NZ522135A - Somatostatin dye conjugates used as contrast agents for optical diagnostics - Google Patents

Abstract

A peptide-polymethine-dye conjugates of the general formula A1-(X)m-A2 is described wherein: X stands for an alpha-, beta- or gamma- amino acid with D- or L- configuration and m stands for a number from 5 to 30; Whereby the resulting amino acid sequence (X)m can be cyclized in a straight-chain nature or via a disulfide bridge between two cysteines or homocysteines or amidically between the N- and C-terminus and m stands for the amino acid sequence of the somatostatin; A1 stands for a hydrogen atom and acetyl radical or an alkyl radical with up to 10 C-atoms which optionally can be substituted with 1 to 3 carboxy groups and/or 1 to 6 hydroxy groups or a poly(oxyethylene) radical with 2 to 30 -CH2CH2O units or a dye molecule from the class of the polymethine dyes which has at least one absorption maximum in the range of 380 to 1200nm, A2 stands for a hydroxy group, an amino acid or a dye molecule from the class of the polymethine dyes which has at least one absorption maximum in the range of 380 to 1200nm, Under the condition that at least one of the radicals A1 or A2 represents a dye molecule from the class of polymethine dyes which has at least one absorption maximum in the range of 380 to 1200nm, whereby for the case that A1 and/or A2 represents a dye molecule from the class of polymethine dyes which has at least one absorption maximum in the range of 380 to 1200nm, A1 is linked to the N-terminal amino group and A2 is linked to an amino group of the amino acid lysine or to a hydroxy group of the amino acid serine in any position within the amino acid sequence (X)m. Preferably the dye molecules A1 and/or A2 stand for a cyanine, squarilium, croconium, mercyanine or oxonol dye. The compounds can be used diagnosis of tumors, other diseased tissue areas or adenomas using optical detection processes and fluorescence diagnosis of tumors, tumor cells and inflammatory tissues.

Description

522135 Patents Form No. 5 N.Z. No.

Divided out of Parent Application No. 514533 NEW ZEALAND Patents Act 1953 COMPLETE SPECIFICATION SHORT-CHAIN PEPTIDE DYE CONJUGATES USED AS CONTRAST AGENTS FOR OPTICAL DIAGNOSTICS We, INSTITUT FUR DIAGNOSTIKFORSCHUNG GMBH AN DER FREIEN UNIVERSITAT BERLIN, a German Company of Spandauer Damm 130, D-14050 Berlin, Germany, do hereby declare the invention, for which we pray that a patent may be granted to us, and the method by which it is to be performed, to be particularly described in and by the following statement:- i'NTELLECi UAL PROPERTY OFFICE OF N.Z. 2 2 OCT 2002 received (Followed by 1A) 1A WO 00/61194 PCT/EPO0/02697 Short-Chain Peptide-Dye Conjugates as Contrast Media for Optical Diagnosis The invention relates to compounds for tumor diagnosis that consist of conjugates of dyes with short-chain peptides, which are derived from vaso-active intestinal peptide, somatostatin or neurotensin, the use of these compounds as optical diagnostic agents, and diagnostic agents that contain these compounds.

On a cellular level, disease-induced alterations are often manifested as a receptor distribution or expression that is altered relative to the normal state. These differences can be both of quantitative type (e.g., the amount of transferrin receptors in proliferating cells) or else also of qualitative / type (e.g., expression of vascular endothelial growth factors, VEGF). Previous attempts to image a pathological receptor expression or distribution have been noted mainly in radiodiagnosis because of the necessary sensitivity of the detection process.

Heptahelical receptors are target molecules of many pharmacological active ingredients (e.g., ^-blockers, H2-acid blockers, antihistamines). In addition to therapeutic batches, mainly radiolabeled, agonistic ligands of these receptors are used diagnostically for the so-called receptor scintigraphy for in-vivo detection and location of tumors. In this case, the mechanism of the receptor-mediated endocytosis is used, e.g., by 2 the somatostatin receptor, which is more strongly expressed in neuroendocrine tumors. The somatostatin analog 111In-DTPA-pentetreotide (octreoscan<R>) is clinically approved for routine scintigraphic diagnosis; literature: J. Steroid Biochem. Mol. Biol. 37, 1079-82, 1990, J. Nucl. Med. 32, 1184-9, 1991,; J.

Nucl. Med. 33, 652-8, 1992; Digestion 3, 54-9, 1994, J. Clin. Invest. 93, 1321-5, 1994, Metabolism 45, 21-3, 1996.

Another batch consists in the use of radiolabeled VIP and VIP-analogs, which bind to the VIP-receptors. The VIP-receptor is more strongly expressed by a broad spectrum of tumors (i.a., adenocarcinomas).

WO 96/30055 describes radiodiagnostic and radiotherapeutic reagents, special VIP-receptor-binding peptides, which are radiolabeled and can be used for radiodiagnosis and radiotherapy.

VIP-receptor-binding peptides that can be labeled with Tc-99m for ✓ scintigraphy are described especially advantageously. Additional literature: Cancer Research 54, 690-700, 1994; Endocrinology 136, 2662-80, 1994, J. Nucl. Med. 40, 353-361, 1999.

All described diagnosis batches that are based on the somatostatin receptor and VIP-receptor are radiodiagnostic batches (scintigraphy with 123I, 125I, 111In or "Tc-labeled peptides).

Literature: EP 588754, US 5650134; US 5620675; US 5225180; WO 96/23527; J. Steroid Biochem. Mol. Biol. 37, 1083-87, 1990; Lancet 242-4, 1989, J. Nucl. Med. 39, 1913-17, 1998.

No fluorescence-labeled peptides that are conjugated with dyes that make possible an in-vivo-fluorescence detection of 3 tumors are known to date, however (Photochem. Photobiol. 68, 603-632, 1998) .

The object of the invention is to make available new compounds that make possible a sensitive diagnosis of tumors by-detection of fluorescence radiation with use of a receptor-specific binding of the compounds to the target tissue. In this case, special dye molecules that are coupled to biomolecules are to yield a highly sensitive, detectable fluorescence signal.

The object is achieved by the provision of compounds that contain fluorescence dyes, which are coupled covalently to short- chain peptides. These conjugates have a high binding affinity to heptahelical receptors, especially the somatostatin receptor, the VIP-receptor (vaso-active intestinal peptide), and the neurotensin receptor, and they are optionally taken up intracellularly by receptor-mediated endocytosis. The compounds / according to the invention are therefore suitable for the technically simple, harmless optical diagnosis of tumor cells and tumor tissues, which increasingly express somatostatin receptors, VIP-receptors or neurotensin receptors in comparison to healthy cells. Especially suitable are the compounds for fluorescence diagnosis and especially advantageously for the fluorescence-endoscopic diagnosis in hollow organs, such as the esophagus, the cervix, the colon, and the bronchial tubes of various tumor types, such as, e.g., adenocarcinomas, neuroendocrine tumors or ductal pancreatic tumors.

Especially preferred dyes are distinguished in that they satisfy certain photophysical and chemical requirements. From the photophysical standpoint, the dyes must have high absorption coefficients and high fluorescence quantum yields to provide an effective signal even in the case of the smallest tissue concentrations. The absorption maxima must overlap a wide spectral range in a freely selectable manner. Thus, for detection in lower tissue layers (several centimeters below the surface) , the spectral range of between 600 and 900 nm is essential, while for surface detection, absorption wavelengths of 400 to 600 nm are sufficient. From the chemical standpoint, the dyes must have a high photostability and must exhibit no signs of decomposition (photobleaching) during excitation. The dyes must be usable as synthesis components in the solid-phase-synthetic production of peptides and thus be stable under common synthesis conditions so that a simple, advantageous production of structurally defined dye-peptide-conjugates with solid / stoichiometric ratios is ensured between dye and peptide. The requirements are best satisfied by polymethine dyes, especially cyanine, merocyanine, oxonol and squarilium dyes.

Subjects of the invention are therefore peptide-polymethine dye-conjugates of general formula (I) A1 - (X). - A2 I in which X stands for an a-, E- or y-amino acid with D- or L- configuration, and m stands for a number from 5 to 30, whereby the resulting amino acid sequence (X)m can be cyclized in a straight-chain nature or via a disulfide I bridge between two cysteines or homocysteines or amidically between the N- and C-terminus and (X)m stands for the amino acid sequence of the somatostatin or for fragments, partial sequences, derivatives or analogs of the somatostatin A1 stands for a hydrogen atom, an acetyl radical or an alkyl radical with up to 10 C atoms, which optionally can be substituted with 1 to 3 carboxy groups and/or 1 to 6 hydroxy groups, or a poly(oxyethylene) radical with 2 to 30 -CH2CH20 units, or a dye molecule from the class of the polymethine dyes, which has at least one absorption maximum in the range of 380 to 1200 iim, A2 stands for a hydroxy group, an amino group or a dye molecule from the class of polymethine dyes, which has / at least one absorption maximum in the range of 380 to 1200 nm, under the condition that at least one of radicals A1 or A2 represents a dye molecule from the class of polymethine dyes, which has at least one absorption \ . maximum in the range of 380 to 1200 nm, whereby for the case that A1 and/or A2 represents a dye molecule from the class of polymethine dyes, which has at least one absorption maximum in the range of 380 to 1200 nm, A1 is linked to the N-terminal amino group, and A2 is linked to an amino group of the amino acid IPONZ Id MAR2004 6 lysine or to a hydroxy group of the amino acid serine in any position within the amino acid sequence (X)(a, and their physiologically compatible salts.

Fragments, partial sequences, derivatives or analogs of the above-mentioned peptides stand, i.a., for shortened amino acid sequences, exchanges of individual or all amino acids for the corresponding D-amino acids, exchanges of individual amino acids for other amino acids, inverted sequences and combinations of the above-mentioned features.

The fragments, partial sequences, derivatives or analogs of the above-mentioned peptides can also contain amino acids that are not natural, such as, e.g., naphthalanine, cyclohexylalanine, norleucine, norvaline, or-aminoadipic acid, a-aminobutyric acid, fi-alanine, fi-cyclohexylalanine, ornithine, sarcosine or 5-hydroxylysine.

/ Especially preferred embodiments of the invention are compounds of general formula I, which are distinguished in that dye molecule and/or A2 stands for a cyanine, squarilium, croconium, merocyanine or oxonol dye. These dyes belong to the class of polymethine dyes and have the advantages that are described above.

Other preferred compounds of general formula I according to" the invention are distinguished in that dye molecule A1 and/or A2 stands for a cyanine dye or squarilium dye of general formula II 7 in which d stands for a fragment corresponding to general formulas III to VI, whereby the position that is identified with a star means the linkage with B r3. r2 III IV V r2 VI B stands for a fragment that corresponds to general formulas VII to XII r4 A vii viii ix R4 TT (CHA R4 (ChU xi R1 and R2 stand for E1, R3 stands for a fluorine, chlorine, bromine, iodine atom or a nitro group or for a radical -cooe1, -cone1e2, -nhcoe1, -nhconhe1, -ne'e2, -0e1, -oso3e1, -so3e1, -so2nhe1, -e1, 8 whereby E1 and E2, independently of one another, stand for a hydrogen atom, a sulfoalkyl chain, a saturated or unsaturated, branched or straight-chain C^-Cg,, alkyl chain, whereby the chain or parts of this chain optionally can form one or more aromatic or saturated cyclic C5-C6 units or bicyclic C10 units, and whereby the C^-Cjg alkyl chain is interrupted by 0 to 15 oxygen atoms and/or by 0 to 3 carbonyl groups and/or is substituted with 0 to 5 hydroxy groups, R4 stands for a hydrogen atom, for a fluorine, chlorine, bromine, iodine atom or a branched or straight-chain Ct-C10 alkyl chain, • " b means a number 2 or 3, X and Y, independently of one another, mean 0, S, Se, -CH=CH- or C(CH3)2( t L stands for a group that corresponds to the formulas below oo o A ,A in which n means a number from 1 to 10.

(In the above-mentioned formulas, the solid line that is drawn to the left in the molecule portion represents the linkage 9 to the dye skeleton, and the dashed line to the right in the molecule portion represents the linkage to the peptide.) From the class of polymethine dyes, the cyanine dyes, e.g., the indocarbo-, indodicarbo- and indotricarbocyanines that are based on the indole structure, are especially advantageous.

These structures are distinguished by a high chemical and photochemical stability. By advantageous synthesis, derivatives can be obtained that absorb and fluoresce between 400 and 1000 nm in any way desired, can be coupled to peptides by substitution with suitable linkers and functional groups, preferably carboxyl groups, and have a high water solubility, preferably by sulfonate groups. In contrast to cyanine dyes that are known in the literature, the compounds that are used according to the invention have only one reactive group, which makes possible a stoichiometrically defined coupling to the peptide as part of the y resin synthesis of the conjugate.

Especially preferred embodiments of the compounds of general formula I according to the invention are therefore distinguished in that dye molecule A1 and/or A2 stands for an indocarbocyanine dye, an indodicarbocyanine dye or an indotricarbocyanine dye, dye molecule A1 and/or A2 stands for an indocarbocyanine dye, an indodicarbocyanine dye or an indotricarbocyanine dye of general formula XIII or XIV in which / p stands for 1, 2 or 3, n stands for a number l, 2, 3, 4 or 10, R1 and R2, independently of one another, stand for a 4-sulfobutyl, 3-sulfopropyl, 2-sulfoethyl, 3-methyl-3-sulfopropyl, methyl, ethyl or propyl radical, and R3 stands for hydrogen, a chlorine, bromine, iodine' atom or a nitro group or for a radical -COOE1, -C0NE1E2, -NHCOE1, -NHCONHE1, -NE1E2, -OE1, -OSOjE1, -SOjE1, - SOjNHE1, whereby E1 and E2, independently of one another, stand for a hydrogen atom or for a methyl or ethyl 11 radical or a C3-C6 alkyl radical, which is interrupted by 0 to 2 oxygen atoms and/or by 0 to 1 carbonyl groups, and/or is substituted with 0 to. 5 hydroxy groups, or E1 and E2 stand for a poly(oxyethylene)glycol radical with 2 to 3 0 -CH2CH20 units, dye molecule A1 and/or A2 stands for an indocarbocyanine dye, an indodicarbocyanine dye or an indotricarbocyanine dye of general formula XIII or XIV O jf +>-4ch=ch)-ch=( N P N r XIII o o Y4ch=ch)-c Zff p n—(ch2 h XIV in which p stands for 1, 2 or 3, n stands for 1, 2 or 4, 12 R1 and R2, independently of one another, stand for a 4- sulfobutyl or 3-sulfopropyl radical, R3 stands for hydrogen or for a radical -COOE1 or -CONHE1, ethyl radical or a C3-C6 alkyl radical, which is interrupted by 0 to 2 oxygen atoms and/or by 0 to 1 carbonyl groups and/or is substituted with 0 to 5 hydroxy groups, dye molecule A1 and/or A2 stands for an indotricarbocyanine dye of general formula XV or XVI: whereby E1 means a hydrogen atom or a methyl or XV 13 (ch2)n 0 0 N fe ;V' ~^NH k x V • c rd n- '2 r2 V r5 XVI in which n stands for 2 or 3, R1 and R2, independently of one another, represent a 4- sulfobutyl, 3-sulfopropyl or 2-sulfoethyl radical, / R3 stands for a radical -CONH-peptide, -CONH-(CH2) m-CONH peptide, -CONH-(CH2)n-NH-CS-NH-peptide or -CONH-(CH2)n-NHCO-CH2-peptide with m = 1 to 10 and n = 2 or 3, or R3 represents a group below: .N peptide s R4 and R5, independently of one another, stand for a hydrogen atom, a methyl radical or a hydroxylated alkyl radical, such as, e.g., 2-hydroxyethyl, 3- 14 hydroxypropyl, 2,3-dihydroxypropyl, l,3-dihydroxy-2-propyl, 2,3,4-trihydroxybutyl, l,3,4-trihydroxy-2-butyl, 2,3,4,5,6-pentahydroxyhexyl, R6 stands for one of the following groups: - {CH2)m-CONH-peptide with m = 0 to 2, - (CH^-NH-CS-NH-peptide with m = 0 to 2, and X stands for an oxygen atom or a sulfur atom; dye molecule A1 and/or A2 stands for an indotricarbocyanine dye of general formula XVII: XVII in which R1 and R2, independently of one another, stand for a 4-sulfobutyl radical or 3-sulfopropyl radical, R3 stands for a radical -CONH-peptide, -CONH- (CH2)m-CONH-peptide, -CONH-(CH2) n-NH-CS-NH-peptide or -CONH- (CH2) n-NHCO-CH2-peptide with m = 1 to 10 and n = 2 or 3, or R3 represents a group below: 0 n h peptide s and R4 and R5, independently of one another, stand for a hydrogen atom, a methyl radical or a hydroxylated alkyl radical, such as, e.g., 2-hydroxyethyl, 3-hydroxypropyl, 2,3-dihydroxypropyl, 1,3-dihydroxy-2-propyl, 2,3,4-trihydroxybutyl, 1,3,4-trihydroxy-2-butyl, 2,3,4,5,6-pentahydroxyhexyl.

The use of dye-labeled antibodies for tumor detection is known in the literature (J. Cell. Pharmacol. 3, 141-145, 1992; Cancer Immunol. Immunother. 41, 257-63, 1995; Cancer Research 54, 2643-9, 1994, Biotechnol. Prog. 13, 649-658, 1997).

In contrast, the compounds according to the invention contain as biomolecules low-molecular peptides and peptide derivatives that exhibit the advantages of antibodies, such as a high binding to target structures, without the diagnostic potential being limited by an unfavorable pharmacokinetics (long blood half-lives, allergenic side-effects (immunogenicity)).

Biological and pharmacological requirements on peptide sequences are consequently an adequate plasma stability in the case of quick build-up in the target tissue and simultaneous 16 quick elimination from the remainder of the body, preferably via the renal excretion route.

It has been found, surprisingly enough, that peptide sequences that contain at least 5 amino acids of the C-terminal side of the VIP-sequence and to which a dye is coupled for fluorescence diagnosis have an imaging in tumor cells that is comparable to the native VIP. Moreover, it has been found that by the incorporation of at least one D-amino acid, or the exchange by.at least one D-amino acid, the plasma stability could be considerably increased. In the example of a complete exchange of all L-amino acids for D-amino acids in a VIP-binding dye-peptide conjugate, it was possible to show that the binding properties and the cell imaging are unchanged.

Other especially preferred compounds of general formula I according to the invention are distinguished in that (X)m stands for the amino acid sequence of the somatostatin that corresponds to AG^KNFFWKTFTSC or for fragments, partial sequences, derivatives or analogs of the somatostatin that consists of 5 to 20 amino acids, 17 2 to m amino acids, independently of one another, can be exchanged for their respective D-amino acid or for other L- or D-amino acids, whereby m has the above- indicated meaning, at least one of amino acids (X)B, independently of one another, can be exchanged for other amino acids or amino acid derivatives that are not natural, at least one of amino acids (X)m, independently of one another, can be exchanged for other amino acids or amino acid derivatives that are not natural, such as, e.g., naphthalanine, cyclohexylalanine, norleucine, norvaline, a-aminoadipic acid, a-aminobutyric acid, B-alanine, S-cyclohexylalanine, ornithine, sarcosine or 5-hydroxylysine, all amino acids (X)m are exchanged for their respective D-amino acid, retrosynthetic amino acid sequences are selected as fragments, partial sequences, derivatives or analogs of the vaso-active intestinal peptide, the following amino acid sequences are selected as fragments, partial sequences, derivatives or analogs of the somatostatin: 18 AG^KNFFwKTFTS^ AGt^KNFFwKTFTSC AG9KNFFWKTFTS9 AG<^KNFFwKTFTSy yKNFFwKTFTS^ (pKNFFwKTFTSf f FYwICVFT ftpFwKV^T fcFwKVCT fCYwKVCT fcYwKVCT 1 1 1 1 fCFwKTCT fcFwKTCT ' 1 1 1 fCYwKTCT fcYwKTCT 1 1 t l D-NaI-CYwKVC D-Nal-cYwKVC I 1 1 I fCywK-Abu-C-Nal fcywK-Abu-C-Nal 1 1 II 1 The terminology of general formula I contains the usual language of amino acid sequences. The N-terminus is always on the left and the C-terminus on the right (unsubstituted according to H- (X) ^"OH or, in the case of an amide, H- (X) ra~NH2) . The one- character abbreviations of the amino acids that are used can be looked up in M. Bodanszky, Peptide Chemistry -- A Practical Textbook, 2nd Edition,' Springer-Verlag Heidelberg 1993, p. 3.

Capital letters mean amino acids with L-configuration (natural amino acids), small letters mean D-amino acids, disulfide bridges (cyclic peptides) are identified by connecting lines between the corresponding letters (C = cysteine or homocysteine).

Retrosynthetically, sequences are designated in which in the synthesis, the sequence of the amino acids is inverted in comparison to a given native sequence, i.e., the synthesis begins with the original N-terminal amino acid and produces the sequence / up to the original C-terminal amino acid.

The substances according to the invention have various advantages compared to radiolabeled substances. Fluorescence dyes can often be excited at will for fluorescence emission. No 19 continuous signal is present, which uses as a basis a decomposition with corresponding half-life. Consequently, the time of diagnosis can be selected at will and can be repeated as often as desired and is not limited by the half-life of an isotope. The patient is not exposed to any ionizing radiation, and the light radiation that is used is harmless in the doses used. The optical detection technique allows the highly sensitive detection of a few photons and is therefore comparable to radiodiagnosis relative to the sensitivity.

A process for diagnosis using near-infrared radiation (NIR radiation) with use of dye biomolecule conjugates was described (WO 96/17628). It has proven especially advantageous in the case of this invention that the peptide conjugates in advantageous yield and high purity can be produced by the process of the automated solid-phase synthesis. It has been found, surprisingly enough, that various carboxyl group-carrying indocyanin^ compounds can be used as amino acid analogs, and both N-terminal groups and an amino group of the lysine can be coupled to the solid phase (resin). After resin is cleaved off and after chromatographic purification, the dye-peptide conjugates were obtained in purities > 95%. A new coupling process allows the coupling of haloacetyl dyes to the amino acid cysteine or homocysteine, which can replace any amino acid of the native VIP sequence.

The basic problem when using light for fluorescence excitation is the limited penetration depth of the light, which is in the submillimeter range in the VIS, but can be in centimeters in the NIR. With respect to the penetration depth, detection processes are without problems in surface tissue diseases, as well as soft tissues. Subjects of the invention are therefore mammographic processes, endoscopic processes and intraoperative processes, in which diseased tissue areas are diagnosed with use of the compounds according to the invention by detection of fluorescence or the non-absorbed radiation. A more special subject of the invention is the use of the compounds according to the invention in endoscopic processes, e.g., coloscopy, bronchoscopy, esophageal endoscopy, in which changes in tissue that are near the surface are diagnosed. The use of white light with direct visual evaluation is common in endoscopic diagnosis. The compounds according to the invention contribute to a decisive improvement of the process by the production of a tissue-specific signal, especially in the case of the diagnosis / of premature, visually undetectable tissue changes (e.g./, dysplasias of the colon).

It has been found that after the dye-coupled compounds according to the invention are atomized in the intestines of rats with chemically induced dysplasias and colon carcinomas, subsequent flushing and the implementation of an endoscopic fluorescence diagnosis (excitation 740 nm, detection above 760 nm) make it possible to detect tissue areas of increased fluorescence in the colon.

The subject of the invention is therefore also a process for endoscopic fluorescence diagnosis, especially of the gastrointestinal tract, with use of the compounds according to 21 the invention. In this case, one or more of the substances are fed to the tissue preferably intravenously, or topically by atomization, and the light from the corresponding spectral range is irradiated for electronic" excitation of the dye that is used.

The reflected fluorescence radiation or the fluorescence radiation that is emitted by the dye is recorded. Preferred are the methods in which the tissue is irradiated over a large surface, and the fluorescence radiation is indicated with local resolution by imaging with a CCD camera, or the tissue areas that are to be imaged are rastered with a fiber optic light guide, and the signals that are obtained are reacted by computer into a synthetic image. In this case, the fluorescence can be detected and evaluated spectrally and/or phase-selectively as well as in a stationary and/or time-resolved manner. The fluorescence images that are obtained can be produced at the same time as the white / light images and are produced over one another in a figure for data evaluation.

The synthesis of the compounds according to the invention is carried out in a way that is similar to the methods that are known in the literature. The peptides are produced in a solid-phase-synthetic manner in polymer resins. Details are known to one skilled in the art. Literature: Peptide Chemistry -- A Practical Textbook (M. Bodanszky), 2nd Edition, Springer-Verlag Heidelberg 1993; Anti-Cancer Drug Design 12, 145-167, 1997; J. Am. Chem. Soc. 117, 11821-2, 1995.

The dyes are produced separately and then, as part of the solid-phase-synthetic production of the peptides, the dyes are 22 coupled to the peptides, and the compounds according to the invention are obtained as highly pure compounds after cleavage from resin and purification. Preferred are those dyes that contain carboxyl groups, which after activation with common reagents are coupled to amino groups of the peptide, especially the i-amino group of the lysine or the N-terminal peptide-amino group. In addition, dyes with haloalkyl or haloacetyl radicals are preferred that are coupled to thiol groups of the peptide, especially the amino acid cysteine or homocysteine.

Literature on the synthesis of polymethine dyes: Bioconjugate Chem. 4, 105-111, 1993: Bioconjugate Chem. 7, 356- 62, 1996; Bioconjugate Chem. 8, 751-56, 1997; Cytometry 10, 11- 19, 198 9 and 11, 418-30, 1990; J. Heterocycl. Chem. 33, 1871-6, 1996; J. Org. Chem. 60, 2391-5, 1995; Dyes and Pigments 17, 19- 27, 1991, Dyes and Pigments 21, 227-34, 1993; J. Fluoresc. 3, / 153-155, 1993; Anal. Biochem. 217, 197-204, 1994; US 49&1977; US 5688966; US 5808044; WO 97/42976; WO 97/42978; WO 98/22146; WO 98/26077; EP 0800831.

Especially suitable for a coupling to peptides in the solid phase are dyes that contain precisely one carboxyl group, especially advantageously cyanine dyes of general formula XVIII in which 23 p stands for 1, 2 or 3, n stands for 1, 2, 3, 4 or 10, R1 and R2, independently of one another, stand for a 4- sulfobutyl, 3-sulfopropyl, 2-sulfoethyl, 3-methyl-3-sulfopropyl, methyl, ethyl or propyl radical, and R3 stands for hydrogen or for a radical -COOE1, -CONE1E2, -NHCOE1, -NHCONHE1, -NE1E2, -OE1, -OSO3E1, -SO3E1, -so2nhe\ whereby E1 and E2, independently of one another, stand for a hydrogen atom or for a methyl, ethyl or a C3-C6 alkyl radical, which is interrupted by 0 to 2 oxygen atoms and/or by 0 to 1 carbonyl groups and/or is substituted by 0 to 5 hydroxy groups, or cyanine dyes of general formula XIX or XX / ✓ XIX 24 XX in which n stands for 2 or 3, R1 and R2, independently of one another, represent a 4- sulfobutyl, 3-sulfopropyl or 2-sulfoethyl radical, R3 stands for a -COOH group or one of the following / radicals: -CONH- (CH2)n-COOH with n = 2 or 3 , -CONH-(CH2)n-NCS with n = 2 or 3, -CONH- (CH2)n-NHCO-CH2"X1 with n = 2 or 3 and X1 = CI, Br, R4 and R5, independently of one another, stand for a hydrogen atom, a methyl radical or a hydroxylated alkyl radical, such as, e.g., 2-hydroxyethyl, 3- hydroxypropyl, 2,3-dihydroxypropyl, 1,3-dihydroxy-2-propyl, 2,3,4-1rihydroxybutyl, 1,3,4-trihydroxy-2-butyl, 2,3,4,5,6-pentahydroxyhexyl, R6 stands for one of the following groups: - (CH2)m-COOH With ra = 0 to 2, -(CH2)m-NCS with m = 0 to 2, and X stands for an oxygen atom or a sulfur atom; or cyanine dyes of general formula XXI / / XXI in which R1 and R2, independently of one another, stand for a 4- sulfobutyl-, 3-sulfopropyl or 2-sulfoethyl radical, R3 stands for a -COOH group or one of the following radicals: -CONH-(CH2)n-COOH with n = 2 or 3, -CONH-(CH2)n-NCS with n = 2 or 3, -CONH-(CH2)n-NHCO-CH2-X1 with n = 2 or 3 and X1 = Cl, Br, I 26 O A n' h /}— ncs and R4 and R5, independently of one another, stand for a hydrogen atom, a methyl radical or a hydroxylated alkyl radical, such as, e.g., 2-hydroxyethyl, 3-hydroxypropyl, 2,3-dihydroxypropyl, 1,3-dihydroxy-2-propyl, 2,3,4-trihydroxybutyl, 1,3,4-trihydroxy-2-butyl, 2,3,4,5, 6-pentahydroxyhexyl.

The advantage of only one activatable group, such as, e.g., a carboxyl group, or an already activated group, such as, e.g., an isothiocyanate, a haloalkyl group or a haloacetyl group, consists in the fact that a chemically uniform coupling can be carried out. The haloacetyl group has the special advantage that a chemically uniform coupling to the mercapto group of the / cysteine or homocysteine is carried out. This coupling'can be carried out in solution to the unbonded peptide from which protective groups are removed. By the activated groups, a coupling to peptides is possible without secondary reactions occurring. To increase the water solubility, the peptide-dye conjugates in-the dye exhibit an increased number of hydroxy groups. By the position of the linker in the indole system of the dye, in addition an adequate hydrophilia by radicals that contain sulfonate groups can be produced in the nitrogen atoms of the indole system. As a result, a structurally uniform coupling reaction can be performed with the peptides (see Examples 4 to 38 and 44 to 49) . 21 Another subject of the invention is an optical diagnostic agent for in-vivo diagnosis of diseased tissue areas, which is distinguished in that it contains at least one compound of general formula I together with common adjuvants and/or vehicles as well as diluents. 28 The following examples explain the invention: Examples 1 to 3: Synthesis of indocyanine dyes 1-3 for solid-phase- synthetic coupling to amino groups (N-terminal or £-lysine) of the peptides The synthesis is generally carried out starting from l-(4 -sulfobutyl)-2,3,3-trimethyl-3H-indolenine and 1-(4-sulfobutyl)-2,3,3-trimethyl-5-carboxy-3H-indolenine (Cytometry 10, 11-19, 1989, Talanta 39, 505-510, 1992).

Example 1: Synthesis of 1,l'-bis(4-sulfobutyl)indocarbocyanine-5-carboxylic acid, sodium salt (1) 0.8 g (4.0 mmol) of N,N-diphenylformamidine is introduced into 15 ml of acetic acid anhydride and mixed at room temperature in portions with 1.4 g (4.2 mmol) of 1-(4-sulfobutyl)-2,3,3- trimethyl-5-carboxy-3H-indolenine, stirred for 30 minutes at / 120°C and then cooled to room temperature with a water t)ath.

Then, 1.2 g (4.1 mmol) of 1-(4-sulfobutyl)-2,3,3-trimethyl-3H-indolenine, 1.2 g (14.6 mmol) of anhydrous sodium acetate, 15 ml of acetic acid anhydride and 6 ml of acetic acid are added. The reaction mixture is heated for 1 hour to 12 0°C, and the dark red solution is cooled and mixed with 100 ml of ether. The precipitated solid is filtered off. A chromatographic purification on RP-silica gel EUROPREP 60-30 C18, 60A, 20-45 m is carried out (eluant: water/MeOH, step gradient of 0% to 70% MeOH). Methanol is removed from the product-containing fractions in a rotary evaporator, and the fractions are then freeze-dried, yield: 1.5 g (58%), red lyophilizate. 29 Example 2: Synthesis of 1,1' -bis(4-sulfobutyl)indodicarbocyanine-5-carboxylic acid, sodium salt (2) 1.2 g (4.1 mmol) of 1-(4-sulfobutyl)-2,3, 3-trimethyl-3H-indolenine and 1.0 g (3.9 mmol) of malonaldehyde-bis-phenylimine hydrochloride are stirred in 15 ml of acetic acid anhydride for 30 minutes at 120°C and then cooled to room temperature with a water bath. Then, 1.4 g (4.2 mmol) of 1-(4-sulfobutyl)-2, 3, 3-trimethyl-5-carboxy-3H-indolenine, 1.2 g (14.6 mmol) of anhydrous sodium acetate, 15 ml of acetic acid anhydride and 6 ml of acetic acid are added in succession. The reaction mixture is heated for 1 hour to 12 0°C, the solution that is now blue is cooled and mixed with 100 ml of ether. The working-up and purification are carried out as described in Example 1. Yield: 1.8 g (66%), blue lyophilizate.

/ / Example 3: Synthesis of l,1'-bis(4-sulfobutyl)indotricarbocyanine-5-carboxylic acid, sodium salt (3) 1.2 g (4.1 mmol) of 1-(4-sulfobutyl)-2,3,3-trimethyl-3H-indolenine arid. 1.1 g (3.9 mmol) of glutaconaldehyde-dianil hydrochloride are stirred in 15 ml of acetic acid anhydride for 30 minutes at 12 0°C and then cooled to room temperature with a water bath. Then, 1.4 g (4.2 mmol) of 1-(4-sulfobutyl)-2,3,3-trimethyl-5-carboxy-3H-indolenine, 1.2 g (14.6 mmol) of anhydrous sodium acetate, 15 ml of acetic acid anhydride and 6 ml of acetic acid are added. The reaction mixture is heated for 1 hour to 12 0°C, the now blue solution is cooled and mixed with 100 ml of ether. The working-up and purification are carried out as described in Example 1, yield: 1.8 g (60%), blue lyophilizate.

The structures of the compounds of Examples 1-3 are depicted in Fig. 1.

Examples 4 to 6: Synthesis of indocyanine dyes 4-6 from 1-3 for solid-phase-synthetic coupling to amino groups (N-terminal or lily sine) of the peptides The synthesis is carried out by amidation of dyes 1-3 with E-alanine-t-butylester and acidic cleavage of the t-butylester group.

A solution of 0.5 mmol of dyes 1-3 and 0.1 g (1.0 mmol) of triethylamine in 2 0 ml of dimethylformamide is mixed at 0°C with 0.5 mmol of TBTU in 10 ml of dimethylformamide, and it is stirred / for 15 minutes at 0°C. Then, a solution of 0.11 g (0.6 mmol) of fi-alanine-t-butylester-hydrochloride and 0.6 mmol of triethylamine in 5 ml of dimethylformamide is added in drops, and the reaction mixture is stirred for 2 hours at room temperature. After 100 ml of diethyl ether is added, the precipitated solid is filtered off,.dissolved in 2 0 ml of dichloromethane, mixed with 10 ml of trifluoroacetic acid and stirred for 24 hours at room temperature. The mixture is concentrated by evaporation in a vacuum, and the residue is purified by chromatography and freeze-dried as described in Example 1; yields: 0.21 g (58%) of 4, 0.29 g (76%) of 5, 0.28 g (72%) of 6. 31 Examples 7 to 9: Synthesis of indocyanine dyes 7-9 from 1-3 for solid-phase-synthetic coupling to amino groups (N-terminal or £-lysine) of the peptides The production is carried out analogously to Examples 4-6 with use of 0.1 g (0.6 mmol) of glycine-t-butylester-hydrochloride, yields: 0.25 g (68%) of 4, 0.30 g (80%) of 5, 0.32 g (83%) of 6.

Examples 10 to 12: Synthesis of indocyanine dyes 10-12 from 1-3 for solid-phase-synthetic coupling to peptides by coupling to thiol groups of cysteine.

The synthesis is carried out by amidation of dyes 1-3 with 3-aminopropanol and subsequent conversion of the alcohol group into a bromide.

A solution of 0.5 mmol of dyes 1-3 and 0.1 g (1.0 mmol) of / triethylamine in 20 ml of dimethylformamide is mixed at 0°C with 0.5 mmol of TBTU in 10 ml of dimethylformamide, and it is stirred for 15 minutes at 0°C. Then, a solution of 850 mg (1.2 mmol) of 3-aminopropanol and 1.2 mmol of triethylamine in 5 ml of dimethylformamide is added in drops, and the reaction mixture is stirred for 6 "hours at room temperature. After 100 ml of diethyl ether is added, the precipitated solid is filtered off and purified by chromatography and freeze-dried as described in Example 1.

The reaction to bromides 10-12 is carried out by stirring 0.3 mmol of the intermediate products with 55 mg (0.5 mmol) of N-bromosuccinimide and 130 mg (0.5 mmol) of triphenylphosphine in a 32 mixture of 4 ml of dichloromethane and 4 ml of dimethylformamide for 4 8 hours at 4°C. By adding 3 ml of ether, the products are precipitated, filtered off and used as crude products in the peptide coupling.

Examples 14-16 and 18-27: Resin synthesis of peptide conjugates of VIP-receptor-binding peptides and dyes 1-9 and 13. a) Solid-phase peptide synthesis: According to the Fmoc strategy and analogously to the standard-Fmoc machine protocol (Pept. Res., 36 (1990) 225), the peptides are synthesized in 50 jimol of TentaGel-Sram resin (Rapp Polymers, Tubingen) with use of coupling reagent PyBOP (benzotriazol-l-yloxy-tris-pyrrolidinophosphonium hexafluorophosphate) and N-methylmorpholine. The following side-protective groups were used: trityl for Cys, His, Asn and Gin; t-butyl for Asp, Glu, t Ser and Thr; t-butyloxycarbonyl for Lys and Trp, and ' pentamethylchromanosulfonyl for Arg.

The coupling to the £-amino group of a lysine (Example 24) is achieved by orthogonal protective group technology. As a lysine component, Fmoc-Lys(Dde-OH) is used, and the peptide is synthesized as described above. After acetylation of the N-terminus, the cleavage of the Dde-protective groups is carried out selectively by 3% hydrazine hydrate. b) Dye coupling: The dyes are bonded in the N-terminal position or to lysine in the peptides that are still solid-phase-bonded. In this connection, 75 ^mol of the respective dyes 1-9 33 and 13 (1.5 eq) in 600 jtl of dimethylformamide is dissolved and mixed with 83 fxmol of TBTU (2-(lH-benzotriazol-l-yl)-1,1, 3, 3-tetramethyluronium-tetrafluoroborate) and 150 /imol of N, N-diisopropylethylamine. After 2 minutes, this reaction mixture is added to the respective peptide-carrying resin and allowed to react overnight. Then, the resin is washed 5 times with dimethylformamide and 3 times with dichloromethane and dried in air. c) Protective group cleavage and detachment of the dye-peptide- conjiigates: 1.5 ml each of a mixture that consists of 750 mg of phenol, 2 50 fil of ethanedithiol, 500 /l1 of thioanisole and 500 jil of water in 10 ml of trifluoroacetic acid are added to the peptide-conjugate-carrying resin and allowed to act for four hours. The dye-peptide conjugates are precipitated with cold t- / butylmethyl ether, washed six times with cold diethyl ether, dissolved in 5% acetic acid and freeze-dried. Purity analysis and purification of the conjugates are carried out with use of RP-HPLC in a Vydac-C18 column (gradient: water+0, 05% TFA/acetonitrile, 5% to 60% acetonitrile in 20 minutes, detection: 214 and 750 nm).

The structures of the synthesized dye-peptide conjugates are summarized in the following survey: 34 Dye Conjugates with VIP-Receptor-Binding Peptides I Examples 14 to 16: Conjugates of dyes 1-3 with VIP (1-28) O ^n-hsdavftdnytrlrkqmavkkylnsiln h n = 1 n = 2 n = 3 (CH2)4S03* (CH2)4S03"Na* Indocarbocyanine-VIP (1-28)-conjugate 14 Indodicarbocyanine-VIP (1-28)-conjugate 15 Indotricarbocyanine-VIP (1-28)-conjugate 16 Example 17: Conjugate of Dye 12 with Cys17-VIP (1-28) O .3 ? (CH2)4S03 (CH2)4S03" Na* HSDAVFTDNYTRLRKQ-Cys-AVKKYLNSILN Indotricarbocyanine-Cys17-VIP (1-28)-conjugate 17 Examples 18 to 20: Conjugates of dyes 1-3 with VIP (14-28) n-rkqmavkkylnsiln H (CH2)4S03' (CH2)4S03"Na+ n = n = n = 1: Indocarbocyanine-VIP (14-28)-conjugate 18 2: Indodicarbocyanine-VIP (14-28)-conjugate 19 3: Indotricarbocyanine-VIP (14-28)-conjugate 20 Examples 21 to 23: Conjugates of dyes 4-6 with VIP (14-24) n—rkqmavkkyln H (CH2)4S03' (CH2)4S03"Na* n = 1: n = 2 : n = 3 : Indocarbocyanine-£-alanine-VIP (14-24)-conjugate 21 -Indodicarbocyanine-fi-alanine-VIP (14-24)-conjugate 22 Indotricarbocyanine-fi-alanine-VIP (14-24)-conjugate 23 Example 17: Resin synthesis of peptide conjugates that consist of VIP-receptor-binding peptides and dyes 10-12.

/ To bind bromine-carrying dyes 10-12 chemoselectively via a thioether bond to the peptides, a cysteine or homocysteine with an orthogonal protective group must be incorporated in the peptide. The solid-phase-peptide synthesis is carried out as described for Examples 14-16/18-27, and the component Fmoc-cys (Mmt)-OH is used. The monomethoxytrityl group (Mmt) can be cleaved by 1% TFA/5% triisobutylsilane in dichloromethane while obtaining the other side protective groups. In this connection, the resin is incubated three times with l ml each of the above solution for 10 minutes. After the resin is washed with dichloromethane (3x), DMF (5x) and ethanol (3x), the resin is incubated for 2 minutes with a 20% cesium carbonate solution (1 36 ml) and then washed with water (2x), ethanol (2x) and DMF (2x). Then, 75 /mol of respective dye 10-12 (1.5 eq) is dissolved in 600 ill of dimethylformamide and added to the respective resin, and the process is repeated after 30 minutes. Then, the resin is washed five times with dimethylformamide (5x) and with dichloromethane (2x). After the resin is dried in air, the protective group cleavage and detachment of the vehicle are carried out as described above.

The structures of other synthesized dye-peptide conjugates are summarized in the following survey: Dye Conjugates with VIP-Receptor-Binding Peptides II Example 24: Conjugate of dye 6 with Lys25-VIP (14-25) (£-Amino-indotricarbocyanine)-Lys25-VIP (14-25)-conjugate 24 Example 25: Conjugate of dye 3 with D-VIP (14-24) V I \ (CH2)4S03" (CH2)4S03"Na+ \ rkqmavkkylnk / / (CH2)4S03 (CH2)4S03" Na+ Indotricarbocyanine-D-VIP (14-24)-conjugate 25 37 Example 26: Conjugate of dye 13 with D-VIP (14-24) Indotricarbocyanine-5-carboxylic acid glucamide-D-VIP (14-24)-conjugate 2 6 Example 27: Conjugate of dye 13 with retro-D-VIP (14-24) Indotricarbocyanine-5-carboxylic acid glucamide-retro-D-VIP (14-24)-conjugate 27 Examples 28 to 32: Resin synthesis of peptide conjugates that consist of somatostatin-receptor-binding peptides and dyes 1-9 and 13.

General Instructions: The syntheses were performed on 500 mg of TCP-Thr (But)-fmoc-resin (Pepchem Tubingen Company) with a concentration of 0.49 mmol/g. The peptide is synthesized "step by step" with use of the following temporary protective groups: tert-butyl for Thr 38 and Ser, trityl for Cys and Asp, Boc for Trp and Lys. As a condensation reagent, HBTU is used.

After cleavage of the N-terminal Fmoc-protective group, dyes 1-9, 13 are condensed in a special synthesis step. To this end, 255 mg of resin is suspended in about 2 ml of DMF and mixed with 0.5 mmol of dye, 0.5 mmol of HBTU and 0.17 ml of DIEA. It is stirred for 18 hours at room temperature, the resin is suctioned off, washed with dichloromethane and dried. The cleavage of the dye-peptide conjugate from resin was carried out with 95% trifluoroacetic acid with the addition of triisopropylsilane with subsequent freeze-drying from 10% acetic acid. The crude product is cyclized with use of activated carbon and purified by chromatography (50x300 mm VYDAC RP-18, gradient: water/acetonitrile).

The structures of the synthesized dye-peptide conjugates are summarized in the following survey: Dve Conjugates with Somatostatin-Receptor-Binding Peptides Examples 28 to 30: Conjugate of dyes 1-3 with pentetreotide / (CH2)4S03- (CH2)4S03- Na+ n = 1: Indocarbocyanine-pentetreotide 28 n = 2: Indodicarbocyanine-pentetreotide 29 n = 3: Indotricarbocyanine-pentetreotide 30 39 Example 31: Conjugate of dye 3 with somatostatin-14 N-AGfKNFFWKTFTSCp (CH2)4S03- (CH2)4S03-Na+ Indotricarbocyanine-somatostat in-14 -conj ugate 31 Example 32: Conjugate of dye 13 with somatostatin-14 N~AG(pKNFFWKTFTS(p (CH2)4S03 (CH2)4S03- Na* Indotricarbocyanine-5-carboxylic acid-glucamide-somatostatin-14-conjugate 32 Examples 33 to 38: Synthesis of peptide conjugates from neurotensin peptides and dye 3.

The synthesis of substances is carried out analogously to the general protocols that are described for Examples 14-27.

The structures of the synthesized dye-peptide conjugates are summarized in the following survey: 40 Dve Conjugates with Neurotensin-Receptor-Binding Peptides Examples 33 to 35: Conjugate of dyes 7-9 with D-Tyr11-neurotensin (7-13) n = 1: Indocarbocyanine-D-Tyr11-neurotensin (7-13)-conjugate 33 n = 2: Indodicarbocyanine-D-Tyr11-neurotensin (7-13)-conjugate 34 n = 3: Indotricarbocyanine-D-Tyr11-neurotensin (7-13)-conjugate 35 O iJ-PRRPylL (CH2)4S03" (CH2)4S03"Na+ / Example 36: Conjugate of dye 2 with D-Tyr11-neurotensin pGlu LYENKPRRPylL -amino-Lys6-indodicarbocyanine) -D-Tyr11 - neurot ens in-conjugate 36 41 Examples 37 to 38: Conjugate of dyes 10-11 with D-Tyr11 neurotensin (5-13)-Cys N H NKPRRPylLC (CH2)4S03- (CH2)4S03-Na+ n = 1: Indocarbocyanine-D-Tyr11-neurotensin (5-13)-Cys-conjugate 37 n = 2: Indodicarbocyanine-D-Tyr11-neurotensin (5-13)-Cys-conjugate 3 8 Example 39: Absorption and fluorescence properties of the synthesized dye-peptide conjugates Absorption maxima and extinction coefficients were determined in PBS and in bovine plasma (Perkin Elmer Lambda 2). on the short-wave side (about 40 nm from the absorption maximum) (SPEX Fluorolog, R92 8 PMT).

The absorption and fluorescence data are summarized in Fig. 4. In Fig. 5, typical absorption and fluorescence emission spectra are indicated by way of example.

Example 40: Determination of the cell imaging using fluorescence microscopy The binding and imaging of the compounds according to the invention were studied in vitro in human tumor cells, and the receptors for vaso-active intestinal peptide and/or somatostatin y Fluorescence emission spectra were obtained in PBS by excitation 42 and/or neurotensin were expressed. To this end, 5 x 105 tumor cells were incubated in 1.5 ml of medium, which contained the test substance. Different concentrations of the substances (10 nM - 10 fiM) were used, and the incubation period varied (1 minute-24 hours). After the incubation, the cells were set, and microscopic preparations were produced. The evaluation was carried out on a Zeiss Axiovert 135-fluorescence microscope, which was equipped with a Cy7- (Exciter HQ 710/70 nm, emitter 810/90 nm, beam splitter 750 nm LP), Cy5- (exciter 575-625 nm, emitter 660-710 nm BP, beam splitter 645 nm) and Cy3-filter set (exciter 546/12 nm, emitter 590 nm LP, beam splitter 580 nm). From all preparations, white light and fluorescence,.images were recorded with a CCD-camera.(Visitron RTE/CCD-576) and digitally stored.

Selected results are described below: / Microscopic white light and fluorescence images (Cy7-filter set) of HT29 cells were set up after 30 minutes of incubation with 10 fiM indotricarbocyanine-VIP (1-28)-conjugate 16. In the fluorescence image, a largely homogeneous fluorescence dispersed over the cells was detected. In addition, areas of increased signals were visible, which can be associated with vesicular compartments. The cells in the fluorescence image correlate in" their-spatial expansion with the white light image.

With the following compounds, white light and fluorescence images (Cy7-filter set) were obtained by analogous means: 43 Indotricarbocyanine-VIP (14-28)-conjugate 20, 10 pM, HT29-cells. Fluorescence dispersed homogeneously over the cells, good correlation with the white light image.

Indotricarbocyanine-retro-D-VIP (24-14) 25, 10 jiM, HT29-cells. Fluorescence dispersed homogeneously over the cells, good correlation with the white light image.

Indotricarbocyanine-pentetreotide conjugate 30, 10 fiM, RIN38-VIPl-cells. Fluorescence areas with a vesicular pattern in the membrane area of the cell, good correlation with the white light image.

In addition, fluorescence images were obtained by analogous means with the following compounds: ( -amino-indotricarbocyanine)-Lys25-VIP (14-25)-conjugate 24, 10 fiM, RIN38-VIPl-cells, Cy7-filter set. The fluorescence image shows a homogeneous, intracellular near-nucleus fluorescence.

/ Indodicarbocyanine-VIP (1-28)-conjugate 15, 10 /xM, RIN38-VlPl-cells, Cy5-filter set. The fluorescence image- shows intracellular fluorescence areas with a vesicular pattern in the membrane area of the cell.

Indocarbocyanine-VIP (1-28)-conjugate 14, 10 /iM, RIN38-VIP1-cells, Cy3-filter set. The fluorescence image shows intracellular fluorescence areas with a vesicular pattern in the membrane area of the cell. 44 Example 41: Study of the tumor concentration using in-vivo-fluorescence imaging in tumor-carrying mice The imaging properties of the compounds according to the invention were studied in vivo after injection into tumor-carrying nude mice. To this end, 0.1 /imol/kg to 2 /xmol/kg of the substance was administered intravenously, and the concentration in the tumor region was observed in a period from 0 to 48 hours. The fluorescence of the substances was excited by irradiation of animals with near-infrared light of wavelength 64 0 nm (indodicarbocyanines) or 74 0 nm (indotricarbocyanines), which was produced with an Nd:YAG laser. The fluorescence radiation was detected at a wavelength of > 700 nm or > 800 nm by an intensified CCD-camera, and the fluorescence images were stored digitally.

Selected results are described below: From a tumor-carrying nude mouse (HT29-tumor in the right rear flank), whole-body-fluorescence images were recorded before and 1 hour after administration of 0.1 /imol/kg of indotricarbocyanine-VIP (14-28)-conjugate 20. The fluorescence intensity before administration is negligible (low autofluorescence). One hour after administration, a signal with . approximately a 2-fold increase in intensity resulted in the tumor relative to the contralateral flank in fluorescence emission, whereby such emission is otherwise dispersed homogeneously over the remainder of the body.

From a tumor-carrying nude mouse (RIN38-SSTR2-tumor in the right rear flank), whole-body-fluorescence images were recorded 45 before and one hour after administration of 0.1 /xmol/kg of indotricarbocyanine-pentetreotide conjugate 30. The fluorescence intensity before administration is negligible (low autofluorescence). One hour after administration, a signal with approximately a 3-fold increase in intensity resulted in the tumor relative to the contralateral flank in fluorescence emission, whereby such emission is otherwise dispersed homogeneously over the remainder of the body.

From a tumor-carrying nude mouse (HT29 tumor in the right rear flank), whole-body-fluorescence images were recorded before and one hour after administration of 0.1 jmol/kg of (£-amino-indotrica'rbocyanine)-Lys25-VIP (14-25) -conjugate 24. The fluorescence intensity before administration is negligible (low autofluorescence). One hour after administration, a signal with approximately a 1.5-fold increase in intensity resulted in the / tumor relative to the contralateral flank. In addition,7 an increased fluorescence signal in the kidneys was detected.

From a tumor-carrying nude mouse (HT2 9-tumor in the right rear flank), whole-body-fluorescence images were recorded before and five minutes after administration of 0.2 /zmol/kg of indodicarbocyanine-VIP (1-28)-conjugate 15. The fluorescence intensity before administration is negligible (low autofluorescence). One hour after administration, a signal with approximately a 1.4-fold increase in intensity resulted in the tumor relative to the contralateral flank. In addition, an increased fluorescence signal was detected in the kidneys. 46 Example 42: Study of the stability of dye-peptide conjugates in bovine plasma The chemical stability of the compounds according to the invention in plasma was studied in vitro using HPLC based on time. To this end, 1 mM solutions of peptides in PBS in bovine blood plasma (Graeber Company, frozen, for heparin analysis) was pipetted while obtaining a concentration of 3 0 /zM, and the solutions were incubated at 3 7°C.

At various times (0.5; 1; 2; 4; 6; 24 hours), the working-up of the samples was carried out by 1 ml of the plasma solution being mixed with 1 ml of MeOH, and the precipitated proteins being centrifuged off.

The analysis of the supernatant was carried out using HPLC by determining the content at 750 nm relative to the content after 1 minute of incubation at 0°C (control).

/ HPLC: Beckmann, diode array detector TIDAS (J & M Company), 350-1000 nm; . , Column: Chromasil 5 [i, 250 mm x 4.5 mm Mobile solvent: A: 90% H20 (+0.5% TFA)/10% MeOH B: 10% H20 (+0.5% TFA)/90% MeOH Gradients. 10% B to 100% B within 20 minutes The examples are summarized in Fig. 6. 47 Example 43: Substitution analysis of VIP using spot synthesis 1. Synthesis of peptides on cellulose The synthesis of peptides on cellulose (spot synthesis) was published in 1988 for the first time by R. Frank and R. Doring and described in detail in 1992 by R. Frank1. Here, the method2 established in the AG Schneider-Mergener was used.

The cellulose membrane was chemically modified to provide suitable anchor functions for the subsequent peptide synthesis.

In this case, a mercapto group4 was inserted into an amino- functionalized cellulose membrane (CAPE membrane)3. The first amino, apid. in the form of a bromopropyl ester could be coupled to this mercapto group. Then, all amino acids of the peptide were successively built up according to the Fmoc strategy. At the end, the indodicarbocyanine solid was bonded in the N-terminal / position to the peptide, and then all side protective groups were cleaved off.

To be able to study the peptides for receptor binding, the peptides had to be cleaved off from the cellulose. In this respect, a method was developed in which it has been possible for the first time to cleave off peptides with an authentic C-terminus from the cellulose. la. Modification of the cellulose membrane • A 20 x 30 cm cellulose membrane (Whatman 50) was incubated for 2 minutes with methanol/l.2% perchloroacetic acid and then freeze-dried. 48 • After three hours of incubation with 10% epibromohydrin in dioxane/1.2% perchloroacetic acid, it was reacted for 3 0 minutes with methanol and then washed twice with methanol.

• Then, it was washed three times with dimethylformamide (DMF) and incubated overnight with 50% 1,3-diaminopropane (v/v) in DMF. Then, it was washed as follows: 3 x DMF, 2 x ethanol, 2 x distilled water, 2 x ethanol, 15 minutes with 5 M sodium methanolate, 3 x methanol, 4 x distilled water, 3 x ethanol, 1 x diethyl ether.

Definition of spots • For the spot definition, 1.3 fil of 0.6 M Fmoc-S- alanine-Opfp solution with the auto-spot robot 222 XL / (Abimed, Langenfeld) was doubly-pipetted at a reaction time of 15 minutes to certain points on the cellulose membrane.

• The membrane-was acetylated for 2 minutes with 2% acetic anhydride solution and for 3 0 minutes with 20% acetic anhydride/10% diisopropylethylamine.

• For the cleavage of the Fmoc-protective group, the membrane was washed 3 x with DMF, incubated 2 x for 10 minutes with 20% piperidine solution, and washed 5 x with DMF and 1 x with ethanol. The free amino groups could be made visible with bromophenolyl blue. After repeated washing with ethanol, the membrane was dried. 49 lc. Coupling of the Mmt-mercaptopropionic acid and the bromo-propylester • 0.6 M mercaptopropionic acid was double-pipetted at a reaction time of 15 minutes to the defined spots.

Then, it was washed 3 x with DMF and 3 x with dichloromethane (DCM).

• The cleavage of the Mmt-protective group was carried out with incubation for 2 minutes with 10% dichloroacetic acid/0.5% trifluoroacetic acid and 3 x for 5 minutes with 10% dichloroacetic acid/0.5% trifluoroacetic acid/5% triisobutylsilane. The following washing steps were performed: 1 x DCM, 2 x ethanol, 1 x distilled water, 1-2 minutes with 10% cesium carbonate, 1 x distilled water, 2 x ethanol, 1 x diethyl ether / • The respective Fmoc-bromopropyl-amino acid est:er was coupled 3 x at a concentration of 0.6 M and a reaction time of 15 minutes. The cleavage of the Fmoc-protective group was performed as in lb.

Id. Coupling of the amino acids • The peptides were built up to form the spots by repeated pipetting of 0.6 M amino acid solutions in N-methylpyrrolidone and subsequent cleavage of the Fmoc-protective groups. 50 le. Coupling of the indodicarbocyanine dye • An 0.3 M solution of the indodicarbocyanine dye was activated with 0.3 M TBTU and 0.6 M diisopropylethylamine, and it was pipetted 4 x at a reaction time of 15 minutes to the spots.

If. Cleavage of the side protective groups • The cleavage of the side protective groups was carried out by subsequent treatment of the membrane with 90% trifluoroacetic acid/3% triisobutylsilane/2% distilled water/1% phenol for 30 minutes and with 50% trifluoroacetic acid/3% triisobutylsilane/2% distilled water/1% phenol for 2.5 hours. Then, it was washed 4 : with dichloromethane, 3 x with DMF and 1 x with ethanol. y 2. Cleavage of the peptides from the cellulose-membrane • The spots were punched out and washed with methanol. For the cleavage, it was incubated for 3 0 minutes with .70 mM of sodium methanolate in methanol. It was possible to correct the pH by adding 3 7% hydrochloric acid. Then, the peptides were dried in a speed-vac.

• After drying, the peptides were taken up in distilled water and analyzed using Reversed-Phase-HPLC and MALDI TOF. 51 3. Cell assay and continuous-flow cytometry • The concentration of the VIP derivatives was determined photometrically via the dye. In the cell assay, the peptides were used with a final concentration of 150 mM. In this case, 1 x 105 RIN38 (VAPC1) cells were incubated with the VIP derivatives for one hour at 37°C in a binding buffer (50 mM of tris/HCL, pH 7.5, 5 nM of MgCl2, 1 mM of CaCl2, 100 mM of NaCl, 4% BSA) .

• Then, the cells were washed 2 x with PBS, moved into the FACS-tube and centrifuged for 5 minutes at 377 g. The cell pellet was measured resuspended in 300 /xl of Cellfix in the FACS-Calibur (Becton Dickinson) with an FL4-lens system. 4. Evaluation / • The fluorescence intensities of the native, naturally occurring, human VIP-peptides measured in the continuous-flow cytometry were set at 100%. The standard deviation of 28 native VIP-peptides was 11%. The other VIP-derivatives were adapted to this 100%.

Fig. 7 shows relative fluorescence intensities of RIN38 VPAC1 cells after incubation in the presence of 150 nM of the dye-labeled peptides for 1 hour at 3 7°C. Data in percentage relative to the native peptide of the respective series.

Literature for spot synthesis: 1. Frank, R. (1992) Spot Synthesis: An Easy Technique for the Positionally Addressable, Parallel Chemical 52 Synthesis on a Membrane Support. Tetrahedron 48, 9217-9232 2. Kramer, A.; Schneider-Mergener, J. (1998) Synthesis and Screening of Peptide Libraries on Continuous Cellulose Membrane Supports. Methods in Molecular Biology 87, 25-39 3. Volkmer-Engert, R.; Hoffman, B.; Schneider-Mergener, J. (1997) Tetrahedron Lett. 38, 1029-1032 4. Licha, K.; Bhargava, S.; Rheinlander, C.; Becker, A.; Schneider-Mergener, J.; Volkmer-Engert, R. (in press) Highly Parallel Nano-Synthesis of Cleavable Peptide-Dye Conjugates on Cellulose Membranes. Tetrahedron Lett.

Example 44 a) 5-N-(2,3-Dihydroxypropyl)aminocarbonyl-1-(4-sulfobutyl)- / 2,3,3-trimethyl(3H)indolenine ' 0.9 g (2.6 mmol) of 5-carboxy-l-(4-sulfobutyl)-2,3,3-. trimethyl(3H)indolenine (Anal. Biochem. 217, 197, 1994) is introduced into 30 ml of absolute N,N-dimethylformamide and 3 ml of pyridine and mixed with 1.3 5 g (5.3 mmol) of disuccinimidyl carbonate. After three hours, 0.965 g (10.6 mmol) of 2,3-dihydroxypropylamine is added. It is stirred overnight.at room" temperature, the batch is evaporated to the dry state, and the residue is absorptively precipitated with diethyl ether. The: solid is suctioned off and chromatographed on RP-material for purification.

Yield: 0.82 g (76% of theory) 53 Analysis (relative to solventless substance): Cld: C 55.32 H 6.84 N 6.79 S 7.77 O 23.27 Fnd: C 55.39 H 6.95 N 6.57 S 7.58 b) 4-[2-[4-Chloro-7-[5-N-(dihydroxypropyl)aminocarbonyl-3,3-dimethyl-1-(4-sulfonatobutyl)indolin-2-ylidene]-3,5-(propane-1,3-diyl)-1,3,5-heptatrien-l-yl]-5-N-(dihydroxypropyl)aminocarbonyl-3,3-dimethyl(3H)-indolio]-butanesulfonate, sodium salt A solution of 360 mg (1 mmol) of N-[5-anilino-3-chloro-2,4-(propane-1,3-diyl)-2,4-pentadien-l-ylidene]anilinium-chloride, 825 mg (2 mmol) of 5-N-(2,3-dihydroxypropyl)aminocarbonyl-1-(4-sulfobutyl)-2,3,3-trimethyl(3H)indolenine (Example 44a) and 330 mg (4 mmol) of anhydrous sodium acetate in 30 ml of ethanol are refluxed for two hours under argon. Then, the ethanol is / distilled off, and the residue is purified by chromatography. Yield: 0.58 g (59% of theory) Analysis (relative to solventless substance): Cld: C 56.17 H 6.15 CI 3.60 N 6.79 S 7.77 0 23.27 Na 2.34 Fnd: C 55.99 H 6.3 0 CI 3.41 N 6.87 S 7.64 Na 2.17 54 c) 4-[2-{4-(4-(2-Carboxyethyl)phenyloxy)-7-[5-N- (dihydroxypropyl)aminocarbonyl-3,3-dimethyl-1-{4 -sulfonatobutyl)indolin-2-ylidene]-3,5-(propane-1,3-diyl)-1,3,5-heptatrien-l-yl]-5-N-(dihydroxypropyl)aminocarbonyl-3,3-dimethyl(3H)indolio]butanesulfonate, sodium salt, N-hydroxysuccinimide ester 225 mg (1.4 mmol) of 3-(4-hydroxyphenyl)propionic acid is dissolved in 10 ml of dry N,N-dimethylformamide under a cover gas and mixed with 65 mg (2.7 mmol) of sodium hydride (60% in oil).

After 30 minutes, 138 mg (0.14 mmol) of 4-[2-[4-chloro-7-[5-N- (dihydroxypropyl)aminocarbonyl-3,3-dimethyl-1-(4- sulfonatobutyl)indolin-2-ylidene]-3,5-(propane-1,3-diyl)-1,3,5- heptatrien-l-yl]-5-N-(dihydroxypropyl)aminocarbonyl-3,3- dimethyl(3H)indolio]butanesulfonate, sodium salt (Example 44b), is added, and it is stirred for another 3 0 minutes. Then, the / reaction mixture is quenched with dry ice and evaporated to the dry state. The residue is purified via a preparative HPLC. For production of the active ester, 14 mg (120 /mol) of N-hydroxysuccinimide and 2 mg (2.4 /imol) of the carboxylic acid are dissolved in 200 /il of N,N-dimethylformamide. After ten minutes, 24 mg (120 /imol) of dicyclohexylcarbodiimide is added, and it is -stirred overnight at room temperature. The active ester is. used" without further purification in the next step.

Analogously to the synthesis according to Examples 14-:i6. and 18-27a (solid-phase peptide synthesis), the VIP-analog HSDAVFWDNY TRLRKQMAVK KYLNSILN is synthesized in the solid phase. The dye 4- [2- [4-(4-(2-carboxyethyl)-phenyloxy)-7-[5-N- 55 (dihydroxypropyl)aminocarbonyl-3,3-dimethyl-1-(4-sulfonatobutyl)indolin-2-ylidene]-3,5-(propane-1,3-diyl)-1,3,5-heptatrien-l-yl]-5-N-(dihydroxypropyl)aminocarbonyl-3,3 -dimethyl(3H)indolio]-butanesulfonate, sodium salt, is coupled to the peptide according to Examples 14-16 and 18-27b (dye coupling), and this conjugate is isolated and purified according to Examples 14-16 and 18-27c (protective group cleavage and detachment of the dye-peptide conjugates). d) 4- [2- [4- (4-(2-Isothiocyanatoethyl)phenyloxy)-7-[5-N- (dihydroxypropyl)aminocarbonyl-3,3-dimethyl-l-(4- ■ sulfonatobutyl)indolin-2-ylidene] -3,5-(propane-1,3-diyl)- 1,3,5-heptatrien-l-yl]-5-N-(dihydroxypropyl)aminocarbonyl- 3,3-dimethyl(3H)indolio]butanesulfonate, sodium salt 116 mg (0.6 mmol) of 2-(4-hydroxyphenyl)ethylisothiocyanate / in 2 ml of N,N-dimethylformamide is added to a suspension of 28 mg (0.6 mmol) of sodium hydride (60% in oil) in 4 ml of anhydrous N,N-dimethylformamide at 0°C. After 3 0 minutes, the solution that is thus produced is added to 138 mg (0.14 mmol) of 4- [2-£4-chloro-7-[5-N-(dihydroxypropyl)aminocarbonyl-5-N-(dihydroxypropyl)aminocarbonyl-3,3-dimethyl-l-(4-sulfonatobutyl)indolin-2-ylidene]-3,5-(propane-l,3-diyl)-1,3,5-heptatrien-l-yl]-3,3-dimethyl(3H)indolio]butanesulfonate, sodium salt (Example 44b). It is stirred overnight at room temperature and then quenched with dry ice. It is evaporated to the dry state in a rotary evaporator, and the residue is purified via preparative HPLC. 56 Yield: 85 mg (54% of theory) Analysis: (relative to solventless substance): Cld: C 58.65 H 6.09 N 6.22 S 8.54 O 18.47 Na 2.04 Fnd: C 58.53 H 6.17 N 6.11 S 8.63 Na 1.83 Analogously to the synthesis.according to Examples 14-16 and 18-27a (solid-phase peptide synthesis), the VIP-analog HSDAVFTDNY TRLRFQMAVK KYLNSILN is synthesized in the solid phase. The dye 4- [2- [4- (4- (2-isothiocyanatoethyl) -phenyloxy) -7- [5-N- (dihydroxypropyl) aminocarbonyl-3, 3-dimethyl-l-(4- sulforaafcobutyl) indolin-2-ylidene] -3, 5-(propane-1, 3-diyl) -1,3,5- heptatrien-l-yl]-5-N-(dihydroxypropyl)aminocarbonyl-3,3- dimethyl(3H)indolio]-butanesulfonate, sodium salt, is coupled to the peptide in the N-terminal position, and this conjugate is / isolated and purified according to Examples 14-16 and \i~21c (protective, group cleavage and detachment of the dye-peptide conjugates),.

Analogously, other symmetrically hydrophilic dyes can be built up from the following components: Hydrophilic indolenine derivatives with hydroxyalkyl substituents: (produced according to Example 44a) a) 5-N-(2,3-Dihydroxypropyl)-N-methylaminocarbonyl-1-(4-sulfobutyl)-2,3,3-trimethyl(3H)indolenine b) 5-N-(Hydroxyethyl)-aminocarbonyl-1-(4-sulfobutyl)-2,3,3-trimethyl(3H)indolenine 57 c) 5-N-(2,3-Dihydroxypropyl)-N-(hydroxyethyl)-aminocarbonyl-1-(4 -sulfobutyl) - 2,3, 3 -trimethyl(3H)indolenine d) 5-N,N-(bis-Hydroxyethyl)-aminocarbonyl-1-(4-sulfobutyl)-2,3,3-trimethyl(3H)indolenine e) 5-N-(2,3,4,5,6-Pentahydroxyhexyl)-aminocarbonyl-1-(4-sulfobutyl)-2,3,3-trimethyl(3H)indolenine f) 5-N-(1,3,4-Trihydroxybut-2-yl)-N-methylaminocarbonyl-1-(4-sulfobutyl)-2,3,3-trimethyl(3H)indolenine Example 45 a): 5-N-.(2 ,3,4, 5, 6-Pentahydroxyhexyl) aminocarbonyl-i-(4-sulfobutyl)-2,3,3-trimethyl(3H)indolenine 0.6 g (1.8 mmol) of 5-carboxy-l-(4-sulfobutyl)-2,3,3 - trimethyl(3H)indolenine (Anal. Biochem. 217, 197, 1994) is / introduced into 2 0 ml of absolute N,N-dimethylformamide'and 2 ml of pyridine, and it is mixed with 0.95 g (3.6 mmol) of disuccinimidyl carbonate. After two hours, 1.4 ml (10 mmol) of triethylamine and 322 mg (1.8 mmol) of glucamine are added. It is stirred overnight at room temperature, the batch is evaporated to the dry state, and the residue is absorptively precipitated with diethyl ether. The solid is suctioned off and chromatographed on RP-material for purification.

Yield: 0.67 g (74% of theory) 58 Analysis (relative to solventless substance): Cld: C 52.58 H 6.82 N 5.57 S 6.38 0 28.65 Fnd: C 52.47 H 6.91 N 5.39 S 6.44 b) 4- [2- [4-Chloro-7- [5-N- (2,3,4,5,6- pentahydroxyhexyl)aminocarbonyl-3,3-dimethyl-1 - (4 -sulfonatobutyl)indolin-2-ylidene]-3,5- (propane-l,3-diyl)-1,3,5-heptatrien-l-yl]-3,3-dimethyls-[N-(2,3,4,5,6-. pentahydroxyhexyl)aminocarbonyl] (3H)indolio]butanesulfonate, sodium salt A solution of 180 mg (0.5 mmol) of N- [5-anilino-3-chloro-2,4-(propane-1,3-diyl)-2,4-pentadien-l-ylidene]anilinium-chloride, 503 mg (l mmol) of 5-N-(2,3,4,5,6-pentahydroxyhexyl)aminocarbonyl-1-(4-sulfobutyl)-2,3,3- trimethyl(3H)indolenine (Example 45a), and 165 mg (2 mmol) of / anhydrous sodium acetate in 10 ml of ethanol are refluxed for two hours under argon. Then, the ethanol is distilled off, and the residue is purified by chromatography.

Yield: 0.31 g (53% of theory) Analysis .. .(relative to solventless substance) : Cld: C 54.05 H 6.33 Cl 3.01 N 4.76 S 5.44 0 24.45 Na 1.95 Fnd: C 53.89 H 6.20 Cl 2.87 N 4.83 S 5.29 Na 1.72 59 c) 4-[2-[4-(4-Isothiocyanatothiophenyloxy)-7-[5-N-(2,3,4,5,6-pentahydroxyhexyl)aminocarbonyl-3,3-dimethyl-1-(4-sulfonatobutyl)indolin-2-ylidene]-3,5- (propane-1,3-diyl)-1,3,5-heptatrien-l-yl]-3,3-dimethyl-5-[N-(2,3,4,5,6-pentahydroxyhexyl)aminocarbonyl](3H)indolio]butanesulfonate, sodium salt 54 mg (0.4 mmol) of 4-aminothiophenol is dissolved in 10 ml of absolute N,N-dimethylformamide under argon atmosphere and mixed at room temperature with 165 mg (0.14 mmol) of 4-[2-[4-chloro-7-[5-N-(2,3,4,5,6-pentahydroxyhexyl)aminocarbonyl-3,3 -dimethyl-1-(4-sulfonatobutyl)indolin-2-ylidene]-3,5-(propane-1,3-diyl)-1,3,5-heptatrien-l-yl] -3,3-dimethyl-5-[N-(2,3,4,5,6-pentahydroxyhexyl)aminocarbonyl](3H)indolio]butanesulfonate, sodium salt (Example 45b). After 10 minutes, the reaction mixture is quenched with dry ice, and 210 mg (1 mmol) of thiocarbonyldiimidazole is added. After 4 5 minutes, the dye is precipitated with diethyl ether, and the solid is isolated via centrifuging. For purification, it is can be chromatographed on RP-material.

Yield: 78 mg (43% of theory) Analysis (relative to solventless substance): Cld: C 55.07 H 6.01 N 5.35 S 9.80 0 22.01 Fnd: C 54.89 H 6.20 N 5.24 S 9.58 Na 1.76 Na 1.54 Analogously to the synthesis according to Examples 14-16 and 18-27a (solid-phase peptide synthesis), the VIP-analog HSWAVFTDNY 60 TRLRKQMAVK KYLNSILN is synthesized in the solid phase. The dye 4- [2-[4-(4-isothiocyanatothiophenyloxy)-7-[5-N-(2,3,4,5,6-pentahydroxyhexyl)-aminocarbonyl-3,3-dimethyl-l-(4-sulfonatobutyl)indolin-2-ylidene]-3,5-(propane-1,3-diyl)-1,3,5-heptatrien-l-yl] -3,3-dimethyl-5-[N-(2,3,4,5,6-pentahydroxyhexyl)aminocarbonyl](3H)indolio]butanesulfonate, sodium salt, is coupled to the peptide in the N-terminal position, and this conjugate is isolated and purified according to Examples 14-16 and 18-27c (protective group cleavage and detachment of the dye-peptide conjugates).

Analogously, other symmetrical hydrophilic dyes can be built up from the following components: Hydrophilic indolenine derivatives with hydroxyalkyi substituents: (produced according to Example 44a) a) 5-N-(2,3-Dihydroxypropyl)-N-methylaminocarbonyl-1-(4- / sulfobutyl)-2,3,3-trimethyl(3H)indolenine b) 5-N-(Hydroxyethyl)-aminocarbonyl-1-(4-sulfobutyl)-2,3,3-trimethyl(3H)indolenine c) 5-N-(2,3-Dihydroxypropyl)-N-(hydroxyethyl)-aminocarbonyl-1-(4-sulfobutyl)-2,3,3-trimethyl(3H)indolenine d) 5-N,N-(bis-Hydroxyethyl)-aminocarbonyl-1-(4-sulfobutyl) -2,3,3-trimethyl(3H)indolenine e) 5-N-(2,3,4,5,6-Pentahydroxyhexyl)-aminocarbonyl-l-(4-sulfobutyl)-2,3,3-trimethyl(3H)indolenine f). 5-N- (1,3, 4-Trihydroxybut-2-yl) -N-methylaminocarbonyl-l- (4-sulfobutyl)-2,3,3-trimethyl(3H)-indolenine 61 Example 4 6 7- [5-N-(2,3-Dihydroxypropyl)aminocarbonyl-3,3-dimethyl-1-(4-sulfonatobutyl)indolin-2-ylidene]-1,3,5-heptatrien-l-yl]-3,3-dimethyl-5-carboxy(3H)indolio]butanesulfonate, sodium salt A solution of 2.35 g (5.71 mmol) of 5-N-(2,3-dihydroxypropyl)aminocarbonyl-1-(4-sulfobutyl)-2,3,3-t'rimethyl (3H) indolenine (Example 44a) and 1.57 g (5.5 mmol) of glutaconaldehyde dianilide-hydrochloride in 25 ml of acetic acid anhydride are stirred for 3 0 minutes at 12 0°C. Then, 2.4 g (7.1 mmol) of 5-carboxy-1-(4-sulfobutyl)-2,3,3-trimethyl(3H)-indolenine, 1.71 g of sodium acetate, 22 ml of acetic acid anhydride and 8.6 ml of acetic acid ate added. The reaction mixture is allowed to stir for one hour at 120°C, cooled to room temperature, and the product is precipitated with diethyl ether. The crude product is chromatographed on RP-material.

/ Yield: 1.9 g (40% of theory) ' Analysis (relative to solventless substance): Cld: C 54.47 H 6.03 N 5.03 S 7.67 0 21.05 Na 2.75 Fnd: C 54.26 H 6.12 N 5.00 S 7.49 Na 2.48 Analogously to the synthesis according to Examples 14-16 and 18-27a (solid-phase peptide synthesis), the VIP-analog HSDAVFTDNY TRLRKKMAVK KYLNSILN is synthesized in the solid phase. The dye 7-[5-N-(2,3-dihydroxypropyl)aminocarbonyl-3,3-dimethyl-1- (4-sulfonatobutyl)indolin-2-ylidene]-1,3,5-heptatrien-l-yl]-3,3-dimethyl-5-carboxy(3H)indolio]butanesulfonate, sodium salt, is 62 coupled to the peptide in the N-terminal position according to Examples 14-16 and 18-27b (dye coupling), and this conjugate is isolated and purified using HPLC according to Examples 14-16 and 18-27c (protective group cleavage and detachment of the dye-peptide conjugate).

Analogously, other unsymmetrical hydrophilic dyes can be built up from the following components: Hydrophilic indolenine derivatives with hydroxyalkyl substituents: (produced according to Example 44a) a) 5-N-(2,3-Dihydroxypropyl)-N-methylaminocarbonyl-1-(4-sulfobutyl)-2,3,3-trimethyl(3H)indolenine b) 5-N-(Hydroxyethyl)-aminocarbonyl-1-(4-sulfobutyl) -2,3,3-trimethyl(3H)indolenine . c) 5-N-(2,3-Dihydroxypropyl)-N-(hydroxyethyl)-aminocarbonyl-1-(4-sulfobutyl)-2,3,3-trimethyl(3H)indolenine d) 5-N,N-(bis-Hydroxyethyl)-aminocarbonyl-1-(4-sulfobutyl)-2,3,3 -trimethyl(3H)indolenine e) 5-N- (2,3,4,5,6-Pentahydroxyhexyl)-aminocarbonyl-1-(4-sulfobutyl)-2,3,3-trimethyl(3H)indolenine f) 5-N- (1,3,4-Trihydroxybut-2-yl)-N-methylaminocarbonyl-1-(4-sulfobutyl)-2,3,3-trimethyl(3H)indolenine Indolenine derivatives with carboxyl groups: a) 5-Carboxy-1-(4-sulfobutyl)-2,3, 3-trimethyl(3H)indolenine. b) 5-Carboxymethyl-l-(4-sulfobutyl)-2,3,3-trimethyl(3H)indolenine c) 5-Carboxy-1-(3-sulfopropyl)-2 , 3, 3-trimethyl(3H)indolenine 63 d) 5-Carboxymethyl-l-(3-sulfopropyl)-2,3,3-trimethyl(3H)indolenine e) 5-Carboxy-1-(2-sulfoethyl)-2,3,3-trimethyl(3H)indolenine f) 5-Carboxymethyl-l-(2-sulfoethyl)-2,3,3-trimethyl(3H)indolenine Dianil derivatives for reaction with the above-mentioned indolenines with the formation of mono-, di- or tricarbocyanines a) Glutaconaldehyde dianilide-hydrochloride b) Malonaldehyde-bis-phenylimine-hydrochloride c) N,N-Diphenylformamidine d) N-[5-Anilino-2,4-(propane-1,3-diyl)-2,4-pentadien-l-ylidene]anilinium-chloride e) N-[5-Anilino-2,4-(ethane-1,2-diyl)-2,4-pentadien-l-ylidene]anilinium-chloride i f) N-[5-Anilino-3-chloro-2,4-(propane-1,3-diyl)-2,4-pentadien-1-ylidene]anilinium chloride g) N-[5-Anilino-3-chloro-2,4 -(ethane-1,2-diyl)-2,4-pentadien-l ylidene]anilinium chloride 64 Example 47 7-[5-N-(1,3,4-Trihydroxybut-2-yl)-aminocarbonyl-3,3-dimethyl-l-(4-sulfonatobutyl)indolin-2-ylidene]-3,5-(2-carboxypropane-l,3 -diyl)-1,3,5-heptatrien-l-yl]-3,3-dimethyl-5-N-(1,3,4-trihydroxybut-2-yl)-aminocarbonyl(3H)indolio]butanesulfonate, sodium salt, N-hydroxysuccinimide ester a) 4-[2-[4-Chloro-7-[5-N-(1,3,4-trihydroxybut-2- yl)aminocarbonyl-3,3-dimethyl-1-(4-sulfonatobutyl)indolin-2-ylidine]-3,5-[2-(methoxycarbonyl)propane-1,3-diyl]-1,3,5-heptatrien-l-yl]-3,3-dimethyl-5-[N-(1,3,4 -trihydroxybut-2-yl)aminocarbonyl](3H)indolio]butanesulfonate, sodium salt 5.5 ml-(10 mmol) of phosphoroxy chloride and 6 ml of N,N-dimethylformamide are added to a solution of 0.8 g (5 mmol) of 4-(methoxycarbonyl)-cyclohexanone in 5 ml of dichloromethane at 0°C. Then, it is refluxed for one hour. The dichloromethane is distilled off, and 4 ml of aniline in 10 ml of methanol'is added at a maximum of 5°C» The reaction mixture is poured onto ice, 5 ml of concentrated hydrochloric acid is added, and the intermediate product is allowed to crystallize out for five hours at 0°C. The crystals are suctioned off, and the latter are used without further purification in the next reaction. To this end, the crystals are dissolved in anhydrous ethanol, and 4.4 g (10 mmol) of 5-N-(1,3,4-trihydroxybut-2-yl)-N-methylaminocarbonyl-1-(4-sulfobutyl)-2,3,3-trimethyl(3H)indolenine (see Example 45).and 0.8 g of anhydrous sodium acetate are added. It is refluxed for one hour, the solid is filtered off, and the filtrate is 65 evaporated to the dry state. The residue is chromatographed for purification.

Yield: 3.25 g (58% of theory) Analysis (relative to solventless substance): Cld: C 54.90 H 6.14 Cl 3.18 N 5.02 S 5.75 0 22.94 Na 2.06 Fnd: C 54.76 H 6.03 Cl 2.99 N 4.91 S 5.60 Na 1.83 b) 7-[5-N-(1, 3,4-Trihydroxybut-2-yl)aminocarbonyl-3,3-dimethyl 1-(4-sulfonatobutyl)indolin-2-ylidene]-3,5-(2-carboxypropane-1,3-diyl)-1,3,5-heptatrien-l-yl]-3,3-dimethyl-5-N-(1,3,4-trihydroxybut-2- yl)aminocarbonyl(3H)indolio]butanesulfonate, sodium salt A mixture of 10 mg (0.4 mmol) of sodium hydride and 80 mg (1.3 mmol) of ethanethiol in 10 ml of anhydrous N,N-dimethylformamide are stirred under nitrogen for 3 0 minutes at room temperature. Then, it is mixed with 112 mg (0.1 mmol) of 4 [2-[4-chloro-7-[5-N-(2,3,4,5,6-pentahydroxyhexyl)aminocarbonyl-3,3-dimethyl-l-(4-sulfonatobutyl)indolin-2-ylidene]-3,5-[2-(methoxycarbonyl)propane-l,3-diyl]-1,3,5-heptatrien-l-yl]-3,3-dimethyl5-[N-(2,3,4,5,6-pentahydroxyhexyl)- aminocarbonyl](3H)indolio]butanesulfonate, sodium salt (Example 47a), in 3 ml of N,N-dimethylformamide. The reaction mixture is heated for two hours to 100°C and after cooling to room temperature, it is quenched with carbon dioxide. It is evaporated to the dry state in a rotary evaporator, and the 66 residue is extracted with hot ethanol. The extract is evaporated, and the crude product is chromatographed.

Yield: 75 mg (67% of theory) Analysis (relative to solventless substance): Cld: C 56.27 H 6.33 N 5.25 S 6.01 0 23.99 Na 2.15 Fnd: C 56.13 H 6.46 N 5.12 S 5.87 Na 1.88 c) 7-[5-N-(1,3,4-Trihydroxybut-2-yl)-aminocarbonyl-3,3- dimethyl-1-(4-sulfonatobutyl)indolin-2-ylidene]-3,5-(2-carboxypropane-1,3-diyl)-1,3,5-heptatrien-l-yl] -3,3-dimethyl-5-(N-(1,3,4-trihydroxybut-2-yl)-aminocarbonyl(3H)indolio]butanesulfonate-N-hydroxysuccinimide ester, sodium salt For the production of the active ester, 14 mg (0.12 mmol) of / N-hydroxysuccinimide and 64 mg (0.06 mmol) of the carboxylic acid in 2 ml of N,N-dimethylformamide are dissolved. After 15 minutes, 25 mg (0.12 mmol) of dicyclohexylcarbodiimide is added, and it is stirred overnight at room temperature. The active ester is purified using preparative HPLC.

Yield: 60 mg (86% of theory) Analysis (relative to solventless substance): Cld: C 55.71 H 6.06 N 6.02 S 5.51 0 24.73 Na 1.97 : Fnd: C 55.59 H 6.21 N 5.93 S 5.37 Na 1.75 67 Analogously to the synthesis according to Examples 14-16 and 18-27a (solid-phase peptide synthesis), the VIP-analog HSDAVFTDNY TRLRKAMAVK KYLNSILN is synthesized in the solid phase. The dye 7-[5-N-(1, 3, 4-trihydroxybut-2-yl)-aminocarbonyl-3,3-dimethyl-1-(4-sulfonatobutyl)indolin-2-ylidene]-3,5-(2-carboxypropane-1,3-diyl)-1,3, 5-heptatrien-l-yl]-3,3-dimethyl-5-N-(1,3,4-trihydroxybut-2-yl)-aminocarbonyl(3H)indoliolbutanesulfonate, sodium salt, is coupled to the peptide in the N-terminal position according to Examples 14-16 and 18-27b, and this conjugate is isolated and purified according to Examples 14-16 and 18-27c (protective group cleavage and detachment of the dye-peptide conjugates).

Example 48 7- [5-N-(1, 3,4-Trihydroxybut-2-yl)-aminocarbonyl-3,3-dimethyl-1- / (4-sulfonatobutyl)indolin-2-ylidene] -3,5-(2-carboxypropane-l,3-diyl)-1,3, 5-heptatrien-l-yl]-3,3-dimethyl-5-N-(1,3,4-trihydroxybut-2-yl)-aminocarbonyl(3H)indolio]butanesulfonate, sodium salt a) 5-N-(11-Aminoundecyl)aminocarbonyl-1-(4-sulfobutyl)-2,3,3-trimethyl(3H)indolenine 34 0 mg (1 mmol) of 5-carboxy-1-(4-sulfobutyl)-2,3,3 -trimethyl(3H)indolenine (Anal. Biochem. 217, 197, 1994) is -introduced into 5 ml of absolute N,N-dimethylformamide and l ml of pyridine, and it is mixed with 0.5 g (2 mmol) of disuccinimidyl carbonate. After three hours, 0.8 05 g (4 mmol) of 68 11-aminoundecanoic acid is added. It is stirred overnight at room temperature, the batch is evaporated to the dry state, and the residue is absorptively precipitated with diethyl ether. The solid is suctioned off and chromatographed on RP-material for purification.

Yield: 0.37 g (71% of theory) Analysis (relative to solventless substance): Cld: C 62.04 H 8.10 N 5.36 S 6.13 0 18.37 Fnd: C 61.88 H 8.23 N 5.17 S 6.02 b) 7-[5-N-(1,3,4-Trihydroxybut-2-yl)-aminocarbonyl-3,3- dimethyl-1-(4-sulfonatobutyl)indolin-2-ylidene]-3,5-(2- carboxypropane-l,3-diyl)-1,3,5-heptatrien-l-yl]-3,3- dimethyl-5-N-(1,3,4-trihydroxybut-2-yl)- aminocarbonyl- / (3H)indolio]butanesulfonate, sodium salt A solution of 0.35 g (0.67 mmol) of 5-N-(11-aminoundecyl)aminocarbonyl-1-(4-sulfobutyl)-2,3,3-trimethyl(3H)indolenine (Example 48a) and 0.18 g (0.645 mmol) of glutaconaldehyde dianil in 3 ml of acetic acid anhydride is stirred for 20- minutes at 110°C. Then, 344 mg (0.83 mmol) of 5-N-(2,3-dihydroxypropyl)-aminocarbonyl-1-(4-sulfobutyl)-2,3,3-trimethyl(3H)indolenine (Example 44a), 0.2 g of sodium acetate, 3 ml of acetic acid anhydride and 1 ml of acetic acid are added.. The reaction mixture is allowed to stir for two hours at 110°C, cooled to room temperature, and the product is precipitated with 69 diethyl ether. The crude product is chromatographed on RP-material.

Yield: 0.41 g (60% of theory) Analysis (relative to solventless substance): Cld: C 60.10 H 7.02 N 5.50 S 6.29 0 18.84 Na 2.26 Fnd: C 59.96 H 7.14 N 5.33 S 6.15 Na 2.11 Analogously to the synthesis according to Examples 14-16 and 18-27a (solid-phase peptide synthesis), the VIP-analog HSDAVFTDNY TRLRKQMWVK KYLNSILN is synthesized in the solid phase. The dye 7- [5-N-(1,3,4-trihydroxybut-2-yl)-aminocarbonyl-3,3-dimethyl-1- (4-sulfonatobutyl)indolin-2-ylidene]-3,5-(2-carboxypropane-l,3- diyl)-1,3,5-heptatrien-l-yl]-3,3-dimethyl-5-N-(1,3,4- trihydroxybut-2-yl)-aminocarbonyl(3H)indolio]butanesulfonate, / sodium salt, is coupled to the peptide in the N-terminal position according to Examples 14-16 and 18-27b, and this conjugate is isolated and purified according to Examples 14-16 and 18-27c (protective group cleavage and detachment of the dye-peptide conjugates).

Other dyes according to the invention can be produced according to Examples 44a and b, in which instead of 11-aminoundecanoic acid in Example 4 8a, the following amino acids are used, and the indolenine derivatives that are mentioned- in Example 46 are used with hydroxyalkyl substituents a)-f): i. Glycine ii. Alanine 70 ill. iv. v. vi. vii. viii. ix. fi-Alanine 4-Aminobutanoic acid 6-Aminohexanoic acid HjN-(CH2CH20)3CH2C00H (TH 53, 20, 6977) H2N- (CH2CHzO)4CH2COOH (JOC 63, 5, 1728, 1998) HjN-CH-jCH-jCOO (CH2CH20)4-C0-CH2CH2C00H (Lett. Pept Sci. 6, 135, 1999) HC1* H-jN-PEG-COOH (MW 3400 g/mol; Shearwater Polymers Inc., USA Example 49 4-[2-[4-(4-(N-(4-Aza-6-bromo-5-oxohexyl)aminocarbonyl- ; ethyl)phenyloxy)-7-[5-N-(dihydroxypropyl)aminocarbonyl-3,3- dimethyl-l-(4-sulfonatobutyl)indolin-2-ylidene]-3,5-(propane-1,3 diyl)-1,3,5-heptatrien-l-yl]-5-N-(dihydroxypropyl)aminocarbonyl- / 3,3-dimethyl(3H)indolio]butanesulfonate, sodium salt a) [3-[N-(tert-Butoxycarbonyl)amino] propyl]-N'-(bromoacetyl)- amide 2.5 g (14.4 mmol) of [3-[N-(tert-butoxycarbonyl)amino]-propyl]amine is dissolved in 15 ml of dioxane, and after 4.4 ml of triethylamine is added at 0°C, it is mixed with 3.2 g (16 mmol) of bromoacetyl bromide. It is stirred overnight at room temperature, and then another 32 0 mg of bromoacetyl bromide is added. After two hours at room temperature, the precipitate is suctioned off, the solution is concentrated by evaporation, and 71 the residue is taken up in ethyl acetate. It is washed with water, and the organic phase is dried on sodium sulfate.

Yield: 3.2 g (75% of theory) Analysis (relative to solventless substance): Cld: C 40.69 H 6.49 Br 27.07 N 9.49 0 16.26 Fnd: C 40.50 H 6.37 Br 26.89 N 9.58 b) (3-[N-(Bromoacetyl)amino]propyl]amine, hydrochloride 3.1 g (10.5 mmol) of [3-[N-(tert-butoxycarbonyl)amino]propyl]-N'-(bromoacetyl)-amide (Example 49a) is stirred with 50 mmol of 1M hydrochloric acid in ethyl acetate for five hours at room temperature. The product is suctioned off, and the solid is rewashed with ethyl acetate.

Yield: 2.3 g (95% of theory) / t Analysis (relative to solventless substance): Cld: C 25.94 H 5.22 Cl 15.31 Br 34.51 N 12.10 0 6.91 Fnd: C 25.76 H 5.41 Cl 15.55 Br 34.34 N 11.97 c) 4-[2-[4-(4-(N-(4-Aza-6-bromo-5-oxo-hexyl)aminocarbonyl- ethyl)phenyloxy) -7-[5-N-(dihydroxypropyl)amino-carbonyl-3,3 -dimethyl-1-(4-sulfonatobutyl)indolin-2-ylidene]-3,5-(propane-1,3-diyl)-1,3,5-heptatrien-l-yl]-5-N-(dihydroxypropyl)aminocarbonyl-3,3 -dimethyl(3H)indolio]butanesulfonate, sodium salt 121 mg (0.1 mmol) of 4- [2- [4-(4-(2-carboxyethyl)phenyloxy)-7- [5-N-(dihydroxypropyl)aminocarbonyl-3,3-dimethyl-1-(4-sulfonatobutyl)indolin-2-ylidene]-3,5-(propane-1,3-diyl)-1,3,5-heptatrien-l-yl] -5-N-(dihydroxypropyl)-aminocarbonyl-3,3-dimethyl(3H)indolio]butanesulfonate, sodium salt, N-hydroxysuccinimide ester (Example 44c) are dissolved in 0.5 ml of N,N-dimethylformamide, and mixed with 0.06 ml of triethylamine and 70 mg (0.3 mmol) of [3-[N-(bromoacetyl)amino]propyl]amine, hydrochloride (Example 4 9b).

/ It is stirred for four hours at 60°C, then cooled to room temperature, and the product is precipitated with diethyl ether. The solid is suctioned off and washed with ample diethyl ether. Yield: 0.11 mg (80% of theory) Analysis -(relative to solventless substance): Cld: C 56.17 H 6.18 Br 6.13 N 6.44 S 4.92 Na 1.76.0 18.40" Fnd: C 55.96 H 6.26 Br 6.01 N 6.27 S 4.81 Na 1.53 Analogously to the synthesis according to Examples 14-16 and 18-27a (solid-phase peptide synthesis), the VIP-analog HSDAVFTDNY TRLRKQCAVK KYLNSLLN is synthesized in the solid phase. The dye 73 bromide 4-[2-[4-(4-(N-(4-aza-6-bromo-5-oxo-hexyl)aminocarbonylethyl)phenyloxy)-7-[5-N-(dihydroxypropyl)aminocarbonyl-3,3-dimethyl-1-(4-sulfonatobutyl)indolin-2-ylidene]-3,5-(propane-1,3-diyl)-1,3, 5-heptatrien-l-yl] -5-N-(dihydroxypropyl)amino-carbonyl-3,3-dimethyl(3H)indolio]butanesulfonate, sodium salt, is coupled to the peptide in the N-terminal position according to Example 17, and this conjugate is isolated and purified according to Examples 14-16 and 18-27c (protective group cleavage and detachment of the dye-peptide conjugates). 74

Claims (23)

Claims

1. Peptide-polymethine-dye conjugates of general formula (I) A1 - (X),, - A2 I in which X stands for an a-, £- or y-amino acid with D- or L- configuration, and m stands for a number from 5 to 30, whereby the resulting amino acid sequence (X)m can be cyclized in a straight-chain nature or via a disulfide bridge between two cysteines or homocysteines or amidically between the N- and C-terminus, and (X)m stands for the amino acid sequence of the somatostatin, or for fragments, partial sequences, derivatives or analogs of the somatostatin, A1 stands for a hydrogen atom, an acetyl radical or an alkyl radical with up to 10 C-atoms, which optionally can -be substituted with 1 to 3 carboxy groups and/or 1 to 6 hydroxy groups, or a poly(oxyethylene) radical with 2 to 3 0 -CH2CH20 units, or a dye molecule from the class of the polymethine dyes, which has at least one absorption maximum in the range of 380 to 1200 nm, A2 stands for a hydroxy group, an amino group or a dye molecule from the class of polymethine dyes, which has IPONZ 10 mar 2004 75 at least one absorption maximum in the range of 380 to 1200 nm, under the condition that at least one of radicals A1 or A2 represents a dye molecule from the class of polymethine dyes, which has at least one absorption maximum in the range of 38 0 to 12 00 nm, whereby for the case that A1 and/or A2 represents a dye molecule from the class of polymethine dyes, which has at least one absorption maximum in the range of 3 80 to 1200 nm, A1 is linked to the N-terminal amino group, and A2 is linked to an amino group of the amino acid -lysine or to a hydroxy group of the amino acid serine in any position within the amino acid sequence (X)m, and their physiologically compatible salts.

2. Compounds according to claim 1, characterized in that / dye molecule A1 and/or A2 stands for a cyanine, squarilium, croconium, merocyanine or oxonol dye.

3. Compounds according to claim 1 or 2, wherein dye molecule A1 and/or A2 stands for a cyanine or squarilium dye of general formulas II in which D stands for a fragment that corresponds to general formulas III to VI, whereby the position that is identified with a star means the linkage with B 76 R3. L fc hi IV V VI B stands for a fragment that corresponds to general formulas VII to XII x. VII R4 VIII IX 'W (CH2)b R1 and R2 stand for E1, R3 stands for a fluorine, chlorine, bromine, iodine atom or a nitro group or for a radical -COOE1, -CONE1E2, -NHCOE1, -NHCONHE1, -NE1E2, -0E1, -OSOjE1, -SO3E1, -SO2NHE1, -E1, whereby E1 and E2, independently of one another, stand for a hydrogen atom, a C^C^, sulfoalkyl chain, a saturated or unsaturated, branched or straight-chain C1 -C50 alkyl chain, whereby the chain or parts of this chain optionally can form one or more aromatic or saturated cyclic C5-C6 units or bicyclic C10 units, and whereby the alkyl chain is interrupted by 0 to 15 77 oxygen atoms and/or by 0 to 3 carbonyl groups and/or is substituted with 0 to 5 hydroxy groups, R4 stands for a hydrogen atom, a fluorine, chlorine, bromine, iodine atom or a branched or straight-chain C^-C^ alkyl chain, b means a number 2 or 3, X and Y, independently of one another, mean 0, S, Se, -CH=CH- or C(CH3)2, L stands for a group that corresponds to the formulas below h h \=/ h ; in which n means a number from 1 to 10.

4. Compounds according to claims 1 to 3, wherein dye molecule A1 and/or A2 stands for an indocarbocyanine dye, an indodicarbocyanine dye or an indotricarbocyanine dye.

5. Compounds according to claim 4, wherein dye molecule A1 and/or A2 stands for an indocarbocyanine dye, an indodicarbocyanine dye or an indotricarbocyanine dye of general formula XIII or XIV 78 ch—ch^-cb P r2 XIII ch=ch)-ch p N—(CH2 h O A R XIV in which p stands for 1, 2 or 3, n stands for a number 1, 2, 3, 4 or 10, R1 and R2, independently of one another, stand for a 4- / sulfobutyl, 3-sulfopropyl, 2-sulfoethyl, 3-methyl-3-sulfopropyl, methyl, ethyl or propyl radical, and R3 stands for hydrogen, a chlorine, bromine, iodine atom or a nitro group or for a radical -COOE1, ; -CONEV, -NHCOE1, -NHCONHE1, -NE1E2, -OE1, -OSOjE1, -S03E1, -SOjNHE1, whereby E1 and E2, independently of one another, stand for a hydrogen atom or for a methyl or ethyl radical or a C3-C6 alkyl radical, which is interrupted by 0 to 2 oxygen atoms and/or by 0 to 1 carbonyl groups and/or is substituted with 0 to 79 5 hydroxy groups, or E1 and E2 stand for a poly(oxyethylene)glycol radical with 2 to 30 -CH2CH20 units.

6. Compounds according to claim 4, wherein dye molecule A1 and/or A2 stands for an indocarbocyanine dye, an indodicarbocyanine dye or an indotricarbocyanine dye of general formula XIII or XIV +^—(cH=CHfcH CH—CH^-CH XIII O N—(CH2JT / H i XIV in which p stands for 1, 2 or 3, n ;.stands for 1, 2 or 4, R1 and R2, independently of one another, stand for a 4 sulfobutyl or 3-sulfopropyl radical, R3 stands for hydrogen or for a radical -COOE1 or -CONHE1, whereby E1 means a hydrogen atom or a methyl or ethyl radical or a C3-C6 alkyl radical, which is 80 interrupted by 0 to 2 oxygen atoms and/or by 0 to 1 carbonyl groups and/or is substituted with 0 to 5 hydroxy groups.

7. Compounds according to claim 4, wherein dye molecule A1 and/or A2 stands for an indotricarbocyanine dye of general formula XV or XVI: XV O w R- -N' k n I ^ \A (,CH2)n XVI 81 in which n stands for 2 or 3, R1 and R2, independently of one another, represent a 4- sulfobutyl, 3-sulfopropyl or 2-sulfoethyl radical, R3 stands for a radical -CONH-peptide, -CONH- (CHZ)m-CONH peptide, -CONH-(CH2)n-NH-CS-NH-peptide or -CONH-(CH2)n-NHCO-CH2-peptide with m = 1 to 10 and n = 2 or 3, or R3 represents a group below: R4 and R5, independently of one another, stand for a hydrogen atom, a methyl radical or a hydroxylated - (CH2) - CONH-peptide with m = 0 to 2, - (CH2) m-NH-CS-NH-peptide with m = 0 to 2, and X stands for an oxygen atom or a sulfur atom.

8. Compounds according to claim 4, wherein dye molecule A1 and/or A2 stands for an indotricarbocyanine dye of general O H H alkyl radical, R6 stands for one of the following groups: 82 XVII : R" ,3 R R O N-R \ n ,4 XVIII in which R1 and R2, independently of one another, stand for a 4 sulfobutyl radical, 3-sulfopropyl radical, or 2-sulfoethyl radical, R3 stands for a radical -CONH-peptide, -NH-CS-NH- peptide or -CONH-(CHZ) n-NHCO-CH2-peptide with n = or 3, or R3 represents a group below: Ov U * ~ H S N— peptide and R4 and Rs, independently of one another, stand for a hydrogen atom, a methyl radical or a hydroxylated alkyl radical. 83 S.

Compounds according to claim 7 or 8, wherein the hydroxylated alkyl radicals stand for 2-hydroxyethyl, 3-hydroxypropyl, 2, 3-dihydroxypropyl, 1,3-dihydroxy-2-propyl, 2, 3, 4-trihydroxybutyl, 1, 3,4-trihydroxy-2-but.yl, 2,3,4,5,6-pentahydroxyhexyl.

10. Compounds according to claim 1, wherein (X)m stands for the amino acid sequence of the somatostatin that corresponds to / AG^KNFFWKTFTSy or for fragments, partial sequences, derivatives or analogs the somatostatin that consists of 5 to 20 amino acids. of 84

11. Compounds according to at least one of the preceding claims, wherein 2 to m amino acids, independently of one another, can be exchanged for their respective D-amino acid or for other L- or D-amino acids, whereby m has the above-indicated meaning.

12. Compounds according to at least one of the preceding claims, wherein at least one of amino acids (X)m, independently of one another, can be exchanged for other amino acids or amino acid derivatives that are not natural.

13. Compounds according to claim 12, wherein as amino acids or amino acid derivatives that are not natural, one of the following compounds is selected: naphthalanine, cyclohexylalanine, norleucine, norvaline, or-aminoadipic acid, a- aminobutyric acid, E-alanine, S-cyclohexylalanine, ornithine, / sarcosine or 6-hydroxylysine. 85

14. Compounds according to at least one of the preceding claims, wherein all amino acids (X)m are exchanged for their respective D-amino acid.

15. Compounds according to claim 10, wherein the following amino acid sequences are selected as fragments, partial sequences, derivatives or analogs of the somatostatin: " AG^KNFFwKTFTS^ AG^KNFFwKTFTScp (^KNFFwKTFTS^ fFYwKVFT fCFwKVtpT fCYwKVCT 1 I fCFwKTCT I I fCYwKTCT I I d-Nal-CYwKVC 1 I AG9KNFFWKTFTS9 AG9KNFFWKTFTS9 9KNFFWKTFTS9 fcFwKVCT I l fcYwKVCT fcFwKTCT fcYwKTCT D-Nal-cYwKVC fCywK-Abu-C-Nal fcywK-Abu-C-Nal ( 86

16. Use of the compounds according to at least one of the preceding claims for in-vivo diagnosis of tumors, other diseased tissue areas or adenomas using optical detection processes, or for in-vivo fluorescence diagnosis of tumors, tumor cells and/or / inflammatory tissues using endoscopic processes in the gastrointestinal tract, esophagus, bronchial tract, bladder or cervix, or for in-vivo fluorescence diagnosis and/or absorption diagnosis of breast tumors using optical mammography (transillumination or optical tomography of the breast) .

17. Process for endoscopic in-vivo fluorescence diagnosis with use of the compounds according to claim 1, wherein the compounds are administered to the patients intravenously or topically by atomization in the gastrointestinal tract, esophagus, bladder or are fed to the bronchial tubes by inhalation, 87 in the case of atomization, the unbonded, excess portion of the compound is removed by washing, the endoscopic study is performed by local excitation with an excitation wavelength that is selected from the spectral range of 380 to 1200 nm and by position-dependent detection, of the specific fluorescence radiation that is emitted by dye.

18- Optical diagnostic agent for in-vivo diagnosis of diseased tissue areas, wherein it contains at least one compound according to claim l together with the common adjuvants and/or vehicles as well as diluents.

19. A compound according to claim 1 for tumor diagnosis.

20. A compound according to claim 1 substantially as herein described or exemplified.

21. A use according to claim 16 substantially as herein described or exemplified.

22. A process according to claim 17 substantially as herein described or exemplified.

23. An optical diagnostic agent according to claim 18 substantially as herein described or exemplified. i\'IELLECTUAL PROPERTY OFFICE OF N.Z. -3 OCT 2033 RECEIVE# INSTITUT FUR DIAGNOSTIKFORSCHUNG GMBH AN DER FREIEN UNIVERSITAT BERLIN By Their Attorneys HENRY HUQHE^ Per: