antitumor ty of huMy9-6 conjugate. Note that
sodium bisulfite was added to the conjugation on for making the conjugate.
shows in vitro cytotoxicity of huMy9SPDB -lf conjugate against
antigen positive cells. Note that sodium bisulfite was added to the conjugation reaction
for making the conjugate.
1 shows in vitro cytotoxicity for huMy9SPDB -lf (A), huMy9
sulfoSPDB-lf (B) and huMy9BMPS -lf (C) against HL60/QC (Ag+) cells with and
without blocking of antigen binding sites. Note that in all three ments (34A, 34B,
and 34C), sodium bisulfite were added to the conjugation reaction for making the
conjugate.
shows in vitro xicity for chB38.1-SPDB -lf (A), and chB38.1-
sulfoSPDB-lf (B) against COLO205 (Ag+) cells. Note that in both experiments, sodium
bisulfite was added to the conjugation reaction for making the conjugate.
shows in vivo efficacy of huMy9SPDB -lf in HL60/QC bearing mice.
Note that sodium ite was added to the conjugation reaction.
shows antiproliferative activity by comparing (A) huMy9SPDB -lf,
(B) huMy9sulfoSPDB -lf, and (C) huMy9BMPS -lf, against OCI-AML3 (Ag+)
cells with and without blocking of antigen g sites. Note that in all three
experiments, sodium bisulfite was added to the conjugation reaction for making the
conjugate.
shows in vivo efficacy of huMy9BMPS -lf in MOLM-13 tumor
bearing mice. Note that sodium bisulfite was added to the conjugation reaction for
making the ate.
shows a entative synthesis scheme for a Sulfonated folate /
cytotoxic compound conjugate. Note that sodium ite was added to the ation
reaction for making the conjugate.
shows in vivo efficacy of huMy9drug 2 in MOLM-13 tumor bearing
mice. Note that sodium bisulfite was added to the conjugation reaction for making the
conjugate.
shows the preparation of 6-sulfo-SPDB -ld using the highly
reactive 4-nitroPy-sulfo-SPDB linker.
DETAILED DESCRIPTION OF THE INVENTION
Reference will now be made in detail to n embodiments of the invention,
examples of which are illustrated in the accompanying structures and formulas. While
the invention will be described in conjunction with the enumerated embodiments, it will
be understood that they are not intended to limit the invention to those embodiments.
On the contrary, the invention is intended to cover all alternatives, cations, and
equivalents which may be included within the scope of the present invention as defined
by the claims. One skilled in the art will ize many methods and materials similar
or equivalent to those described herein, which could be used in the practice of the
present invention.
It should be understood that any of the embodiments described herein, including
those described under different aspects of the invention {e.g., compounds, compoundlinker
molecules, conjugates, compositions, methods of making and using) and different
parts of the specification (including embodiments described only in the Examples) can
be combined with one or more other embodiments of the invention, unless explicitly
imed or improper. Combination of embodiments are not limited to those specific
combinations claimed via the multiple dependent claims.
Definitions
"Linear or branched alkyl" as used herein refers to a saturated linear or
branched-chain monovalent hydrocarbon radical of one to twenty carbon atoms.
es of alkyl include, but are not d to, methyl, ethyl, 1-propyl, 2-propyl, 1-
butyl, 2-methyl-l -propyl, -CH2CH(CH3)2), 2-butyl, 2-methylpropyl, 1-pentyl, 2-
pentyl 3-pentyl, 2-methylbutyl, 3-methylbutyl, 3-methyl-l -butyl, 2-methyl-lbutyl
, 1-hexyl), 2-hexyl, 3-hexyl, 2-methylpentyl, 3-methylpentyl, 4-methyl
pentyl, 3-methylpentyl, 2-methylpentyl, 2,3-dimethylbutyl, 3,3-dimethyl
butyl, 1-heptyl, 1-octyl, and the like. Preferably, the alkyl has one to ten carbon atoms.
More preferably, the alkyl has one to four carbon atoms.
"Linear or branched alkenyl" refers to linear or branched-chain monovalent
hydrocarbon radical of two to twenty carbon atoms with at least one site of unsaturation,
i.e., a -carbon, double bond, wherein the alkenyl radical includes radicals having
"cis" and " orientations, or alternatively, "E" and "Z" orientations. Examples
e, but are not limited to, ethylenyl or vinyl H2), allyl (-CH2CH=CH2), and
the like. Preferably, the alkenyl has two to ten carbon atoms. More preferably, the alkyl
has two to four carbon atoms.
"Linear or branched alkynyl" refers to a linear or branched monovalent
hydrocarbon radical of two to twenty carbon atoms with at least one site of unsaturation,
i.e., a carbon-carbon, triple bond. Examples include, but are not limited to, ethynyl,
propynyl, 1-butynyl, 2-butynyl, 1-pentynyl, 2-pentynyl, 3-pentynyl, hexynyl, and the
like. Preferably, the l has two to ten carbon atoms. More preferably, the alkynyl
has two to four carbon atoms.
The term cycle," "carbocyclyl" and "carbocyclic ring" refer to a
monovalent non-aromatic, saturated or partially unsaturated ring having 3 to 12 carbon
atoms as a monocyclic ring or 7 to 12 carbon atoms as a bicyclic ring. Bicyclic
ycles having 7 to 12 atoms can be ed, for example, as a bicyclo [4,5], [5,5],
[5,6], or [6,6] , and bicyclic carbocycles having 9 or 10 ring atoms can be
arranged as a bicyclo [5,6] or [6,6] system, or as bridged s such as
bicyclo[2.2.1]heptane, bicyclo[2.2.2]octane and bicyclo[3.2.2]nonane. Examples of
monocyclic carbocycles include, but are not limited to, cyclopropyl, cyclobutyl,
cyclopentyl, 1-cyclopent-l-enyl, l-cyclopentenyl, opentenyl, cyclohexyl, 1-
cyclohex-l-enyl, l-cyclohexenyl, l-cyclohexenyl, cyclohexadienyl, cycloheptyl,
cyclooctyl, cyclononyl, cyclodecyl, cycloundecyl, cyclododecyl, and the like.
The terms "cyclic alkyl" and "cycloalkyl" can be used interchangeably. They
refer to a monovalent saturated carbocyclic ring radical. Preferably, the cyclic alkyl is 3
to 7 membered monocyclic ring radical. More preferably, the cyclic alkyl is cyclohexyl.
The term "cyclic alkenyl" refers to a carbocyclic ring radical having at least one
double bond in the ring ure.
The term "cyclic alkynyl" refers to a carbocyclic ring radical having at least one
triple bond in the ring ure.
"Aryl" means a monovalent aromatic hydrocarbon radical of 6-18 carbon atoms
derived by the removal of one hydrogen atom from a single carbon atom of a parent
aromatic ring system. Some aryl groups are represented in the exemplary structures as
"Ar." Aryl includes bicyclic radicals comprising an aromatic ring fused to a saturated,
partially unsaturated ring, or aromatic carbocyclic or heterocyclic ring. Typical aryl
groups include, but are not d to, radicals derived from benzene (phenyl),
substituted benzenes, naphthalene, cene, l, indanyl, 1,2-dihydronapthalene,
1,2,3,4-tetrahydronapthyl, and the like. Preferably, aryl is phenyl group.
The terms "heterocycle," "heterocyclyl," and ocyclic ring" are used
interchangeably herein and refer to a ted or a partially unsaturated (i.e., having one
or more double and/or triple bonds within the ring) carbocyclic radical of 3 to 18 ring
atoms in which at least one ring atom is a heteroatom selected from nitrogen, oxygen,
phosphorus, and sulfur, the remaining ring atoms being C, where one or more ring atoms
is optionally substituted independently with one or more substituents described below.
A heterocycle may be a monocycle having 3 to 7 ring members (2 to 6 carbon atoms and
1 to 4 heteroatoms ed from N, O, P, and S) or a bicycle having 7 to 10 ring
members (4 to 9 carbon atoms and 1 to 6 heteroatoms selected from N, O, P, and S), for
example: a bicyclo [4,5], [5,5], [5,6], or [6,6] . Heterocycles are described in
Paquette, Leo A.; iples of Modern Heterocyclic Chemistry" (W. A . Benjamin,
New York, 1968), particularly Chapters 1, 3, 4, 6, 7, and 9; "The Chemistry of
Heterocyclic Compounds, A series of Monographs" (John Wiley & Sons, New York,
1950 to present), in particular Volumes 13, 14, 16, 19, and 28; and J . Am. Chem. Soc.
(1960) 82:5566. "Heterocyclyl" also includes radicals where cycle radicals are
fused with a saturated, partially unsaturated ring, or aromatic carbocyclic or heterocyclic
ring. Examples of heterocyclic rings include, but are not limited to, pyrrolidinyl,
tetrahydrofuranyl, dihydrofuranyl, tetrahydrothienyl, tetrahydropyranyl, dihydropyranyl,
ydrothiopyranyl, piperidino, morpholino, thiomorpholino, thioxanyl, piperazinyl,
homopiperazinyl, azetidinyl, oxetanyl, thietanyl, peridinyl, oxepanyl, thiepanyl,
oxazepinyl, diazepinyl, pinyl, olinyl, 3-pyrrolinyl, indolinyl, 2H-pyranyl,
4H-pyranyl, dioxanyl, oxolanyl, pyrazolinyl, dithianyl, dithiolanyl,
dihydropyranyl, dihydrothienyl, dihydrofuranyl, pyrazolidinylimidazolinyl,
imidazolidinyl, 3-azabicyco[3.1.0]hexanyl, 3-azabicyclo[4.1.0]heptanyl, and
azabicyclo[2.2.2]hexanyl. Spiro moieties are also included within the scope of this
definition. Examples of a heterocyclic group wherein ring atoms are substituted with
oxo (=0) moieties are pyrimidinonyl and 1,1-dioxo-thiomorpholinyl.
The term "heteroaryl" refers to a monovalent aromatic radical of 5- or 6-
membered rings, and includes fused ring systems (at least one of which is aromatic) of
-18 atoms, containing one or more heteroatoms ndently selected from nitrogen,
oxygen, and sulfur. Examples of heteroaryl groups are pyridinyl (including, for
example, 2-hydroxypyridinyl), imidazolyl, imidazopyridinyl, pyrimidinyl (including, for
example, 4-hydroxypyrimidinyl), pyrazolyl, triazolyl, pyrazinyl, tetrazolyl, furyl,
thienyl, isoxazolyl, lyl, oxazolyl, isothiazolyl, pyrrolyl, quinolinyl, isoquinolinyl,
indolyl, benzimidazolyl, benzofuranyl, cinnolinyl, indazolyl, indolizinyl, azinyl,
pyridazinyl, triazinyl, isoindolyl, pteridinyl, purinyl, oxadiazolyl, triazolyl, thiadiazolyl,
furazanyl, benzofurazanyl, benzothiophenyl, hiazolyl, benzoxazolyl, olinyl,
quinoxalinyl, naphthyridinyl, and furopyridinyl.
The heterocycle or heteroaryl groups may be carbon (carbon-linked) or en
(nitrogen-linked) attached where such is possible. By way of example and not
tion, carbon bonded heterocycles or heteroaryls are bonded at position 2, 3, 4, 5, or
6 of a pyridine, position 3, 4, 5, or 6 of a pyridazine, position 2, 4, 5, or 6 of a
pyrimidine, position 2, 3, 5, or 6 of a pyrazine, position 2, 3, 4, or 5 of a furan,
tetrahydrofuran, thiofuran, thiophene, pyrrole or tetrahydropyrrole, on 2, 4, or 5 of
an oxazole, imidazole or thiazole, position 3, 4, or 5 of an isoxazole, pyrazole, or
isothiazole, position 2 or 3 of an aziridine, position 2, 3, or 4 of an azetidine, position 2,
3, 4, 5, 6, 7, or 8 of a quinoline or position 1, 3, 4, 5, 6, 7, or 8 of an noline.
By way of example and not limitation, nitrogen bonded heterocycles or
heteroaryls are bonded at position 1 of an aziridine, azetidine, e, pyrrolidine, 2-
pyrroline, 3-pyrroline, imidazole, imidazolidine, 2-imidazoline, 3-imidazoline, pyrazole,
pyrazoline, zoline, 3-pyrazoline, piperidine, piperazine, indole, indoline, 1H-
indazole, position 2 of a isoindole, or isoindoline, position 4 of a morpholine, and
position 9 of a carbazole, or O-carboline.
The heteroatoms present in heteroaryl or heterocyclcyl include the oxidized
forms such as NO, SO, and S0 2.
The term "halo" or "halogen" refers to F, CI, Br or I .
The alkyl, alkenyl, alkynyl, cyclic alkyl, cyclic alkenyl, cyclic alkynyl,
carbocyclyl, aryl, heterocyclyl and heteroaryl described above can be optionally
substituted with one more (e.g., 2, 3, 4, 5, 6 or more) substituents.
If a substituent is described as being "substituted," a non-hydrogen substituent
is in the place of a hydrogen tuent on a carbon, oxygen, sulfur or nitrogen of the
substituent. Thus, for example, a substituted alkyl substituent is an alkyl substituent
wherein at least one non-hydrogen substituent is in the place of a en substituent
on the alkyl substituent. To illustrate, monofluoroalkyl is alkyl substituted with a fluoro
tuent, and difluoroalkyl is alkyl substituted with two fluoro substituents. It should
be recognized that if there is more than one tution on a tuent, each non-
hydrogen substituent may be identical or different (unless otherwise stated).
If a tuent is described as being "optionally substituted," the substituent
may be either (1) not substituted, or (2) substituted. If a carbon of a tuent is
described as being optionally substituted with one or more of a list of substituents, one
or more of the hydrogens on the carbon (to the extent there are any) may separately
and/or together be replaced with an independently selected optional substituent. If a
nitrogen of a substituent is bed as being optionally substituted with one or more of
a list of substituents, one or more of the hydrogens on the en (to the extent there
are any) may each be replaced with an independently selected optional substituent. One
exemplary substituent may be depicted as -NR'R", wherein R' and R" together with the
nitrogen atom to which they are attached, may form a cyclic ring. The
heterocyclic ring formed from R' and R" together with the nitrogen atom to which they
are attached may be lly or fully saturated. In one embodiment, the heterocyclic
ring consists of 3 to 7 atoms. In r embodiment, the heterocyclic ring is selected
from the group consisting of pyrrolyl, imidazolyl, pyrazolyl, triazolyl, tetrazolyl,
isoxazolyl, pyridyl and thiazolyl.
This specification uses the terms "substituent," "radical," and "group"
hangeably.
If a group of substituents are collectively described as being optionally
tuted by one or more of a list of substituents, the group may include: (1)
unsubstitutable substituents, (2) substitutable substituents that are not substituted by the
optional substituents, and/or (3) substitutable substituents that are substituted by one or
more of the optional tuents.
If a substituent is described as being optionally substituted with up to a particular
number of non-hydrogen substituents, that substituent may be either (1) not substituted;
or (2) substituted by up to that particular number of non-hydrogen substituents or by up
to the maximum number of substitutable positions on the substituent, whichever is less.
Thus, for example, if a substituent is described as a heteroaryl optionally substituted
with up to 3 non-hydrogen substituents, then any heteroaryl with less than 3
substitutable positions would be optionally tuted by up to only as many nonhydrogen
substituents as the heteroaryl has substitutable positions. Such substituents, in
non-limiting examples, can be selected from a linear, branched or cyclic alkyl, alkenyl
or alkynyl having from 1 to 10 carbon atoms, aryl, heteroaryl, heterocycyclyl, halogen,
inium [-NH(C=NH)NH2], , NR101R102, -N0 2, -NR101COR 102, -SR100, a
sulfoxide represented by -SOR101 , a sulfone represented by -S0 101 , a sulfonate -
S0 3M, a sulfate -OSO3M, a sulfonamide represented by -SO2NR101R102, cyano, an
azido, -COR 101 , -OCOR101 , -OCONR 2 and a polyethylene glycol unit (-
OCH2CH2) R101 wherein M is H or a pharmaceutically able cation (such as Na+ or
K+); R101 , R102 and R10 are each independently selected from H, linear, branched or
cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol
unit (-OCH2CH2) -R 104, n n is an integer from 1 to 24, an aryl having from 6 to 10
carbon atoms, a heterocyclic ring having from 3 to 10 carbon atoms and a heteroaryl
having 5 to 10 carbon atoms; and R104 is H or a linear or branched alkyl having 1 to 4
carbon atoms, wherein the alkyl, alkenyl, alkynyl, aryl, heteroaryl and heterocyclcyl in
the groups represented by R100, R101 , R102, R10 and R104 are optionally substituted with
one or more (e.g., 2, 3, 4, 5, 6 or more) substituents ndently selected from
halogen, -OH, -CN, -N0 2 and unsubstituted linear or branched alkyl having 1 to 4
carbon atoms. Preferably, the substituents for the optionally substituted alkyl, alkenyl,
alkynyl, cyclic alkyl, cyclic alkenyl, cyclic alkynyl, carbocyclyl, aryl, heterocyclyl and
heteroaryl bed above include halogen, -CN, -NR102R103 , -CF3, -OR101 , aryl,
heteroaryl, heterocycycl, -SR , -SOR , -S0 2R and -S0 3M .
The term "compound" or "cytotoxic compound," "cytotoxic dimer" and
"cytotoxic dimer compound" are used interchangeably. They are intended to include
compounds for which a structure or formula or any biologically active derivative thereof
has been disclosed in the present invention or a structure or formula or any derivative
thereof that has been incorporated by reference. The term also includes, stereoisomers,
geometric isomers, tautomers, es, metabolites, salts (e.g., pharmaceutically
acceptable salts) and prodrugs, and prodrug salts of a compound of all the ae
disclosed in the present invention. The term also includes any solvates, hydrates, and
polymorphs of any of the foregoing. The specific recitation of "stereoisomers,"
"geometric isomers," "tautomers," "solvates," "metabolites," "salt" "prodrug," "prodrug
salt," "conjugates," "conjugates salt," "solvate," "hydrate," or "polymorph" in n
aspects of the invention described in this application shall not be interpreted as an
intended omission of these forms in other aspects of the invention where the term
"compound" is used without recitation of these other forms. In one embodiment,
cytotoxic compound comprises a linking group or a linking group with a reactive group
bonded o. Alternatively, cytotoxic compound does not comprise a linking group
or a linking group with a reactive group bonded thereto.
The term "conjugate" as used herein refers to a compound described herein or a
tive thereof that is linked to a cell binding agent.
The term "linkable to a cell binding agent" as used herein refers to the
compounds described herein or derivates thereof comprising at least one linking group
or a precursor thereof le to bond these compounds or derivatives thereof to a cell
binding agent.
The term "precursor" of a given group refers to any group which may lead to
that group by any deprotection, a al modification, or a ng reaction.
The term "linked to a cell binding agent" refers to a conjugate molecule
comprising at least one of the compounds described herein (e.g., compounds and drug-
linker compounds describe herein), or derivative f bound to a cell binding agent
via a le linking group or a precursor f.
The term "chiral" refers to molecules which have the property of nonsuperimposability
of the mirror image r, while the term "achiral" refers to
molecules which are superimposable on their mirror image partner.
The term "stereoisomer" refers to compounds which have identical chemical
constitution and connectivity, but different orientations of their atoms in space that
cannot be interconverted by on about single bonds.
[ 1] "Diastereomer" refers to a stereoisomer with two or more centers of chirality
and whose molecules are not mirror images of one another. Diastereomers have
different physical properties, e.g. melting , boiling points, spectral properties, and
reactivities. Mixtures of diastereomers may separate under high resolution analytical
ures such as crystallization, electrophoresis and chromatography.
"Enantiomers" refer to two stereoisomers of a compound which are non-
superimposable mirror images of one another.
Stereochemical definitions and conventions used herein generally follow S. P.
Parker, Ed., -Hill Dictionary of Chemical Terms (1984) McGraw-Hill Book
Company, New York; and Eliel, E. and Wilen, S., "Stereochemistry of Organic
Compounds," John Wiley & Sons, Inc., New York, 1994. The compounds of the
invention may contain asymmetric or chiral s, and therefore exist in ent
stereoisomeric forms. It is intended that all stereoisomeric forms of the compounds of
the invention, including but not limited to, diastereomers, enantiomers and atropisomers,
as well as mixtures thereof such as racemic mixtures, form part of the present invention.
Many c compounds exist in optically active forms, i.e., they have the ability to
rotate the plane of plane-polarized light. In describing an optically active compound, the
prefixes D and L, or R and S, are used to denote the absolute uration of the
molecule about its chiral center(s). The prefixes d and I or (+) and (-) are employed to
designate the sign of rotation of polarized light by the compound, with (-) or 1
meaning that the compound is levorotatory. A compound prefixed with (+) or d is
dextrorotatory. For a given chemical structure, these stereoisomers are identical except
that they are mirror images of one another. A specific stereoisomer may also be referred
to as an enantiomer, and a mixture of such isomers is often called an enantiomeric
mixture. A 50:50 e of omers is referred to as a racemic mixture or a
racemate, which may occur where there has been no stereoselection or specificity
in a chemical reaction or process. The terms "racemic e" and "racemate" refer to
an equimolar mixture of two enantiomeric s, devoid of optical activity.
The term "tautomer" or "tautomeric form" refers to structural isomers of
different energies which are interconvertible via a low energy barrier. For example,
proton tautomers (also known as prototropic tautomers) include interconversions via
migration of a proton, such as keto-enol and imine-enamine isomerizations. Valence
tautomers include interconversions by reorganization of some of the bonding electrons.
The term "prodrug" as used in this application refers to a precursor or tive
form of a compound of the invention that is capable of being enzymatically or
hydrolytically activated or converted into the more active parent form. See, e.g.,
Wilman, "Prodrugs in Cancer herapy" Biochemical Society Transactions, 14, pp.
375-382, 615th Meeting Belfast (1986) and Stella et al., "Prodrugs: A Chemical
Approach to Targeted Drug Delivery," Directed Drug Delivery, Borchardt et al., (ed.),
pp. 247-267, Humana Press (1985). The prodrugs of this invention include, but are not
limited to, ester-containing prodrugs, phosphate-containing gs, thiophosphatecontaining
prodrugs, sulfate-containing prodrugs, peptide-containing prodrugs, D-amino
acid-modified prodrugs, glycosylated prodrugs, b-lactam-containing prodrugs,
optionally substituted phenoxyacetamide-containing gs, optionally substituted
phenylacetamide-containing prodrugs, rocytosine and other 5-fluorouridine
prodrugs which can be converted into the more active cytotoxic free drug. Examples of
cytotoxic drugs that can be derivatized into a prodrug form for use in this invention
include, but are not limited to, compounds of the invention and chemotherapeutic agents
such as described above.
The term "prodrug" is also meant to include a derivative of a compound that can
yze, oxidize, or otherwise react under ical conditions (in vitro or in vivo) to
provide a compound of this invention. gs may only become active upon such
reaction under biological conditions, or they may have activity in their unreacted forms.
Examples of prodrugs contemplated in this ion e, but are not limited to,
analogs or derivatives of compounds of any one of the formulae sed herein that
se biohydrolyzable moieties such as biohydrolyzable amides, biohydrolyzable
esters, biohydrolyzable carbamates, biohydrolyzable carbonates, biohydrolyzable
s, and biohydrolyzable phosphate analogues. Other examples of prodrugs include
derivatives of compounds of any one of the formulae disclosed herein that comprise -
NO, -N0 2, -ONO, or -ON0 2 moieties. Prodrugs can typically be prepared using well-
known methods, such as those bed by Burger's Medicinal Chemistry and Drug
Discovery (1995) 8, 949-982 (Manfred E . Wolff ed., 5th ed); see also Goodman
and Gilman's, The Pharmacological basis of Therapeutics, 8th ed., McGraw-Hill, Int.
Ed. 1992, "Biotransformation of Drugs."
One preferred form of prodrug of the invention includes compounds (with or
without any linker groups) and conjugates of the invention sing an adduct formed
between an imine bond of the compounds / conjugates and an imine reactive t.
The term "imine reactive reagent" refers to a reagent that is capable of reacting
with an imine group. Examples of imine reactive t includes, but is not limited to,
sulfites (H2S0 3, H2SO2 or a salt of HS0 2
3 , S0 3 or HS0 2 formed with a cation),
metabisulfite (H2S2O5 or a salt of S2O5 formed with a cation), mono, di, tri, and tetrathiophosphates
(P0 3SH3, P0 2S2H3, POS3H3, PS4H3 or a salt of P0 3S3 , P0 2S23 , POS33
or PS43 formed with a cation), thio phosphate esters ((R O)2PS(OR ), P SH, PJSOH,
R'SC^H, R'S0 3H), various amines (hydroxyl amine (e.g., NH2OH), hydrazine (e.g.,
NH2NH2), NH20-R\ R^NH-R , NH2-R'), NH2-CO-NH2, NH2-C(=S)-NH2 thiosulfate
(H2S20 3 or a salt of S20 32- formed with a cation), dithionite (H2S20 4 or a salt of S20 42-
formed with a cation), phosphorodithioate (ORk)(SH)(OH) or a salt f
formed with a cation), hydroxamic acid (RkC(=0)NHOH or a salt formed with a cation),
ide (RkCONHNH2), formaldehyde sulfoxylate (HOCH2S0 2H or a salt of
HOCH2S0 2 formed with a cation, such as HOCH2S0 2 Na+), glycated nucleotide (such
as GDP-mannose), fludarabine or a e thereof, wherein R1and R1 are each
independently a linear or branched alkyl having 1 to 10 carbon atoms and are substituted
with at least one substituent ed from -N(R )2, -C0 2H, -S0 3H, and -P0 3H; R and R
can be further optionally substituted with a tuent for an alkyl described herein; R
is a linear or branched alkyl having 1 to 6 carbon atoms; and Rk is a linear, branched or
cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms, aryl, heterocyclyl or
heteroaryl (preferably, Rk is a linear or branched alkyl having 1 to 4 carbon atoms; more
preferably, Rk is methyl, ethyl or propyl). Preferably, the cation is a monovalent cation,
such as Na+ or K+. Preferably, the imine reactive t is selected from sulfites,
hydroxyl amine, urea and hydrazine. More preferably, the imine ve reagent is
NaHS0 3 or KHS0 3.
As used herein and unless otherwise indicated, the terms "biohydrolyzable
" "biohydrolyzable ester," "biohydrolyzable carbamate," "biohydrolyzable
carbonate," "biohydrolyzable ureide" and "biohydrolyzable phosphate analogue"
mean an amide, ester, carbamate, carbonate, ureide, or phosphate analogue, respectively,
that either: 1) does not destroy the biological ty of the compound and confers upon
that nd advantageous properties in vivo, such as uptake, duration of , or
onset of action; or 2) is itself ically inactive but is converted in vivo to a
biologically active compound. Examples of biohydrolyzable amides include, but are not
limited to, lower alkyl amides, a-amino acid amides, alkoxyacyl amides, and
alkylaminoalkylcarbonyl amides. Examples of biohydrolyzable esters include, but are
not limited to, lower alkyl esters, acyloxy esters, alkyl acylamino alkyl esters, and
choline esters. Examples of biohydrolyzable carbamates include, but are not limited to,
lower alkylamines, substituted ethylenediamines, amino acids, hydroxyalkylamines,
heterocyclic and heteroaromatic amines, and polyether amines. ularly favored
gs and prodrug salts are those that increase the bioavailability of the compounds
of this invention when such compounds are administered to a mammal.
The phrase "pharmaceutically able salt" as used herein, refers to
pharmaceutically acceptable organic or inorganic salts of a compound of the ion.
Exemplary salts include, but are not limited, to sulfate, citrate, acetate, oxalate, chloride,
bromide, iodide, nitrate, bisulfate, phosphate, acid phosphate, otinate, lactate,
salicylate, acid citrate, tartrate, oleate, e, henate, bitartrate, ascorbate,
succinate, maleate, gentisinate, fumarate, gluconate, glucuronate, saccharate, formate,
benzoate, glutamate, methanesulfonate "mesylate," ethanesulfonate, benzenesulfonate,
p-toluenesulfonate, pamoate (i.e., l,l'-methylene-bis-(2-hydroxynaphthoate)) salts,
alkali metal (e.g., sodium and potassium) salts, alkaline earth metal (e.g., magnesium)
salts, and ammonium salts. A pharmaceutically acceptable salt may involve the
inclusion of another le such as an e ion, a succinate ion or other counter
ion. The counter ion may be any organic or inorganic moiety that stabilizes the charge
on the parent compound. Furthermore, a pharmaceutically able salt may have
more than one charged atom in its structure. Instances where multiple charged atoms are
part of the pharmaceutically able salt can have multiple counter ions. Hence, a
pharmaceutically acceptable salt can have one or more charged atoms and/or one or
more counter ion.
If the compound of the invention is a base, the desired pharmaceutically
acceptable salt may be prepared by any suitable method available in the art, for example,
treatment of the free base with an inorganic acid, such as hydrochloric acid,
hydrobromic acid, sulfuric acid, nitric acid, methanesulfonic acid, phosphoric acid and
the like, or with an organic acid, such as acetic acid, maleic acid, succinic acid, mandelic
acid, fumaric acid, malonic acid, pyruvic acid, oxalic acid, glycolic acid, salicylic acid, a
pyranosidyl acid, such as glucuronic acid or galacturonic acid, an alpha hydroxy acid,
such as citric acid or tartaric acid, an amino acid, such as aspartic acid or glutamic acid,
an aromatic acid, such as benzoic acid or cinnamic acid, a sulfonic acid, such as p-
esulfonic acid or ethanesulfonic acid, or the like.
If the compound of the invention is an acid, the desired pharmaceutically
acceptable salt may be prepared by any suitable method, for example, treatment of the
free acid with an inorganic or organic base, such as an amine (primary, secondary or
tertiary), an alkali metal hydroxide or alkaline earth metal ide, or the like.
rative examples of suitable salts include, but are not limited to, organic salts
derived from amino acids, such as glycine and arginine, ammonia, primary, ary,
and tertiary amines, and cyclic amines, such as piperidine, morpholine and piperazine,
and inorganic salts derived from sodium, calcium, potassium, magnesium, manganese,
iron, copper, zinc, aluminum and lithium.
As used herein, the term "solvate" means a compound which further includes a
stoichiometric or non-stoichiometric amount of solvent such as water, panol,
acetone, ethanol, methanol, DMSO, ethyl acetate, acetic acid, and lamine
dichloromethane, 2-propanol, or the like, bound by non-covalent intermolecular forces.
Solvates or hydrates of the compounds are readily prepared by addition of at least one
molar equivalent of a ylic solvent such as methanol, ethanol, 1-propanol, 2-
propanol or water to the nd to result in solvation or hydration of the imine
moiety.
A "metabolite" is a product produced through metabolism in the body of a
ied compound, a derivative thereof, or a ate f, or salt thereof.
Metabolites of a compound, a derivative f, or a conjugate thereof, may be
identified using routine techniques known in the art and their ties determined using
tests such as those described herein. Such products may result for example from the
oxidation, hydroxylation, reduction, hydrolysis, ion, deamidation, esterification,
deesterification, enzymatic cleavage, and the like, of the administered compound.
Accordingly, the invention includes metabolites of compounds, a derivative f, or a
conjugate thereof, of the invention, including compounds, a derivative thereof, or a
conjugate thereof, produced by a process comprising contacting a compound, a
derivative thereof, or a conjugate f, of this invention with a mammal for a period
of time sufficient to yield a metabolic t thereof.
The phrase "pharmaceutically acceptable" indicates that the substance or
composition must be compatible chemically and/or toxicologically, with the other
ingredients comprising a ation, and/or the mammal being treated therewith.
The term "protecting group" or "protecting moiety" refers to a substituent that
is commonly employed to block or protect a particular functionality while reacting other
functional groups on the compound, a derivative thereof, or a conjugate thereof. For
example, an "amine-protecting group" or an "amino-protecting moiety" is a
substituent attached to an amino group that blocks or protects the amino onality in
the compound. Such groups are well known in the art (see for example P . Wuts and T .
Greene, 2007, Protective Groups in Organic Synthesis, Chapter 7 , J . Wiley & Sons, NJ)
and exemplified by carbamates such as methyl and ethyl carbamate, FMOC, substituted
ethyl carbamates, carbamates cleaved by l,6 -P-elimination (also termed "self
immolative"), ureas, , peptides, alkyl and aryl derivatives. Suitable aminoprotecting
groups include acetyl, trifluoroacetyl, t-butoxycarbonyl (BOC),
benzyloxycarbonyl (CBZ) and 9-fluorenylmethylenoxycarbonyl (Fmoc). For a general
description of protecting groups and their use, see P . G.M. Wuts & T . W . Greene,
Protective Groups in Organic Synthesis, John Wiley & Sons, New York, 2007.
The term "leaving group" refers to an group of charged or uncharged moiety
that departs during a substitution or displacement. Such g groups are well known
in the art and include, but not d to, halogens, esters, , hydroxyl, tosylates,
triflates, mesylates, nitriles, azide, ate, disulfides, thioesters, hers and
diazonium compounds.
The term "bifunctional crosslinking agent," "bifunctional linker" or
"crosslinking agents" refers to modifying agents that s two reactive groups
connected to a "linking ; one of which is capable of reacting with a cell binding
agent while the other one reacts with the cytotoxic compound to link the two moieties
together. Such bifunctional crosslinkers are well known in the art (see, for example,
Isalm and Dent in jugation chapter 5, p218-363, Groves Dictionaries Inc. New
York, 1999). For example, bifunctional crosslinking agents that enable linkage via a
thioether bond include inimidyl(N-maleimidomethyl)-cyclohexane-l-
carboxylate (SMCC) to introduce ido groups, or with N-succinimidyl
(iodoacetyl)-aminobenzoate (SIAB) to introduce iodoacetyl groups. Other bifunctional
crosslinking agents that introduce maleimido groups or haloacetyl groups on to a cell
binding agent are well known in the art (see US Patent Applications 050310,
20050169933, available from Pierce Biotechnology Inc., P.O. Box 117, Rockland, IL
6 1105, USA) and include, but not limited to, bis-maleimidopolyethyleneglycol
(BMPEO), BM(PEO) 2, BM(PEO) 3, N-(p-maleimidopropyloxy)succinimide ester
(BMPS), g-maleimidobutyric acid N-succinimidyl ester , e-maleimidocaproic
acid N-hydroxysuccinimide ester (EMCS), 5-maleimidovaleric acid NHS, HBVS, N-
succinimidyl(N-maleimidomethyl)-cyclohexane-l-carboxy-(6-amidocaproate), which
is a "long chain" analog of SMCC CC), m-maleimidobenzoyl-N-
hydroxysuccinimide ester (MBS), 4-(4-N-maleimidophenyl)-butyric acid hydrazide or
HC1 salt (MPBH), N-succinimidyl 3-(bromoacetamido)propionate (SBAP), N-
succinimidyl iodoacetate (SIA), K-maleimidoundecanoic acid N-succinimidyl ester
(KMUA), N-succinimidyl 4-(p-maleimidophenyl)-butyrate (SMPB), succinimidyl(P-
maleimidopropionamido)hexanoate (SMPH), succinimidyl-(4-vinylsulfonyl)benzoate
(SVSB), dithiobis-maleimidoethane (DTME), 1,4-bis-maleimidobutane (BMB), 1,4
bismaleimidyl-2,3-dihydroxybutane (BMDB), bis-maleimidohexane (BMH), bismaleimidoethane
(BMOE), sulfosuccinimidyl 4-(N-maleimido-methyl)cyclohexane-lcarboxylate
(sulfo-SMCC), uccinimidyl(4-iodo-acetyl)aminobenzoate (sulfo-
SIAB), m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester (sulfo-MBS), N-(g-
maleimidobutryloxy)sulfosuccinimde ester (sulfo-GMBS), N-(e-
idocaproyloxy)sulfosuccimido ester (sulfo-EMCS), N-(k-
maleimidoundecanoyloxy)sulfosuccinimide ester -KMUS), and sulfosuccinimidyl
4-(p-maleimidophenyl)butyrate (sulfo-SMPB).
Heterobifunctional inking agents are tional crosslinking agents
having two different reactive groups. Heterobifunctional crosslinking agents containing
both an amine-reactive N -hydroxysuccinimide group (NHS group) and a carbonylreactive
hydrazine group can also be used to link the cytotoxic compounds described
herein with a inding agent (e.g., antibody). Examples of such commercially
available bifunctional crosslinking agents include succinimidyl 6-
hydrazinonicotinamide acetone hydrazone (SANH), succinimidyl 4-
hydrazidoterephthalate hydrochloride (SHTH) and succinimidyl hydrazinium nicotinate
hloride (SHNH). Conjugates bearing an abile linkage can also be prepared
using a hydrazine-bearing benzodiazepine derivative of the present invention. Examples
of bifunctional crosslinking agents that can be used include succinimidyl-p-formyl
benzoate (SFB) and imidyl-p-formylphenoxyacetate (SFPA).
Bifunctional crosslinking agents that enable the linkage of cell g agent
with cytotoxic nds via disulfide bonds include N-succinimidyl(4-nitropyridyl-
2-dithio)butanoate, and other agents known in the art that include N-succinimidyl(2-
pyridyldithio)propionate (SPDP), N-succinimidyl(2-pyridyldithio)pentanoate (SPP),
N-succinimidyl(2-pyridyldithio)butanoate , N-succinimidyl(2-
pyridyldithio)2-sulfo ate (sulfo-SPDB) to introduce dithiopyridyl groups. Other
bifunctional crosslinking agents that can be used to introduce disulfide groups are
known in the art and are disclosed in U.S. Patents 6,913,748, 6,716,821 and US Patent
Publications 20090274713 and 20100129314, all of which are incorporated herein by
reference. Alternatively, crosslinking agents such as 2-iminothiolane, homocysteine
thiolactone or S-acetylsuccinic anhydride that introduce thiol groups can also be used.
A "linker," "linker moiety," or "linking group" as defined herein refers to a
moiety that connects two moieties, such as a cell binding agent and a cytotoxic
compound, er. A tional inking agent may comprise two reactive
groups, one at each ends of a linker moiety, such that one reactive group can be first
reacted with the cytotoxic compound to provide a compound bearing the linker moiety
and a second reactive group, which can then react with a cell binding agent.
Alternatively, one end of the bifunctional crosslinking agent can be first d with the
cell binding agent to provide a cell binding agent bearing a the linker moiety and a
second ve group, which can then react with a cytotoxic compound. The g
moiety may contain a chemical bond that allows for the release of the cytotoxic moiety
at a particular site. Suitable chemical bonds are well known in the art and include
disulfide bonds, thioether bonds, acid labile bonds, photolabile bonds, peptidase labile
bonds and esterase labile bonds (see for example US Patents 5,208,020; 5,475,092;
6,441,163; 6,716,821; 6,913,748; 7,276,497; 7,276,499; 7,368,565; 7,388,026 and
7,414,073). Preferred are disulfide bonds, thioether and peptidase labile bonds. Other
s that can be used in the present invention include non-cleavable linkers, such as
those described in are described in detail in U.S. ation number 20050169933, or
charged linkers or hydrophilic linkers and are described in US 2009/0274713, US
2010/01293140 and , each of which is expressly incorporated herein
by reference, each of which is expressly incorporated herein by reference.
In one embodiment, the linking group with a reactive group attached at one end,
such as a reactive ester, is selected from the following "List 1":
-O(CR20R2l)m(CR22R23)n(OCH2CH2)p (CR40R4l) p"Y" (CR 24R25)q(CO) tX '',
-0(CR 2oR2i)m(alkynyl) (CR22R23)n(OCH 2CH2) p(CR4oR4i)p"Y' '(CR 24R25) (CO) tX '',
-0(CR 2oR 2i)m(piperazino) t CR 22R 23)n(OCH 2CH 2)p(CR 4oR4i)p"Y"(CR 24R 25) (CO)tX ,
-O(CR 20R2l )m(pyrrolo) t CR 22R 23)n(OCH 2CH 2)p(CR 40R4 l )p"Y"(CR 24R 25)q(CO) tX",
-O(CR20R2l)mA"m"(CR22R23)n(OCH (CR40R4l)p"Y' '(CR 24R25)q(CO) tX '',
-S(CR2oR2l)m(CR22R23)n(OCH2CH2)p(CR4oR4l)p"Y"(CR24R25) q(CO) tX '',
-S(CR 20R 2l )m(alkynyl) CR 22R CH 2CH 2)p(CR 40R4 l )p"Y"(CR 24R 25)q(CO) tX",
-S(CR2oR2i)m(piperazino) t<CR22R23)n(OCH 2CH2)p(CR4oR4i)p"Y' '(CR 24R25)q(CO) tX '',
-S(CR 20R 2l )m(P r lo)t CR 22R 23)n(OCH 2CH 2)p(CR 40R4 l )p"Y"(CR 24R 25) (CO)tX",
-S(CR2oR2l)mA" m"(CR22R23)n(OCH2CH2)p(CR4oR4l)p"Y"(CR24R25) q(CO) tX '',
-NR 33(C=O) p"(CR 20R 2 l )m(CR 22R 23)n(OCH 2C H 2)p(CR 40R4 l )p"Y"(CR 24R 25)q(CO) tX",
-NR33(C=O)p<CR20R2l)m(CR26^R27)m<CR22R23)n(OOT2CH2)p(CR40^
-NR33 (C=0) 2i)m(piperazino)t<CR22R23)n(OCH2CH2) (CR4oR4i)p^
-NR33 (C=O)p CR20R2l rolo)t CR22R23)n(OCH2CH2)p(CR 4 R4l )p'Y ' 5)q (CO)tX'',
-NR33 (C=O)p CR20R2l )mA''m CR22R23)n(OCH (CR 49R4l )p"Y''(CR 24R25)q(CO)tX'',
-(CR2oR2l)m(CR22R23)n(OCH2CH 2)p(CR4oR4l) p"Y"(CR24R25) q(CO)tX' ',
-(CR 20R 2l )m(alkynyl) CR 22R 23)n(OCH 2CH 2)p(CR 40R4 l )p"Y"(CR 24R 25)q(CO) tX",
-(CR2oR 2 i)m (piperazino) t.(CR22R23)n (OCH 2CH2) p (CR4 0R4i)p"Y' '(CR 24 R25)q(CO) tX '',
-(CR20R2l)mA" m"(CR22R23)n (OCH (CR40R4l)p"Y' '(CR 24R25 )q(CO) tX '',
-(CR20R2l)m(CR29 =N-NR30)„"(CR22R23)n(OCH2CH2) (CR40R4l)p"Y' '(CR 24R25 ) (CO) tX '',
-(CR20R2l)m(CR29 =N-NR30)„"(CR26=CR27)m <CR22R23)n (OCH 2CH2) (CR40R4l)p"Y"
(CR24R25) (CO) tX",
-(CR R2i R 29=N-NR3o) " <C R C
2 rf 2 2 3 2CH^
wherein:
m, n, p , q, m', n', t' are integer from 1 to 10, or are optionally 0;
t, m", n" and p" are 0 or 1;
X" is selected from OR SR NR R wherein R R R38, R39 are H, or
36, 3 7 6 37
linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 20 carbon atoms
and, or, a polyethylene glycol unit -(OCH 2CH2)n, R37, optionally, is a thiol protecting
group when t = 1, COX" forms a reactive ester selected from N-hydroxysuccinimide
esters, N-hydroxyphthalimide esters, N-hydroxy sulfo-succinimide esters, paranitrophenyl
esters, ophenyl esters, pentafluorophenyl esters and their derivatives,
wherein said derivatives facilitate amide bond formation;
Y" is absent or is selected from O, S, S-S or NR , wherein R has the same
32 32
definition as given above for R, or
when Y" is not S-S and t = 0, X" is selected from a maleimido group, a
haloacetyl group or SR , wherein R has the same definition as above;
37 37
A" is an amino acid selected from glycine, alanine, leucine, valine, lysine,
citrulline and glutamate or a polypeptide containing between 2 to 20 amino acid units;
R2o R2i, R R R24 R25 R26 and R are the same or different and are H or a
22 23 27
linear or branched alkyl having from 1 to 5 carbon atoms;
R29 and R3o are the same or different and are H or alkyl from 1 to 5 carbon
atoms;
R is H or linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to
12 carbon atoms, a polyethylene glycol unit -(OCH 2CH2)n, or R is -COR , -CSR -
33 34 34
SOR , or -S0 2R , wherein R is H or linear, branched or cyclic alkyl, l or
34 34 34
alkynyl having from 1 to 20 carbon atoms or, a polyethylene glycol unit -(OCH 2CH2) ;
one of R4o and R is optionally a vely or vely charged functional
group and the other is H or alkyl, l, alkynyl having 1 to 4 carbon atoms.
The term "amino acid" refers to lly occurring amino acids or non-
naturally occurring amino acid represented by NH2-C(R R )OH, wherein R
and R are each independently H, an optionally substituted linear, branched or cyclic
alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms, aryl, heteroaryl or cyclyl.
The term "amino acid" also refers to the corresponding residue when one hydrogen atom
is removed from the amine and/or carboxy end of the amino acid, such as -NH-
R R -C C O-.
The term "cation" refers to an ion with positive . The cation can be
monovalent (e.g., Na+, K+, etc.), bi-valent (e.g., Ca2+, Mg2+, etc.) or multi-valent (e.g.,
Al etc.). Preferably, the cation is monovalent.
The term "therapeutically effective amount" means that amount of active
compound or conjugate that elicits the d biological response in a subject. Such
response includes alleviation of the symptoms of the disease or disorder being treated,
prevention, inhibition or a delay in the recurrence of symptom of the disease or of the
disease itself, an se in the longevity of the subject compared with the absence of
the treatment, or prevention, tion or delay in the progression of symptom of the
e or of the disease itself. Determination of the effective amount is well within the
capability of those skilled in the art, especially in light of the detailed disclosure
provided herein. Toxicity and eutic efficacy of compound I can be ined by
standard pharmaceutical ures in cell cultures and in experimental animals. The
effective amount of nd or conjugate of the present invention or other eutic
agent to be administered to a subject will depend on the stage, category and status of the
le myeloma and characteristics of the subject, such as general health, age, sex,
body weight and drug tolerance. The effective amount of compound or conjugate of the
present invention or other therapeutic agent to be administered will also depend on
administration route and dosage form. Dosage amount and interval can be adjusted
individually to provide plasma levels of the active compound that are sufficient to
maintain desired therapeutic effects.
The term "thiol ve group" refers to a functional group that will react with
a thiol moiety. Examples of thiol reactive group includes, but is not limited to,
maleimido, yridine, vinyl sulfone, vinyl sulfonamide, a haloacetyl-based group
(e.g., haloacetamido) or a disulfide (e.g., -SSRd, wherein Rd is a linear or branched alkyl
having 1 to 4 carbon atoms, phenyl, nitrophenyl, dinitrophenyl, carboxynitrophenyl,
pyridyl, 2-nitropyridyl, 4-nitropyridyl, or 3-carboxynitropyridyl).
The term "reactive ester" refers to an ester contains a leaving group that is
readily displaced by an amine group or a hydroxyl group. Examples of reactive ester
includes, but is not limited to, N-hydroxysuccinimide ester, N-hydroxy sulfosuccinimide
ester, nitrophenyl ester, dinitrophenyl ester, tetrafluorophenyl ester, sulfo-
tetraflurophenyl ester, and pentafluorophenyl ester. Preferably, the reactive ester is N-
hydroxysuccinimide (NHS) ester.
The term "an imine-containing drug" or "an imine-containing cytotoxic
compound "refers to a compound bed herein (without a linker group) that has at
least one imine functional group. Preferably, the imine-containing drug contains one
imine functional group.
Methods of the Present Invention
In a first aspect, the present invention is directed to a method for ing a
ate comprising a cell-binding agent (CBA) conjugated to a cytotoxic compound
with a linking group, the method comprising reacting a cytotoxic compound with a
modified CBA at a pH of about 4 to about 9, wherein:
a) the modified CBA comprises a residue of a bifunctional crosslinking
agent bonded to the CBA, and the residue ses the linking group
and a thiol-reactive group; and
b) the cytotoxic compound comprises a thiol group, and a group represented
wherein:
Y is a leaving group, and is a sulfite (HS0 3, HS0 2 or a salt of HSO 3 ,
SO3 or HS0 2 formed with a cation), metabisulfite (H2S20 5 or a salt of S20 5
formed with a cation), mono-, di-, tri-, and tetra- thiophosphate (PO 3SH3,
P0 2S2H2, POS3H2, PS4H2 or a salt of P0 3S3 , P0 2S23 , POS33 or PS43 formed
with a cation), thio phosphate ester (P O PS OR ), P S-, P SO, P SC , S0 ,
lfate (HS2C"3 or a salt of S2C"3 formed with a cation), dithionite (HS20 4 or
a salt of S20 42 formed with a cation), phosphorodithioate (ORk')(S)(OH)
or a salt thereof formed with a cation), hydroxamic acid (Rk C(=0)NOH or a salt
formed with a cation), formaldehyde sulfoxylate (HOCH2S0 2 or a salt of
HOCH2S0 2 formed with a cation, such as HOCH2S0 2 Na+) or a mixture thereof,
wherein R1is a linear or ed alkyl having 1 to 10 carbon atoms and is
substituted with at least one substituent selected from -N(R )2, -C0 2H, -SO 3H ,
and -PO 3H ; R1can be r optionally substituted with a substituent for an alkyl
described herein; R is a linear or branched alkyl having 1 to 6 carbon atoms; Rk
is a linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon
atoms, aryl, heterocyclyl or aryl.
In certain embodiments, the cytotoxic compound is produced by reacting an
imine-containing cytotoxic compound bearing the thiol group with an imine ve
reagent.
In certain embodiments, the method may further comprises purifying the
cytotoxic compound prior to reacting with the modified CBA.
In certain embodiments,
(1) the imine-containing xic compound is represented by one of the
follo ing formulae, or a pharmaceutically acceptable salt thereof:
the cytotoxic compound is represented by one of the ing formulae,
or a pharmaceutically acceptable salt thereof:
the cytotoxic compound and the linking group portion of the ate
re resented by one of the following formulae:
(lib )
wherein:
X' is selected from -H, an amine-protecting group, an optionally
substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to
carbon atoms, a polyethylene glycol unit H20 ) -R , an optionally
substituted aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18-
membered heteroaryl ring containing one or more atoms independently
selected from nitrogen, oxygen, and sulfur, and an optionally substituted 3- to
18-membered heterocyclic ring containing 1 to 6 heteroatoms ndently
selected from O, S, N and P ;
Y' is selected from -H, an oxo group, an optionally substituted ,
branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms,
an optionally substituted 6- to 18-membered aryl, an optionally substituted 5- to
18-membered aryl ring ning one or more heteroatoms independently
selected from nitrogen, oxygen, and sulfur, an optionally substituted 3 to 18-
membered heterocyclic ring having 1 to 6 heteroatoms;
R is -H or a substituted or unsubstituted linear or branched alkyl having
1 to 4 carbon atoms;
R R2, R3,
1 R4, Ri', R2', R3' and R4' are each independently selected from
the group consisting of -H, an optionally tuted linear, branched or cyclic
alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene
glycol unit CH2) -R , halogen, inium [-NH(C=NH)NH2], -OR, -
NR'R", -NO2, -NCO, -NR'COR", -SR, a sulfoxide represented by -SOR', a
e represented by -S0 2R', a sulfonate -S0 3 M+, a sulfate -OS0 3 M+, a
sulfonamide represented by -S0 2NR'R", cyano, an azido, -COR', -OCOR', -
OCONR'R";
R, for each occurrence, is independently selected from the group
consisting of -H, an optionally substituted linear, branched or cyclic alkyl,
alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -
(CH2CH20 ) -R , an optionally substituted aryl having 6 to 18 carbon atoms, an
optionally substituted 5- to 18-membered heteroaryl ring containing one or more
heteroatoms independently selected from nitrogen, , and sulfur, or an
optionally substituted 3- to 18-membered heterocyclic ring ning 1 to 6
heteroatoms independently selected from O, S, N and P ;
R' and R'' are each independently selected from -H, -OH, -OR, -NHR, -
NR2, -COR, an ally tuted linear, ed or cyclic alkyl, alkenyl or
alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -
(CH2CH20 ) -R , and an optionally substituted 3membered heterocyclic ring
having 1 to 6 heteroatoms independently selected from O, S, N and P ;
n is an integer from 1 to 24;
W is selected from C=0, C=S, CH2, BH, SO and S0 2;
R6 is -H, -R, -OR, -SR, -NR'R", -N0 2, or halogen;
Z and Z' are independently selected from -(CH2) - , -(CH2) --CR R8-
(CH2 -, -(CH2V-NR 9-(CH2) , -(CH ) (CH ) and -(CH ) -S-(CH ) ;
a a a
n' and na' are the same or ent, and are ed from 0, 1, 2 and 3;
R7 and R are the same or different, and are each independently selected
from -H, -OH, -SH, -COOH, -NHR', a polyethylene glycol unit -(OCH2CH2) -,
an amino acid, a peptide unit bearing 2 to 6 amino acids, an optionally
substituted linear, branched or cyclic alkyl having from 1 to 10 carbon atoms;
R 9 is independently selected from -H, an optionally substituted linear,
branched or cyclic alkyl having from 1 to 10 carbon atoms, a polyethylene glycol
unit -(OCH2CH2) -;
A and A' are the same or different, and are independently selected from -
0-, oxo (-C(=0)-), -CRR'O-, -CRR'-, -S-, -CRR'S-, -N(R5)- and -CRR'N(R5)-,
R 5 for each occurrence is independently -H or an optionally substituted
linear or ed alkyl having 1 to 10 carbon atoms;
D and D' are the same or different, and are independently absent or
selected from the group ting of an optionally substituted linear, branched
or cyclic alkyl, alkenyl or l having 1 to 10 carbon atoms, an amino acid, a
peptide bearing 2 to 6 amino acids, and a polyethylene glycol unit (-OCH2CH2) -
L is absent, or when present, comprises the thiol group, or is a
polyethylene glycol unit (-OCH2CH2) -, a linear, branched or cyclic alkyl or
alkenyl having 1 to 10 carbon atoms, a phenyl group, a 3- to 18-membered
heterocyclic ring or a 5- to 18-membered heteroaryl ring having 1 to 6
heteroatoms independently selected from O, S, N and P, wherein the alkyl,
alkenyl, phenyl, or heterocyclic or heteroaryl ring is optionally substituted;
wherein at least one of X', Y', R6, R , R R2, R3, R4, Ri', R2', R ', R4', L
(e.g., through an optionally substituted group), is bonded to the linking group in
formulas (lb') or (lib').
In certain embodiments, the modified CBA is prepared by reacting the CBA with
the tional crosslinking agent, said bifunctional crosslinking agent sing the
reactive group and a group reactive with the CBA, both bonded to the linking
group.
In certain embodiments, the group reactive with the CBA reacts with an amino
group of the CBA (such as the amino group of a Lys sidechain), or with a thiol group of
the CBA (such as the thiol group of a Cys sidechain).
In n embodiments, the reactive group is selected from the group
consisting of maleimido, vinylpyridine, vinyl sulfone, vinyl sulfonamide, a haloacetylbased
group and a disulfide group.
alternatively, the reactive group may be maleimido, haloacetamido or -
SSRd, wherein Rd is a linear or branched alkyl having 1 to 4 carbon atoms, phenyl,
nitrophenyl, dinitrophenyl, carboxynitrophenyl, pyridyl, 2-nitropyridyl, 4-nitropyridyl,
or 3-carboxynitropyridyl.
In certain embodiments, the modified CBA is:
An exemplary reaction scheme is shown in in which in "step one," an
imine reactive reagent (shown in the reaction scheme as a nucleophile (Nuc:)) is added
to the drug containing a thiol and allowed to react and form a modified drug bearing the
thiol group. The modified drug is ally purified to remove excess imine reactive
reagent. In "step two," the antibody is modified with a linker containing a thiol reactive
group X (maleimide, SSPy, vinyl sulfone, etc), and reacted with the modified drug
bearing the thiol group at pH 6-9 to generate a stable disulfide or thioether bond between
the drug and the antibody. In "step three," the side products (such as excess imine
ve reagent, the ed drug that does not react with the antibody, etc.) are
removed and the conjugate is formulated. The number of the drug molecules conjugated
to the antibody is equal to n, which can be from, for example, 1-10.
A representative example of a two-step conjugation method is described in , n an antibody is first modified with a bifunctional crosslinking agent resulting
in an antibody that possesses a desired number of linkers suitable for reaction with a
dimer compound having a free thiol moiety. In this example the antibody huMy9-6 was
first modified with SPDB to give an antibody with linkers ning the pyridyl
moiety. The modified antibody was then exposed to a free thiol, such as 2a, generating
the desired ate huMy9SPDB -2a. Additional suitable thiol reactive s that
may be used in similar reactions are included in .
The imine reactive reagent can be mixed with the drug bearing a thiol group in
organic solvent (e.g., dimethylacetamide, dimethylformamide, dimethylsulfoxide,
acetonitrile, ethanol, methanol, methylene chloride, chloroform, e, or a mixture
thereof) or a mixture of water (e.g., deionized water) and one or more organic solvents.
When only organic solvent is used, the imine reactive reagent can be mixed with the
drug at room temperature for 30 min or longer (for example, about 1 hour, about 2
hours, about 3 hours, about 4 hours, about 5 hours, about 10 hours, about 24 hours or
until the reaction is complete). Preferrably, the incubation / on time is about 0-4
hrs, or 1-3 hrs. The resulting mixture can be used immediately to react with the cellbinding
agent (e.g., antibody) modified with a thiol-reactive group buffered at pH about
4 to about 9, preferably about 6 to about 9 . Alternatively, the mixture can be frozen and
stored, for example, at -20°C or -80°C, and used later while maintaining its reactivity
with the cell-binding agent (e.g., antibody). If a mixture of water and organic solvent(s)
is used as a miscible vent system (e.g., water and dimethylacetamide), the on
mixture of drug and imine reactive reagent is used ately or kept frozen until use
after mixing to react with the cell-binding agent g a thiol-reactive group. If a
mixture of water and organic solvent(s) is used as a non-miscible co-solvent system
(e.g., water and methylene de), the drug and the imine reactive reagent are mixed
for 10 min or longer (for example, about 30 mins, about 1 hour, about 2 hours, about 5
hours, about 10 hours, about 24 hours or until the reaction is complete), and the aqueous
layer is ted, quantified for the drug and reactive thiol (e.g., by UV spectroscopy
and Ellman's assay with DTNB (5,5'-dithiobis-(2-nitrobenzoic acid)) reagent) and
added to the cell-binding agent (e.g., antibody) bearing a thiol-reactive group buffered at
pH of about 4 to about 9, preferably about 6 to about 9 .
In a second , the present invention provides a method for preparing a
conjugate comprising a cell-binding agent (CBA) conjugated to a cytotoxic compound
with a linking group, the method comprising reacting the CBA with an imine-containing
cytotoxic compound, an imine reactive reagent, and a bifunctional inking agent
comprising the linking group to form the conjugate.
[ 112] In certain embodiments, the cell-binding agent (e.g., antibody) is contacted with
a drug (e.g., the imine-containing cytotoxic compound) and an imine reactive reagent to
form a first mixture; and the first mixture is then contacted with a bifunctional
crosslinking agent to form the cell-binding agent-drug conjugate. Preferably, the
bifuctional crosslinking agent is contacted with the first mixture ately after the
formation of the first mixture. Alternatively, the first mixture was held for a time
interval (e.g., about 1-10 mins, about 10-30 mins, about 30 mins to 1 hr, about 1 to 5 hrs,
about 5 to 24 hrs, or about 1 to 2 days) before it is contacted with a bifunctional
crosslinking agent.
In certain embodiments, the method may further comprises purifying the
conjugate.
An exemplary reaction scheme is shown in , in which in "step 1," an
imine reactive reagent (shown in the reaction scheme as a nucleophile (Nuc:)) is added
to the CBA (e.g., an antibody), a drug containing a thiol, a bifunctional crosslinking
agent containing both a thiol reactive group X mide, SSPy, vinyl sulfone, etc) and
a reactive ester group, and allow the reaction to proceed at pH 6-9 to te a stable
drug-antibody conjugate. In "step two," the side products (such as excess imine reactive
reagent, the modified drug that does not react with the antibody, etc.) are removed and
the conjugate is formulated. The number of the drug molecules conjugated to the
antibody is equal to n, which can be from, for example, 1-10.
In a third , the present invention provides a method for preparing a
conjugate comprising a cell-binding agent (CBA) conjugated to a cytotoxic nd
with a linking group, the method comprising:
a) reacting a cytotoxic compound with a tional inking agent
sing the linking group, a group reactive with the CBA (such as a
thiol group, a maleimide group, a haloacetamide group, or an amine
group), and a group reactive with the cytotoxic nd, to form a
modified cytotoxic compound covalently bonded to a residue of the
bifunctional crosslinking agent, wherein the residue comprises the linking
group and the group reactive with the CBA;
n the cytotoxic nd is represented by one of the following as,
or a pharmaceutically acceptable salt thereof:
wherein:
Y is a leaving group, and is a sulfite (HSO 3, HS0 2 or a salt of HSO 3 ,
SO3 or HS0 2 formed with a cation), sulfite (H2S20 5 or a salt of S20 5
formed with a ), mono-, di-, tri-, and tetra- thiophosphate (PO 3SH3,
P0 2S2H2, POS3H2, PS4H2 or a salt of PO3S3 , P0 2S23 , POS33 or PS43 formed
with a cation), thio phosphate ester (P O PS OR ), P S-, P SO, P SC , S0 ,
thiosulfate (HS20 3 or a salt of S2C "3 formed with a cation), dithionite (HS20 4 or
a salt of S20 42 formed with a cation), phosphorodithioate (P(=S)(ORk')(S)(OH)
or a salt thereof formed with a cation), hydroxamic acid (Rk C(=0)NOH or a salt
formed with a cation), formaldehyde sulfoxylate (HOCH2S0 2 or a salt of
HOCH2S0 2 formed with a cation, such as HOCH2S0 2 Na+) or a mixture thereof,
wherein R1is a linear or branched alkyl having 1 to 10 carbon atoms and is
substituted with at least one substituent selected from -N(R )2, -C0 2H, -SO 3H ,
and -PO 3H ; R1can be further optionally substituted with a substituent for an alkyl
described herein; R is a linear or branched alkyl having 1 to 6 carbon atoms; Rk
is a linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon
atoms, aryl, heterocyclyl or heteroaryl;
X' is selected from -H, an protecting group, an optionally
substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to
carbon atoms, a polyethylene glycol unit -(CH2CH20 ) -R , an optionally
substituted aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18-
membered heteroaryl ring containing one or more heteroatoms independently
selected from nitrogen, oxygen, and sulfur, and an optionally substituted 3- to
bered heterocyclic ring containing 1 to 6 heteroatoms independently
ed from O, S, N and P ;
Y' is selected from -H, an oxo group, an ally tuted linear,
branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms,
an optionally substituted 6- to 18-membered aryl, an optionally substituted 5- to
18-membered heteroaryl ring containing one or more heteroatoms independently
selected from nitrogen, oxygen, and sulfur, an ally substituted 3 to 18-
ed heterocyclic ring having 1 to 6 heteroatoms;
R is -H or a substituted or unsubstituted linear or branched alkyl having
1 to 4 carbon atoms;
R R2, R3,
1 R4, Ri', R2', R3' and R4' are each independently ed from
the group consisting of -H, an optionally substituted linear, branched or cyclic
alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene
glycol unit -(OCH2CH2) -R , halogen, guanidinium =NH)NH2], -OR, -
NR'R", -N0 2, -NCO, -NR'COR", -SR, a sulfoxide represented by -SOR', a
sulfone represented by -S0 2R', a sulfonate -S0 3 M+, a sulfate -OS0 3 M+, a
sulfonamide represented by -S0 2NR'R", cyano, an azido, -COR', -OCOR', -
OCONR'R";
R, for each occurrence, is independently selected from the group
consisting of -H, an optionally substituted linear, branched or cyclic alkyl,
alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -
(CH2CH20 ) -R , an optionally substituted aryl having 6 to 18 carbon atoms, an
optionally substituted 5- to 18-membered heteroaryl ring containing one or more
heteroatoms independently selected from nitrogen, oxygen, and , or an
ally substituted 3- to 18-membered heterocyclic ring containing 1 to 6
heteroatoms independently selected from O, S, N and P ;
R' and R'' are each ndently selected from -H, -OH, -OR, -NHR, -
NR2, -COR, an optionally substituted linear, branched or cyclic alkyl, alkenyl or
alkynyl having from 1 to 10 carbon atoms, a hylene glycol unit -
(CH2CH20 ) -R , and an optionally substituted 3membered heterocyclic ring
having 1 to 6 heteroatoms independently selected from O, S, N and P ;
n is an integer from 1 to 24;
W is selected from C=0, C=S, CH2, BH, SO and S0 2;
R6 is -H, -R, -OR, -SR, -NR'R", -N0 2, or, halogen;
Z and Z ' are independently selected from -(CH2) - , -(CH2) -CR7R -
(CH2) , -(CH ) NR9-(CH ) , -(CH ) (CH )
a a a - and -(CH ) -S-(CH ) ;
n' and na' are the same or different, and are selected from 0, 1, 2 and 3;
R7 and R are the same or different, and are each independently selected
from -H, -OH, -SH, -COOH, -NHR', a polyethylene glycol unit CH2) -,
an amino acid, a peptide unit bearing 2 to 6 amino acids, an optionally
substituted linear, branched or cyclic alkyl having from 1 to 10 carbon atoms;
R 9 is ndently selected from -H, an optionally substituted linear,
branched or cyclic alkyl having from 1 to 10 carbon atoms, a polyethylene glycol
unit -(OCH2CH2) -;
A and A' are the same or different, and are independently selected from -
0-, oxo (-C(=0)-), -CRR'O-, -CRR'-, -S-, -CRR'S-, -N(R5)- and -CRR'N(R 5)-,
R 5 for each occurrence is independently -H or an optionally substituted
linear or branched alkyl having 1 to 10 carbon atoms;
D and D' are the same or different, and are independently absent or
selected from the group consisting of an optionally substituted linear, branched
or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms, an amino acid, a
e bearing 2 to 6 amino acids, and a polyethylene glycol unit (-OCH2CH2) -;
L is absent, or when present, ses the thiol group, or is a
polyethylene glycol unit (-OCH2CH2) -, a linear, ed or cyclic alkyl or
l having 1 to 10 carbon atoms, a phenyl group, a 3- to 18-membered
heterocyclic ring or a 5- to 18-membered heteroaryl ring having 1 to 6
atoms independently selected from O, S, N and P, wherein the alkyl,
alkenyl, phenyl, or heterocyclic or heteroaryl ring is optionally substituted; and,
b) reacting the modified cytotoxic nd with the CBA through the
group reactive with the CBA, at a pH of about 4 to about 9, to form the
ate.
In certain embodiments, the cytotoxic compound is produced by reacting an
imine-containing cytotoxic compound bearing the thiol group of the following formulas
with an imine reactive reagent in a on mixture
In certain embodiments, the method may r comprises purifying the
cytotoxic compound prior to step a).
In certain embodiments, the method may further comprises purifying the
modified cytotoxic compound prior to step b).
In certain embodiments, the reaction mixture is stored frozen before the frozen
mixture is thawed and step a) is carried out.
In certain embodiments, the method may further comprises storing the reaction
mixture of step a) frozen before thawing and before step b) is carried out.
In certain embodiments, the bifunctional crosslinking agent is bismaleimidohexane
or BMPEO.
An exemplary reaction scheme is shown in , in which in "step 1," an
imine reactive reagent (shown in the on scheme as a nucleophile (Nuc:)) is added
to a xic compound containing a thiol. The resulting cytotoxic compound is
optionally purified, before the cytotoxic compound is reacted in "step two" with a
bifunctional crosslinking agent (such as a bismaleimidohexane or BMPEO) to produce a
second modified drug g a thiol-reacting group. Then in "step three," a ontaining
CBA (such as antibody) is added, and the reaction is allowed to proceed (at
pH 6-9) to generate a stable drug-antibody conjugate. In "step four," the side ts
(such as excess imine reactive reagent, the modified drug that does not react with the
antibody, etc.) are removed and the conjugate is formulated. The number of the drug
molecules conjugated to the antibody is equal to n, which can be from, for example, 1-
The imine reactive t can be mixed with the drug bearing a thiol-reactive
group in organic solvent (e.g., dimethylacetamide, dimethylformamide,
dimethylsulfoxide, acetonitrile, ethanol, ol, methylene chloride, chloroform,
dioxane, or a mixture thereof) or a mixture of water (e.g., zed water) and one or
more organic solvents. When only organic solvent is used, the imine reactive reagent
can be mixed with the drug at room temperature for 30 min or longer (for example,
about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 10 hours,
about 24 hours or until the reaction is complete). Preferrably, the incubation / reaction
time is about 0-4 hrs, or 1-3 hrs. The resulting mixture can be used immediately to react
with the inding agent (e.g., antibody) modified with a thiol-reactive group buffered
at pH about 4 to about 9, preferably about 6 to about 9 . Alternatively, the mixture can
be frozen and stored, for example, at -20°C or -80°C, and used later while maintaining
its reactivity with the cell-binding agent (e.g., antibody). If a mixture of water and
organic solvent(s) is used as a miscible co-solvent system (e.g., water and
dimethylacetamide), the reaction mixture of the drug and the imine reactive t is
used immediately after mixing or kept frozen until use to react with the cell-binding
agent bearing a thiol-reactive group. If a mixture of water and organic solvent(s) is used
as a non-miscible co-solvent system (e.g., water and methylene chloride), the drug and
the imine reactive reagent are mixed for 10 min or longer (for example, about 30 mins,
about 1 hour, about 2 hours, about 5 hours, about 10 hours, about 24 hours or until the
reaction is complete), and the s layer is collected, quantified for the drug (e.g., by
UV oscopy) and added to the cell-binding agent (e.g., antibody) bearing a thiol
group buffered at pH of about 4 to about 9, preferably about 6 to about 9 .
In a fourth aspect, the present invention is directed to a method for preparing a
conjugate sing a cell-binding agent (CBA) ated to a cytotoxic compound
with a linking group, the method comprising reacting a ed cytotoxic compound
with the CBA at a pH of about 4 to about 9, wherein the modified xic compound
comprises:
a) a residue of a bifunctional crosslinking agent bonded to the cytotoxic
compound, and the residue comprises the linking group and a reactive
group selected from a reactive ester and a thiol-reactive group, and,
b) a group ented by:
wherein:
Y is a leaving group, and is a sulfite (HS0 3, HS0 2 or a salt of HSO3 ,
S0 32- or HSO 2 formed with a cation), metabisulfite (H 2S2O5 or a salt of S2O5
formed with a cation), mono-, di-, tri-, and tetra- thiophosphate (PO 3SH3,
PO2S2H2, POS3H2, PS4H2 or a salt of PO3S 3 , P0 3 , POS 3
2S2 3 or PS4 formed
with a ), thio phosphate ester (R O)2PS(OR ), R S-, R SO, R S0 2, S0 ,
thiosulfate (HS 2O3 or a salt of S2O3 formed with a cation), dithionite (HS 20 4 or
a salt of S20 42 formed with a cation), phosphorodithioate (P(=S)(ORk')(S)(OH)
or a salt thereof formed with a cation), hydroxamic acid (Rk C(=0)NOH or a salt
formed with a cation), formaldehyde sulfoxylate (HOCH 2SO2 or a salt of
HOCH formed with a cation, such as HOCH +) or a mixture
2SO2 2SO2 Na thereof,
wherein R1is a linear or branched alkyl having 1 to 10 carbon atoms and is
substituted with at least one tuent selected from -N(R )2, -CO 2H , -SO 3H ,
and -PO 3H ; R1can be further optionally substituted with a substituent for an alkyl
described herein; R is a linear or branched alkyl having 1 to 6 carbon atoms; Rk
is a linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon
atoms, aryl, heterocyclyl or heteroaryl.
In n embodiments, the modified xic compound is produced by
reacting an imine reactive reagent with an imine-containing xic compound bearing
the linking group and the reactive group.
In certain embodiments, the method may r ses purifying the
ed cytotoxic compound prior to reacting with the CBA.
In certain embodiments, the reactive ester may be selected from the group
ting of N-hydroxysuccinimide ester, N-hydroxy sulfosuccinimide ester,
nitrophenyl ester, dinitrophenyl ester, tetrafluorophenyl ester, sulfo-tetraflurophenyl
ester, and pentafluorophenyl ester. Preferably, the ve ester is N-
hydroxysuccinimide ester.
In certain embodiments, the thiol-reactive group may be selected from the group
consisting of maleimido, vinylpyridine, vinyl sulfone, vinyl sulfonamide, a haloacetylbased
group and a disulfide group.
In certain ments, the thiol-reactive group may be maleimido,
haloacetamido or -SSRd, wherein Rd is a linear or branched alkyl having 1 to 4 carbon
atoms, phenyl, nitrophenyl, dinitrophenyl, carboxynitrophenyl, pyridyl, 2-nitropyridyl,
4-nitropyridyl, or 3-carboxynitropyridyl.
An exemplary reaction scheme is shown in in which in "step one," an
imine reactive reagent (shown in the reaction scheme as a nucleophile ) is added
to the drug ning an reactive ester (lc) and allowed to react to form a ed
drug. The modified drug can be optionally purified to remove excess imine reactive
reagent. In "step two," the modified drug with a reactive ester is reacted with an
antibody buffered at pH 6-9. In "step three," the side products (such as excess imine
ve reagent, modified drug that does not react with the antibody, etc.) are d,
and the conjugate is formulated. The number of the drug molecules conjugated to the
antibody is equal to n, which can be from, for example, 1 to 10.
Another reaction scheme depicting an exemplary method of the present invention
is shown in . In "step one," an imine reactive regent is added to the drug
containing a thiol-reactive group (where R is maleimide group, SSPy, etc.) and allowed
to react and form a modified drug. The modified drug is optionally purified to remove
excess imine reactive reagent. In "step two," the modified drug is reacted with an
antibody containing a reactive thiol to form an antibody-drug conjugate having antibody
ntly linked to the drug through a stable ide or thioether bond. Antibodies
with reactive thiol group can be generated by methods described herein, for example, by
reducing interchain disulfides, genetically ng cysteine, or modifying antibody
with linkers containing thiols or chemically masked thiols. In "step three," the drug
which does not react with the antibody is d and the ate is formulated. The
number of the drug molecules conjugated to the antibody is equal to n, which can be
from, for example, 1-10.
The imine reactive reagent can be mixed with the drug bearing an activated ester
{e.g., N-hydroxysuccinimidyl ester, pentafluorophenol ester, sulfo N-
hydroxysuccinimidyl ester) in an organic solvent {e.g., dimethyl acetamide, ethanol,
ene chloride, chloroform, dioxane, or a mixture thereof) or a mixture of water
{e.g., deionized water) and one or more organic solvents. When only organic solvent is
used, the imine reactive reagent can be mixed with the drug at a temperature of 0 to
100 °C, preferably at a temperature of 0 to 30 °C, more ably at room temperature
for 5 min or longer (for example, about 30 min, 1 hour, about 2 hours, about 3 hours,
about 4 hours, about 5 hours, about 10 hours, about 24 hours or until the reaction is
complete). Preferrably, the tion / reaction time is about 0-4 hrs, or 1-3 hrs. The
resulting reaction mixture can be used immediately to react with the cell-binding agent
{e.g., antibody) buffered in pH of about 4 to about 9, preferably about 6 to about 9 .
atively, the reaction mixture can be frozen and stored, for example, at about -20°C
or -80°C and used later while maintaining its reactivity with the antibody. Preferrably,
no purification of intermediate products is required. When a mixture of water and
organic solvent is used as a le co-solvent system (e.g., water and
dimethylacetamide), the drug and imine on mixture is used immediately after
mixing, or kept frozen until use, to react with the cell-binding agent (e.g., dy).
When a mixture of water and organic solvent is used as a non-miscible co-solvent
system (e.g., water and methylene chloride), the drug and the imine reactive reagent are
mixed for 10 min or longer, and the aqueous layer is collected, quantified for the drug
and added to the cell-binding agent (e.g., antibody) buffered at pH about 4 to about 9,
preferably about 6 to about 9 .
In any of the above aspects, a suitable amount of the imine reactive reagent can
be used. For example, about 0.1 to about 30 molar equivalents of the imine reactive
reagent to the drug can be used. Preferably, about 1 to about 10 molar equivalents, more
preferably, about 1 to about 5 molar lents, and even more preferably about 3 to
about 5 molar lents of the imine reactive reagent can be used.
Using this general procedure, in any of the above aspects, any of the following
imine ve reagent can be used: sulfites (H2SO3, H2SO2 or a salt of HSO3 , SO32- or
HSO2 formed with a ), metabisulfite (H2S2O5 or a salt of S2O52- formed with a
cation), mono, di, tri, and tetra- thiophosphates (PO3SH3, PO2S2H3, POS3H3, PS4H3 or a
salt of PO3S3 , P0 2S23 , POS33 or PS4 formed with a cation), thio phosphate esters
((R O)2PS(OR ), R SH, R^OH, R^C^H, R^OsH), s amines (hydroxyl amine (e.g.,
NH2OH), hydrazine (e.g., NH2NH2), NH20-R\ R^NH-R , NH2-R'), NH2-CO-NH2, NH2-
C(=S)-NH2, thiosulfate 3 or a salt of S2O3 formed with a cation), nite
(H2S20 4 or a salt of S20 4 formed with a cation), phosphorodithioate
(P(=S)(ORk)(SH)(OH) or a salt thereof formed with a cation), hydroxamic acid
(RkC(=0)NHOH or a salt formed with a cation), hydrazide (RkCONHNH2),
formaldehyde sulfoxylate (HOCH2SO2H or a salt of HOCH2SO2 formed with a cation,
such as HOCH2SO2 Na+), glycated nucleotide (such as GDP-mannose), fludarabine or a
mixture thereof, wherein R1and R1 are each independently a linear or branched alkyl
having 1 to 10 carbon atoms and are substituted with at least one tuent selected
from -N(R )2, -C0 2H, -SO3H, and -PO3H ; R and R can be further optionally substituted
with a substituent for an alkyl described herein; R is a linear or branched alkyl having 1
to 6 carbon atoms; and Rk is a linear, branched or cyclic alkyl, alkenyl or alkynyl having
1 to 10 carbon atoms, aryl, cyclyl or heteroaryl (preferably, Rk is a linear or
branched alkyl having 1 to 4 carbon atoms; more preferably, Rk is methyl, ethyl or
propyl). Preferably, the cation is a monovalent , such as Na+ or K+.
Preferably, the imine reactive reagent is selected from sulfites (e.g., NaHS0 3 or
KHS0 3), hydroxylamine, hydrazine and urea. More preferably, the imine reactive
reagent is NaHS0 3 or KHS0 3.
In one embodiment, the ed drugs described in any of the above aspects are
purified before reacting with a cell-binding agent. Any suitable methods known in the
art can be used for purifying the modified drug. For example, the modified drug can be
purified by column chromatography (e.g., silica gel tography) or HPLC.
In another embodiment, the inding agent-drug conjugate prepared
according to any of the s above is purified by tangential flow filtration, adsorptive
chromatography, tive filtration, selective precipitation, non-absorptive filtration or
combination thereof. Preferably, tangential flow filtration (TFF, also known as cross
flow filtration, ultrafiltration and diafiltration) and/or adsorptive chromatography resins
are used for the purification of the conjugates.
Any suitable TFF systems may be utilized, including a Pellicon type system
pore, Billerica, Mass.), a Sartocon Cassette system (Sartorius AG, Edgewood,
N.Y.), and a Centrasette type system (Pall Corp., East Hills, N.Y.).
Any suitable tive tography resin may be utilized. Preferred
adsorptive chromatography resins include resins for hydroxyapatite chromatography,
hydrophobic charge induction chromatography (HCIC), hydrophobic interaction
chromatography (HIC), ion exchange chromatography, mixed mode ion exchange
tography, immobilized metal affinity chromatography (IMAC), dye ligand
chromatography, affinity chromatography, reversed phase chromatography, and
combinations thereof. Examples of suitable hydroxyapatite resins include ceramic
hydroxyapatite (CHT Type I and Type II, Bio-Rad Laboratories, Hercules, Calif.), HA
Ultrogel hydroxyapatite (Pall Corp., East Hills, N.Y.), and ceramic fluoroapatite (CFT
Type I and Type II, d Laboratories, Hercules, Calif.). An example of a suitable
HCIC resin is MEP Hypercel resin (Pall Corp., East Hills, N.Y.). es of suitable
HIC resins include Butyl-Sepharose, Hexyl-Sepaharose, Phenyl-Sepharose, and Octyl
Sepharose resins (all from GE Healthcare, Piscataway, N.J.), as well as Macro-prep
Methyl and Macro-Prep t-Butyl resins d Laboratories, Hercules, ).
Examples of le ion exchange resins include SP-Sepharose, CM-Sepharose, and QSepharose
resins (all from GE Healthcare, Piscataway, N.J.), and Unosphere S resin
(Bio-Rad Laboratories, Hercules, Calif.). Examples of suitable mixed mode ion
exchangers include Bakerbond ABx resin (JT Baker, Phillipsburg N.J.). Examples of
suitable IMAC resins e ing Sepharose resin (GE Healthcare, Piscataway,
N.J.) and Profinity IMAC resin (Bio-Rad Laboratories, Hercules, Calif.). Examples of
suitable dye ligand resins include Blue Sepharose resin (GE Healthcare, Piscataway,
N.J.) and Affi-gel Blue resin (Bio-Rad Laboratories, Hercules, Calif.). Examples of
suitable affinity resins include Protein A Sepharose resin (e.g., MabSelect, GE
Healthcare, away, N.J.), where the cell binding agent is an antibody, and lectin
affinity resins, e.g. Lentil Lectin Sepharose resin (GE Healthcare, Piscataway, N.J.),
where the cell binding agent bears appropriate lectin binding sites. Alternatively an
antibody specific to the cell binding agent may be used. Such an antibody can be
immobilized to, for instance, Sepharose 4 Fast Flow resin (GE Healthcare, Piscataway,
N.J.). Examples of suitable reversed phase resins include C4, C8, and C18 resins (Grace
Vydac, Hesperia, Calif.).
Any suitable non-absorptive chromatography resins can be used in the s
of the present invention. Examples of suitable chromatography resins include, but are
not d to, SEPHADEX™ G-25, G-50, G-100, SEPHACRYL™ resins (e.g., S-200
and S-300), SUPERDEX™ resins (e.g., SUPERDEX™ 75 and SUPERDEX™ 200),
BIO-GEL® resins (e.g., P-6, P-10, P-30, P-60, and , and others known to those of
ordinary skill in the art.
Drugs Bearing a Linking Moiety
Drugs that can be used in the present methods include compounds described in
US2010/0316656, US 2010/003641, US2010/0203007, all of which are orated
herein by reference.
In certain other embodiments, cytotoxic compounds that can be conjugated with
cell-binding agents via a linking group do not comprise the linking group. d, a
tional cross-linking reagent (comprising the linking group) may be required to
conjugate the linkerless cytotoxic compound with the CBA through the linker group.
Thus in the first ic embodiment, a drug ntly connected to a linking
group with a reactive group bonded thereto, which can be used in the methods of the
present ion (such as in the 1-step reagent method as described in the fourth aspect
of the invention above), or which may be an ediate product of the methods of the
invention (such as the method described in the third aspect of the invention), is a
cytotoxic compound bearing a reactive group, such as a reactive ester or a thiol-reactive
group (collectively "the reactive group"), comprising a linking group with the reactive
group bonded thereto, capable of covalently linking the cytotoxic compound to the
CBA, wherein the cytotoxic compound is represented by any one of the following
formulas:
(Ila)
or a pharmaceutically acceptable salt thereof. Upon reacting with the imine
reactive t, the cytotoxic compounds may be represented by any one of the
follo ing as:
wherein:
Y is a sulfite (HS0 2
3, HS0 2 or a salt of HS0 3 , S0 3 or HS0 2 formed
with a cation), metabisulfite (H2S20 5 or a salt of S20 5 formed with a cation),
mono-, di-, tri-, and tetra- thiophosphate (P0 3SH3, P0 2S2H2, POS3H2, PS4H2 or a
salt of P0 3S3 , P0 2S23 , POS33 or PS4 formed with a cation), thio phosphate
ester (P O PS OR ), P S-, R^O, R O , R O , thiosulfate (HS20 3 or a salt of
S20 32- formed with a cation), dithionite (HS20 4 or a salt of S20 42- formed with a
cation), phosphorodithioate (P(=S)(ORk )(S)(OH) or a salt f formed with a
), hydroxamic acid (Rk C(=0)NOH or a salt formed with a cation),
formaldehyde sulfoxylate (HOCH2S0 2 or a salt of HOCH2S0 2 formed with a
cation, such as HOCH2S0 2 Na+) or a mixture thereof, n R1is a linear or
branched alkyl having 1 to 10 carbon atoms and is substituted with at least one
substituent ed from -N(R )2, -C0 2H, -S0 3H, and -P0 3H; R can be further
optionally substituted with a substituent for an alkyl described herein; R is a
linear or branched alkyl having 1 to 6 carbon atoms; Rk is a linear, branched or
cyclic alkyl, alkenyl or l having 1 to 10 carbon atoms, aryl, heterocyclyl or
heteroaryl;
X' is selected from -H, -OH, an amine-protecting group, the g
group with the reactive group bonded thereto, an optionally substituted linear,
branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a
polyethylene glycol unit -(CH2CH20 ) -R , an optionally substituted aryl having 6
to 18 carbon atoms, an optionally substituted 5- to 18-membered heteroaryl ring
containing one or more heteroatoms independently selected from nitrogen,
oxygen, and sulfur, and an optionally tuted 3- to bered heterocyclic
ring containing 1 to 6 heteroatoms independently selected from O, S, N and P ;
Y' is selected from -H, an oxo group, the linking group with the reactive
group bonded thereto, an optionally substituted , branched or cyclic alkyl,
alkenyl or alkynyl having from 1 to 10 carbon atoms, an optionally substituted 6-
to 18-membered aryl, an ally substituted 5- to 18-membered heteroaryl
ring containing one or more heteroatoms independently selected from nitrogen,
oxygen, and sulfur, an optionally substituted 3- to 18-membered heterocyclic
ring having 1 to 6 heteroatoms;
R is -H or a substituted or unsubstituted linear or branched alkyl having
1 to 4 carbon atoms, or the linking group with the reactive group bonded thereto;
R R2, R3, , Ri', R2', R3' and R ' are each independently selected from
the group consisting of -H, an optionally substituted linear, branched or cyclic
alkyl, l or alkynyl having from 1 to 10 carbon atoms, a polyethylene
glycol unit -(OCH2CH2) -R , halogen, guanidinium [-NH(C=NH)NH2], -OR, -
NR'R", -N0 2, -NCO, -NR'COR", -SR, a sulfoxide represented by -SOR', a
sulfone represented by -S0 2R', a sulfonate -S0 M+, a sulfate -OS0 M+, a
sulfonamide represented by -S0 2NR'R", cyano, an azido, -COR', -OCOR', -
OCONR'R", and the linking group with the reactive group bonded thereto;
R, for each occurrence, is independently selected from the group
consisting of -H, an optionally tuted , branched or cyclic alkyl,
alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -
(CH2CH20 ) -R , an ally substituted aryl having 6 to 18 carbon atoms, an
optionally substituted 5- to 18-membered heteroaryl ring containing one or more
heteroatoms ndently selected from nitrogen, oxygen, and sulfur, or an
optionally substituted 3- to 18-membered heterocyclic ring containing 1 to 6
heteroatoms independently selected from O, S, N and P ;
R' and R'' are each independently selected from -H, -OH, -OR, -NHR, -
NR2, -COR, an optionally substituted linear, branched or cyclic alkyl, alkenyl or
l having from 1 to 10 carbon atoms, a polyethylene glycol unit -
(CH2CH20 ) -R , and an optionally substituted 3- to 18-membered heterocyclic
ring having 1 to 6 heteroatoms independently selected from O, S, N and P ;
n is an integer from 1 to 24;
W is selected from C=0, C=S, CH2, BH, SO and S0 2;
R6 is -H, -R, -OR, -SR, -NR'R", -N0 2, halogen or the linking group with
the reactive group bonded thereto;
Z and Z' are independently selected from -(CH2) - , -(CH2) -CR7R -
(CH2W-, -(CH2V-NR 9-(CH2) , -(CH2V-CHCH2W- and -(CH2) -S-(CH 2) ;
a a
n' and na' are the same or different, and are ed from 0, 1, 2 and 3;
R7 and R are the same or ent, and are each independently selected
from -H, -OH, -SH, -COOH, -NHR', a polyethylene glycol unit CH2) -,
an amino acid, a e unit bearing 2 to 6 amino acids, an optionally
substituted linear, branched or cyclic alkyl having from 1 to 10 carbon atoms;
R9 is independently selected from -H, an optionally substituted linear,
branched or cyclic alkyl having from 1 to 10 carbon atoms, a polyethylene glycol
unit -(OCH2CH2) -;
A and A' are the same or different, and are independently selected from -
O-, oxo (-C(=0)-), -CRR'O-, -CRR'-, -S-, -CRR'S-, -NR5 and (R5)-;
R 5 for each occurrence is ndently -H or an optionally substituted
linear or branched alkyl having 1 to 10 carbon atoms;
D and D' are the same or different, and are independently absent or
selected from the group consisting of an optionally substituted linear, ed
or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms, an amino acid, a
e bearing 2 to 6 amino acids, and a polyethylene glycol unit (-OCH2CH2)n-
L is , the linking group with the reactive group bonded thereto, a
polyethylene glycol unit (-OCH2CH2)n-, linear, branched or cyclic alkyl or
alkenyl having 1 to 10 carbon atoms, a phenyl group, a 3 to 18-membered
heterocyclic ring or a 5- to 18-membered heteroaryl ring having 1 to 6
heteroatoms ndently selected from O, S, N and P, wherein the alkyl or
alkenyl is optionally substituted with the linking group with the reactive group
bonded thereto; phenyl or heterocyclic or heteroaryl ring can be optionally
substituted, wherein the substituent can be the linking group with the reactive
group bonded thereto.
Preferably, L is absent, or is selected from an optionally substituted
phenyl group and an optionally substituted pyridyl group, wherein the phenyl
and the pyridyl group bears the linking group with the reactive group bonded
thereto, or L is an amine group bearing the g group with the reactive group
bonded thereto {i.e., -N(linking group)-), or L is a linear, branched or cyclic alkyl
or alkenyl having from 1 to 6 carbon atoms and bearing the linking group with
the reactive group bonded thereto.
Several representative compounds of formulas (la') and (Ila') are listed below:
In n embodiments,
X' is selected from the group consisting of -H, -OH, an optionally
substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to
carbon atoms, phenyl, the linking group with the reactive group bonded
thereto, and an amine-protecting group. Preferably, X' is -H, -OH, -Me or the
g group with the reactive group bonded thereto. More preferably, X' is -H;
Y' is selected from the group consisting of -H, an oxo group, a
substituted or unsubstituted linear, branched or cyclic alkyl, alkenyl or alkynyl
having from 1 to 10 carbon atoms. Preferably, Y' is selected from -H or oxo.
More preferably, Y' is -H;
W is C=0;
R P 2, 3, P 4 , Rn ΐ ' , R2', R3', and R4' are each ndently selected
from -H, -NR'R", -NR'(C=0)R, -OR, -SR, -N0 2 and the linking group with the
ve group bonded thereto. Preferably, one of R2, R3, R2', and R3' is the
linking group with the reactive group bonded thereto and the rest are -H;
R, for each ence, is independently selected from the group
consisting of -H, an optionally substituted linear, branched or cyclic alkyl,
alkenyl or alkynyl having from 1 to 10 carbon atoms or phenyl;
R' and R" are the same or different, and are independently selected from
-H, -OH, -OR, an optionally substituted linear, branched or cyclic alkyl, alkenyl
or alkynyl having from 1 to 10 carbon atoms or phenyl;
R6 is -OR or -SR , wherein R is -H, a linear or ed alkyl having 1
to 4 carbon atoms. Preferably, R6 is -OMe or -SMe. Even more preferably, R6 is
-OMe;
Z and Z' are -CH2-;
A and A' are the same or different, and are selected from , -S-, -NR5
and oxo (C=0). Preferably, A and A' are the same or different, and are selected
from -O- and -S-. More preferably, A and A' are ;
D and D' are the same or ent, and are independently selected from a
polyethylene glycol unit (-OCH2CH2) , wherein n is an integer from 1 to 24, an
amino acid, a peptide bearing 2 to 6 amino acids, or a , branched or cyclic
alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms, wherein the alkyl, alkenyl
and alkynyl are optionally substituted with one or more (e.g., 2, 3, 4, 5, 6 or
more) substituents independently selected from the group consisting of halogen,
-OR, -NR'COR", -SR, and -COR';
Preferably, D and D' are the same or different, and are independently
selected from linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1
to 10 carbon atoms. More ably, D and D' are linear or ed alkyl
g 1 to 4 carbon atoms. Still more preferably, D and D' are the same or
different, and are selected from a linear alkyl having 1 to 4 carbon atoms;
L is absent, or is selected from an optionally substituted phenyl group and
an optionally substituted pyridyl group, wherein the phenyl and the l group
bears the linking group with the reactive group bonded thereto, or L is an amine
group g the linking group with the reactive group bonded thereto (i.e., -N
(linking group)-), or L is a linear, branched or cyclic alkyl or alkenyl having
from 1 to 6 carbon atoms and bearing the linking group with the reactive group
bonded thereto.
In a second specific embodiment, for cytotoxic dimers (la) or (Ila), the variables
are as described below:
W is C=0;
Ri, R2, R2', R4, and R4' are -H;
one of R3 or R3' is optionally the linking group with the reactive group bonded
thereto and the other is -H;
R6 is -OMe;
Z and Z' are -CH2-;
X' is -H;
Y' is -H;
A and A' are ; and the remainder of the variables are as described in the first
specific embodiment.
In a third specific embodiment, the cytotoxic dimers (bonded to the linking group
with the reactive group attached thereto) of formula (la') and (Ila') are represented by
the following formulas
wherein:
X' is selected from the group consisting of -H, -OH, a substituted or
unsubstituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1
to 10 carbon atoms, phenyl, and an amine-protecting group. Preferably, X' is -H,
-OH or -Me. More preferably, X' is -H;
Y' is selected from the group consisting of -H, an oxo group, a
substituted or unsubstituted linear, branched or cyclic alkyl, alkenyl or alkynyl
having from 1 to 10 carbon atoms. Preferably, Y' is selected from -H or -Me.
More ably Y' is -H;
L', L", and L"' are same or different and are independently selected
from -H, an optionally substituted linear, branched or cyclic alkyl, alkenyl or
alkynyl having from 1 to 10 carbon atoms, a hylene glycol unit -
(OCH2CH2)n-R , n, guanidinium [-NH(C=NH)NH2], -OR, , -N0 2,
-NR'COR", -SR, a sulfoxide represented by -SOR', a sulfone represented by -
S0 2R', a sulfonate -S0 +, a sulfate -OS0 +M , a sulfonamide represented
3 M 3 by -
S0 , cyano, an azido, -COR', -OCOR', 'R" and the linking
group with the ve group bonded thereto, provided only one of L', L" and
L'" is the linking group with the reactive group bonded thereto. Preferably, L'
is the linking group with the ve group bonded thereto. Alternatively, one of
L', L", or L'" is the linking group with the reactive group bonded thereto, while
the others are -H. More preferably, L' is the linking group with the ve
group bonded thereto, and L'' and L''' are -H;
P 6 is -OR or -SR , wherein R is a linear or branched alkyl having 1 to 4
carbon atoms. Preferably, R6 is -OMe or -SMe. Even more preferably, R6 is -
OMe;
A and A' are selected from -O- and -S-. Preferably, A and A' are ;
R is -H, an optionally substituted linear, ed or cyclic alkyl, alkenyl
or alkynyl having from 1 to 10 carbon atoms or a PEG group (CH2CH20)n-R ;
n is an integer from 1 to 24; and,
R is a linear or branched alkyl having 1 to 4 carbon atoms;
R' and R" are the same or different, and are selected from -H, -OH, -OR,
-NRR , -COR, an optionally substituted linear, branched or cyclic alkyl, alkenyl
or alkynyl having from 1 to 10 carbon atoms, an ally substituted aryl
having from 6 to 18 carbon atoms, an optionally substituted 3- to 18-membered
heterocyclic ring having 1 to 6 heteroatoms ed from O, S, N and P, a PEG
group -(CH2CH20 ) -R , wherein n is an integer from 1 to 24, preferably n is 2, 4
or 8; and R is -H, an optionally substituted linear, branched or cyclic alkyl,
alkenyl or alkynyl having from 1 to 10 carbon atoms or a PEG group
(CH2CH20)n-R ;
G is selected from -CH- or -N-; and the remainder of the variables are as
described in the first specific embodiment.
In a fourth specific embodiment, for the cytotoxic dimers of formula (IAa') or
(IIAa'), L' is represented by the formula:
-W'-R -V-R -J,
W and V are the same or different, and are each independently absent, or
ed from -CR R '-, , C(=0)-, -C(=0), -S-, -SO-, -S0 2-, -CH2-S-, -
CH20-, -CH2NR -, (C=0)0-, (C=0)N(R )-, -N(R )-, -N(R )-C(=0)-,
-C(=0)-N(R )-, -N(R )-C(=0)0-, -N(C(=0)R )C(=0)-, 0)R )-, -(0-CH 2-
CH2) -, -SS-, or -C(=0)-, or an amino acid, or a peptide having 2 to 8 amino
acids;
R and R are the same or different, and are each independently absent or
an optionally substituted , branched or cyclic alkyl, alkenyl or alkynyl
having 1 to 10 carbon atoms, an aryl bearing 6 to 10 carbon atoms or a 3- to 8-
ed hetereocyclic ring g 1 to 3 heteroatoms ed from O, N or S;
R and R are the same or different, and are selected from -H, a linear,
branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms or -
(CH2-CH2-0) -Rk, wherein Rk is a -H, a linear, branched cyclic alkyl having 1 to
6 carbon atoms, optionally bearing a secondary amino (e.g., -NHR 101 ) or tertiary
amino (-NR101R102) group or a 5- or 6-membered nitrogen containing
heterocycle, such as piperidine or morpholine, wherein R101 and R102 are each
independently a linear, branched, or cyclic alkyl, alkenyl or alkynyl having 1 to
carbon atoms; preferably, R101 and R102 are each independently a linear or
branched alkyl having 1 to 6 carbon atoms;
n is an integer from 1 to 24; and
J comprises the reactive group bonded thereto, and is selected from a
maleimide, a haloacetamido, -SH, -SSRd, -CH2SH, -CH(Me)SH, -C(Me)2SH,
and -COE, wherein -COE represents a ve ester selected from, but not
limited to, N-hydroxysuccinimde ester, oxy sulfosuccinimide ester,
nitrophenyl (e.g., 2 or ophenyl) ester, dinitrophenyl (e.g., 2,4-dinitrophenyl)
ester, sulfo-tetraflurophenyl (e.g., 4-sulfo-2,3,5,6-tetrafluorophenyl) ester, and
pentafluorophenyl ester, and wherein R l is -H or a substituted or unsubstituted
linear or branched alkyl having 1 to 4 carbon atoms, and,
Rd is selected from phenyl, nitrophenyl (e.g., 2 or 4-nitrophenyl),
dinitrophenyl (e.g., 2 or 4-nitrophenyl), carboxynitrophenyl (e.g., 3-carboxy
nitrophenyl), pyridyl or yridyl (e.g., 4-nitropyridyl).
Preferably, J is -SH, -SSRd, a maleimide, or a N-hydroxysuccinimide ester.
Preferably, R is -H or -Me; R is a linear or branched alkyl having 1 to 6 carbon
atoms or -(CH2-CH2-0) -Rk; n is an integer from 2 to 8; preferably Rk is -H, -Me or
-CH2CH2-NMe2, and the remainder of the les are as described above in the third
specific embodiment.
In another preferred embodiment, V is an amino acid or a peptide having 2 to 8
amino acids. More preferably, V is -citrulline, gly-gly-gly or ala-leu-ala-leu.
In another preferred ment, W is , -N(R )- or -N(R )-C(=0)-; R is -H,
a linear or branched alkyl having 1 to 4 carbon atoms, or -(CH2-CH2-0) -Rk; R is a
linear or branched alkyl having 1 to 6 carbon atoms; V is absent, -(0-CH 2-CH2) -,
-C(=0)-NH-, -S-, -NH-C(=0)-; R is absent or a linear or branched alkyl having 1 to 4
carbon atoms; and J is -SH, -SSRd or -COE rably, N-hydroxysuccinimide ester).
The remainder of the variables is as bed in the fourth specific embodiment.
In another preferred embodiment, W is , -N(R )- or -N(R )-C(=0)-; R is H, -
Me, or -(CH2-CH2-0) -Me; n is an r from 2 to 6; R is linear or branched alkyl
bearing 1 to 6 carbon atoms; V and R are absent; and J is -COE, preferably N-
hydroxysuccinimide ester.
In a fifth specific embodiment, L' is represented by the following formula:
-W'-[CRi"R -V-[Cy]o-i-[CR3"R4"]b -COE,
2 "]a
wherein:
Rr', R2 , and R are each independently -H or -Me;
R4" is -H, -Me, -S0 +, wherein
3H, or -S0 3 M M+ is a ceutically
acceptable cation;
a is an rs from 0-2, b is an integer from 0-3; and,
Cy is an optionally substituted 5-membered heterocyclic ring bearing an
N heteroatom, preferably Cy is
In certain embodiments, such as in the fourth or the fifth specific embodiments,
W is -N(R )-.
In certain embodiments, such as in the fourth or the fifth specific embodiments,
R is -(CH2-CH2-0) Rk, wherein Rk is a -H, a linear, branched cyclic alkyl having 1 to
2 _6-
6 carbon atoms.
In certain embodiments, such as in the fourth or the fifth specific ments,
V is -S- or -SS-.
In a sixth specific embodiment, L', such as in the fourth or the fifth specific
embodiments, is represented by the following formula:
- NR -[CRi"R 2"] -S-[CR3"R4"]b-COE.
In certain embodiments, the cytotoxic compound bonded to the linking group
with the reactive group attached thereto, as in the 4th, 5th, and 6th specific
embodiments, is:
wherein Y is -SO3M, and M is -H or a pharmaceutically acceptable cation.
In a seventh specific embodiment, L', such as in the , fifth, or sixth specific
embodiment, is represented by the following formula:
- NRe-[CRi"R 2"]a-S-Cy-[CR3 "R4 "]b-COE.
In certain embodiments, the cytotoxic compound bonded to the linking group
with the reactive group attached o, as in the 4th, 5th, and 7th specific embodiment,
wherein Y is -SO3M, and M is -H or a pharmaceutically acceptable cation.
In an eighth specific embodiment, the cytotoxic compounds of a (la) and
(Ila) are represented by the following formulas:
W is absent, or selected from , -N(R )-, -N(R )-C(=0)-, -
N(C(=0)R )-, -S- or -CH 2-S-, -CH2NR -;
R is absent or selected from a linear, branched or cyclic alkyl having 1 to
carbon atoms;
R is -H, a linear, branched or cyclic alkyl, alkenyl or l having 1 to
carbon atoms or -(CH2-CH2-0) -Rk, wherein Rk is a -H, a linear, branched
cyclic alkyl having 1 to 6 carbon atoms, optionally bearing a secondary amino
(e.g., -NHR101 ) or tertiary amino (-NR101R102) group or a 5 or 6-membered
en containing heterocycle, such as piperidine or morpholine, wherein R101
and R102 are each independently a linear, branched, or cyclic alkyl, alkenyl or
alkynyl having 1 to 10 carbon atoms. Preferably, R101 and R102 are each
independently a linear or branched alkyl having 1 to 6 carbon atoms;
Zs is -H, -SRm;
Rm is Rd or a substituted or unsubstituted linear or branched alkyl having
1 to 4 carbon atoms bearing a reactive ester, selected from N-
ysuccinimide esters, N-hydroxyphtalimide esters, N-hydroxy sulfo-
succinimide esters, para-nitrophenyl esters, dinitrophenyl esters,
pentafluorophenyl esters;
Rd is selected from phenyl, nitrophenyl, dinitrophenyl,
carboxynitrophenyl, l or nitropyridyl;
n is an integer from 1 to 24; and the remainder of the variables are as
described above in the fourth specific embodiment.
ably, Rk is -H or -Me and n is an r from 2 to 8. Preferably, R is a
linear or branched alkyl having 1 to 6 carbon atoms; and the remainder of the variables
is as described above in the fifth specific embodiment.
In certain embodiments, for compounds of a (IBa) and (IIBa) bed in
the eighth ic embodiment, the variables are as described below:
X' and Y' are both -H;
A and A' are both ;
R6 is -OMe;
R is a linear or branched alkyl having 1 to 6 carbon atoms; and the remainder of
the variables is as described above in the eighth specific embodiment.
Preferably, R is -(CH2)p-(CR R )-, wherein R and R are each independently
selected from H or a linear or branched alkyl having 1 to 4 carbon atoms; p is 0, 1, 2 or
3 . More preferably, R and R are the same or different and are selected from -H and -
Me; and p is 1.
In a ninth specific embodiment, the cytotoxic compound bonded to the linking
group with the reactive group ed thereto is represented by any one of the following
formulas:
wherein:
Y is selected from -S0 3M, -S0 2M or -OS0 3M;
M is -H or a pharmaceutically acceptable cation such as Na+ or K+;
X' is selected from the group consisting of -H, -OH, a tuted or
unsubstituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1
to 10 carbon atoms, phenyl, and an amine-protecting group;
Y' is selected from the group consisting of -H, an oxo group, a
substituted or unsubstituted linear, branched or cyclic alkyl, alkenyl or alkynyl
having from 1 to 10 carbon atoms;
A and A' are selected from -O- and -S-;
W is absent, or selected from , -N(R )-, -N(R )-C(=0)-, -
N(C(=0)R )-, -S- or -CH2-S-, -CH2NR -;
R is absent or selected from a linear, branched or cyclic alkyl having 1 to
carbon atoms;
R is -H, a linear, ed or cyclic alkyl, alkenyl or alkynyl having 1 to
carbon atoms or -(CH2-CH2-0) -Rk, wherein Rk is a -H, a linear, ed
cyclic alkyl having 1 to 6 carbon atoms, optionally bearing a secondary amino
(e.g., -NHR101 ) or tertiary amino (-NR101R102) group or a 5- or 6-membered
nitrogen containing cycle, such as piperidine or morpholine, n R101
and R102 are each independently a linear, branched, or cyclic alkyl, alkenyl or
alkynyl having 1 to 10 carbon atoms;
G is selected from -CH- or -N-;
Zs -H, or is selected from any one of the following formulas:
wherein:
q is an integer from 1 to 5 ; preferably q is 2 ;
n is an integer from 2 to 6; preferably n is 4 ;
D is -H or -SO3M;
M is -H or a pharmaceutically acceptable cation, such as Na+ or K+.
In n embodiments, Zs is represented by any one of the following formulas:
In certain ments, such as the ninth specific embodiment, W is -N(R )-.
In n embodiments, R is -(CH2-CH2-0) -Rk, wherein Rk is a -H, a linear,
branched cyclic alkyl having 1 to 6 carbon atoms.
In certain embodiments, Rk is -H or -Me, n is 4, and q is 2 .
In certain embodiments, R is a linear or branched alkyl having 1 to 6 carbon
atoms.
In certain embodiments, R is -(CH2)p-(CR R )-, wherein R and R are each
ndently selected from -H or a linear or branched alkyl having 1 to 4 carbon atoms;
and p is 0, 1, 2 or 3 .
In certain embodiments, R and R are the same or different, and are selected
from -H and -Me; and p is 1.
In a tenth ic embodiment, the variables of the ninth specific embodiment
are represented below: Y is -SO3M; M is -H or a pharmaceutically acceptable cation
(e.g., Na+); X ' and Y' are both -H; A and A' are both ; R6 is -OMe; and R is a linear
or branched alkyl having 1 to 6 carbon atoms.
In any of the embodiments above, such as the 1st through the 9th specific
embodiments, Y is selected from -SO3M, -S0 2M and a sulfate -OSO3M. Preferably, Y
is -SO3M, wherein M is ably -H, Na+ or K+.
In any of the embodiments above, such as the 1st through the 10th specific
embodiments, W, when present, is C=0.
In any of the embodiments above, such as the 1st through the 10th specific
embodiments, Z and Z', when present, are -CH2-.
In any of the embodiments above, such as the 1st through the 10th specific
embodiments, X' is selected from the group consisting of -H, -OH, an optionally
substituted linear, branched or cyclic alkyl, alkenyl or l having from 1 to 10
carbon atoms, , the linking group with the reactive group bonded thereto, and an
protecting group. ably, X' is -H, -OH, -Me or the linking group with the
reactive group bonded thereto. More preferably, X' is -H.
In any of the embodiments above, such as the 1st through the 10th specific
embodiments, Y' is selected from the group consisting of -H, an oxo group, a substituted
or unsubstituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10
carbon atoms. Preferably, Y' is -H or oxo. More preferably, Y' is -H.
In any of the embodiments above, such as the 1st through the 10th ic
embodiments, A and A' are the same or different, and are selected from , -S-, -NR 5-,
and oxo -(C=0)-. Preferably, A and A' are the same or ent, and are selected from -
O- and -S-. More preferably, A and A' are .
In any of the embodiments above, such as the 1st through the 10th specific
embodiments, D and D', when present, are the same or different, and are independently
selected from a polyethylene glycol unit (-OCH2CH2)n, wherein n is an integer from 1 to
24, an amino acid, a peptide bearing 2 to 6 amino acids, or a linear, branched or cyclic
alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms, wherein the alkyl, alkenyl and
l are optionally substituted with one or more substituents independently selected
from the group consisting of n, -OR, -NR'COR", -SR and -COR'. Preferably, D
and D' are linear or branched alkyl bearing 1 to 4 carbon atoms.
In a eleventh ic embodiment, the various groups of the cytotoxic
compounds of the first, third, and nineth specific embodiment, are represented below: W
is C=0; R R2, Ri', R2', R4 and R ' are -H; one of R3, or R ' is optionally the linking
group with the reactive group bonded thereto and the other is -H; R6 is -OMe; Z and Z'
are -CH2-; X' is -H; Y' is -H; and A and A' are .
in another embodiment, the linking group with the reactive group attached
thereto as in any of the specific embodiment above is any one of those listed in List 1.
In another embodiment, cytoxic dimers without a linker es (such as the
linker moieties described above) attached thereto may further react with a bifunctional
crosslinking reagent to form a drug bearing a linking moiety with a reactive group
attached thereto, in order to be used in the methods of the present invention (e.g., to
further react with a cell-binding agent to form the drug-CBA conjugate). Alternatively,
cytoxic dimers without a linker moieties (such as the linker es described above)
attached thereto may r react with a bifunctional crosslinking reagent and a nding
reagent in a one-step reaction to directly form the drug-CBA conjugate. In
either case, an imine-reactive reagent may be added to the reaction mixture to form a
drug-imine reactive reagent adduct (such as a bisulfite adduct) prior to the reaction to
create the drug-CBA conjugate. Preferably, the c dimers without a linker moieties
(such as the linker moieties described above) attached thereto may be first pre-incubated
with the imine reactive reagent to form the adduct, before the reaction mixture is used in
the subsequent reactions to form the BA conjugate.
Thus in a twelfth ic embodiment, the imine-containing cytotoxic
compound is ented by any one of the following formulas, or a pharmaceutically
acceptable salt thereof:
and, after reacting with the imine reactive reagent, the cytotoxic nd is
represented by the following formula, or a ceutically acceptable salt
thereof:
wherein:
Y is a sulfite (HS0 3, HS0 2
2 or a salt of HS0 3 , S0 3 or HS0 2 formed
with a cation), metabisulfite (H2S2O5 or a salt of S2O5 formed with a cation),
mono-, di-, tri-, and tetra- thiophosphate (P0 3SH3, P0 2S2H2, POS3H2, PS4H2 or a
salt of P0 3S3 , PO2S23 , POS33 or PS43 formed with a cation), thio phosphate
ester (R O)2PS(OR ), R S-, R SO, 0 2, R S0 3, thiosulfate (HS20 3 or a salt of
S20 32- formed with a ), dithionite (HS20 4 or a salt of S20 42- formed with a
cation), phosphorodithioate (P(=S)(ORk )(S)(OH) or a salt thereof formed with a
cation), hydroxamic acid (Rk C(=0)NOH or a salt formed with a cation),
formaldehyde sulfoxylate (HOCH2S0 2 or a salt of HOCH2S0 2 formed with a
, such as HOCH2S0 2 Na+) or a mixture thereof, wherein R1is a linear or
branched alkyl having 1 to 10 carbon atoms and is substituted with at least one
substituent selected from -N(R )2, -C0 2H, -S0 3H, and -P0 3H; R can be further
optionally substituted with a substituent for an alkyl described herein; R is a
linear or branched alkyl having 1 to 6 carbon atoms; Rk is a linear, branched or
cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms, aryl, heterocyclyl or
heteroaryl; preferably, Y is an adduct of a ite, a hydrosulfite, or a
metabisulfite, or salts thereof (such as sodium salt);
X' is ed from the group consisting of -H, -OH, an amine-protecting
group, an optionally substituted linear, branched or cyclic alkyl, alkenyl or
alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -
(CH2CH20 ) -R , an optionally substituted aryl having 6 to 18 carbon atoms (e.g.,
phenyl), an optionally tuted 5- to 18-membered heteroaryl ring containing
one or more heteroatoms ndently selected from nitrogen, oxygen, and
, and an optionally substituted 3- to 18-membered heterocyclic ring
containing 1 to 6 heteroatoms independently selected from O, S, N and P.
ably, X' is -H, -OH, or -Me. More preferably, X' is -H;
Y' is selected from the group consisting of -H, an oxo group, an
optionally substituted linear, ed or cyclic alkyl, alkenyl or alkynyl having
from 1 to 10 carbon atoms, an optionally substituted 6- to 18-membered aryl, an
ally substituted 5- to 18-membered heteroaryl ring containing one or more
heteroatoms independently selected from nitrogen, oxygen, and sulfur, an
optionally substituted 3- to 18-membered heterocyclic ring having 1 to 6
heteroatoms. Preferably, Y' is selected from -H or oxo. More ably, Y' is -
R is -H or a substituted or unsubstituted linear or branched alkyl having
1 to 4 carbon atoms;
R R2, R3,
1 R4, Ri', R2', R3', and R4' are each independently selected
from the group consisting of -H, an optionally tuted linear, branched or
cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene
glycol unit -(OCH2CH2) -R , halogen, guanidinium [-NH(C=NH)NH2], -OR, -
NR'R", -N0 2, -NCO, -NR'COR", -SR, a sulfoxide represented by -SOR', a
sulfone represented by -S0 2R', a sulfonate -S0 3 M+, a sulfate -OS0 +, a
sulfonamide represented by -S0 2NR'R", cyano, an azido, -COR', -OCOR', and
-OCONR'R". ably, 1, 2, 3, or all of R2, R3, R2' and R3' is -H;
M is -H or a pharmaceutically acceptable cation;
R, for each occurrence, is independently selected from the group
consisting of -H, an optionally tuted linear, branched or cyclic alkyl,
alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -
(CH2CH20 ) -R , an optionally substituted aryl having 6 to 18 carbon atoms, an
optionally tuted 5- to 18-membered heteroaryl ring ning one or more
heteroatoms independently selected from en, oxygen, and sulfur, or an
optionally substituted 3- to 18-membered heterocyclic ring containing 1 to 6
heteroatoms independently selected from O, S, N and P ;
R' and R" are the same or ent, and are independently selected from
-H, -OH, -OR, -NHR, -NR2, -COR, an optionally substituted linear, ed or
cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene
glycol unit -(CH2CH20 ) -R , and an optionally substituted 3- to18-membered
heterocyclic ring having 1 to 6 heteroatoms independently selected from O, S, N
and P;
n is an integer from 1 to 24;
W is selected from C=0, C=S, CH2, BH, SO, and S0 2;
R6 is -H, -R, -OR, -SR, , -N0 2, halogen, -OR or -SR ;
preferably, R6 is -OMe or -SMe. Even more preferably, R6 is -OMe;
Z and Z' are independently selected from -(CH2) - , -(CH2) -CR7R -
(CH2)
a - , -(CH2) NR9-(CH2) , -(CH2) (CH and -(CH2) -S-(CH ;
a 2) a - 2) a
n' and na' are the same or different, and are selected from 0, 1, 2 and 3;
R7 and R are the same or different, and are each independently selected
from -H, -OH, -SH, -COOH, -NHR', a polyethylene glycol unit -(OCH2CH2) -,
an amino acid, a peptide unit bearing 2 to 6 amino acids, an optionally
substituted linear, branched or cyclic alkyl having from 1 to 10 carbon atoms;
R9 is independently selected from -H, an optionally substituted linear,
branched or cyclic alkyl having from 1 to 10 carbon atoms, a polyethylene glycol
unit -(OCH2CH2) -;
A and A' are the same or different, and are independently selected from -
0-, oxo (-C(=0)-), -CRR'O-, -CRR'-, -S-, -CRR'S-, -N(R5)- and -CRR'N(R 5)-.
Preferably, A and A' are the same or ent, and are selected from -O- and -S-.
More ably, A and A' are ;
R 5 for each occurrence is independently -H or an optionally substituted
linear or branched alkyl having 1 to 10 carbon atoms;
D and D' are the same or different, and are ndently absent or
selected from the group consisting of an optionally tuted linear, branched
or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms, an amino acid, a
peptide bearing 2 to 6 amino acids, and a polyethylene glycol unit (-OCH2CH2) -
L is absent, or when present, comprises the thiol group, and is a
polyethylene glycol unit (-OCH2CH2) -, a linear, branched or cyclic alkyl or
alkenyl having 1 to 10 carbon atoms, a phenyl group, a 3- to 18-membered
heterocyclic ring or a 5- to 18-membered heteroaryl ring having 1 to 6
atoms independently selected from O, S, N and P, n the alkyl,
alkenyl, phenyl, or heterocyclic or heteroaryl ring is optionally substituted.
Representative ures of such imine-containing cytotoxic nds are
shown in Table 15. See compounds 1, 3, 4, 5 , and Id.
In certain embodiments,
W is C=0;
Ri, R2, R3, R4, Rr, Ry, R , and R4 are -H;
Z and Z' are -CH2-;
A and A' are both ;
W is -(C=0)-;
G is -CH-;
R6 is -H, or optionally substituted CI-CIO linear, C I-CIO branched, or
C3-C7 cyclic alkyl, -O-alkyl, or -O-halo-alkyl, such as -OMe;
X' is selected from the group consisting of -H, -OH, a substituted or
unsubstituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1
to 10 carbon atoms, phenyl, and an amine-protecting group; and
Y' is selected from the group consisting of -H, an oxo group, a
substituted or tituted linear, branched or cyclic alkyl, alkenyl or alkynyl
having from 1 to 10 carbon atoms.
Preferably, Y is selected from -S0 3M, -S0 2M, or -OS0 3M, and wherein M is -H
or a pharmaceutically acceptable cation such as Na+ or K+.
Preferably, Y is -S0 3M; M is -H or Na+.
In certain embodiments, the imine-containing cytotoxic compound is ented
by any one of the following as:
wherein:
L', L", and L"' are the same or different, and are independently selected
from -H, an optionally substituted , branched or cyclic alkyl, alkenyl or
alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -
(OCH2CH2) -R , halogen, guanidinium [-NH(C=NH)NH 2], -OR, -NR'R", -N0 2,
R", -SR, a sulfoxide ented by -SOR', a sulfone represented by -
S0 2R', a sulfonate -SO3M, a e -OSO3M, a sulfonamide represented by -
S0 2NR'R", cyano, an azido, -COR', -OCOR', -OCONR'R";
M is -H or a pharmaceutically acceptable cation; and,
G is selected from -CH- or -N-.
In certain embodiments, the cytotoxic compound, when present, is represented
by one of the following formulas, or a pharmaceutically acceptable salt thereof:
In certain embodiments, one of L', L", or L'" bears the thiol group, while the
others are -H. Preferably, L' bears the thiol group, and L" and L"' are -H.
In certain embodiments, A and A' are both ; R6 is -OMe; and G is -CH-.
In n embodiments, the imine-containing cytotoxic compound may be
ented by any one of the ing formulas:
wherein:
W is absent, or when present, is selected from -CR R -, , C(=0)-,
-C(=0), -S-, -SO-, -S0 2-, -CH2-S-, -CH20-, -CH2NR -, (C=0)0-,
(C=0)N(R )-, -N(R )-, -N(R )-C(=0)-, -C(=0)-N(R )-, -N(R )-C(=0)0-, -
N(C(=0)R )C(=0)-, -N(C(=0)R )-, -(0-CH 2-CH2) -, -SS-, or -, or an
amino acid, or a peptide having 2 to 8 amino acids;
R is , or when present, is an optionally substituted linear, branched
or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms, an aryl bearing 6
to 10 carbon atoms or a 3- to 8-membered hetereocyclic ring g 1 to 3
heteroatoms selected from O, N or S;
R and R are the same or different, and are selected from -H, a linear,
branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms or -
(CH2-CH2-0) -Rk, wherein Rk is a -H, a , branched cyclic alkyl having 1 to
6 carbon atoms, optionally bearing a secondary amino (e.g., -NHR101 ) or tertiary
amino (-NR101R102) group or a 5- or 6-membered nitrogen containing
heterocycle, such as piperidine or morpholine, wherein R101 and R102 are each
independently a linear, branched, or cyclic alkyl, alkenyl or alkynyl having 1 to
carbon atoms; preferably, R101 and R102 are each independently a linear or
branched alkyl having 1 to 6 carbon atoms;
n is an integer from 1 to 24.
In certain embodiments, the cytotoxic compound, when present, may be
ented by one of the following formulas, or a pharmaceutically acceptable salt
In certain embodiments,
Y is ed from -S0 3M, -S0 2M or -OS0 3M;
M is -H or a pharmaceutically acceptable cation such as Na+ or K+;
X' is selected from the group consisting of -H, -OH, a substituted or
unsubstituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1
to 10 carbon atoms, phenyl, and an amine-protecting group;
Y' is selected from the group consisting of -H, an oxo group, a
substituted or unsubstituted linear, branched or cyclic alkyl, alkenyl or alkynyl
having from 1 to 10 carbon atoms;
A and A' are selected from -O- and -S-;
W is absent, or selected from , -N(R )-, -N(R )-, -
N(C(=0)R )-, -S- or -CH2-S-, -CH2NR -;
R is absent or selected from a linear, branched or cyclic alkyl having 1 to
carbon atoms;
R is -H, a linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to
carbon atoms or -(CH2-CH2-0) -Rk, wherein Rk is a -H, a linear, branched
cyclic alkyl having 1 to 6 carbon atoms, optionally bearing a secondary amino
(e.g., -NHR 101 ) or tertiary amino (-NR 101R 102) group or a 5- or 6-membered
nitrogen containing heterocycle, such as piperidine or morpholine, wherein R 101
and R 102 are each independently a linear, branched, or cyclic alkyl, alkenyl or
alkynyl having 1 to 10 carbon atoms;
G is selected from -CH- or -N-.
In certain embodiments, W is -N(R )-.
In certain embodiments, R is -(CH2-CH2-0) -Rk, wherein Rk is a -H, a linear,
branched cyclic alkyl having 1 to 6 carbon atoms.
In certain embodiments, Rk is -H or -Me, n is 4, and q is 2 .
In certain ments, R is a linear or branched alkyl having 1 to 6 carbon
atoms.
In certain embodiments, R is p-(CR R )-, n R and R are each
independently selected from -H or a linear or branched alkyl having 1 to 4 carbon atoms;
and p is 0, 1, 2 or 3 .
In certain embodiments, R and R are the same or ent, and are ed
from -H and -Me; and p is 1.
In certain embodiments,
Y is -SO3M, -S0 2M, or a sulfate -OSO3M; preferably -SO3M;
M is -H or a ceutically acceptable cation (e.g., Na+);
X' and Y' are both -H;
A and A' are both ;
R6 is -OMe; and
R is a linear or branched alkyl having 1 to 6 carbon atoms.
In certain embodiments, the tional inking agent is:
a maleimido-based moiety selected from: N-succinimidyl 4-
(maleimidomethyl)cyclohexanecarboxylate (SMCC), N-succinimidyl(N-
maleimidomethyl)-cyclohexane-l-carboxy-(6-amidocaproate) (LC-SMCC), K-
maleimidoundecanoic acid N-succinimidyl ester (KMUA), g-maleimidobutyric acid N-
succinimidyl ester (GMBS), e-maleimidocaproic acid N-hydroxysuccinimide ester
(EMCS), m-maleimidobenzoyl-N-hydroxysuccinimide ester (MBS), N-(oc-
maleimidoacetoxy)-succinimide ester (AMAS), succinimidyl-6 -( -
maleimidopropionamido)hexanoate (SMPH), N-succinimidyl 4-(p-maleimidophenyl)-
butyrate (SMPB), N-(p-maleimidophenyl)isocyanate (PMPI), N -succinimidyl(4-
nitropyridyldithio)butanoate; or,
a haloacetyl-based moiety selected from: N-succinimidyl(iodoacetyl)-aminobenzoate
(SIAB), N-succinimidyl iodoacetate (SIA), N-succinimidyl bromoacetate (SBA), and N-
succinimidyl 3-(bromoacetamido propionate (SBAP), bis-maleimidopolyethyleneglycol
(BMPEO), BM(PEO) 2, BM(PEO) 3, N-(p-maleimidopropyloxy)succinimide ester
(BMPS), 5-maleimidovaleric acid NHS, HBVS, 4-(4-N-maleimidophenyl)-butyric acid
hydrazide-HCl (MPBH), imidyl-(4-vinylsulfonyl)benzoate , dithiobismaleimidoethane
(DTME), 1,4-bis-maleimidobutane (BMB), l,4-bismaleimidyl-2,3-
dihydroxybutane (BMDB), bis-maleimidohexane (BMH), bis-maleimidoethane
(BMOE), sulfosuccinimidyl 4-(N-maleimido-methyl)cyclohexane-l-carboxylate (sulfo-
SMCC), sulfosuccinimidyl(4-iodo-acetyl)aminobenzoate -SIAB), mmaleimidobenzoyl-N-hydroxysulfosuccinimide
ester (sulfo-MBS), N -(g -
maleimidobutryloxy)sulfosuccinimde ester (sulfo-GMBS), N -(e-
maleimidocaproyloxy)sulfosuccimido ester (sulfo-EMCS), N - (k -
idoundecanoyloxy)sulfosuccinimide ester (sulfo-KMUS), sulfosuccinimidyl 4-
(p-maleimidophenyl)butyrate (sulfo-SMPB), CXl-1, sulfo-Mal and PEG -Mal.
In certain embodiments, the bifunctional crosslinking agent is selected from the
group ting of SMCC, SMCC, BMPS, GMBS, SIA, SIAB, N -succinimidyl-
4-(4-nitropyridyldithio)butanoate, bis-maleimidohexane or BMPEO.
In certain ments, the modified CBA, when present, is:
[ENVOfiH—CBA {QMN—CBAH$03Ho
O O
| NM HNQK H H
N N—CBA
NHAW NHAWW
O O O
O O
~/\)k | H—cBA | NM
N—CBA
O 0
o o
NMkEMOMN—CBA H
N—CBA
n : 2—20 (e.g., 2, 4, 6, s, 10)
o o
9 9
$03H
“—CBA N s “CBA
0 0 M5/
MWso3H-CBA H
X: HorNOz O O
N’\/O\/\O/\/O\/\N 0
)3 N—CBA
N/VWN CBA Q1
\ I
BMH O
O ”—CBA
In a thirteens specific embodiment, the imine—containing cytotoxic compound is:
The bifunctional crosslinking agents can be any tional linker known in the
art. For example, the bifunctional linkers can be used for making the drug-linker
compounds are those that form disulfide bonds, thioether bonds, acid labile bonds,
photolabile bonds, peptidase labile bonds and esterase labile bonds with the cytotoxic
compounds (see for example, US Patent 5,208,020; 5,475,092; 6,441,163; 6,716,821;
6,913,748; 7,276,497; 7,276,499; 7,368,565; 7,388,026 and 7,414,073, all of which are
incorporated herein by nce). ably, the bifunctional crosslinking agents are
those that form disulfide bonds, thioether and peptidase labile bonds with the cytotoxic
compounds. Other bifunctional inking agents that can be used in the present
invention include non-cleavable linkers, such as those described in U.S. publication
number US 169933, or charged linkers or hydrophilic linkers and are described in
US 2009/0274713, US 2010/01293140 and , each of which is
expressly incorporated herein by reference. The bifunctional crosslinking agents that
can be used for making the drug-linker compounds of the present ion also include
those described in Thermo Scientific Pierce Crosslinking cal ok, the entire
teaching of which is incorporated herein by reference.
In another preferred ment, the drug (with or without a linker group with a
reactive group attached thereto) that can be used in the present invention is any one of
the compounds shown in Tables 1-7. In another preferred embodiment, the cell-binding
agent-drug conjugate that can be made by the present invention is any one of the
conjugates shown in Table 8.
Table 1. Structures of representative nds in the present invention.
Table 2 . Structures of entative compounds in the present invention (Continued).
Table 3 . Structures of representative compounds in the t invention (Continued).
Table 4 . Structures of representative compounds in the present invention (Continued).
Table 5 . Structures of entative compounds in the present invention.
Table 6. ures of representative compounds in the present invention (Continued).
Table 7 . Structures of representative compounds in the t invention (Continued).
Table 8. Structures of representative conjugates of the present invention.
In any of the compounds or conjugates bed above in Tables 1-8, the imine
double bond may react with / have reacted with any of the reactive reagent (such
as those described herein) ing to the methods of the invention to form adducts,
including bisulfite adducts. Such imine-protected adducts in the compounds of Tables
1-7 may be used in further reactions according to the methods of the invention to
produce conjugates of the invention. Similarly, compounds comprising protected
adducts may be used in the methods of the invention to produce the conjugates in Table
In another embodiment, drugs optionally bearing a linking moiety (e.g., a linker
group with a reactive group attached thereto) that can be used in the methods of the
present ion are represented by formula (Al) or (A2):
(A2) .
wherein:
the double line =-= between N and C represents a single bond or a double bond,
provided that at least one of == n N and C represents a double bond, and when it
is a double bond, X is absent and Y is -H, and when it is a single bond, X is -H or an
amine protecting moiety that converts the compound into a prodrug; preferably, when it
is a double bond, X is absent and Y is -H, and the double bond may react with the imine-
reactive reagent of the invention to form an adduct (such as a ite adduct) prior to
the adduct is used in the methods of the invention to produce drug-CBA conjugates;
Y is ed from -H, -OR, an ester represented by -OCOR', a carbonate
represented by -OCOOR', a carbamate represented by 'R", an amine or a
hydroxyl amine represented by -NR'R", amide represented by ', a peptide
represented by -NRCOP, wherein P is an amino acid or a polypeptide ning
between 2 to 20 amino acid units, a thioether represented by -SR', a sulfoxide
represented by -SOR', a sulfone represented by -S0 2R', a sulfite -SO3, a bisulfite -
OSO3, -S0 2M, -SO3M, -OSO3M, a halogen, cyano, an azido, or a thiol; wherein M is -H
or a pharmaceutically acceptable cation (such as Na+); or,
Y is a sulfite (HS0 3, HS0 2
2 or a salt of HS0 3 , S0 3 or HS0 2 formed with a
cation), metabisulfite (H2S20 5 or a salt of S20 5 formed with a ), mono-, di-, tri-,
and tetra- thiophosphate (PO 3SH3, P0 2S2H2, POS3H2, PS4H2 or a salt of P0 3S , P0 2S23 ,
POS 33 or PS43 formed with a cation), thio phosphate ester (R O S OR ), R S-, R SO,
R'S02, R'SOs, thiosulfate (HS20 3 or a salt of S20 32 formed with a cation), dithionite
(HS20 4 or a salt of S20 4 formed with a cation), phosphorodithioate
(P(=S)(ORk )(S)(OH) or a salt thereof formed with a cation), amic acid
(Rk C(=0)NOH or a salt formed with a cation), formaldehyde sulfoxylate (HOCH2S0 2
or a salt of HOCH2S0 2 formed with a cation, such as HOCH2S0 2 Na+) or a mixture
thereof, wherein R1is a linear or branched alkyl having 1 to 10 carbon atoms and is
tuted with at least one substituent selected from -N(R )2, -C0 2H, -SO3H, and
-PO3H; R1can be further optionally substituted with a tuent for an alkyl described
herein; R is a linear or branched alkyl having 1 to 6 carbon atoms; Rk is a linear,
branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms, aryl,
heterocyclyl or heteroaryl;
R, R', and R" are the same or different, and are selected from -H, substituted or
unsubstituted linear, branched or cyclic alkyl, l or alkynyl having from 1 to 10
carbon atoms, a polyethylene glycol unit (-OCH2CH2) , wherein n is an integer from 1 to
2000 (preferably 1-200, or 1-20), a 5- or 6-membered heteroaryl ring containing one or
more atoms independently selected from nitrogen, oxygen, and sulfur, a 5- to 18-
membered fused ring system, wherein at least one of the rings is ic, containing
one or more heteroatoms ndently selected from en, oxygen, and sulfur, aryl
having from 6 to 18 carbon atoms, 3- to bered heterocyclic ring having 1 to 6
heteroatoms selected from O, S, N and P, wherein the substituent is selected from
halogen, -OR 7, -NR8R9, -N0 2, -NRCOR' , -SR 10 , a sulfoxide represented by -SOR', a
sulfone represented by -S0 2R', a sulfite -SO 3, a bisulfite -OSO 3, a sulfonamide
represented by -S0 2NRR', cyano, an azido, -COR , -OCOR or -OCONR Ri2;
R7, R8, R9, Rio, R 11 and Ri2 are each independently selected from -H, linear,
branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a
polyethylene glycol unit (-OCH2CH2) , wherein n is an integer from 1 to 2000
(preferably 1-200, or 1-20), a 5- or 6-membered heteroaryl ring containing one or more
heteroatoms independently selected from nitrogen, oxygen, and sulfur, a 5- to 18-
ed fused ring system, wherein at least one of the rings is aromatic, ning
one or more heteroatoms independently ed from nitrogen, oxygen, and sulfur, aryl
having from 6 to 18 carbon atoms, 3- to 10-membered heterocyclic ring having 3- to 18-
membered heterocyclic ring having 1 to 6 heteroatoms selected from O, S, N and P, and
Rio is optionally SR 13 or COR 13 ;
R i3 is selected from , branched or cyclic alkyl, alkenyl or alkynyl having
from 1 to 10 carbon atoms, a 5- or 6-membered heteroaryl ring containing one or more
heteroatoms independently selected from nitrogen, oxygen, and sulfur, a 5- to 18-
membered fused ring system, wherein at least one of the rings is aromatic, containing
one or more heteroatoms independently selected from nitrogen, , and sulfur, aryl
having from 6 to 18 carbon atoms, 3- to 18-membered heterocyclic ring having 1 to 6
heteroatoms selected from O, S, N and P, optionally R is OR , wherein R has the
14 1
same definition as R, optionally R" is -OH;
W is C=0, C=S, CH2, BH, SO or S0 2;
Ri, R2, R3, , Ri', R2', R3', and R ' are each independently selected from -H,
substituted or unsubstituted linear, ed or cyclic alkyl, alkenyl or alkynyl having
from 1 to 10 carbon atoms, a polyethylene glycol unit (-OCH2CH2)n, wherein n is an
integer from 1 to 2000 (preferably 1-200, or 1-20), or a substituent ed from a
halogen, inium [-NH(C=NH)NH 2], -OR7, -NR R9, -N0 2, -NRCOR', -SR , a
sulfoxide represented by -SOR', a sulfone ented by -S0 2R', a sulfite -S0 3, a
bisulfite -OS0 3, a sulfonamide represented by -S0 2NRR', cyano, an azido, -CORn, -
OCORn or nRi 2, wherein R7, R , R9, Rio, Rn and Ri2 are as defined above,
optionally, any one of Ri, R2, R3, R , Ri', R2', R3', or R ' is the linking group with the
reactive group attached thereto (if present), which may be selected from a rrolo,
poly-indolyl, poly-imidazolyl, polypyrollo-imidazolyl, poly-pyrollo-indolyl or
polyimidazolo-indolyl unit optionally g the linking group with the reactive group
attached thereto;
Z is selected from -(CH2) -, wherein n is 1, 2 or 3, -CR 15R 16 , -NR 1 , -O- or -S-,
wherein R 15 , Ri6 and R are each independently ed from -H, , branched or
cyclic alkyl having from 1 to 10 carbon atoms, a polyethylene glycol unit (-OCH2CH2)n,
wherein n is an integer from 1 to 2000 (preferably 1-200, or 1-20);
R6 is -OR, -SR or -NRR', wherein R and R' have the same definition as given
above, optionally R6 is the linking group with the reactive group attached thereto (if
present);
X' is selected from -CH2, -NR, -CO, -BH, -SO or -S0 2 wherein R has the same
definition as given above;
Y' is , -CH2-, -NR or -S, wherein R has the same definition as given above;
Z' is -CH2 or -(CH2) , wherein n is 2, 3 or 4, provided that X', Y' and Z' are not
all CH2 at the same time;
A and A' are the same or different and are selected from , -CRR'O, S, -
CRR'S, -NR 15 or -CRR'NHRi 5, wherein R and R' have the same definition as given
above and wherein R 15 has the same definition as R ;
D and D' are the same or different, and are independently selected from linear,
branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms, optionally
substituted with any one of halogen, -OR7, -NRgRg, -N0 2, -NRCOR', -SR , a sulfoxide
ented by -SOR', a sulfone represented by -S0 2R', a sulfite -SO3, a ite -
OSO3, a sulfonamide represented by -S0 2NRR', cyano, an azido, -CORn, -OCORn or -
OCONRnRi 2, wherein the definitions of R7, R , R9, R , Rn and R are as defined
12
above, or a polyethylene glycol unit (-OCH2CH2) , wherein n is an integer from 1 to
2000 (preferably 1-200, or 1-20);
L is an optional phenyl group or 3- to 18-membered heterocyclic ring having 1 to
6 heteroatoms selected from O, S, N and P that is optionally substituted, wherein the
substituent is the linking group with the reactive group ed thereto (if present), or is
selected from linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10
carbon atoms, optionally substituted with any one of halogen, -OR7, -NR R9, -N0 2, -
NRCOR', -SRio, a sulfoxide represented by -SOR', a e represented by -S0 2R', a
sulfite -SO 3, a bisulfite -OSO 3, a sulfonamide represented by -S0 2NRR', cyano, an
azido, -CORn, OCOR or OCONR Ri2, wherein R7, R , R9, R , Rn and R have the
12
same definitions as given above, a polyethylene glycol unit (-OCH2CH2)n, wherein n is
an integer from 1 to 2000 (preferably 1-200, or 1-20); ally, L itself is the linking
group with the reactive group attached thereto; or their pharmaceutically acceptable
solvates, salts, es or hydrated salts, their optical isomers, racemates,
reomers, enantiomers or the polymorphic crystalline structures of these
compounds; provided that the compound has no more than one linking group with the
reactive group ed thereto.
In one preferred embodiment, for drugs of formula (Al) or (A2):
the double line = = between N and C represents a single bond or a double bond,
provided that when it is a double bond X is absent and Y is -H, and when it is a single
bond, X is -H or an amine protecting group that converts the compound into a prodrug;
Y is selected from -H, -OR, NR'R", a sulfite -SO 3M , or a bisulfite -OSO 3M ,
n M is -H or a pharmaceutically acceptable cation (such as Na+);
R is selected from -H, linear, branched or cyclic alkyl, l or alkynyl having
from 1 to 10 carbon atoms, a polyethylene glycol unit (-OCH2CH2) , wherein n is an
integer from 1 to 2000 rably 1-200 or 1-20), aryl having from 6 to 10 carbon
atoms, heterocyclic ring having from 3 to 10 carbon atoms;
W is C=0, CH2 or S0 2;
R R2, R3, R4, Ri'. R2'. R3' and R4' are each independently selected from -H, -
N0 2 or the linking group with a reactive group ed thereto (if present);
R6 is -ORi , wherein R has the same definition as R ;
Z is selected from -(CH2) , wherein n is 1, 2 or 3, -CR^R^, -NR , -O- or -S-,
wherein 5, R and R are each ndently selected from -H, linear, branched or
16 17
cyclic alkyl having from 1 to 10 carbon atoms, a hylene glycol unit (-OCH2CH2) ,
n n is an integer from 1 to 2000 (preferably 1-200 or 1-20);
X' is selected from -CH2, or C=0;
Y' is , -NR, or -S, wherein R is defined as above;
Z' is -CH2- or -(CH2)2-;
A and A' are each ;
D and D' are the same or different, and are independently selected from linear,
branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms;
L is an optional phenyl group or a heterocycle ring having from 3 to 10 carbon
atoms that is optionally substituted, wherein the substituent is the linking group with a
reactive group attached thereto (if present), or is selected from linear, ed or cyclic
alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, optionally substituted with
any one of halogen, -OR7, -NR Rg, -N0 2, -NRCOR', -SRio, a sulfoxide ented by -
SOR', a sulfone represented by -S0 2R', a sulfite -SO3, a bisulfite -OSO3, a sulfonamide
represented by -S0 2NRR', cyano, an azido, -COR , -OCOR or -OCONR Ri2, a
polyethylene glycol unit (-OCH2CH2) , wherein n is an integer from 1 to 2000
(preferably 1-200 or 1-20); optionally, L itself is the linking group with a reactive group
attached thereto; or their pharmaceutically acceptable solvates, salts, hydrates or
hydrated salts, their optical isomers, racemates, diastereomers, omers or the
polymorphic crystalline structures of these compounds.
In another preferred embodiment, the drug of a (Al) or (A2) is
represented b compounds of formulae (A4) or (A5):
wherein:
the double line = = between N and C represents a single bond or a double bond,
provided that when it is a double bond, X is absent and Y is -H, and when it is a single
bond, X is -H or an amine protecting group that converts the compound into a prodrug;
Y is ed from -H, -OH, an ether represented by -OR, -NR'R", a sulfite -
S0 3M, or a bisulfite -OSO3M;
M is -H or a pharmaceutically acceptable cation (such as Na+);
R, R', and R" are selected from , branched or cyclic alkyl, alkenyl or
alkynyl having from 1 to 1 0 carbon atoms;
one of R2, R3, R2' and R3' is the linking group with a reactive group attached
thereto (if present) and the others are -H, -NRCOR' or -N0 2;
R6 is -OR, n R has the same definition as above;
Z is -CH2- or -NR, wherein R has the same definition as above;
A is -O- or -NR15;
L is -(CH2 )nn-, wherein nn is 0 or an integer between 1 and 5 , or a substituted or
unsubstituted alkyl or l having from 2 to 4 carbon atoms, wherein the substituent
is selected from halogen, -OR 7, -NRgRg, -N0 2, -NRCOR', -SR , a sulfoxide represented
by -SOR', a sulfone represented by -S0 2R', a sulfite -S0 3, a bisulfite -OS0 3, a
amide represented by -S0 2NRR', cyano, an azido, -CORn, -OCORn, or -
OCONRiiRi 2;
R , R8, R9, Rio, R11, Ri2 and 5 has the same tion as given above;
optionally, L itself is the linking group with a reactive group attached thereto (if
present);
one of L', L", or L'" is the linking group with a ve group attached thereto
(if present), while the others are -H; preferably L' is the linking group with a reactive
group attached thereto (if present); and
G is -CH- or -N-, or their pharmaceutically acceptable solvates, salts, hydrates or
ed salts, their optical isomers, racemates, diastereomers, enantiomers or the
polymorphic crystalline structures of these compounds.
In yet another red embodiment, the compound of formula (Al)
represented by compounds of formulae from formulae (A6) or (A7):
wherein:
the double line =-= between N and C represents a single bond or a double bond,
provided that when it is a double bond, X is absent and Y is -H, and when it is a single
bond, X is -H or an amine protecting group that converts the compound into a g;
Y is ed from -H, -OH, an ether represented by -OR, a sulfite -SO3, or a
bisulfite -OS0 3;
R is selected from linear, branched or cyclic alkyl, alkenyl or alkynyl having
from 1 to 10 carbon atoms;
nn is 0 or an integer from 1 to 5 ;
one of R2, R3, R2' and R3' is the linking group with a reactive group attached
thereto (if present) and the others are -H, -NRCOR', or -N0 2;
one of L', L" or L'" is the linking group with a reactive group attached thereto
(if present), provided that when one of L', L" or L'" is the g group with a reactive
group attached thereto, the others are -H (e.g., if L' is the linking group with a reactive
group attached thereto, then L" and L'" are -H);
G is -CH- or -N-, or their pharmaceutically acceptable solvates, salts, es or
hydrated salts, their l isomers, racemates, diastereomers, enantiomers or the
polymorphic crystalline structures of these compounds.
In another specific embodiment, one of R2, R , R2' and R ' of a (A4) and
(A6) is the linking group with a reactive group attached thereto(if present), and is
represented by a -W'-R -V-R -J, and the rest are -H; L" and L"' of formula
(A5) and (A7) are -H, and L' is the linking group with a reactive group attached thereto
(if present), and is represented by formula
-W'-R -V-R y-J
wherein:
is absent, -CR R -, , C(=0)-, -S-, -CH2-S-, (C=0)0-,
(C=0)N(R )-, -N(R )-, -N(R )-C(=0)-, -N(R )-C(=0)0-, or -C(=0)-;
R is absent or an optionally substituted linear, branched or cyclic alkyl, alkenyl
or l having 1 to 10 carbon atoms;
V is absent, -(CH2-CH2-0) -, , C(=0)-, -S-, (C=0)0-, 0-(C=0)N(R )-,
-N(R )-, -N(R )-C(=0)-, -N(R )-C(=0)0-, -C(=0)-, an amino acid, or a peptide having 2
to 8 amino acids;
R is absent or a linear, branched or cyclic alkyl having 1 to 10 carbon atoms;
R is -H or a linear or branched alkyl having 1 to 4 carbon atoms;
R is -H, a linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10
carbon atoms or -(CH2-CH2-0) -R ,
n is an integer from 1 to 24; and
J is as bed above in the fourth specific embodiment.
Preferably, R is -H or -Me; R is a linear or branched alkyl having 1 to 6 carbon
atoms or -(CH2-CH2-0) -R ; n is an integer from 2 to 8; and the remainder of the
variables are as bed above in the fourth specific embodiment.
In another preferred embodiment, V is an amino acid or a peptide having 2 to 8
amino acids. More preferably, V is valine-citrulline, gly-gly-gly or u-ala-leu.
ably, J is -SH, -SSRd or -COE as described above.
In another specific embodiment, one of R2, R3, R2' and R3' of formula (A4) and
(A6) is the linking group with a ve group attached thereto (if present), and is
represented by formula -W '-R -S-Zs; L" and L'" of formula (A5) and (A7) are -H, and
L' is represented by -W '-R -S-Zs, wherein the variables are as described in the eigth and
ninth ic embodiments.
In another embodiment, the compounds of formula (A1)-(A7) (with or without
pre-incubation with the imine-reactive reagent), if the linking group with a reactive
group attached thereto is not already present, can further react with a bifunctional
crosslinking reagent bed above to form an imine-containing drug bearing the
linking group with a reactive group attached thereto, which can be used in the methods
of the present invention.
In certain embodiments, the containing drug bearing the linking group
with a reactive group attached thereto that can be used in the methods of the present
invention is represented by any one of the following formulas:
(A8)
wherein:
"Linker" is represented by formula (al), (a2), (a3), (a4), (a5), (a6), (a7) or (a8)
described above (in the ninth specific embodiment);
q is an integer from 1 to 5 ;
n is an integer from 2 to 6;
D is -H or -SO3M;
M is -H or a pharmaceutically acceptable cation, such as Na+ or K+; and the
der of the variables is as bed in the eigth or ninth specific embodiments.
Preferably, q is 2 and n is 4 .
In a preferred embodiment, Linker is represented by formula (al), (a4), (a5), (a9)
or (alO) described above.
In certain embodiments, for compounds of formula (A8) described immediately
above, the variables are as bed below:
is , -N(R )-, -N(R )-C(=0)-, -N(COR )-, -S- or -;
R is absent or selected from a linear, branched or cyclic alkyl having 1 to 6
carbon atoms;
R is -H, a linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10
carbon atoms or -(CH2-CH2-0) -Rk, wherein Rk is a -H, a linear, ed cyclic alkyl
having 1 to 6 carbon atoms, optionally bearing a primary, secondary or tertiary amino
group or a 5- or 6-membered Nitrogen containing heterocycle, such as piperidine or
morpholine;
n is an integer from 1 to 24; and the remainder of the variables are as described
above in the embodiment immediately above.
ably, Rk is -H or -Me and n is an integer from 2 to 8. Preferably, R is a
linear or branched alkyl having 1 to 6 carbon atoms.
In another preferred embodiment, the linker is represented by any one of the
a selected from formulas (al), (a4), (a5), (alO) and (all) shown above; and the
remainder of the variables are as described above in the ninth specific ment.
In certain embodiments, for compounds of formula (A8) described in the
embodiments above, the variables are as described below:
X' and Y' are both -H;
A and A' are both ;
R6 is -OMe;
R is a linear or branched alkyl having 1 to 6 carbon atoms; and the remainder of
the variables is as described above.
Preferably, R is -(CH2)p-(CR R )-, wherein R and R are each independently
selected from -H or a linear or branched alkyl having 1 to 4 carbon atoms; p is 0, 1, 2 or
3 . More preferably, R and R are the same or different and are selected from -H and -
Me; and p is 1.
In r preferred embodiment, the linker is represented by any one of the
formula selected from formulas (al), (a4), (a5), (alO) and (all) shown above; and the
remainder of the les are as described above.
In another preferred embodiment, the drug of formula (Al), (A2) or (A3) is any
one of the compounds shown in Tables 11-13 and the conjugate can be made by the
method of the present invention is any one of the conjugates shown in Table 14.
Table 11. Structures of representative drugs that can be used in the s of the
present invention.
Note: Z" = H, SMe, SPy, 2, Ac; X"' = NHS;
Table 12. Structures of representative drugs that can be used in the methods of the
present invention (Continued).
Table 13. ures of representative drugs that can be used in the methods of the
present invention (Continued).
WO 12687
102102
Table 14. Structures of representative conjugates that can be made by methods of the
present invention.
Any compounds of Tables 11-13 and any conjugates of Table 14 may have at
least one of its imine bonds reacted with a subject imine reactive reagent, thus forming
an adduct, such as bisulfite adduct.
In one embodiment, the imine-containing drug bearing a g moiety are those
having a reactive ester group, a thiol or a thiol ve group described above.
Alternatively, the drug described above can further react with bifunctional
crosslinking agent to form a drug bearing a linking moiety. Any bifunctional
crosslinking agents described can be used.
In another preferred embodiment, the drug that can be used in the present
invention is any one of the nds shown in Table 15.
Table 15. Representative drug compounds that can be used in the present methods.
CELL-BINDING AGENT
The iveness of the conjugates of the invention as therapeutic agents
depends on the careful selection of an appropriate cell-binding agent. Cell-binding
agents may be of any kind tly known, or that become known and includes
peptides and non-peptides. Generally, these can be dies (especially monoclonal
antibodies), lymphokines, hormones, growth factors, vitamins (such as folate etc., which
may bind to a cell surface receptor therefor, e.g., a folate receptor), nutrient-transport
molecules (such as transferrin), or any other cell-binding molecule or substance.
In certain embodiments, the cell-binding agents are proteins or polypetides, or
compounds comprising proteins or polypetides. Preferably, the proteins or polypeptides
comprise one or more Lys residues with side chain -NH2 groups. Alternatively or in
addition, the proteins or polypeptides comprise one or more Cys residues. The side
chain -SH groups of the Cys residues may be , or may be in a disulfide bond that
can be reduced. Preferably, reduction of the disulfide bond(s) does not significantly
negatively impact the cell-binding function of the proteins or ptides {e.g., in the
case of antibody or antigen-binding portion thereof, reduction of the disulfide bonds
does not substantially se the dissociation of light chains / heavy chains).
The Lys side chain -NH2 groups and/or the Cys side chain -SH groups may be
covalently linked to the linkers, which are in turn linked to the dimer compounds of the
invention, thus conjugating the cell-binding agents to the dimer compounds of the
invention. Each protein-based cell-binding agents may contain multiple Lys side chain -
NH2 groups and/or the Cys side chain -SH groups available for linking the nds
of the invention through the bifunctional crosslinkers.
More specific examples of cell-binding agents that can be used include:
polyclonal antibodies;
monoclonal dies;
fragments of dies such as Fab, Fab', and 2, Fv, minibodies,
diabodies, tribodies, tetrabodies (Parham, J. Immunol. 131:2895-2902 (1983); Spring et
al. J. Immunol. 113:470-478 (1974); Nisonoff et al. Arch. Biochem. Biophys. 89:230-
244 (1960), Kim et al., Mol, Cancer Ther., 7 : 2486-2497 (2008), Carter, Nature Revs.,
6 : 343-357 (2006));
interferons (e.g. a, b, g) ;
lymphokines such as IL-2, IL-3, IL-4, IL-6;
hormones such as insulin, TRH (thyrotropin releasing hormone), MSH
(melanocyte-stimulating hormone), steroid es, such as androgens and estrogens;
growth factors and colony- ating factors such as EGF, pha, FGF,
VEGF, G-CSF, M-CSF and GM-CSF ss, logy Today 5:155-158 (1984));
transferrin (O'Keefe et al. J. Biol. Chem. 260:932-937 );
vitamins, such as folate;
Protein scaffolds based on a consensus sequence of fibronectin type III (FN3)
repeats (also known as Centyrins; See U.S. Patent Publication 2010/0255056,
incorporated herein by nce);
Designer Ankyrin Repeat Proteins (DARPins; U.S. Patent Application Nos.
20040132028; 82274; 20110118146; 20110224100, incorporated herein by
reference), C. Zahnd et al. 2010, Cancer Res., 70; 1595-1605, incorporated herein by
reference); and,
Fibronectin domain scaffold proteins (Adnectins: US Patent Application Nos.
20070082365; 20080139791, incorporated herein by reference).
Monoclonal dy techniques allow for the production of extremely ic
cell-binding agents in the form of specific monoclonal antibodies. ularly well
known in the art are techniques for creating onal antibodies produced by
immunizing mice, rats, hamsters or any other mammal with the n of interest such
as the intact target cell, antigens isolated from the target cell, whole virus, attenuated
whole virus, and viral proteins such as viral coat proteins. Sensitized human cells can
also be used. Another method of creating monoclonal antibodies is the use of phage
libraries of scFv (single chain variable region), specifically human scFv (see e.g.,
Griffiths et al., U.S. Patent Nos. 5,885,793 and 5,969,108; McCafferty et al., WO
92/01047; Liming et al., WO 99/06587). In addition, resurfaced antibodies disclosed in
U.S. Patent No. 5,639,641 may also be used, as may chimeric antiobodies and
humanized antibodies. Selection of the appropriate cell-binding agent is a matter of
choice that depends upon the particular cell population that is to be targeted, but in
general human monoclonal antibodies are preferred if an appropriate one is available.
For example, the monoclonal antibody MY9 is a murine IgGi antibody that binds
specifically to the CD33 Antigen {J.D. Griffin et al 8 Leukemia Res., 521 (1984)} and
can be used if the target cells s CD33 as in the disease of acute myelogenous
leukemia (AML). The cell-binding agent may be any compound that can bind a cell,
either in a specific or non-specific manner. Generally, these can be antibodies (especially
monoclonal antibodies and antibody fragments), interferons, lymphokines, hormones,
growth factors, vitamins, nutrient-transport molecules (such as transferrin), or any other
cell-binding molecule or substance.
Where the cell-binding agent is an antibody, it binds to an antigen that is a
polypeptide and may be a transmembrane le {e.g. receptor) or a ligand such as a
growth factor. Exemplary antigens include molecules such as renin; a growth hormone,
including human growth hormone and bovine growth hormone; growth hormone
releasing factor; parathyroid hormone; thyroid stimulating e; lipoproteins; alpha-
1-antitrypsin; n A-chain; insulin B-chain; proinsulin; follicle ating hormone;
calcitonin; luteinizing hormone; glucagon; clotting factors such as factor vmc, factor IX,
tissue factor (TF), and von Willebrands factor; anti-clotting factors such as Protein C;
atrial natriuretic factor; lung surfactant; a plasminogen activator, such as urokinase or
human urine or tissue-type plasminogen activator (t-PA); bombesin; thrombin;
hemopoietic growth factor; tumor necrosis factor-alpha and -beta; enkephalinase;
RANTES (regulated on activation normally T-cell expressed and secreted); human
macrophage inflammatory protein (MIP-1 ); a serum albumin, such as human
serum albumin; rian-inhibiting substance; n A-chain; relaxin n;
axin; mouse gonadotropin- associated peptide; a microbial protein, such as beta-
lactamase; DNase; IgE; a cytotoxic T-lymphocyte associated antigen (CTLA), such as
CTLA-4; inhibin; activin; vascular elial growth factor ; ors for
es or growth factors; protein A or D; rheumatoid factors; a rophic factor
such as bone-derived neurotrophic factor (BDNF), neurotrophin-3, -4, -5, or -6 (NT-3,
NT4, NT-5, or NT-6), or a nerve growth factor such as NGF-b; platelet-derived growth
factor (PDGF); fibroblast growth factor such as aFGF and bFGF; fibroblast growth
factor receptor 2 (FGFR2); epidermal growth factor (EGF); transforming growth factor
(TGF) such as TGF-alpha and TGF-beta, including TGF- bI , TGF-p2, TGF- b3, TGF-
b4, or TGF- b5; insulin-like growth factor-I and -II (IGF-I and IGF-II); des(l-3)-IGF-I
(brain IGF-I), insulin-like growth factor binding proteins, EpCAM, GD3, FLT3, PSMA,
PSCA, MUCl, MUCl 6, STEAP, CEA, TENB2, EphA receptors, EphB ors, folate
receptor, FOLR1, mesothelin, cripto, alphavbeta6, integrins, VEGF, VEGFR, EGFR,
tamsferrin receptor, IRTAl, IRTA2, IRTA3, IRTA4, IRTA5; CD proteins such as CD2,
CD3, CD4, CD5, CD6, CD8, CD11, CD14, CD19, CD20, CD21, CD22, CD25, CD26,
CD28, CD30, CD33, CD36, CD37, CD38, CD40, CD44, CD52, CD55, CD56, CD59,
CD70, CD79, CD80. CD81, CD103, CD105, CD134, CD137, CD138, CD152 or an
dy which binds to one or more tumor-associated antigens or cell-surface receptors
disclosed in US Publication No. 20080171040 or US Publication No. 20080305044 and
are incorporated in their entirety by reference; erythropoietin; osteoinductive factors;
immunotoxins; a bone morphogenetic protein (BMP); an interferon, such as eron-
alpha, -beta, and ; colony stimulating factors (CSFs), e.g., M-CSF, GM-CSF,
and G-CSF; interleukins (ILs), e.g., IL-1 to IL-10; superoxide dismutase; T-cell
receptors; surface membrane proteins; decay rating factor; viral antigen such as,
for example, a portion of the HIV envelope; transport proteins; homing receptors;
addressins; regulatory proteins; integrins, such as CDlla, CDllb, CDllc, CD18, an
ICAM, VLA-4 and VCAM; a tumor ated antigen such as HER2, HER3 or HER4
receptor; endoglin, c-Met, 1GF1R, PSGR, NGEP, PSMA, PSCA, LGR5, B7H4, and
fragments of any of the above-listed polypeptides.
Additionally, GM-CSF, which binds to d cells can be used as a cell-
binding agent to ed cells from acute myelogenous leukemia. IL-2 which binds to
activated T-cells can be used for prevention of transplant graft rejection, for therapy and
prevention of graft-versus-host e, and for treatment of acute T-cell leukemia.
MSH, which binds to melanocytes, can be used for the treatment of melanoma, as can
antibodies directed towards melanomas. Folic acid can be used to target the folate
receptor expressed on ovarian and other tumors. Epidermal growth factor can be used to
target squamous cancers such as lung and head and neck. Somatostatin can be used to
target lastomas and other tumor types.
Cancers of the breast and testes can be successfully targeted with estrogen (or
estrogen analogues) or androgen (or androgen analogues) respectively as cell-binding
agents.
In one embodiment, the cell-binding agent is humanized onal antibodies.
In another embodiment, the cell-binding agent is huMy9-6, or other related antibodies,
which are described in U.S. Pat. Nos. 7,342,110 and 7,557,189 (incorporated herein by
reference). In another embodiment, the cell-binding agent is an anti-folate receptor
antibody described in U.S. Provisional ation Nos. 61/307,797, ,595,
61/413,172 and U.S. Application No. 13/033,723 (published as US 2012-0009181 Al).
The teachings of all these applications are incorporated herein by reference in its
entirety.
In certain embodiments, the cell-binding agent may be a onal dy or
n-binding portions thereof g sequences critical for antigen-binding with an
antibody sed herein, such as huMy9-6 or its related antibodies described in U.S.
Pat. Nos. 7,342,1 10 and 7,557,189 (incorporated herein by reference). These derivative
antibodies may have substantially the same or identical (1) light chain and/or heavy
chain CDR3 regions; (2) light chain and/or heavy chain CDR1, CDR2, and CDR3
regions; or (3) light chain and/or heavy chain regions, compared to an dy
described herein. Sequences within these regions may n conservative amino acid
subsitutions, including substitutions within the CDR regions. Preferably, there is no
more than 1, 2, 3, 4, or 5 conservative substitutions. In certain embodiments, the
derivative antibodies have a light chain region and/or a heavy chain region that is at least
about 90%, 95%, 99% or 100% identical to an antibody described herein. These
derivative antibodies may have substantially the same binding specificity and/or affinity
to the target antigen compared to an antibody described herein. Preferably, the K
and/or s of the derivative dies are within 10-fold (either higher or lower),
-fold (either higher or lower), 3-fold (either higher or , or 2-fold (either higher or
lower) of an antibody bed herein. These derivative antibodies may be fully human
antobodies, or humanized antibodies, or chimeric antibodies. The derivative antibodies
may be produced according to any art-recognized methods.
In one embodiment, the anti-folate receptor antibody is a zed antibody or
antigen binding fragment thereof that specifically binds a human folate receptor 1,
wherein the antibody comprises: (a) a heavy chain CDR1 comprising GYFMN (SEQ ID
NO: 1); a heavy chain CDR2 comprising RIHPYDGDTFYNQXaa 1FXaa2Xaa3 (SEQ ID
NO: 2); and a heavy chain CDR3 comprising YDGSRAMDY (SEQ ID NO: 3); and (b)
a light chain CDR1 comprising KASQSVSFAGTSLMH (SEQ ID NO: 4); a light chain
CDR2 comprising RASNLEA (SEQ ID NO: 5); and a light chain CDR3 comprising
QQSREYPYT (SEQ ID NO: 6); wherein Xaai is selected from K, Q, H, and R; Xaa2 is
selected from Q, H, N, and R ; and Xaa3 is selected from G, E, T, S, A, and V.
Preferably, the heavy chain CDR2 sequence comprises RIHPYDGDTFYNQKFQG
(SEQ ID NO: 7).
In another embodiment, the anti-folate receptor antibody is a humanized
antibody or antigen binding fragment thereof that specifically binds the human folate
receptor 1 comprising the heavy chain having the amino acid sequence of
QVQLVQSGAEVVKPGASVKISCKASGYTFTGYFMNWVKQSPGQSLEWIGRIHP
YDGDTFYNQKFQGKATLTVDKSSNTAHMELLSLTSEDFAVYYCTRYDGSRAM
DYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK
KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH
EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY
KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP
SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV
MHEALHNHYTQKSLSLSPGK (SEQ ID NO: 8).
In another embodiment, the anti-folate antibody is a zed antibody or
antigen binding fragment thereof encoded by the plasmid DNA deposited with the
ATCC on April 7, 2010 and having ATCC deposit nos. PTA-10772 and PTA-10773 or
10774.
In r ment, the anti-folate receptor antibody is a humanized
antibody or antigen binding fragment thereof that specifically binds the human folate
receptor 1 comprising the light chain having the amino acid sequence of
DIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMHWYHQKPGQQPRLLIYRA
SNLEAGVPDRFSGSGSKTDFTLNISPVEAEDAATYYCQQSREYPYTFGGGTKLEI
PSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO: 9); or
DIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMHWYHQKPGQQPRLLIYRA
VPDRFSGSGSKTDFTLTISPVEAEDAATYYCQQSREYPYTFGGGTKLEI
KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
(SEQ ID NO: 10).
In another embodiment the anti-folate receptor antibody is a humanized antibody
or antigen binding nt thereof that specifically binds the human folate receptor 1
comprising the heavy chain having the amino acid sequence of SEQ ID NO: 8, and the
light chain having the amino acid sequence of SEQ ID NO: 9 or SEQ ID NO: 10.
Preferably, the antibody comprises the heavy chain having the amino acid sequence of
SEQ ID NO: 8 and the light chain having the amino acid sequence of SEQ ID NO: 10
(hu FOLR1).
In another embodiment, the anti-folate receptor antibody is a humanized
antibody or antigen binding fragment thereof d by the plasmid DNA deposited
with the ATCC on April 7, 2010 and having ATCC deposit nos. PTA- 10772 and PTA-
10773 or 10774.
In another ment, the anti-folate receptor antibody is a humanized
antibody or antigen binding fragment f comprising a heavy chain variable domain
at least about 90%, 95%, 99% or 100% identical to
QVQLVQSGAEVVKPGASVKISCKASGYTFTGYFMNWVKQSPGQSLEWIGRIHP
YDGDTFYNQKFQGKATLTVDKSSNTAHMELLSLTSEDFAVYYCTRYDGSRAM
DYWGQGTT VTVSS (SEQ ID NO: 11), and a light chain variable domain at least
about 90%, 95%, 99% or 100% identical to
DIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMHWYHQKPGQQPRLLIYRA
SNLEAGVPDRFSGSGSKTDFTLNISPVEAEDAATYYCQQSREYPYTFGGGTKLEI
KR (SEQ ID NO: 12);
orDIVLTQSPLSLAVSLGQPAIISCKASQSVSFAGTSLMHWYHQKPGQQPRLLIYR
ASNLEAGVPDRFSGSGSKTDFTLTISPVEAEDAATYYCQQSREYPYTFGGGTKLE
IKR (SEQ ID NO: 13).
A cell-binding agent, such as an antibody, can be ed with a
heterobifunctional crosslinker bearing an amine-reactive group, such as N -
ysuccinimide group (NHS , a reactive maleimido, vinylpyridine,
vinyl sulfone, vinyl sulfonamide or a haloacetyl-based group, or a thiol group.
Thiol residues in antibody can be introduced by a number of methods known in
the art, including: a) modification of antibody with thiol-generating reagents such as 2-
iminothiolane or homocysteine thiolactone, or b) via reaction with a disulfidecontaining
bifunctional crosslinking agent such as SPP, SPDP, SPDB, sulfo-
SPDB followed by reduction of the disulfide bond with DTT or TCEP to generate a free
thiol, c) mutagenesis to incorporate non-native ne residues, such as cysteine -
engineered antibodies (US2007/0092940 Al, US 003766 Al, US 7723485 B2),
or d) reduction of native disulfide bonds (del Rosario, R. B . et al., Cancer Res. Suppl.
1990, 50, 804s-808s).
A reactive group, such as maleimido, vinylpyridine, vinyl sulfone, vinyl
sulfonamide or a haloacetyl-based group in antibody can be introduced by modifying an
dy with a heterobifunctional crosslinking agent bearing a thiol-reactive group
(including but not limited to SPDB, inimidyl(4-nitropyridyl
dithio)butanoate, sulfo-SMCC, SMCC, LC-SMCC, KMUA, BMPS, GMBS, sulfo-
GMBS, EMCS, EMCS, AMAS, SVSB, SPP, NHS-(PEG)n-mal, where n = 1 to
24, preferably 2, 4, 8, 12, and 24). Crosslinking agents comprising a maleimido-based
moiety include /V-succinimidyl 4-(maleimidomethyl)cyclohexane-carboxylate ,
N-succinimidyl(N-maleimidomethyl)-cyclohexane-l-carboxy-(6-amidocaproate),
which is a "long chain" analog of SMCC (LC-SMCC), K-maleimidoundecanoic acid/V-
succinimidyl ester (KMUA), g-maleimidobutyric acid N-succinimidyl ester (GMBS), e-
maleimidocaproic acid /V-hydroxysuccinimide ester (EMCS), imidobenzoyl -N-
hydroxysuccinimide ester (MBS), N-(a-maleimidoacetoxy)-succinimide ester (AMAS),
succinimidyl(P-maleimidopropionamido)hexanoate (SMPH), /V-succinimidyl 4-(pmaleimidophenyl
)-butyrate (SMPB), and N-(p-maleimidophenyl)isocyanate (PMPI).
Thiol reactive compounds which contain a vinylpyridine are bed (Friedman M. et.
Al. Int. J. Peptide Protein Res. 1974, 6, 183-185; Mak A. et. Al. Anal. Biochem. 1978,
84, 432-440). Thiol reactive compounds which contain a vinyl sulfone moiety have
been described (Masri M . S . J . Protein Chem., 1988, 7, 49-54; Morpurgo, M. et. Al.
Bioconjugate Chem. 1996, 7, 363-368) Cross-linking reagents comprising a haloacetylbased
moiety include N-succinimidyl(iodoacetyl)-aminobenzoate (SIAB), N-
imidyl iodoacetate (SIA), /V-succinimidyl bromoacetate (SBA), and N-
succinimidyl 3-(bromoacetamido propionate (SBAP).
The modified antibody can be purified by any suitable methods known in the art,
for example, gel filtration, TFF or ion-exchange chromatography or affinity
tography.
All references cited herein and in the examples that follow are expressly
incorporated by nce in their entireties.
CELL-BINDING AGENT-DRUG CONJUGATES
The present invention provides improved methods to e cell-binding agent-
drug conjugates, comprising a cell-binding agent linked to one or more cytotoxic
compounds of the present invention via a variety of linkers, including, but not limited to,
ide linkers, thioether linkers, amide bonded linkers, peptidase-labile linkers, acid-
labile s, esterase-labile linkers.
Representative conjugates that can be made using the methods of the invention
include antibody / cytotoxic compound, antibody fragment / cytotoxic nd,
epidermal growth factor (EGF) / cytotoxic compound, melanocyte stimulating e
(MSH) / cytotoxic compound, d ating e (TSH) / cytotoxic
compound, somatostatin/cytotoxic compound, folate / cytotoxic nd, estrogen /
cytotoxic compound, estrogen analogue / cytotoxic compound, androgen/cytotoxic
compound, and androgen analogue / cytotoxic compound. A representative folate /
cytotoxic compound conjugate is depicted below, with the optional -S0 3Na adduct on
the imine bond of one of the two drug monomers. A representative synthesis scheme for
this conjugate is shown in .
folate / cytotoxic compound conjugate
In a preferred embodiment, the present invention provides methods for ing
conjugates comprising an indolinobenzodiazepine dimer compound (e.g., formulas (lb'),
(lib'), (lab'), (IIAb'), (IBb'), (IIBb'), (XHIb'), (Xb'), etc.) and the cell-binding agent
linked h a covalent bond. The linker can be cleaved at the site of the
tumor/unwanted proliferating cells to deliver the cytotoxic agent to its target in a number
of ways. The linker can be d, for example, by low pH (hydrazone), reductive
environment (disulfide), proteolysis (amide/peptide link), or through an enzymatic
reaction (esterase/glycosidase).
In a preferred aspect, representative cytotoxic conjugates that can be produced by
the methods of the invention are antibody / indolinobenzodiazepine dimer compound,
antibody fragment / indolinobenzodiazepine dimer compound, epidermal growth factor
(EGF) / indolinobenzodiazepine dimer compound, melanocyte stimulating hormone
(MSH) / nobenzodiazepine dimer compound, thyroid ating hormone (TSH) /
nobenzodiazepine dimer compound, somatostatin/ indolinobenzodiazepine dimer
compound, folate/ indolinobenzodiazepine dimer compound, estrogen /
indolinobenzodiazepine dimer compound, estrogen analogue / indolinobenzodiazepine
dimer compound, prostate specific membrane antigen (PSMA) inhibitor /
indolinobenzodiazepine dimer compound, matriptase inhibitor / indolinobenzodiazepine
dimer compound, designed ankyrin repeat proteins (DARPins) /
indolinobenzodiazepine dimer compound, androgen / indolinobenzodiazepine dimer
compound, and androgen analogue/ nobenzodiazepine dimer compound.
Thus in the fourteenth specific embodiment, the methods of the invention
produce a conjugate comprising: a cytotoxic nd and a cell binding agent (CBA),
wherein the cytotoxic nd is covalently linked to the CBA through a linking
group, and wherein the cytotoxic nd and the g group portion of the
conjugate is re resented by any one of the following formulas:
or a pharmaceutically acceptable salt thereof, wherein:
Y is a leaving group, and is a e (HS0 2-
3, HS0 2 or a salt of HSO3 , SO3 or
HSO2 formed with a cation), metabisulfite 5 or a salt of S2O52- formed with a
), mono-, di-, tri-, and tetra- thiophosphate (PO3SH3, PO2S2H2, POS3H2, PS4H2 or
a salt of PO3S3 , PO2S23 , POS33 or PS43 formed with a cation), thio phosphate ester
(R O)2PS(OR ), R S-, R SO, R^, S , thiosulfate (HS20 3 or a salt of S20 32 formed
with a cation), dithionite (HS20 4 or a salt of S20 4 formed with a cation),
phosphorodithioate (P(=S)(ORk )(S)(OH) or a salt thereof formed with a cation),
hydroxamic acid (Rk C(=0)NOH or a salt formed with a cation), formaldehyde
sulfoxylate (HOCH2SO2 or a salt of HOCH2SO2 formed with a cation, such as
HOCH2SO2 Na+) or a mixture f, wherein R1is a linear or branched alkyl having 1
to 10 carbon atoms and is substituted with at least one substituent selected from -N(R )2,
-CO2H, -SO3H, and -PO3H; R1can be further optionally substituted with a substituent for
an alkyl described herein; R is a linear or branched alkyl having 1 to 6 carbon atoms;
Rk is a linear, ed or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms,
aryl, heterocyclyl or heteroaryl; preferably, Y is an adduct of a bisulfite, a hydrosulfite,
or a metabisulfite, or salts thereof (such as sodium salt);
X' is selected from -H, an protecting group, the g group, an
optionally substituted linear, ed or cyclic alkyl, alkenyl or alkynyl having from 1
to 10 carbon atoms, a polyethylene glycol unit -(CH2CH20 ) -R , an optionally
substituted aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18-
membered heteroaryl ring containing one or more heteroatoms independently selected
from nitrogen, oxygen, and sulfur, and an optionally substituted 3- to bered
heterocyclic ring containing 1 to 6 heteroatoms independently selected from O, S, N and
Y' is selected from -H, an oxo group, the linking group, an optionally substituted
linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, an
optionally substituted 6- to 18-membered aryl, an optionally substituted 5- to 18-
membered heteroaryl ring containing one or more heteroatoms independently ed
from nitrogen, oxygen, and sulfur, an optionally tuted 3- to 18-membered
heterocyclic ring having 1 to 6 heteroatoms;
R is -H or a substituted or unsubstituted linear or branched alkyl having 1 to 4
carbon atoms, or the linking group;
R R2, R3, R4, Ri', R2', R3' and R4' are each independently selected from the
group consisting of -H, an optionally substituted linear, branched or cyclic alkyl, l
or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(OCH2CH2) -
R , halogen, guanidinium [-NH(C=NH)NH2], -OR, -NR'R", -N0 2, -NCO, -NR'COR",
-SR, a sulfoxide represented by -SOR', a sulfone represented by -SO2R', a sulfonate -
S0 3 M+, a e -OS0 +, a sulfonamide represented
3 M by -S0 2NR'R", cyano, an
azido, -COR', , -OCONR'R" and the linking group;
M is -H or a pharmaceutically acceptable cation, such as Na+;
R, for each ence, is independently selected from the group consisting of -
H, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having
from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH2CH20 ) -R , an optionally
substituted aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18-
membered heteroaryl ring containing one or more heteroatoms independently selected
from nitrogen, , and sulfur, or an optionally substituted 3- to bered
heterocyclic ring containing 1 to 6 atoms independently selected from O, S, N and
R' and R" are each independently selected from -H, -OH, -OR, -NHR, -NR2, -
COR, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl
having from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH2CH20 ) -R , and an
optionally substituted 3membered cyclic ring having 1 to 6 heteroatoms
independently selected from O, S, N and P ;
R is -H or a substituted or unsubstituted linear or ed alkyl having 1 to 4
carbon atoms, or the linking group;
n is an integer from 1 to 24;
W is selected from C=0, C=S, CH2, BH, SO and S0 2;
R6 is -H, -R, -OR, -SR, -NR'R", -N0 2, halogen or the linking group;
Z and Z' are independently selected from -(CH2) - , -(CH2) '-CR7Rg-(CH2) -, -
(CH2V-NR9-(CH2) a , -(CH2) (CH 2) a and -(CH2) -S-(CH 2) a ;
n' and na' are the same or different, and are selected from 0, 1, 2 and 3;
R7 and R are the same or different, and are each independently selected from -H,
-OH, -SH, -COOH, -NHR', a polyethylene glycol unit -(OCH2CH2) -, an amino acid, a
e unit bearing 2 to 6 amino acids, an optionally substituted linear, branched or
cyclic alkyl having from 1 to 10 carbon atoms;
R 9 is independently selected from -H, an ally substituted linear, branched
or cyclic alkyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -
(OCH CH ) -;
A and A' are the same or different, and are independently selected from , oxo
(-C(=0)-), -CRR'O-, -CRR'-, -S-, -CRR'S-, -N(R5)- and -CRR'N(R5)-,
R 5 for each occurrence is ndently -H or an optionally substituted linear or
branched alkyl having 1 to 10 carbon atoms;
D and D' are the same or ent, and are independently absent or selected from
the group consisting of an optionally tuted linear, branched or cyclic alkyl, alkenyl
or alkynyl having 1 to 10 carbon atoms, an amino acid, a e bearing 2 to 6 amino
acids, and a polyethylene glycol unit (-OCH2CH2)n-;
L is absent, the g group, a polyethylene glycol unit (-OCH2CH2) -, an
optionally substituted linear, branched or cyclic alkyl or alkenyl having 1 to 10 carbon
atoms, a phenyl group, a 3- to 18-membered cyclic ring or a 5- to 18-membered
heteroaryl ring having 1 to 6 atoms independently selected from O, S, N and P,
wherein the alkyl or alkenyl is optionally substituted with the linking group; phenyl or
heterocyclic or heteroaryl ring can be optionally substituted, wherein the substituent can
comprise the linking group.
A representative conjugate is presented below ("Ab" stands for a CBA, such as
an antibody):
In certain embodiments, Y is -S0 2M, -S0 3M, or -OS0 3M .
In certain embodiments, the conjugates that can be synthesized by the methods of
the invention include the following:
2012/025257
N/\/\n/N——CBA
/ H Y
NpOMeo mom/No N\{
O O
wherein:
CBA is the cell-binding agent, r is an integer from 1 to 10, Y is -H, an
adduct of a bisulfite, a hydrosulfite, a metabisulfite, or salts thereof, or -SO3M,
and M is -H or a pharmaceutically acceptable cation.
In certain embodiments, L is absent, or is selected from an optionally substituted
phenyl group and an optionally substituted pyridyl group, wherein the phenyl and the
pyridyl group bears the linking group, or L is an amine group bearing the linking group
(i.e., -N(linking group)-), or L is a , branched or cyclic alkyl or alkenyl having
from 1 to 6 carbon atoms and bearing the linking group.
In the fifteenth specific embodiment, the xic compound bonded to the
linking group is ented by any one of the following formulas:
wherein:
L', L", and L"' are the same or different, and are independently selected
from -H, an optionally tuted linear, ed or cyclic alkyl, alkenyl or
alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -
(OCH2CH2)n-R , halogen, guanidinium [-NH(C=NH)NH 2], -OR, -NR'R", -N0 2,
-NR'COR", -SR, a sulfoxide ented by -SOR', a sulfone represented by -
S0 2R', a sulfonate -SO3M, a sulfate -OSO3M, a sulfonamide represented by -
S0 2NR'R", cyano, an azido, -COR', -OCOR', -OCONR'R" and the linking
group, ed only one of L', L", and L'" is the linking group; and
G is ed from -CH- or -N-. The remaining groups are as described in
the fourteenth specific embodiment above.
In certain embodiments, one of L', L", or L'" is the linking group, while the
others are -H. Preferably, L' is the linking group, and L" and L"' are -H.
In n ments, A and A' are both , R6 is -OMe, and G is -CH-.
In a nth specific ment, L' is represented by the following formula:
-W'-R -V-R -J,
wherein:
W and V are the same or different, and are each independently absent, or
selected from -CR R '-, , C(=0)-, -C(=0), -S-, -SO-, -S0 2-, -CH2-S-, -
CH20-, -CH2NR -, (C=0)0-, (C=0)N(R )-, -N(R )-, -N(R )-C(=0)-, -
C(=0)-N(R )-, -N(R )-C(=0)0-, -N(C(=0)R )C(=0)-, -N(C(=0)R )-, -(0-CH 2-
CH2) -, -SS-, or -C(=0)-, or an amino acid, or a peptide having 2 to 8 amino
acids;
R and R are the same or different, and are each independently absent or
an optionally substituted , branched or cyclic alkyl, alkenyl, or alkynyl
having 1 to 10 carbon atoms, an aryl bearing 6 to 10 carbon atoms or a 3- to 8-
membered hetereocyclic ring bearing 1 to 3 heteroatoms selected from O, N or S;
R and R are the same or different, and are selected from -H, a linear,
branched or cyclic alkyl, alkenyl, or alkynyl having 1 to 10 carbon atoms or -
(CH2-CH2-0) -Rk, wherein Rk is a -H, a linear, branched cyclic alkyl having 1 to
6 carbon atoms, optionally bearing a secondary amino (e.g., -NHR101 ) or tertiary
amino (-NR101R102) group or a 5- or 6-membered nitrogen containing
heterocycle, such as dine or morpholine, wherein R101 and R102 are each
independently a linear, branched, or cyclic alkyl, l or alkynyl having 1 to
carbon atoms; preferably, R101 and R102 are each independently a linear or
branched alkyl having 1 to 6 carbon atoms;
n is an integer from 1 to 24; and
J is covalently linked to the CBA, and is ed from a succinimide, a
acetamido, -S-, -SS-, , -CH(Me)S-, -C(Me)2S-, -NR 1-, -CH 1-, -
NR l N-, and -C(=0)-, wherein R l is -H or a substituted or unsubstituted linear
or branched alkyl having 1 to 4 carbon atoms.
In n embodiments, J is -S-, -SS-, a succinimide, or -C(=0)-.
In certain embodiments, R is -H or -Me; R is a linear or branched alkyl having
1 to 6 carbon atoms or -(CH2-CH2-0) -Rk; n is an integer from 2 to 8; and Rk is -H, -Me
or -CH2CH2-NMe2, and the remainder of the variables are as described above in the
fifteenth specific embodiment.
In n embodiments, V is an amino acid or a peptide having 2 to 8 amino
acids.
In certain ments, V is valine-citrulline, gly-gly-gly, or ala-leu-ala-leu.
In certain embodiments,
is , -N(R )- or -N(R )-C(=0)-;
R is H, a linear or branched alkyl having 1 to 4 carbon atoms, or -(CH2-
CH2-0) -Rk;
R is a linear or branched alkyl having 1 to 6 carbon atoms;
V is , -(0-CH 2-CH2) -, -C(=0)-NH-, -S-, -NH-C(=0)-;
R is absent or a linear or ed alkyl having 1 to 4 carbon atoms; and
J is -S-, -SS-, or -C(=0)-, and the remaining groups are as defined in the
sixteenth specific embodiment.
In certain embodiments,
is , -N(R )- or -N(R )-;
R is -H, -Me, or -(CH2-CH2-0) -Me;
n is an integer from 2 to 6;
R is linear or branched alkyl bearing 1 to 6 carbon atoms;
V and R are absent; and
J is -C(=0)-. The remaining groups are as defined in the sixteenth
specific embodiment.
In a seventeenth specific embodiment, L' in the sixteenth specific embodiment is
represented by the following formula:
-W'-[CRi"R 2 "]a-V-[Cy]o-i-[CR3 "R4 "]b-C(=0)-,
wherein:
Rr , R2", and R3 are each independently -H or a linear or branched alkyl
bearing 1 to 4 carbon atoms, preferably -Me;
R4 is -H, a linear or ed alkyl bearing 1 to 4 carbon atoms
(preferably -Me), -S0 +, wherein
3H, or -S0 3 M M+ is a ceutically
acceptable cation;
a is an integers from 0-5 (e.g., from 0 to 2, 3, 4, or 5), and b is an integer
from 0-6 (e.g., from 0 to 3, 4, 5, or 6); and,
Cy is an optionally substituted 5-membered heterocyclic ring bearing an
N heteroatom, preferably Cy is
In certain embodiments, such as in the sixteenth or the seventeenth specific
embodiment, W is -N(R )-.
In certain embodiments, such as in the sixteenth or the seventeenth specific
embodiment, R is -(CH2-CH2-0)2Rk, wherein Rk is a linear or branched alkyl having
1 to 6 carbon atoms.
In n embodiments, such as in the sixteenth or the seventeenth specific
embodiment, V is -S- or -SS-.
In an eighteenth specific embodiment, L' in the sixteenth or the seventeenth
specific embodiment is represented by the following formula:
- NR -[CRi"R 2 "]a -S-[CR 3 "R4 =0)-.
In certain embodiments, such as in the sixteenth to seventeenth specific
ments, the conjugate is:
n r is an integer from 1 to 10, Y is -S0 3M, and M is -H or a
pharmaceutically able cation.
In certain embodiments, such as in the sixteenth to eighteenth specific
embodiments, the antibody is huMy9-6.
In a nineteenth specific embodiment, L' in the sixteenth or the seventeenth
specific embodiment is represented by the following formula:
- NR -[CRi"R2"]a-S-Cy-[CR 3"R4 "]b-C(=0)-.
In certain embodiments, such as in the sixteenth, seventeenth, and the enth
specific embodiments, the ate is:
wherein r is an integer from 1 to 10, Y is -S0 3M, and M is -H or a
pharmaceutically acceptable cation.
In certain embodiments, such as in the sixteenth, seventeenth, and the nineteenth
ic embodiments, the antibody is huMy9-6.
In a twentieth specific embodiment, the cytotoxic compound bonded to the
linking group is ented by the following formula:
wherein:
W is absent, or selected from , -N(R )-, -N(R )-C(=0)-, -
N(C(=0)R )-, -S-, -, or -CH2NR -;
R is absent or selected from a linear, branched or cyclic alkyl having 1 to
carbon atoms;
R is -H, a linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to
carbon atoms or -(CH2-CH2-0) -Rk, wherein Rk is a -H, a linear, branched
cyclic alkyl having 1 to 6 carbon atoms, optionally g a secondary amino
(e.g., -NHR 101 ) or tertiary amino (-NR101R102) group or a 5 or 6-membered
en containing heterocycle, such as piperidine or morpholine, wherein R101
and R102 are each independently a linear, branched, or cyclic alkyl, alkenyl or
alkynyl having 1 to 10 carbon atoms;
Zs is linked to the CBA, and is either a bond, or -SRm-;
Rm is Rd or a substituted linear or branched alkyl having 1 to 4 carbon
atoms g a ve ester, ed from N-hydroxysuccinimide esters, N-
hydroxyphtalimide esters, N-hydroxy sulfo-succinimide esters, para-nitrophenyl
esters, dinitrophenyl esters, and pentafluorophenyl esters;
Rd is selected from phenyl, nitrophenyl, dinitrophenyl,
carboxynitrophenyl, pyridyl or nitropyridyl; and
n is an integer from 1 to 24; and the remainder of the variables are as
described above in the eighth or the fifteenth specific embodiment.
In a twenty-first specific embodiment, the cytotoxic compound bonded to the
linking group is represented by the following formula:
wherein:
W is absent, or selected from , -N(R )-, -N(R )-C(=0)-, -
N(C(=0)R )-, -S-, -CH2-S-, or -CH2NR -;
R is absent or selected from a linear, branched or cyclic alkyl having 1 to
carbon atoms;
R is -H, a linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to
carbon atoms or -(CH2-CH2-0) -Rk, wherein Rk is a -H, a linear, branched
cyclic alkyl having 1 to 6 carbon atoms, optionally bearing a secondary amino
(e.g., -NHR101 ) or ry amino (-NR101R102) group or a 5 or 6-membered
nitrogen ning heterocycle, such as piperidine or morpholine, wherein R101
and R102 are each independently a linear, branched, or cyclic alkyl, l or
alkynyl having 1 to 10 carbon atoms;
n is an integer from 2 to 6;
Zs is linked to the CBA, and is selected from:
a bond;
q is an integer from 1 to 5 ; and,
M is -H or a pharmaceutically acceptable cation, such as Na+ or K+.
In certain embodiments Zs is represented by any one of the following formulas:
In certain embodiments, such as the 2 1st specific embodiment, W is -N(R )-.
In certain embodiments, such as the 2 1st specific embodiment, R is -(CH2-CH2-
0 ) -Rk, wherein Rk is a -H, a , ed cyclic alkyl having 1 to 6 carbon atoms.
In certain embodiments, such as the 2 1st specific embodiment, Rk is -H or -Me, n
is 4, and q is 2 .
In certain embodiments, such as the 2 1st specific embodiment, R is a linear or
branched alkyl having 1 to 6 carbon atoms.
In certain embodiments, such as the 2 1st specific embodiment, R is -(CH2)P-
(CR R )-, wherein R and R are each independently selected from H or a linear or
branched alkyl having 1 to 4 carbon atoms; and p is 0, 1, 2 or 3 .
In certain embodiments, such as the 2 1st specific embodiment, R and R are the
same or different, and are ed from -H and -Me; and p is 1.
In a twenty-second specific embodiment, the conjugate of a (VHIb') and
(Xb') described in the twenty-first specific embodiment, the variables are as described
below:
Y is -SO3M;
M is -H or a pharmaceutically acceptable cation (e.g . , Na+);
X' and Y' are both -H;
A and A' are both ;
R6 is -OMe; and
R is a linear or branched alkyl having 1 to 6 carbon atoms.
In certain embodiments, such as the 14th to the 2 1st ic embodiment, Y is
selected from -SO3M, -S0 2M and a sulfate -OSO3M. Preferably, Y is -SO3M .
Preferably, M is -H, Na+ or K+.
In n embodiments, such as the 14th to the 22nd specific embodiment, W,
when present, is C=0.
In certain embodiments, such as the 14 to the 22 ic embodiment^ and
Z', when present, are -CH2-.
In certain embodiments, such as the 14th to the 22nd ic embodiment,X' is
selected from the group consisting of -H, -OH, an optionally substituted linear, ed
or cyclic alkyl, l or alkynyl having from 1 to 10 carbon atoms, phenyl, the linking
group, and an amine-protecting group. In certain embodiments, X' is -H, -OH, -Me or
the linking group. Preferably, X' is -H.
In certain embodiments, such as the 14th to the 22nd specific embodiment,Y' is
selected from the group consisting of -H, an oxo group, a substituted or unsubstituted
linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms.
Preferably, Y' is -H or oxo. More preferably, -H.
In certain embodiments, such as the 14th to the 22nd specific embodiment,A and
A' are the same or different, and are selected from , -S-, -N(R5)-, and oxo (C=0).
Preferably, A and A' are the same or different, and are selected from -O- and -S-. More
preferably, A and A' are .
In certain embodiments, such as the 14th to the 22nd specific embodiment,D and
D', when present, are the same or different, and are independently ed from a
polyethylene glycol unit (-OCH2CH2) , wherein n is an integer from 1 to 24, an amino
acid, a peptide bearing 2 to 6 amino acids, or a linear, branched or cyclic alkyl, alkenyl
or alkynyl having 1 to 10 carbon atoms, wherein the alkyl, l and alkynyl are
ally substituted with one or more substituents independently selected from the
group consisting of halogen, -OR, -NR'COR", -SR and -COR'. Preferably, D and D'
are linear or ed alkyl bearing 1 to 4 carbon atoms.
In a twenty-third specific embodiment, for nds of formula (Ibb') or
(IIBb'), described in the twentieth specific embodiment, the variables are as described
below:
Y is -SO3M;
M is -H or Na+;
X' and Y' are both -H;
A and A' are both ;
R6 is -OMe;
R is a linear or branched alkyl having 1 to 6 carbon atoms.
Preferably, R is -(CH2)p-(CR R )-, wherein R and R are each independently
selected from -H or a linear or branched alkyl having 1 to 4 carbon atoms; p is 0, 1, 2 or
3 . More ably, R and R are the same or different, and are selected from -H and -
Me; and p is 1.
In a twenty-fourth specific embodiment, the conjugate of the present invention as
bed in the fourteenth, fifteenth, or the twenty-first specific embodiment is
represented by the following:
Y is -SO3M, wherein M is -H or a pharmaceutically acceptable cation
( . ., Na+);
W is C=0;
one of R3, or R3' is optionally the linking group and the other is -H;
R6 is -OMe;
Z and Z' are -CH2;
X' is -H;
Y' is -H; and
A and A' are .
In any of the specific embodiments for the conjugate of the invention above,
such as the 14th to the 24th specific embodiments, Y is selected from -SO3M, -S0 2M and
a sulfate -OS0 3M . Preferably, Y is -S0 3M .
In certain embodiments, such as the 14th to the 24th specific embodiment,M is -H,
Na+ or K+.
In any of the specific embodiments for the conjugate of the invention above,
such as the 14th to the 24th specific embodiments, W, when present, is C=0.
In any of the specific embodiments for the conjugate of the ion above,
such as the 14th to the 24th specific embodiments, Z and Z', when present, are -CH2-.
In any of the ic embodiments for the conjugate of the ion above,
such as the 14th to the 24th specific embodiments, X' is selected from the group
consisting of -H, -OH, an optionally substituted linear, branched or cyclic alkyl, alkenyl
or alkynyl having from 1 to 10 carbon atoms, phenyl, the linking group, and an rotecting
group. In n ments, X' is -H, -OH, -Me or the linking group. In
certain embodiments, X' is -H.
In any of the specific embodiments for the conjugate of the invention above,
such as the 14th to the 24th specific embodiments, Y' is selected from the group
consisting of -H, an oxo group, a substituted or tituted linear, branched or cyclic
alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms. In certain embodiments, Y'
is -H or oxo. In certain embodiments, Y' is -H.
In any of the specific embodiments for the conjugate of the invention above,
such as the 14th to the 24th specific embodiments, A and A' are the same or different, and
are selected from , -S-, -, and oxo (C=0). In certain embodiments, A and A'
are the same or different, and are selected from -O- and -S-. In certain embodiments, A
and A' are .
In any of the specific embodiments for the conjugate of the invention above,
such as the 14th to the 24th specific embodiments, D and D', when present, are the same
or different, and are independently selected from a hylene glycol unit (-
OCH 2CH 2)n, wherein n is an integer from 1 to 24, an amino acid, a e bearing 2 to
6 amino acids, or a linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10
carbon atoms, wherein the alkyl, alkenyl and alkynyl are optionally substituted with one
or more substituents independently selected from the group consisting of halogen, -OR, -
NR'COR", -SR and -COR'. In certain embodiments, D and D' are linear or branched
alkyl bearing 1 to 4 carbon atoms.
In certain ments, the conjugate of any one of the described embodiments,
such as the 14th to the 24th specific embodiments, may comprise 1-10 cytotoxic
compounds, 2-9 cytotoxic compounds, 3-8 cytotoxic compounds, 4-7 cytotoxic
compounds, or 5-6 cytotoxic compounds, each cytotoxic compound sing the
linking group linking the cytotoxic compound to the CBA, and each cytotoxic
compound on the conjugate is the same.
In certain embodiments, the conjugate of any one of the described embodiments,
such as the 14th to the 24th ic embodiments, may comprise 1-10 cytotoxic
compounds, 2-9 cytotoxic nds, 3-8 cytotoxic compounds, 4-7 cytotoxic
compounds, or 5-6 cytotoxic compounds, each cytotoxic compound comprising the
linking group g the cytotoxic compound to the CBA, and each cytotoxic
nd on the ate is the same.
In n embodiments, the conjugate of any one of the described embodiments,
such as the 14th to the 24th specific embodiments, may comprise 1-10 total cytotoxic
compounds and (unmodified) imine-containing xic compounds, 2-9 total cytotoxic
compounds and (unmodified) imine-containing cytotoxic compounds, 3-8 total cytotoxic
compounds and (unmodified) imine-containing cytotoxic nds, 4-7 total cytotoxic
compounds and (unmodified) imine-containing cytotoxic compounds, or 5-6 total
cytotoxic compounds and (unmodified) imine-containing cytotoxic compounds, each
cytotoxic compounds or (unmodified) imine-containing cytotoxic compound comprising
the linking group linking the the cytotoxic compounds or (unmodified) imine-containing
cytotoxic compound to the CBA, and each cytotoxic compounds or (unmodified) iminecontaining
cytotoxic compound on the conjugate is the same (except for the fite)
modification).
In any of the conjugates embodiments, such as the 14th to the 24th specific
embodiments, the cell-binding agent may bind to target cells selected from tumor cells,
virus infected cells, microorganism infected cells, parasite infected cells, mune
cells, activated cells, myeloid cells, activated T-cells, B cells, or melanocytes; cells
expressing the CD4, CD6, CD19, CD20, CD22, CD30, CD33, CD37, CD38, CD40,
CD44, CD56, EpCAM, CanAg, CALLA, or Her-2 antigens; Her-3 antigens; or cells
expressing insulin growth factor receptor, mal growth factor receptor, and folate
receptor.
In any of the conjugates embodiments, such as the 14th to the 24th specific
ments, the cell-binding agent may be an dy, a single chain antibody, an
antibody fragment that specifically binds to the target cell, a onal antibody, a
single chain monoclonal dy, or a monoclonal antibody fragment that specifically
binds the a target cell, a chimeric antibody, a chimeric dy fragment that
specifically binds to the target cell, a domain antibody, a domain antibody fragment that
ically binds to the target cell, a lymphokine, a hormone, a n, a growth factor,
a colony stimulating factor, or a nutrient-transport molecule.
The antibody may be a resurfaced antibody, a resurfaced single chain antibody,
or a resurfaced antibody nt.
The antibody may be a monoclonal antibody, a single chain monoclonal
antibody, or a monoclonal dy fragment thereof.
The antibody may be a humanized antibody, a humanized single chain antibody,
or a humanized antibody fragment.
In any one of the specific ment herein, such as the 1st - 24th specific
embodiments, the imine reactive reagent is selected from the group consisting of sulfites
(H2S0 3, H2S0 2 or a salt of HS0 2
3 , S0 3 or HS0 2 formed with a cation), metabisulfite
or a salt of S2O5 formed with a cation), mono, di, tri, and tetra- thiophosphates
(PO3SH3, PO2S2H3, POS3H3, PS4H3 or a salt of P0 3S3 , P0 2S23 , POS33 or PS4 formed
with a cation), thio ate esters ((R O)2PS(OR ), R SH, R^OH, R^C^H, R^OsH),
various amines (hydroxyl amine (e.g., NH2OH), hydrazine (e.g., NH2NH2), NH2O-R1,
R^NH-R , NH2-R'), NH2-CO-NH2, NH2-C(=S)-NH2'thiosulfate (H2S20 3 or a salt of
S2O32- formed with a cation), dithionite (H2S20 4 or a salt of S20 42- formed with a
cation), phosphorodithioate (P(=S)(ORk)(SH)(OH) or a salt thereof formed with a
cation), hydroxamic acid (RkC(=0)NHOH or a salt formed with a cation), hydrazide
(RkCONHNH 2), dehyde sulfoxylate (HOCH2S0 2H or a salt of HOCH2S0 2
formed with a cation, such as HOCH2SO2 Na+), glycated nucleotide (such as GDP-
mannose), fludarabine or a e thereof, wherein R1and R1 are each independently a
linear or branched alkyl having 1 to 10 carbon atoms and are substituted with at least
one substituent selected from -N(R )2, -C0 2H, -SO3H, and -PO3H; R and R can be
further optionally substituted with a substituent for an alkyl described herein; R is a
linear or branched alkyl having 1 to 6 carbon atoms; Rk is a linear, branched or cyclic
alkyl, alkenyl or alkynyl having 1 to 10 carbon atoms, aryl, heterocyclyl or heteroaryl.
Preferably, the imine reactive reagent is ed from sulfites, hydroxylamine,
ine and urea. More preferably, the imine ve reagent is NaHS0 3 or KHSO3.
In any one of the specific ment herein, such as the 1st - 24th specific
embodiments, about 0.1 to about 30 molar equivalents of the imine reactive reagent to
the imine-containing cytotoxic compound is used. In certain embodiments, about 1 to
about 10 molar equivalents of the imine reactive reagent to the imine-containing
cytotoxic compound is used. In n embodiments, about 3 to about 5 molar
equivalents of the imine reactive reagent to the imine-containing xic compound is
used.
In any one of the ic ment herein, such as the 1st - 24th specific
embodiments, the bifunctional crosslinking agent links the cytotoxic agent to the cellbinding
agent through a thioether bond, and may have a maleimido- or haloacetyl-based
moiety, wherein the bifunctional crosslinking agent having the maleimido-based moiety
is selected from: N-succinimidyl 4-(maleimidomethyl)cyclohexanecarboxylate (SMCC),
N-succinimidyl(N-maleimidomethyl)-cyclohexane-l-carboxy-(6-amidocaproate)
(LC-SMCC), imidoundecanoic acid N-succinimidyl ester (KMUA), g -
maleimidobutyric acid N-succinimidyl ester (GMBS), e-maleimidocaproic acid N-
hydroxysuccinimide ester (EMCS), m-maleimidobenzoyl-N-hydroxysuccinimide ester
(MBS), N-(a-maleimidoacetoxy)-succinimide ester (AMAS), succinimidyl(P-
maleimidopropionamido)hexanoate (SMPH), N-succinimidyl 4-(p-maleimidophenyl)-
butyrate (SMPB), N-(p-maleimidophenyl)isocyanate (PMPI), N -succinimidyl(4-
yridyldithio)butanoate; and, wherein the bifunctional crosslinking agent having
the haloacetyl-based moiety is selected from: N-succinimidyl(iodoacetyl)-
aminobenzoate (SIAB), N-succinimidyl iodoacetate (SIA), inimidyl
bromoacetate (SBA), and N-succinimidyl 3-(bromoacetamido)propionate (SBAP), bismaleimidopolyethyleneglycol
(BMPEO), BM(PEO) 2, BM(PEO) 3, N-(bmaleimidopropyloxy
)succinimide ester (BMPS), 5-maleimidovaleric acid NHS, HBVS,
4-(4-N-maleimidophenyl)-butyric acid hydrazide HCl (MPBH), Succinimidyl-(4-
vinylsulfonyl)benzoate (SVSB), dithiobis-maleimidoethane (DTME), s-
maleimidobutane (BMB), l,4-bismaleimidyl-2,3-dihydroxybutane (BMDB), bismaleimidohexane
(BMH), bis-maleimidoethane (BMOE), sulfosuccinimidyl 4-(N-
maleimido-methyl)cyclohexane-l-carboxylate -SMCC), sulfosuccinimidyl(4-iodoacetyl
)aminobenzoate (sulfo-SIAB), m-maleimidobenzoyl-N-hydroxysulfosuccinimide
ester (sulfo-MBS), N-(y-maleimidobutryloxy)sulfosuccinimde ester (sulfo-GMBS), N-
(e-maleimidocaproyloxy)sulfosuccimido ester (sulfo-EMCS), N-(k-
maleimidoundecanoyloxy)sulfosuccinimide ester -KMUS), sulfosuccinimidyl 4-
(p-maleimidophenyl)butyrate (sulfo-SMPB), CXl-1, sulfo-Mal and PEG -Mal.
In certain embodiments, the bifunctional crosslinking agent is ed from the
group consisting of SMCC, Sulfo-SMCC, BMPS, GMBS, SIA, SIAB, N -succinimidyl-
4-(4-nitropyridyldithio)butanoate, bis-maleimidohexane or BMPEO.
In any of the embodiments, such as the 1st - 24th ic embodiments, the
conjugate is purified by tangential flow tion, adsorptive chromatography, adsorptive
filtration, selective precipitation, non-absorptive filtration or combination thereof.
Preferably, the conjugate is purified by tangential flow filtration and/or adsorptive
tography.
In certain embodiments, such as the 1st - 24th specific embodiments, the nding
agent (CBA) g the thiol-reactive group is:
The compounds or the ates made by the methods of the invention
specifically include:
WO 12687
’OwONOwN’XS‘SWN antlbody.
[ zOWONOWN/XS‘SWNsogH H antibody
[ 0
O N’Vlm
anti body
Sillwfl’OwONOwN/VYNwlwb
n r is an integer from 1 to 10, Y is —H or -SO3M, and M is —H or a
pharmaceutically acceptable cation.
In a 25th specific ment, the invention es a method for preparing a
conjugate of th following formula:
the method comprising reacting a cytotoxic compound of the following formula,
with a modified CBA of the following formula, respectively, at a pH of about 4
to about 9,
wherein:
r is an integer from 1 to 10;
Y is a leaving group, and is a sulfite (HSO 3, HS0 2 or a salt of HSO 3 ,
SO3 or HSO 2 formed with a cation), metabisulfite (H2S2O5 or a salt of S2O5
formed with a ), mono-, di-, tri-, and tetra- thiophosphate (PO 3SH3,
PO2S2H2, POS 3H2, PS4H2 or a salt of P0 3 , P0 3 , POS 3
3S 2S2 3 or PS4 formed
with a cation), thio phosphate ester (R O)2PS(OR ), R S-, R SO, R S0 2, S0 ,
lfate (HS 2O3 or a salt of S2O3 formed with a cation), dithionite (HS 20 4 or
a salt of S20 42 formed with a cation), phosphorodithioate (P(=S)(ORk')(S)(OH)
or a salt thereof formed with a cation), hydroxamic acid (Rk OH or a salt
formed with a cation), formaldehyde sulfoxylate (HOCH 2SO2 or a salt of
HOCH 2SO2 formed with a cation, such as HOCH +) or a mixture thereof,
2SO2 Na
wherein R1is a linear or branched alkyl having 1 to 10 carbon atoms and is
substituted with at least one substituent selected from -N(R )2, -CO 2H , -SO 3H ,
and -PO 3H ; R1can be further optionally substituted with a tuent for an alkyl
described herein; R is a linear or branched alkyl having 1 to 6 carbon atoms; Rk
is a linear, branched or cyclic alkyl, alkenyl or alkynyl having 1 to 10 carbon
atoms, aryl, heterocyclyl or heteroaryl; preferably Y is -SO 3M ; and
M is -H or a pharmaceutically acceptable cation.
In certain embodiments, Y is -SO3M; and M is -H or a pharmaceutically
acceptable .
In certain ments, the cytotoxic compound is produced by reacting an
imine reactive reagent with an imine-containing cytotoxic compound of the following
formula:
In certain embodiments, the CBA is huMy9-6.
In a 26th specific embodiment, the invention provides a method for preparing a
conjugate of the following formula:
the method comprising reacting the CBA with an imine-containing cytotoxic
compound, an imine ve reagent, and a bifunctional crosslinking agent
comprising the linking group to form the conjugate,
wherein:
the i
the bifunctional crosslinking agent is:
, respectively, and,
the imine reactive reagent is selected from: sulfites (H2SO3, H2SO2 or a
salt of HSO3 , SO32- or HSO2 formed with a cation), metabisulfite (H2S2O5 or a
salt of S2O5 formed with a cation), mono, di, tri, and tetra- thiophosphates
(PO3SH3, 3, POS3H3, PS4H3 or a salt of P0 3S3 , P0 2S2 , POS33 or PS4
formed with a cation), thio phosphate esters ((P O PS OR ), R^H, PJSOH,
R'S0 2H, R'S0 3H), various amines (hydroxyl amine (e.g., NH2OH), hydrazine
(e.g., NH2NH2), \ R^NH-R , NH2-R'), NH2-CO-NH2, NH2-C(=S)-NH2'
thiosulfate (H2S20 3 or a salt of S2C "3 formed with a cation), dithionite (H2S20 4
or a salt of S20 4 formed with a cation), phosphorodithioate
(P(=S)(ORk)(SH)(OH) or a salt thereof formed with a cation), hydroxamic acid
(RkC(=0)NHOH or a salt formed with a cation), hydrazide (RkCONHNH2),
formaldehyde sulfoxylate (HOCH2S0 2H or a salt of HOCH2S0 2 formed with a
cation, such as HOCH2S0 2 Na+), glycated nucleotide (such as GDP-mannose),
fludarabine or a mixture thereof, wherein R1and R1 are each independently a
linear or branched alkyl having 1 to 10 carbon atoms and are tuted with at
least one substituent selected from -N(R )2, -C0 2H, -SO3H, and -PO3H; R and R
can be further optionally substituted with a substituent for an alkyl described
herein; R is a linear or branched alkyl having 1 to 6 carbon atoms; Rk is a linear,
branched or cyclic alkyl, alkenyl or l having 1 to 10 carbon atoms, aryl,
heterocyclyl or heteroaryl.
In certain embodiments, Y is -SO3M; and M is -H or a pharmaceutically
acceptable cation.
In certain embodiments, the CBA is huMy9-6.
IN VITRO CYTOTOXICITY OF COMPOUNDS AND ATES
The cytotoxic compounds and cell-binding agent-drug conjugates produced by
the methods of the invention can be evaluated for their ability to suppress eration
of various cancer cell lines in vitro. For e, cell lines such as the human colon
carcinoma line COLO 205, the rhabdomyosarcoma cell line RH-30, and the le
a cell line MOLP-8 can be used for the assessment of cytotoxicity of these
nds and conjugates. Cells to be evaluated can be exposed to the compounds or
conjugates for 1-5 days and the surviving fractions of cells measured in direct assays by
known methods. IC values can then be calculated from the results of the assays.
Alternatively or in addition, an in vitro cell line sensitivity screen, such as the one
described by the U.S. National Cancer Institute (see Voskoglou-Nomikos et al., 2003,
Clinical Cancer Res. 9 : 4239, incorporated herein by reference) can be used as
one of the guides to determine the types of cancers that may be sensitive to ent
with the compounds or conjugates produced by the methods of the invention.
Examples of in vitro potency and target specificity of antibody-cytotoxic agent
conjugates produced by the methods of the present invention is shown in . All of
the conjugates are extremely cytotoxic on the antigen positive cancer cells with an IC
in the low picomolar range. Antigen ve cell lines remained viable when exposed
to the same conjugates. The indolinobenzodiazepine dimers showed target specific
potency being 160 fold less potent when blocked with unconjugated dy huMy9-6
(anti-CD33) () and 40 less potent when blocked with unconjugated dy
FOLR1 (anti-folate receptor antibody) (result not shown). For example, the huMy9
SPDB-lf conjugate bearing the bisulfite adducts killed antigen positive HL60/QC cells
with an IC value of 10.5 pM, while the addition of an excess of unconjugated huMy9-6
antibody reduced this cytotoxic effect (IC = 1.69 nM), demonstrating antigen
specificity (A). In on, the 6-SPDB -lf conjugate is also highly
potent towards both the TCC cell line with an IC value of 2 1 pM and the NB-4
cell line with an IC value of 190 pM (FIGS. 17B and 17C).
The effect of conjugation on antibody binding was measured by comparing the
binding of both unconjugated huMy9-6 antibody and the huMy9SPDB -lf conjugate
s the HL60/QC cell line (). FACS analysis revealed that there is no
change in binding capability of the conjugate to naked antibody indicating that there is
no mise in binding due to conjugation of the cytotoxic agent to the dy.
In one example, in vivo efficacy of a cell binding agent/cytotoxic agent conjugate
was measured. Nude mice bearing human C tumors were treated with huMy9-
6-SPDB-lf conjugate and significant tumor regression was observed at multiple doses
while untreated mice grew tumors rapidly (). Activity was ed at doses as
low as 20 g/kg which is at least 35-fold lower than the maximum tolerated dose.
The effect of imine saturation towards tolerability is shown in Table 9 . Di-imine
huFOLRl-drugl was tested at multiple doses all of which were found to be highly toxic
leaving only survivors in the lowest group tested at 50 g kg. In contrast the partially
reduced mono-imine huFOLRl-drug2 and l-SPDB-IGN (huFOLRl-SPDB -lf)
conjugates were found to have significantly improved tolerability with the l-
SPDB-IGN (huFOLRl-SPDB -lf) conjugate showing 100% animal survival at the
highest doses tested of 560 g kg.
EXEMPLICATION
EXAMPLE 1
Humanized My9-6 antibody at 2 mg/ml was conjugated with 9 molar equivalents
of 2-NHS ester und 2) for 3 hrs at 25°C in 85% PBS, pH 7.4, containing 15%
DMA (v/v) and then purified over a G25 ing column in PBS, pH 7.4, to remove
unreacted or hydrolyzed, unconjugated drug. The conjugate was dialyzed in 10 mM
Histidine, 250 mM Glycine, pH 6.5 buffer, containing 1% sucrose. The conjugate
drug/antibody ratio (DAR) was determined as 1.4 DAR based on UV absorbance at 280
and 320 nm and calculation using the extinction coefficients of the drug and antibody at
280 nm and 320 nm.
The conjugate was analyzed for monomer % by size exclusion chromatography
(SEC) on a TSK-Gel G300SWXL column (7.8 mm x 300 mm, 5 mih particle size) using
an isocratic mobile phase of 400 mm sodium perchlorate, 150 mM potassium phosphate
buffer, pH 7.0, at 1 ml/min. The percentage of monomer (% monomer) and aggregate
were determined by monitoring the UV absorbance of all antibody species at 280 nm
and measuring the area-under-the-curve (AUC) of each antibody peak. Additionally, the
percentage (%) of 2 drug on both the monomer and the aggregate were determined by
monitoring the UV absorbance of all antibody species at 320 nm and 280 nm and
measuring the AUC of each antibody peak. The % monomer of the huMy9-6 -2
ate containing 1.4 DAR was 9 1 % . The % 2 on the monomer was 80%.
For free (unconjugated) drug assay, the conjugate was acetone extracted to
remove n, dried, and reconstituted in mobile phase and injected onto a VYDAC
208TP C8 reverse phase HPLC column (4.6 x 250 mm, 7 mih particle size) using a linear
gradient of 20% acetonitrile and 80% deionized going up to 100% acetonitrile, all
ning 0.025% acetic acid, at 1 ml/min over 48 min and ed to drug-methyl
ester standards. The percentage of free, unconjugated drug in the conjugate was
determined as < 1 % of conjugated drug.
The huMy9-6 -2 conjugate with 1.4 drug/antibody ratio (DAR) was ed by
mass spectrometry (MS) after deglycosylation (). The MS of the ate
showed unconjugated antibody (DO) as the largest peak, with a r D l peak
(antibody with 1 linked drug), and much smaller D2 and D3 peaks of 2 and 3 linked
drugs per antibody. The efficiency of conjugation was low with a conjugate DAR of 1.4
after conjugation with 9-fold molar excess of 2-NHS ester over antibody.
EXAMPLE 2
For the conjugation of 2-NHS ester (compound 2) using sodium bisulfite, the 2-
NHS ester (compound 2) was pre-incubated with 0.9 molar equivalents of sodium
bisulfite (freshly prepared NaHS0 3 in zed water) in 66% DMA
hylacetamide) in water for 30 min at 25°C. HuMy9-6 antibody at 2 mg/ml was
conjugated with 9 molar lents of 2-NHS ester (with added NaHS0 3) for 3 h at
°C in 85% PBS, pH 7.4, 15% DMA (v/v) and then purified over a G25 desalting
column in PBS, pH 7.4 to remove unreacted or hydrolyzed drug. The conjugate was
dialyzed in 10 mM histidine, 250 mM glycine, 1% sucrose, pH 6.5 buffer.
The DAR of the huMy9-6 -2 conjugate prepared using sodium bisulfite was
ed by UV spectrophotometry at 280 and 320 nm and calculated to be 3.1 DAR.
The % monomer of the conjugate was 95% and the % 2 on the monomer was 91%. The
MS of the conjugate prepared using sodium bisulfite following deglycosylation showed
the largest peak of D l with one linked drug, and also D2, D3, D4, D5, D6 peaks with 2-
6 linked drugs per antibody (FIG. IB).
The huMy9-6 -2 conjugate ed with sodium bisulfite showed a much greater
drug incorporation of 3.1 DAR than the conjugate with 1.4 DAR prepared without
sodium bisulfite. The MS of the 3.1 DAR conjugate prepared with sodium bisulfite
showed conjugate peaks of 1-6 linked drugs with the highest Dl peak with 1 linked
drug. In st, the MS of the 1.4 DAR conjugate prepared without sodium bisulfite
showed the t peak of unconjugated antibody (DO) and much smaller Dl, D2 and
D3 linked drug conjugate peaks. The drug% on the monomer for the huMy9-6 -2
ate prepared with sodium bisulfite was 91%, which was higher than the 80% drug
on the monomer for the huMy9-6 -2 conjugate prepared without sodium bisulfite. The
overall conjugate quality for the huMy9-6 -2 conjugate prepared with sodium bisulfite,
therefore, was much superior than by the ional conjugation procedure without
sodium bisulfite.
The conjugations of NHS esters of several drugs (1, 2, 3, and 4) with antibody
were med in the presence of sodium bisulfite (NaHS0 3) and were compared with
the traditional conjugation method t NaHS0 3. The results are shown in Table 16.
In all cases, the addition of sodium bisulfite in the conjugation showed conjugates with
significantly better quality of higher DAR and higher % drug on monomer than
conjugates prepared without the addition of sodium bisulfite.
TABLE 16. Comparisons of conjugations of antibody with l HS esters
without or with added sodium bisulfite (NaHSOs)
The huMy9-6 -2 conjugate prepared with sodium bisulfite showed a r in
vitro cytotoxicity to the conjugate prepared t sodium bisulfite (. Therefore
a better quality conjugate of higher DAR and higher % drug on monomer was prepared
using sodium bisulfite without any loss of xic potency. An anti-CD22 antibody-2
conjugate prepared with sodium bisulfite showed a similar in vitro cytotoxicity to the
conjugate prepared without sodium bisulfite (.
The huMy9-6 -2 conjugate prepared using sodium ite was analyzed by nonreducing
SDS-PAGE using a gel chip analyzer. The conjugate showed only the intact
antibody band; no heavy and light chain bands were observed, showing an unexpected
advantage that the added sodium bisulfite did not cause any unwanted reduction of
native interchain disulfide bonds in the antibody.
2-NHS ester or SPDB-NHS esters of 3, 4, 1, and 5 were pre-incubated with 0.5
to 3 molar equivalents of sodium ite (freshly prepared NaHS03 in deionized
water) in 66-98% DMA (dimethylacetamide) in water from 15 min to 4 h at 25 C . Some
of these reactions were also left overnight at 4 C and used for ations 20 h later.
The 2-NHS ester in DMA treated with sodium bisulfite or without added sodium
bisulfite was analyzed by HPLC using a VYDAC C8 reversed phase column with a
linear gradient of 20% acetonitrile and 80% deionized water going upto 100%
acetonitrile, all containing 0.025% acetic acid, at 1 ml/min over 48 min. As shown in
parent 2-NHS ester eluted at -23 min. After 30 min of treatment with 0.9 molar
equivalents of NaHS0 3 in 66% DMA in water at 25 C, a majority of the 2-NHS was
converted into the sulfonated, more polar form that eluted at -14 min. Unexpectedly, no
undesirable peak of sulfonated hydrolyzed 2 was observed. Therefore, a singly
favorable reaction of sodium bisulfite toward addition to the imine bond without
reaction with the NHS ester was observed.
rly drug NHS esters are treated with imine reactive reagents other than
sodium bisulfite before conjugation with antibody. An alternative conjugation approach
is to treat a mixture of drug-NHS ester and antibody with sodium bisulfite or other imine
ve reagent.
EXAMPLE 3
The disulfide-linked antibody-SPDB -1 conjugate was prepared using synthesized
1-SPDB-NHS ester (compound lc). The 1-SPDB-NHS ester was pre-treated with 3
molar equivalents of sodium bisulfite (using a freshly prepared NaHS0 3 solution in
water) in 96-98% DMA in water for 4-5 h at 25 C . The sodium ite-treated 1-
HS ester in DMA was analyzed using VYDAC C8 reversed phase-HPLC
column using a linear gradient of 20% acetonitrile and 80% deionized water containing
0.025% acetic acid at 1 ml/min for 48 min. The reversed phase HPLC analysis showed
only the desired reaction of bisulfite addition to the imine bond without the undesired
reaction of bisulfite with the NHS ester.
For conjugation, a humanized dy at 2 mg/ml was reacted with 5-7 molar
equivalents of 1-SPDB-NHS ester (pre-treated with NaHS0 3) for 6 h at 25°C in 85%
PBS, pH 7.4, aqueous buffer containing 15% N ,/V-dimethylacetamide (DMA) and then
purified over a G25 gel filtration column in PBS, pH 7.4, to remove unreacted or
hydrolyzed drug. The zed antibody-SPDB -1 ates were dialyzed in 10 mM
Histidine, 250 mM Glycine, 1% sucrose, pH 6.5 buffer. The drug/antibody ratio (DAR)
of the conjugates were measured to be 2.2-2.9 by UV absorbance measurements at 280
and 320 nm and using the extinction coefficients of the drug and antibody at 280 nm and
320 nm. The percentage of monomer in the conjugate ation was determined by
SEC (Size ion Chromatography) as 90%. Based on the UV absorbance of the
r peak in SEC it was also demonstrated that the monomer conjugate peak had
linked drug molecules. The unconjugated drug % by acetone extraction and reversedphase
HPLC was shown to be less than 1%.
The MS of the deglycosylated antibody-SPDB -1 conjugates prepared with
sodium bisulfite added before conjugation showed a much superior conjugate than that
obtained without sodium bisulfite conjugation (. The MS of the conjugate
prepared t sodium bisulfite had an average of 1.4 1/Ab and antibody species with
up to three linked 1 molecules (). In contrast, the MS of the conjugate prepared
with sodium bisulfite showed an average of 2.5 1/Ab and antibody species with up to
seven linked 1 molecules ().
The disulfide-linked antibody-SPDB -1 conjugate prepared using sodium
bisulfite showed only intact antibody band by non-reducing GE gel chip
analysis. The gel chip assay was performed using Agilent Protein 230 Protein Chip and
analyzed using an Agilent 2300 Bioanalyzer. No heavy and light chain bands were
observed, showing an cted advantage that the added sodium ite did not
cause any unwanted reduction of native antibody-interchain disulfide bonds (.
The linked drug obtained in the dy-SPDB -1 ate prepared using sodium
ite also demonstrated surprisingly that the disulfide linker in the conjugate was
stable to the added sodium bisulfite.
EXAMPLE 4
For conjugate ation, l f-SPDB-NHS ester (compound lc, was pre-
ted with 3 molar equivalents of sodium bisulfite (freshly prepared NaHS0 3 in
deionized water) in 96% DMA (dimethylacetamide) in water for 5 h at 25 C and then
incubated overnight at 4 C until needed for conjugation. Humanized antibody at 2-3
mg/ml was derivatized with 8 molar equivalents of l f-SPDB-NHS ester in the absence
or presence of sodium bisulfite (-/+ NaHS0 3) for 4 h at 25°C in 95% 50 mM HEPES,
pH 8.5, aqueous buffer ning 5% DMA (v/v) and then both were purified over G25
desalting columns into PBS, pH 7.4, to remove unreacted, hydrolyzed drug. The
conjugates were dialyzed in 10 mM histidine, 250 mM glycine, 1% sucrose, pH 6.5
buffer. The conjugate DAR was measured by UV spectrophotometry at 280 and 320
nm. The monomer % and % drug on the monomer in the conjugate were determined by
SEC. The unconjugated drug in the conjugate was determined by reverse phase HPLC
after acetone extraction. These conjugations were performed with several humanized
antibodies.
EXAMPLE 5
To conjugate drug thiols with reactive disulfide linker incorporated in antibody,
humanized mAb at 8 mg/ml is derivatized with 4-6 molar equivalents of SPDB
hetrobifunctional linker for 1.5 h at 25 °C in 90% PBS, pH 7.5, aqueous buffer with 5%
DMA (v/v) and then purified over a G25 desalting column into 35 mM citrate, 2 mM
EDTA, 150 mM NaCl, pH 5.5 buffer to remove unreacted, hydrolyzed linker. The LAR
r antibody ratio) is measured by UV absorbance at 280 and 343 nm without and
with added 50 mM threitol (to measure total antibody and releasable SPy). The
SPDB-modified antibody at 2 mg/ml is reacted with 2 molar equivalents of sodium
bisulfite-treated drug thiol per linker for 2 to 20 h at 25°C in 85-90% of 50 mM
potassium phosphate, 50 mM NaCl, pH 7.5 buffer and then purified over a G25
desalting column in PBS, pH 7.4, to remove unreacted, hydrolyzed drug. The DAR of
the antibody-SPDB-drug conjugate is ed by UV absorbance at 280 and 320 nm
and the percentage of monomer and the percentage of drug on the monomer in the
conjugate preparation is determined by SEC.
EXAMPLE 6 Preparation of huMy9sulfo-SPDB -l (2-step method)
My9sulfo-SPDB-1
A reaction containing 6 mg/mL huMy9-6 antibody and 9 molar equivalents
SPDB linker (20 mM stock in DMA) was incubated for 3 h at 25 °C in 50 mM
EPPS buffer pH 8. Unreacted linker was d using a NAP desalting column
(Illustra ex G-25 DNA Grade, GE Healthcare) and the linker to antibody ratio
(LAR) was determined to be 3.7 based on antibody concentration and DTT-released
ridine concentration by UV-Vis (£343 = 8,080 cm^M 1 for 2-thiopyridone).
SPDB modified huMy9-6 was diluted to 2 mg/ml in 50 mM EPPS pH 8.5,
% v/v DMA, and reacted with 2 molar equivalents of compound Id per linker (5 mM
stock in DMA; 7.4 equivalents per antibody) for 3 h at 25 °C.
Post-reaction, the conjugate was ed and buffer exchanged into 250 mM
Glycine, 10 mM Histidine, 1% sucrose, 0.01% Tween-20, 50mM sodium bisulfite at pH
6.2 using a desalting column (G-25 Sephadex, fine grade, GE Healthcare).
The purified conjugate was found to have an average of 2.9 compound 1
molecules linked per antibody (by UV-Vis using molar extinction coefficients m=
,484 cm_1M_1 and 2 o nm= 30, 115 cm_1M_1 for compound 1, and 280 nm= 207,000 cm
M_1 for My9-6 antibody), 97.8% monomer (by size exclusion chromatography), <1%
unconjugated compound 1 (by acetone extraction/reverse-phase HPLC), a 60% yield
based on the amount of the dy used, and an 18% overall yield based on the amount
of compound Id used. The conjugate made using this method could be concentrated (by
stirred cell or Amicon centrifugal filter device) to >3 mg/ml without conjugate
itation.
EXAMPLE 7 Preparation of huMy9SPDB -l
SPDB-1
Method 1 (One-step reagent method):
A reaction containing 2 mg/mL huMy9-6 antibody and 7 molar equivalents 1-
SPDB-NHS (pretreated with 5-fold excess of sodium bisulfite in 90:10 DMA:water, v/v
for 1 h at 25 °C and then overnight at 4 °C) in 50 mM HEPES (4-(2-hydroxyethyl)-lpiperazine
ethanesulfonic acid) pH 8.5 buffer and 10% v/v DMA (N,N-
Dimethylacetamide) ent was allowed to te for 3 h at 25 °C.
Post-reaction, the conjugate was ed and buffer exchanged into 250 mM
Glycine, 10 mM Histidine, 1% sucrose, 0.01% Tween, 50 mM sodium bisulfite
ation buffer, using NAP desalting columns (Illustra Sephadex G-25 DNA Grade,
GE Healthcare). Dialysis was performed in the same buffer for 4 hours at room
temperature utilizing Slide-a-Lyzer dialysis tes (ThermoScientific 20,000
MWCO).
The purified ate was found to have an average of 4.0 compound 1
molecules linked per dy (by UV-Vis using molar extinction coefficients m=
,484 cm_1M_1 and 280 nm= 30, 115 cm_1M_1 for compound 1, and 280 nm= 207,000 cm
for My9-6 antibody), 92% monomer (by size exclusion chromatography, TSK3000,
TOSOH Biosciences), <1% unconjugated compound 1 (by acetone extraction/reverse-
phase HPLC) a 72% yield based on the amount of the antibody used, a 40% overall yield
based on the amount of 1-SPDB-NHS used, and a final protein concentration of 1.0
mg/ml.
Method 2 (two-step method):
A reaction containing 4.8 mg/mL huMy9-6 antibody and 6 molar equivalents
SPDB linker (18.5 mM stock in ethanol) was incubated for 3 h at 25 °C in PBS pH 7.4.
Unreacted linker was removed using a NAP desalting column (Illustra Sephadex G-25
DNA Grade, GE Healthcare) and the linker to antibody ratio (LAR) was ined to
be 4.0 based on antibody concentration and DTT-released 2-thiopyridone concentration
by UV-Vis (e = 8,080 cm^M 1 for 2-thiopyridone).
343 nm
SPDB modified huMy9-6 was diluted to 2 mg/ml in 50 mM EPPS pH 8.5, 10%
v/v DMA and reacted with 1.75 molar equivalents of nd Id per linker (5 mM
stock in DMA; 7 equivalents per antibody) for 3 h at 25 °C.
eaction, the conjugate was purified and buffer exchanged into 250 mM
Glycine, 10 mM Histidine, 1% sucrose, 0.01% Tween-20, 50mM sodium bisulfite at pH
6.2 using a desalting column (Illustra Sephadex G-25 DNA Grade, GE Healthcare).
The purified conjugate was found to have an average of 3.8 compound 1
molecules linked per dy (by UV-Vis using molar extinction cients e nm=
,484 cm_1M_1 and 2 onm= 30,115 cm_1M_1 for compound 1, and 2 onm= 207,000 cm
for My9-6 antibody), 91.6% monomer (by size exclusion tography,
TSK3000, TOSOH Biosciences), <1% unconjugated compound 1 (by acetone
extraction/reverse-phase HPLC), a 40% yield based on the amount of the antibody used,
a 22% l yield based on the amount of compound Id used, and a final protein
concentration of 0.5 mg/ml.
EXAMPLE 8 Preparation of huMy9CX 11
huMy9CX11
Method 1 (in-situ one-step t method):
A DMA solution containing 1.9 n M compound Id, 1 mM CXl-1
heterobifunctional linker with oxysuccinimide (NHS) and maleimide groups, and
mM diisopropyl ethyl amine (DIPEA) was allowed to react at ambient temperature
for 8 min. Then 3 mM maleimido propionic acid (MPA) was added to quench excess
compound Id. The 1-CXl-l-NHS reaction mixture was stored frozen at -80°C, and
later upon thawing was added in two portions to a buffered solution of huMy9-6 at 25
°C (2 mg/ml, 100 mM EPPS, pH 8.0, 10% v/v DMA); 4.8 molar equivalents per
antibody (based on linker concentration) followed by 4.2 equivalents 30 min later. After
2 h reaction, the conjugate was purified and buffer ged into 250 mM Glycine, 10
mM Histidine, 1% sucrose, 0.01 Tween-20, 50 mM sodium bisulfite at pH 6.2 using a
desalting column (Quick-spin protein, G-25 fine resin, , dialysis, and y 0.22
mih sterile filtration.
The ed conjugate was found to have an average of 3.3 compound 1
les linked per antibody (by UV-Vis using molar extinction coefficients =
,484 cm_1M_1 and 2 o nm = 30,115 cm_1M_1 for compound 1, and 2 o nm = 207,000 cm
for My9-6 antibody), 95% monomer (by size ion chromatography, TSK3000,
TOSOH Biosciences), <1% unconjugated compound 1 (by acetone extraction/reversephase
HPLC), a 45% yield based on the amount of the antibody used, a 17% overall
yield based on the amound of compound Id used, and a final protein concentration of
0.7 mg/ml.
Method 2 (one-step method):
To a buffered solution of huMy9-6 antibody (2 mg/ml, 50 mM EPPS, pH 8.5,
8% v/v DMA) was added 14 molar equivalents compound Id (5 mM stock in DMA)
ed by 7 molar equivalents of CXl-1 linker (15 mM stock solution in ethanol) and
incubated for 3 h at 25 °C.
Post-reaction, the conjugate was purified and buffer exchanged into 250 mM
Glycine, 10 mM Histidine, 1% sucrose, 0.01% Tween-20, 50 mM sodium bisulfite at pH
6.2 using a desalting column (Illustra Sephadex G-25 DNA Grade, GE Healthcare),
followed by 2 x dialysis at 4 °C in Slide-a-Lyzer dialysis cassettes (ThermoScientific
,000 MWCO).
The purified conjugate was found to have an average of 3.4 compund 1
molecules linked per dy (by UV-Vis using molar extinction coefficients m =
,484 cm_1M_1 and 2 onm = 30,115 cm_1M_1 for compound 1, and 280 nm = 207,000 cm
for My9-6 dy), 90% monomer (by size exclusion chromatography, TSK3000,
TOSOH Biosciences), <1% ugated compound 1 (by acetone tion/reversephase
HPLC), a 44% yield based on the amount of the antibody used, an 11% overall
yield based on the amount of compound Id used, and a final protein concentration of
1.48 mg/ml.
EXAMPLE 9 MS analysis of deglycosylated SPDB -lf
My9SPDB -lf was made either by conjugating an NHS ester ning
compound If directly to antibody lysines (i.e., one-step t method as described
above), or by conjugating compound Id to a dithiopyridine modified antibody (i.e., two-
step method as described above). Mass spectrometry (MS) analysis of the
deglycosylated SPDB -lf were then carried out as above.
The one-step t method gave a conjugate with 0-9 compound If
modifications, an tric conjugated drug distribution, and a significant amount of
unconjugated anitbody. On the other hand, the conjugate made by the two-step method
had an MS profile with 0-6 compound If modifications, a symmetric conjugated drug
distribution, and very little unconjugated antibody. See . Both conjugates had a
similar average compound l f/antibody ratio of ~4 by UV-vis analysis.
EXAMPLE 10 pH Effect on Two-Step Sysnthesis of My9sulfo-SPDB -l
MS data for My9sulfo-SPDB -lf made using a two-step method under
different pH conditions was shown in . y, My9sulfoSPDB (3.7
linker/antibody) was reacted with 3 lents of compound Id per linker (or about
11.1 equivalents per antibody) for 18 h at pH 6, 7, 8, and 8.5. The MS data showed a
decrease in unreacted linker (260 amu satellite peaks) with increasing reaction pH. Thus
it appeared that pH affects the conjugation reaction in the synthesis of the My9sulfo-
SPDB-lf conjugate. Specifically, a pH of > 8 is ed for compound Id to fully
react with the sulfo-SPDB linker on the antibody.
EXAMPLE 11 Effect of Compound / Linker Ratio on Two-Step Sysnthesis of
chKTI-sulfo-SPDB -1
shows MS data for chKTI-sulfo-SPDB -1 made using a two-step method
with different compound Id / linker ratios. chKTI-sulfoSPDB (3.7 linker/antibody) was
reacted with 1.1, 1.3, 1.5 or 2 equivalents of compound Id per linker for 3 h, at 25 °C,
pH 8.5. The MS showed a decrease in unreacted linker (260 amu satellite peaks) with
increasing equivalents of compound Id per linker. It appeared that under this condition,
a compound Id / linker ratio of >1.3 is required to fully react with the SPDB linker
on the antibody. Increasing the equivalents of compound Id above 1.5 per linker led to
increased dy fragmentation (14-19%) while 1.1-1.3 compound Id / linker did not
cause significant dy fragmentation.
EXAMPLE 12 Preparation of Antibody-SPDB-drug Conjugate
Compound l c was pre-treated with 3 molar equivalents of sodium bisulfite
(using a freshly prepared NaHS0 3 solution in water) in 96-98% DMA in water for 4-5
hrs at 25 C. For conjugation, the humanized antibody at 2 mg/mL was reacted with 5-7
molar equivalents of compound l c (pre-treated with NaHS0 3) for 6 h at 25 C in 85-
90% PBS, pH 7.4, aqueous , or 50 mM HEPES, pH 8.5, aqueous buffer,
containing 10-15% N,N -dimethylacetamide (DMA) and then purified over a G25 gel
filtration column in PBS, pH 7.4, to remove unreacted or hydrolyzed drug compound.
The zed antibody-SPDB-drug conjugates were dialyzed in 10 mM Histidine, 250
mM Glycine, 1% e, pH 6.5 buffer. The Drug Antibody Ratio (DAR) of the
conjugates were measured to be 2.2-2.9 by UV absorbance measurements at 280 and
320 nm and using the extinction cients of the drug and antibody at 280 nm
(215,000 M^cm 1) and 320 nm (9137 M^cm 1) . The percentage of monomer in the
ates were determined as >90% by SEC (Size Exclusion Chromatography) using
TSK-Gel G300SWXL column (7.8 mm x 300 mm, 5 mih particle size). Based on the
UV absorbance of the monomer peak in SEC it was also demonstrated that the monomer
conjugate peaks had linked drug molecules. For free (unconjugated) drug assay, the
conjugate was acetone ted to remove n, dried, and reconstituted in mobile
phase and injected onto a VYDAC 208TP C8 reverse phase HPLC column (4.6 x 250
mm, 7 mih particle size) and compared to standards. The percentage of free drug
compound in the conjugate was determined as <0.5% of conjugated drug compound.
Preparation of humanized Ab-SPDB-2a conjugate:
Humanized Ab at 8 mg/mL was derivatized with 4-6 molar equivalents of SPDB
hetrobifunctional linker for 1.5 h at 25°C in 95% PBS, PH 7.4, containing 5% DMA
(v/v), and then purified over a G25 desalting column into citrate buffer (35 mM citrate
buffer, pH 5.5, containing 2 mM EDTA, 150 mM NaCl) to remove unreacted linker.
The LAR (Linker Antibody Ratio) were measured using UV absorbance at 280 and 343
nm without and with 50 mM dithiothreitol addition (to measure total antibody and
threitol-released SPy) and were determined to be 2.7-4. 1 LAR. The SPDB-
modified antibody at 2 mg/mL was reacted with 2 molar equivalents of compound 2a
(HC1 salt) per linked SPDB for 20 h at ambient temperature in 85% citrate buffer, 15 %
DMA (v/v) and then ed over a G25 desalting column into PBS, pH 7.4 to remove
unconjugated drug compound. The DAR of the final zed Ab-SPDB -2a
conjugate was measured by UV spectrophotometry at 280 and 350 nm and ated to
be -1.7-2.1 DAR. The percentage of monomer and linked drug nd on the
r in the conjugate was determined by HPLC using an SEC (size exclusion
chromatography) column. See .
EXAMPLE 13 Use of colvalent imine reactants to improve g conjugate
specifications (% monomer and drug load)
Adduct formation was carried out with 5 molar lents of imine reactant
over NHS-BMPS -1 in 90% DMSO/ 10% PBS pH 7.4 for 4 hr at 25 °C. The reaction
mixture was then added to huMy9-6 antibody (4 molar equivalents drug, 2 mg/ml, 10%
v/v DMSO, 50 mM HEPES buffer, pH 8.5, 5 h, 25 °C). Conjugates made using sodium
hydrosulfite, sodium bisulfite, or sodium sulfite had similar drug/Ab ratios and %
monomer, while conjugates made with no additive treatment led to very low drug
incorporation.
E 14 In vivo Tolerability Study of huFOLR-1 Conjugates
The in vivo tolerability of huFOLR-1 conjugates was investigated in female CD-
1 mice. Animals were observed for seven days prior to study initiation and found to be
free of disease or s. The mice were administered a single i.v. injection of the
bisulfite-bearing conjugate and the animals were monitored daily for body weight loss,
morbidity or mortality. Table 9 shows that for huFOLRl-drugl, the conjugate was
tolerated at only the lowest dose tested of 50 g kg. In contrast, both mono-imine
conjugates l-drug2 and huFOLRl-SPDB -lf were found to be better tolerated
with a maximum tolerated dose of <198 g g and >560 mg g respectively.
Table 9 . bility comparison data for (A) huFOLRl-drugl, (B) huFOLRl-drug2,
and (C) huFOLRl-SPDB -lf conjugates.
MTD > 560
EXAMPLE 15 Effect of Propylene Glycol in Formulation and Conjugation
This example demonstrates that the subject conjugation reactions carried out in
the presence of propylene glycol as co-solvent do not show itation of the
conjugates, and that as high as 40% (and possibly even higher) propylene glycol can be
used t a decrease in the % monomer of the resulting conjugate (in the presence of
2% dimethylacetamide - data not shown).
More importantly, the ce of propylene glycol during purification leads to
significant increases in yield (Table 10).
While not wishing to be bound by any particular theory, Applicants e that
one of the primary source of ms during the conjugation of the subject conjugates
is the inherent hydrophobicity of the molecular components of the conjugates. This may
at least partially explain the low purified yields, and sometimes aberrant mass
distribution profiles observed with the subject conjugations.
It is also worth noting that the addition of isopropanol during size exclusion
chromatography of the subject conjugates greatly decreases the apparent aggregate
tion. This observation suggests that small hydrophobic cosolvents may increase
the solubility of the drug and conjugate of the ion.
Thus the subject conjugation reactions, the purification steps after the reaction,
and/or the formulation of the formed ates are preferably carried out in the
presence of small hydrophobic cosolvents, such as propylene glycol (e.g., 5, 10, 15, 20,
, 30, 35, 40, 45%).
Antibody- sulfo-SPDB was prepared ing to previously described methods
by the addition of the N-hydroxysuccinimidyl (NHS) ester form of sulfo-SPDB to
antibody (huMy9-6) in water ning 3% DMA, and buffered at pH 8.5 for 3 hours.
The resulting intermediate (antibody-sulfo-SPDB) was purified over G25 Sephadex to
remove excess linker. Antibody and linker were quantitated by UV-vis spectroscopy by
measuring absorbance at 280 nm in the absence of reductant, and at 343 nm in the
presence of -50 mM DTT to measure 2-thiopyridine release from conjugated linker.
To conjugate drug, the antibody-sulfo-SPDB prepared above was reacted at
2 mg/mL antibody with a 2-fold molar excess of compound Id in the presence of the
indicated co-solvents, and with the pH ined at 8.5 with EPPS buffer (final
concentration 60 mM). Dimethylacetamide (SAFC) and propylene glycol (Alfa Aesar)
were used as ed with no further purification. All s were sterilized by
passage through 0.22 micron filter (Corning) and water was purified by e osmosis
/ deionization. The reactions were incubated at 25 °C for 3 hrs and then purified using
disposable G25 Sephadex s (Nap 25, GE Healthcare) into a formulation buffer
consisting of 10 mM histidine, 250 glycine, 1% sucrose, 0.01% polysorbate 20, 50 mM
sodium bisulfite and buffered to pH 6.2, as well as the indicated percentage of propylene
glycol (v/v).
Reaction yields and drug load were determined by absorbance oscopy. All
samples showed >96% monomer by analytical size exclusion chromatography.
Table 10 below shows the % Yield of conjugation as a function of propylene
glycol in the reaction mixture or formulation. Antibody- sulfo-SPDB-1 was ed by
reaction of compound Id with antibody-sulfo-SPDB for 4 hours at pH 8.5 (non-aqueous
components as indicated) followed by cation over G25 Sephadex.
Table 10
A thick white precipitate was observed atop the Sephadex co umn after purification
EXAMPLE 16 Preparation of huMy9sulfo-SPDB -ld using the highly ve
4-nitroPy-sulfo-SPDB linker
A reaction ning 6 mg/mL huMy9-6 antibody and 5 molar equivalents of
the highly reactive N-succinimidyl(4-nitropyridyldithio)butanoate linker (20 mM
stock in ethanol) was incubated for 3 h at 25 °C in 50 mM EPPS buffer at pH 8.
Unreacted linker was removed using a NAP desalting column tra Sephadex G-25
DNA Grade, GE Healthcare). The linker to antibody ratio (LAR) was determined to be
about 2.3 based on antibody concentration and DTT-released nitropyridinethione
concentration by UV-Vis (£394 = 14205 cm M for 2-thionitropyridone).
Linker modified huMy9-6 was diluted to 2 mg/mL in 50 mM HEPES buffer at
pH 8.5, 10% v/v DMA, and reacted with 2 molar equivalents of compound Id per linker
(5 mM stock in DMA; 4.6 equivalents per antibody) for 30 min at 25 °C. Completion of
disulfide exchange reaction was determined by monitoring absorbance increase at
394 nm by UV. Post-reaction, the conjugate was purified and buffer exchanged into 250
mM glycine, 10 mM histidine, 1% e, 0.01% Tween-20, 50 mM sodium bisulfite at
pH 6.2 using a desalting column (G-25 Sephadex, fine grade, GE care).
The purified conjugate was found to have an average of 2.1 les of Id
linked per antibody (by UV-Vis using molar extinction cients £330 = 15,484 cm
and e280 = 30, 115 cm^M 1 for Id, and e280 = 207,000 cm^M 1 for huMy9-6),
nm nm
98% monomer (by size exclusion chromatography), <1% unconjugated Id (by acetone
extraction/reverse-phase HPLC), a 70% protein yield, and a 32% overall Id yield. See
.
The reference in this specification to any prior publication (or ation derived from it),
or to any matter which is known, is not, and should not be taken as an acknowledgment or
admission or any form of suggestion that that prior publication (or information derived
from it) or known matter forms part of the common general knowledge in the field of
our to which this specification relates.
Throughout this specification and the claims which follow, unless the context requires
otherwise, the word "comprise", and variations such as "comprises" and "comprising", will
be understood to imply the inclusion of a stated integer or step or group of integers or steps
but not the exclusion of any other integer or step or group of integers or steps.
Claims (1)
1. A method for preparing a conjugate comprising a cell-binding agent (CBA) conjugated to a cytotoxic compound with a linking group, the method comprising reacting a modified cytotoxic compound with a modified CBA at a pH of about 4 to about 9, wherein: a) the ed CBA comprises a residue of a bifunctional crosslinking agent bonded to the CBA, and the residue comprises the g group and a thiolreactive group; and b) the ed cytotoxic compound comprises a thiol group, and is produced by reacting an imine-containing cytotoxic nd bearing the thiol group with an imine reactive reagent, and wherein the imine-containing xic compound is represented by one of the following formulae: or a pharmaceutically acceptable salt thereof, wherein: X’ is selected from -H, an amine-protecting group, an optionally substituted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, a polyethylene glycol unit -(CH2CH2O)n-Rc, an optionally substituted aryl having 6 to 18 carbon atoms, an optionally substituted 5- to 18-membered heteroaryl ring containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur, and an optionally substituted 3- to 18-membered cyclic ring containing 1 to 6 heteroatoms ndently selected from O, S, N and P; Y’ is selected from -H, an oxo group, an optionally tuted linear, branched or cyclic alkyl, alkenyl or alkynyl having from 1 to 10 carbon atoms, an H:\rbr\Interwoven\NRPortbl\DCC\RBR\8498493_1.docx-23/
Applications Claiming Priority (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161443092P | 2011-02-15 | 2011-02-15 | |
| US201161443062P | 2011-02-15 | 2011-02-15 | |
| US61/443,062 | 2011-02-15 | ||
| US61/443,092 | 2011-02-15 | ||
| US201161483499P | 2011-05-06 | 2011-05-06 | |
| US61/483,499 | 2011-05-06 | ||
| PCT/US2012/025257 WO2012112687A1 (en) | 2011-02-15 | 2012-02-15 | Methods of preparation of conjugates |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| NZ613162A NZ613162A (en) | 2015-10-30 |
| NZ613162B2 true NZ613162B2 (en) | 2016-02-02 |
Family
ID=
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2017268554B2 (en) | Methods of preparation of conjugates | |
| EP3188733B1 (en) | Conjugates comprising cell-binding agents and cytotoxic agents | |
| EP3313845B1 (en) | Conjugates of cysteine engineered antibodies | |
| AU2015311987A1 (en) | Cytotoxic benzodiazepine derivatives | |
| AU2017363237A1 (en) | Selective sulfonation of benzodiazepine derivatives | |
| HK40009850A (en) | Methods of preparation of conjugates | |
| NZ613162B2 (en) | Methods of preparation of conjugates | |
| HK1186685B (en) | Methods of preparation of conjugates | |
| HK1186685A (en) | Methods of preparation of conjugates | |
| HK40044772A (en) | Conjugates of cysteine engineered antibodies | |
| HK1254782B (en) | Conjugates of cysteine engineered antibodies |