NO342822B1 - Vaccine inducing an immune response to copepods and / or a mucus shield in fish comprising peptide combinations, and the use of the peptides to produce a vaccine. - Google Patents
Vaccine inducing an immune response to copepods and / or a mucus shield in fish comprising peptide combinations, and the use of the peptides to produce a vaccine. Download PDFInfo
- Publication number
- NO342822B1 NO342822B1 NO20141508A NO20141508A NO342822B1 NO 342822 B1 NO342822 B1 NO 342822B1 NO 20141508 A NO20141508 A NO 20141508A NO 20141508 A NO20141508 A NO 20141508A NO 342822 B1 NO342822 B1 NO 342822B1
- Authority
- NO
- Norway
- Prior art keywords
- caligus
- seq
- vaccine
- fish
- peptides
- Prior art date
Links
- 229960005486 vaccine Drugs 0.000 title claims abstract description 129
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 85
- 241000251468 Actinopterygii Species 0.000 title claims abstract description 84
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 55
- 241000239250 Copepoda Species 0.000 title claims abstract description 23
- 230000028993 immune response Effects 0.000 title claims abstract description 14
- 210000003097 mucus Anatomy 0.000 title claims description 33
- 230000001939 inductive effect Effects 0.000 title 1
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 38
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 38
- 230000000890 antigenic effect Effects 0.000 claims abstract description 8
- 235000019688 fish Nutrition 0.000 claims description 85
- 239000000203 mixture Substances 0.000 claims description 26
- 239000002671 adjuvant Substances 0.000 claims description 18
- 108060003552 hemocyanin Proteins 0.000 claims description 17
- 241000542855 Megathura crenulata Species 0.000 claims description 16
- 239000002480 mineral oil Substances 0.000 claims description 15
- 235000010446 mineral oil Nutrition 0.000 claims description 15
- 239000000839 emulsion Substances 0.000 claims description 14
- 241000277263 Salmo Species 0.000 claims description 12
- 241000277275 Oncorhynchus mykiss Species 0.000 claims description 10
- 241000277338 Oncorhynchus kisutch Species 0.000 claims description 8
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 7
- 241001280377 Oncorhynchus tshawytscha Species 0.000 claims description 6
- 241000277288 Salmo trutta Species 0.000 claims description 6
- 238000011161 development Methods 0.000 claims description 6
- 238000004519 manufacturing process Methods 0.000 claims description 6
- 241001247232 Caligidae Species 0.000 claims description 5
- 241000277289 Salmo salar Species 0.000 claims description 4
- 238000002360 preparation method Methods 0.000 claims description 4
- 230000015572 biosynthetic process Effects 0.000 abstract description 7
- 241001611011 Caligus Species 0.000 description 192
- 235000018102 proteins Nutrition 0.000 description 34
- 244000045947 parasite Species 0.000 description 21
- 239000003921 oil Substances 0.000 description 20
- 238000002255 vaccination Methods 0.000 description 20
- 241001611004 Caligus rogercresseyi Species 0.000 description 19
- 230000003053 immunization Effects 0.000 description 19
- 238000002649 immunization Methods 0.000 description 19
- 210000004027 cell Anatomy 0.000 description 17
- 241001247234 Lepeophtheirus salmonis Species 0.000 description 16
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 16
- 206010061217 Infestation Diseases 0.000 description 15
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 13
- 230000009467 reduction Effects 0.000 description 13
- 210000002966 serum Anatomy 0.000 description 13
- 238000004458 analytical method Methods 0.000 description 12
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 12
- 235000018417 cysteine Nutrition 0.000 description 12
- 230000003248 secreting effect Effects 0.000 description 12
- 238000000034 method Methods 0.000 description 10
- 241001465754 Metazoa Species 0.000 description 9
- 241000972773 Aulopiformes Species 0.000 description 8
- 241000237858 Gastropoda Species 0.000 description 8
- 241000277331 Salmonidae Species 0.000 description 8
- 101710161198 Vitellogenin-1 Proteins 0.000 description 8
- 150000001413 amino acids Chemical group 0.000 description 7
- 208000015181 infectious disease Diseases 0.000 description 7
- 230000000366 juvenile effect Effects 0.000 description 7
- 235000019515 salmon Nutrition 0.000 description 7
- 230000000694 effects Effects 0.000 description 6
- 239000000499 gel Substances 0.000 description 6
- 238000011282 treatment Methods 0.000 description 6
- 241000239267 Arguloida Species 0.000 description 5
- 241000237988 Patellidae Species 0.000 description 5
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 5
- 108010090932 Vitellogenins Proteins 0.000 description 5
- 238000003776 cleavage reaction Methods 0.000 description 5
- 230000018109 developmental process Effects 0.000 description 5
- 229920002401 polyacrylamide Polymers 0.000 description 5
- 230000007017 scission Effects 0.000 description 5
- 238000002965 ELISA Methods 0.000 description 4
- 101710161186 Vitellogenin-2 Proteins 0.000 description 4
- 239000000427 antigen Substances 0.000 description 4
- 108091007433 antigens Proteins 0.000 description 4
- 102000036639 antigens Human genes 0.000 description 4
- BLFLLBZGZJTVJG-UHFFFAOYSA-N benzocaine Chemical compound CCOC(=O)C1=CC=C(N)C=C1 BLFLLBZGZJTVJG-UHFFFAOYSA-N 0.000 description 4
- 230000002596 correlated effect Effects 0.000 description 4
- 210000002615 epidermis Anatomy 0.000 description 4
- 230000002163 immunogen Effects 0.000 description 4
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 4
- 230000003071 parasitic effect Effects 0.000 description 4
- 239000013535 sea water Substances 0.000 description 4
- 239000007790 solid phase Substances 0.000 description 4
- 239000000725 suspension Substances 0.000 description 4
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 3
- 241001247233 Lepeophtheirus Species 0.000 description 3
- 241000607479 Yersinia pestis Species 0.000 description 3
- 230000004913 activation Effects 0.000 description 3
- 235000001014 amino acid Nutrition 0.000 description 3
- 239000011324 bead Substances 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 230000021615 conjugation Effects 0.000 description 3
- 238000001962 electrophoresis Methods 0.000 description 3
- 210000000981 epithelium Anatomy 0.000 description 3
- 230000001524 infective effect Effects 0.000 description 3
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 3
- 210000003491 skin Anatomy 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- 102000014914 Carrier Proteins Human genes 0.000 description 2
- 108010078791 Carrier Proteins Proteins 0.000 description 2
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 2
- AEMRFAOFKBGASW-UHFFFAOYSA-N Glycolic acid Chemical compound OCC(O)=O AEMRFAOFKBGASW-UHFFFAOYSA-N 0.000 description 2
- 206010022095 Injection Site reaction Diseases 0.000 description 2
- 241000873862 Paracyclopina nana Species 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 241000238680 Rhipicephalus microplus Species 0.000 description 2
- 230000003187 abdominal effect Effects 0.000 description 2
- 238000005273 aeration Methods 0.000 description 2
- 230000005875 antibody response Effects 0.000 description 2
- 230000036528 appetite Effects 0.000 description 2
- 235000019789 appetite Nutrition 0.000 description 2
- 238000009360 aquaculture Methods 0.000 description 2
- 244000144974 aquaculture Species 0.000 description 2
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 2
- 229960005274 benzocaine Drugs 0.000 description 2
- 230000003115 biocidal effect Effects 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 239000012141 concentrate Substances 0.000 description 2
- 238000003795 desorption Methods 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 244000078703 ectoparasite Species 0.000 description 2
- 230000007613 environmental effect Effects 0.000 description 2
- 230000000091 immunopotentiator Effects 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 230000002757 inflammatory effect Effects 0.000 description 2
- 208000028454 lice infestation Diseases 0.000 description 2
- 238000004949 mass spectrometry Methods 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 2
- 239000001301 oxygen Substances 0.000 description 2
- 229910052760 oxygen Inorganic materials 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 238000005070 sampling Methods 0.000 description 2
- 108010004034 stable plasma protein solution Proteins 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 230000000451 tissue damage Effects 0.000 description 2
- 231100000827 tissue damage Toxicity 0.000 description 2
- 239000012646 vaccine adjuvant Substances 0.000 description 2
- 229940124931 vaccine adjuvant Drugs 0.000 description 2
- LLXVXPPXELIDGQ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(2,5-dioxopyrrol-1-yl)benzoate Chemical compound C=1C=CC(N2C(C=CC2=O)=O)=CC=1C(=O)ON1C(=O)CCC1=O LLXVXPPXELIDGQ-UHFFFAOYSA-N 0.000 description 1
- ZTOJFFHGPLIVKC-YAFCTCPESA-N (2e)-3-ethyl-2-[(z)-(3-ethyl-6-sulfo-1,3-benzothiazol-2-ylidene)hydrazinylidene]-1,3-benzothiazole-6-sulfonic acid Chemical compound S\1C2=CC(S(O)(=O)=O)=CC=C2N(CC)C/1=N/N=C1/SC2=CC(S(O)(=O)=O)=CC=C2N1CC ZTOJFFHGPLIVKC-YAFCTCPESA-N 0.000 description 1
- VZQHRKZCAZCACO-PYJNHQTQSA-N (2s)-2-[[(2s)-2-[2-[[(2s)-2-[[(2s)-2-amino-5-(diaminomethylideneamino)pentanoyl]amino]propanoyl]amino]prop-2-enoylamino]-3-methylbutanoyl]amino]propanoic acid Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C(C)C)NC(=O)C(=C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCNC(N)=N VZQHRKZCAZCACO-PYJNHQTQSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- 150000003923 2,5-pyrrolediones Chemical class 0.000 description 1
- 241000238876 Acari Species 0.000 description 1
- ATRRKUHOCOJYRX-UHFFFAOYSA-N Ammonium bicarbonate Chemical compound [NH4+].OC([O-])=O ATRRKUHOCOJYRX-UHFFFAOYSA-N 0.000 description 1
- 241000704622 Antennatus Species 0.000 description 1
- 241000402794 Argulus foliaceus Species 0.000 description 1
- 231100000699 Bacterial toxin Toxicity 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- OBMZMSLWNNWEJA-XNCRXQDQSA-N C1=CC=2C(C[C@@H]3NC(=O)[C@@H](NC(=O)[C@H](NC(=O)N(CC#CCN(CCCC[C@H](NC(=O)[C@@H](CC4=CC=CC=C4)NC3=O)C(=O)N)CC=C)NC(=O)[C@@H](N)C)CC3=CNC4=C3C=CC=C4)C)=CNC=2C=C1 Chemical compound C1=CC=2C(C[C@@H]3NC(=O)[C@@H](NC(=O)[C@H](NC(=O)N(CC#CCN(CCCC[C@H](NC(=O)[C@@H](CC4=CC=CC=C4)NC3=O)C(=O)N)CC=C)NC(=O)[C@@H](N)C)CC3=CNC4=C3C=CC=C4)C)=CNC=2C=C1 OBMZMSLWNNWEJA-XNCRXQDQSA-N 0.000 description 1
- 241000571350 Caligus aesopus Species 0.000 description 1
- 241001235711 Caligus centrodonti Species 0.000 description 1
- 241000420702 Caligus cheilodactyli Species 0.000 description 1
- 241000571348 Caligus chorinemi Species 0.000 description 1
- 241000712786 Caligus clemensi Species 0.000 description 1
- 241000571346 Caligus confusus Species 0.000 description 1
- 241001235719 Caligus curtus Species 0.000 description 1
- 241001382015 Caligus diaphanus Species 0.000 description 1
- 241001405819 Caligus elongatus Species 0.000 description 1
- 241000109841 Caligus fugu Species 0.000 description 1
- 241001235713 Caligus gurnardi Species 0.000 description 1
- 241000571427 Caligus hoplognathi Species 0.000 description 1
- 241001325422 Caligus longirostris Species 0.000 description 1
- 241000571430 Caligus mutabilis Species 0.000 description 1
- 241001155277 Caligus punctatus Species 0.000 description 1
- 241001382014 Caligus quadratus Species 0.000 description 1
- 241000571422 Caligus robustus Species 0.000 description 1
- 241000571424 Caligus sclerotinosus Species 0.000 description 1
- 241000571399 Caligus serratus Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 108010039939 Cell Wall Skeleton Proteins 0.000 description 1
- 241001436044 Chelifer Species 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 102000009016 Cholera Toxin Human genes 0.000 description 1
- 108010049048 Cholera Toxin Proteins 0.000 description 1
- 241000522241 Cordyla <angiosperm> Species 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 101710146739 Enterotoxin Proteins 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 108010040721 Flagellin Proteins 0.000 description 1
- 229920001503 Glucan Polymers 0.000 description 1
- 229920002683 Glycosaminoglycan Polymers 0.000 description 1
- 208000032843 Hemorrhage Diseases 0.000 description 1
- 238000012313 Kruskal-Wallis test Methods 0.000 description 1
- 241001235686 Lepeophtheirus pectoralis Species 0.000 description 1
- 241001382017 Lepeophtheirus thompsoni Species 0.000 description 1
- 241001401881 Longicaudus Species 0.000 description 1
- 241000781273 Longipedis Species 0.000 description 1
- 206010062049 Lymphocytic infiltration Diseases 0.000 description 1
- 241000972747 Macrourus Species 0.000 description 1
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 1
- 241000237852 Mollusca Species 0.000 description 1
- 208000029549 Muscle injury Diseases 0.000 description 1
- 241000186359 Mycobacterium Species 0.000 description 1
- -1 N-protected amino Chemical group 0.000 description 1
- 241000737052 Naso hexacanthus Species 0.000 description 1
- 241000123077 Ocyurus Species 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 208000030852 Parasitic disease Diseases 0.000 description 1
- 101710176384 Peptide 1 Proteins 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 241000882917 Pomacentrus Species 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 241001098657 Pterois Species 0.000 description 1
- 241000353093 Raniceps Species 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 241000306752 Salmoneus Species 0.000 description 1
- 241001194796 Schistonyx Species 0.000 description 1
- 241001290310 Sciaenops Species 0.000 description 1
- 241001187507 Sicarius Species 0.000 description 1
- 108010008038 Synthetic Vaccines Proteins 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 241000045687 Tigriopus japonicus Species 0.000 description 1
- 241000607598 Vibrio Species 0.000 description 1
- YVNQAIFQFWTPLQ-UHFFFAOYSA-O [4-[[4-(4-ethoxyanilino)phenyl]-[4-[ethyl-[(3-sulfophenyl)methyl]amino]-2-methylphenyl]methylidene]-3-methylcyclohexa-2,5-dien-1-ylidene]-ethyl-[(3-sulfophenyl)methyl]azanium Chemical compound C1=CC(OCC)=CC=C1NC1=CC=C(C(=C2C(=CC(C=C2)=[N+](CC)CC=2C=C(C=CC=2)S(O)(=O)=O)C)C=2C(=CC(=CC=2)N(CC)CC=2C=C(C=CC=2)S(O)(=O)=O)C)C=C1 YVNQAIFQFWTPLQ-UHFFFAOYSA-O 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- ZTOJFFHGPLIVKC-CLFAGFIQSA-N abts Chemical compound S/1C2=CC(S(O)(=O)=O)=CC=C2N(CC)C\1=N\N=C1/SC2=CC(S(O)(=O)=O)=CC=C2N1CC ZTOJFFHGPLIVKC-CLFAGFIQSA-N 0.000 description 1
- ZCHPKWUIAASXPV-UHFFFAOYSA-N acetic acid;methanol Chemical compound OC.CC(O)=O ZCHPKWUIAASXPV-UHFFFAOYSA-N 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- 230000029936 alkylation Effects 0.000 description 1
- 238000005804 alkylation reaction Methods 0.000 description 1
- 239000001099 ammonium carbonate Substances 0.000 description 1
- 235000012501 ammonium carbonate Nutrition 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 239000000688 bacterial toxin Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 230000005587 bubbling Effects 0.000 description 1
- FVMOEFABYNPCDS-UHFFFAOYSA-L calcium;1-(4-carboxy-2,6-dioxocyclohexylidene)propan-1-olate Chemical compound [Ca+2].CCC([O-])=C1C(=O)CC(C(O)=O)CC1=O.CCC([O-])=C1C(=O)CC(C(O)=O)CC1=O FVMOEFABYNPCDS-UHFFFAOYSA-L 0.000 description 1
- 210000004520 cell wall skeleton Anatomy 0.000 description 1
- 239000000919 ceramic Substances 0.000 description 1
- 230000000875 corresponding effect Effects 0.000 description 1
- 238000000326 densiometry Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 1
- MCPKSFINULVDNX-UHFFFAOYSA-N drometrizole Chemical compound CC1=CC=C(O)C(N2N=C3C=CC=CC3=N2)=C1 MCPKSFINULVDNX-UHFFFAOYSA-N 0.000 description 1
- 239000000147 enterotoxin Substances 0.000 description 1
- 231100000655 enterotoxin Toxicity 0.000 description 1
- 230000003628 erosive effect Effects 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 238000009313 farming Methods 0.000 description 1
- 239000013505 freshwater Substances 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 230000014509 gene expression Effects 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 210000002175 goblet cell Anatomy 0.000 description 1
- 230000012447 hatching Effects 0.000 description 1
- 230000013632 homeostatic process Effects 0.000 description 1
- 230000028996 humoral immune response Effects 0.000 description 1
- 206010020718 hyperplasia Diseases 0.000 description 1
- DOUYETYNHWVLEO-UHFFFAOYSA-N imiquimod Chemical compound C1=CC=CC2=C3N(CC(C)C)C=NC3=C(N)N=C21 DOUYETYNHWVLEO-UHFFFAOYSA-N 0.000 description 1
- 229960002751 imiquimod Drugs 0.000 description 1
- 230000036737 immune function Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 239000002955 immunomodulating agent Substances 0.000 description 1
- 229940121354 immunomodulator Drugs 0.000 description 1
- 230000001759 immunoprophylactic effect Effects 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 230000015788 innate immune response Effects 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 230000016507 interphase Effects 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- PGLTVOMIXTUURA-UHFFFAOYSA-N iodoacetamide Chemical compound NC(=O)CI PGLTVOMIXTUURA-UHFFFAOYSA-N 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 230000001418 larval effect Effects 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- GZQKNULLWNGMCW-PWQABINMSA-N lipid A (E. coli) Chemical class O1[C@H](CO)[C@@H](OP(O)(O)=O)[C@H](OC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)[C@@H](NC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)[C@@H]1OC[C@@H]1[C@@H](O)[C@H](OC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](NC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](OP(O)(O)=O)O1 GZQKNULLWNGMCW-PWQABINMSA-N 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229940046166 oligodeoxynucleotide Drugs 0.000 description 1
- 230000000426 osmoregulatory effect Effects 0.000 description 1
- 230000036281 parasite infection Effects 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 229940023041 peptide vaccine Drugs 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 239000001397 quillaja saponaria molina bark Substances 0.000 description 1
- 229940124551 recombinant vaccine Drugs 0.000 description 1
- 230000003252 repetitive effect Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 229930182490 saponin Natural products 0.000 description 1
- 150000007949 saponins Chemical class 0.000 description 1
- 238000007790 scraping Methods 0.000 description 1
- 210000002955 secretory cell Anatomy 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 230000003068 static effect Effects 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 230000008719 thickening Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000027 toxicology Toxicity 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 230000007306 turnover Effects 0.000 description 1
- 239000000277 virosome Substances 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/10—Peptides having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1767—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0003—Invertebrate antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
- A61P33/14—Ectoparasiticides, e.g. scabicides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
- C12P21/06—Preparation of peptides or proteins produced by the hydrolysis of a peptide bond, e.g. hydrolysate products
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/55—Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
- A61K2039/552—Veterinary vaccine
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Tropical Medicine & Parasitology (AREA)
- Genetics & Genomics (AREA)
- Gastroenterology & Hepatology (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Biophysics (AREA)
- General Chemical & Material Sciences (AREA)
- Microbiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Toxicology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Mycology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
Isolerte peptider omfattende sekvensene SEQ ID NO. 17, SEQ ID NO. 18, SEQ ID NO. 19, SEQ ID NO. 20, SEQ ID NO. 21, SEQ ID NO. 22, SEQ ID NO. 23, SEQ ID NO. 24, SEQ ID NO. 25, SEQ ID NO. 26, SEQ ID NO. 27 eller SEQ ID NO. 28, hvori ett eller flere peptider induserer en immunrespons mot kopepoder og/eller dannelsen av en slimskjoldbeskyttelse hos fisk. Peptidet kan være konjugert til et antigent protein; for eksempel kan det være kovalent konjugert til KLH. I tillegg er det tilveiebrakt vaksiner omfattende peptidene alene eller kombinert.Isolated peptides comprising the sequences SEQ ID NO. 17, SEQ ID NO. 18, SEQ ID NO. 19, SEQ ID NO. 20, SEQ ID NO. 21, SEQ ID NO. 22, SEQ ID NO. 23, SEQ ID NO. 24, SEQ ID NO. 25, SEQ ID NO. 26, SEQ ID NO. 27 or SEQ ID NO. 28, wherein one or more peptides induce an immune response against copepods and / or the formation of a mucosal shield in fish. The peptide may be conjugated to an antigenic protein; for example, it may be covalently conjugated to KLH. In addition, vaccines comprising the peptides alone or in combination have been provided.
Description
BAKGRUNN FOR OPPFINNELSEN BACKGROUND OF THE INVENTION
Kopepoder i Caligidae-familien, vanligvis kjent som fiskelus, er de mest omfattende rapporterte ektoparasittene hos arter av vill- og oppdrettslaks. Copepods of the Caligidae family, commonly known as fish lice, are the most widely reported ectoparasites of wild and farmed salmon species.
Den dominante arten som angriper lakseoppdrett i Chile, er Caligus rogercresseyi, som er til stede i 99 % av laksefarmer, og infesterer både salmonider og naturlig hjemmehørende fisk og derved skaper høye dødsrater. The dominant species attacking salmon farms in Chile is Caligus rogercresseyi, present in 99% of salmon farms, infesting both salmonids and native fish, thereby causing high mortality rates.
Global vekst i intensivt lakseoppdrett de siste tiårene har gjort kontrollen av fiskelus til et av hovedfokusene i bransjen på grunn av viktige økonomiske tap og miljøpåvirkninger skapt av disse parasittene. Global growth in intensive salmon farming in recent decades has made the control of fish lice one of the main focuses in the industry due to important economic losses and environmental impacts created by these parasites.
Kopepoder livnærer seg av fiskehud, -slim og -blod, og det finnes veldokumentert litteratur vedrørende deres taksonomi, livssyklus og parasitt-vert-relasjon. Copepods feed on fish skin, mucus and blood, and there is well-documented literature regarding their taxonomy, life cycle and parasite-host relationship.
Infestering med fiskelus hos salmonider danner erosjon, tap av epidermis og skjell, blødning i vertsvev og osmoregulatorisk stress som kan forårsake død for de angrepne eksemplarene på grunn av deres manglende evne til å bevare homeostase. Stressforhold øker laksens mottakelighet for infeksjoner på grunn av svakhet forårsaket av fiskelusangrepet. Fish lice infestation in salmonids produces erosion, loss of epidermis and scales, hemorrhage into host tissues, and osmoregulatory stress that may cause death of the infested specimens due to their inability to preserve homeostasis. Stressful conditions increase the salmon's susceptibility to infection due to weakness caused by the fish lice infestation.
Etter som produksjonsnivåene øker i oppdrettsanlegg, fører de store populasjonene av innesperret laks til en økende forekomst av ektoparasitt-skadedyr og assosierte sykdommer, en reduksjon av vekstrate for oppdrettsfisk og lavere kvalitetsstandarder på grunn av muskelskade. Dette fører til tap av økonomisk verdi, høyere produksjonskostnader som er nødvendig for å ha råd til behandlinger for å bekjempe skadedyrene og relaterte sykdommer hos salmonider. Ytterligere problemer er parasittresistens mot terapeutiske kjemikalier og disse produktenes toksisitet for marint liv. As production levels increase in farms, the large populations of captive salmon lead to an increasing incidence of ectoparasitic pests and associated diseases, a reduction in the growth rate of farmed fish and lower quality standards due to muscle damage. This leads to a loss of economic value, higher production costs necessary to afford treatments to control the pests and related diseases of salmonids. Additional problems are parasite resistance to therapeutic chemicals and the toxicity of these products to marine life.
EP 2405003 A1 og WO 2006010265 A1 beskriver rekombinante vaksiner mot infeksjoner hos fisk av kopepoder i Caligidae-familien. EP 2405003 A1 and WO 2006010265 A1 describe recombinant vaccines against infections in copepod fish of the Caligidae family.
EP 2623114 A1 D3 beskriver en vaksinesammensetning for beskyttelse mot ektoparasittinfeskjoner. EP 2623114 A1 D3 describes a vaccine composition for protection against ectoparasite infections.
Vaksiner som bruker vitelogenin 1 som antigen (EP 2405 003 og WO2007/039599), antigener som omfatter proteiner fusjonert til en promiskuøs T-celleepitop (US 2010/00221271) er beskrevet. Det er imidlertid fortsatt et behov for høyeffektive vaksiner som kan fremstilles enklere, for å immunisere fisk som kan infesteres med kopepoder. Videre er det også behov for sammensetninger eller vaksiner som fremmer dannelsen av et slimskjold hos fisk som beskytter mot infesteringer med kopepoder. Vaccines using vitellogenin 1 as antigen (EP 2405 003 and WO2007/039599), antigens comprising proteins fused to a promiscuous T-cell epitope (US 2010/00221271) have been described. However, there is still a need for highly effective vaccines that can be produced more easily, to immunize fish that can be infested with copepods. Furthermore, there is also a need for compositions or vaccines that promote the formation of a mucus shield in fish that protects against copepod infestations.
BESKRIVELSE AV TEGNINGENE DESCRIPTION OF THE DRAWINGS
Figur 1: Figure 1:
Figur 1 viser proteiner ekstrahert fra C. rogercresseyi separert på 8 % natriumdodekylsulfatpolyakrylamid-gel under reduserende betingelser. Felt 1: Figure 1 shows proteins extracted from C. rogercresseyi separated on 8% sodium dodecyl sulfate polyacrylamide gel under reducing conditions. Field 1:
Molekylvektmarkør (Fermentas #SM1811). Felt 2: Løselige proteinkonsentrater fra C. rogercresseyi; Molecular Weight Marker (Fermentas #SM1811). Lane 2: Soluble protein concentrates from C. rogercresseyi;
Figur 2: Figure 2:
Figur 2 viser aminosyresekvensene til SEQ ID NO.1, SEQ ID NO.2, og SEQ ID NO.3 og peptidene brukt til identifikasjon; SEQ ID N°1 Vitellogenin 1 [Lepeophtheirus salmonis], SEQ ID NO.2 Vitellogenin 2 [Lepeophtheirus salmonis], og SEQ ID NO3 Vitellogenin-lignende protein [Lepeophtheirus salmonis]; Figure 2 shows the amino acid sequences of SEQ ID NO.1, SEQ ID NO.2, and SEQ ID NO.3 and the peptides used for identification; SEQ ID N°1 Vitellogenin 1 [Lepeophtheirus salmonis], SEQ ID NO.2 Vitellogenin 2 [Lepeophtheirus salmonis], and SEQ ID NO3 Vitellogenin-like protein [Lepeophtheirus salmonis];
Figur 3: Figure 3:
Figur 3 er en graf som viser effekten til vaksine A ifølge oppfinnelsen uttrykt som prosent reduksjon av antall parasittiske stadier etter provokasjon hos immuniserte ørreter sammenlignet med kontroller i tre provokasjonsstadier: fiksering, utvikling av juvenile Chalimus-stadier (I til IV) og voksne (hanner og hunner). Figure 3 is a graph showing the effect of vaccine A according to the invention expressed as a percentage reduction of the number of parasitic stages after provocation in immunized trout compared to controls in three provocation stages: fixation, development of juvenile Chalimus stages (I to IV) and adults (males and females).
Figur 4: Figure 4:
Figur 4 er en graf som viser det gjennomsnittlige antallet voksne hann- og hunnparasitter funnet per fisk og standardavviket for hver gruppe (vaksine A og kontroller); Figure 4 is a graph showing the average number of adult male and female parasites found per fish and the standard deviation for each group (vaccine A and controls);
Figur 5: Figure 5:
Figur 5 er en graf som viser indusert immunrespons hos fisk vaksinert med vaksine A og kontroller; log serumtitere for spesifikke antistoffer fra 4 vaksinerte grupper (n=5) på ulike tidspunkter etter vaksinasjon er representert. Spesifikke antistofftitere ble bestemt ved hjelp av en Elisa; Figure 5 is a graph showing induced immune response in fish vaccinated with vaccine A and controls; log serum titers for specific antibodies from 4 vaccinated groups (n=5) at different times after vaccination are represented. Specific antibody titers were determined using an Elisa;
Figur 6: Figure 6:
Figur 6 viser aminosyresekvensen til SEQ ID NO.1; Figure 6 shows the amino acid sequence of SEQ ID NO.1;
Figur 7: Figure 7:
Figur 7 er en graf som viser effekten til vaksinene ifølge oppfinnelsen uttrykt som prosent reduksjon av antall parasittiske stadier etter provokasjon hos immuniserte atlanterhavslaks sammenlignet med kontroller, i tre provokasjonsstadier: fiksering, utvikling av juvenile Chalimus-stadier (I til IV) og voksne (hanner og hunner). Figure 7 is a graph showing the effect of the vaccines according to the invention expressed as a percentage reduction of the number of parasitic stages after challenge in immunized Atlantic salmon compared to controls, in three challenge stages: fixation, development of juvenile Chalimus stages (I to IV) and adults (males and females).
Figur 8: Figure 8:
Figur 8 er en graf som viser det gjennomsnittlige antallet voksne hann- og hunnparasitter funnet per fisk og standardavviket for hver gruppe (vaksine 1–7 ifølge oppfinnelsen og kontroller); Figure 8 is a graph showing the average number of adult male and female parasites found per fish and the standard deviation for each group (vaccine 1-7 according to the invention and controls);
Figur 9: Figure 9:
Figur 9 er en graf som viser induksjonskinetikk for spesifikke antistoffer hos atlanterhavslaks vaksinert med de ulike vaksinene ifølge oppfinnelsen og deres kontroller, provosert med infeksiøse stadier av C. rogercresseyi. Figure 9 is a graph showing induction kinetics for specific antibodies in Atlantic salmon vaccinated with the various vaccines according to the invention and their controls, challenged with infective stages of C. rogercresseyi.
Figur 10: Figure 10:
Figur 10 er en graf som viser induksjonskinetikk for spesifikke antistoffer i slim fra atlanterhavslaks vaksinert med de ulike vaksinene ifølge oppfinnelsen og deres kontroller, provosert med infeksiøse stadier av C. rogercresseyi. Figure 10 is a graph showing induction kinetics for specific antibodies in mucus from Atlantic salmon vaccinated with the various vaccines according to the invention and their controls, provoked with infectious stages of C. rogercresseyi.
Figur 11: Figure 11:
Figur 11 er en graf som viser korrelasjon mellom prosentandel av PRI-infestering (%) og serologi er uttrykt som invers log av titeren for spesifikke antistoffer for vaksine 1 og A. Figure 11 is a graph showing correlation between percentage of PRI infestation (%) and serology expressed as the inverse log of the titer of specific antibodies for vaccine 1 and A.
Figur 12: Figure 12:
Figur 12 viser resultatene av en histologisk analyse av epidermis til fisk vaksinert med de ulike vaksinene og deres kontroller utført på tidspunktene 0, 10, 20 og 30 dager etter vaksinering. Hudstrimler farget med PAS-Alcian Blue for å identifisere slimutskillende celler er vist. Figure 12 shows the results of a histological analysis of the epidermis of fish vaccinated with the various vaccines and their controls performed at the times 0, 10, 20 and 30 days after vaccination. Skin strips stained with PAS-Alcian Blue to identify mucus-secreting cells are shown.
Figur 13: Figure 13:
Figur 13 viser en histologisk analyse av epidermis til fisk vaksinert med de ulike vaksinene og deres kontroller utført på dag 40-50-80 og 120 under immunisering og provokasjon (nedenfor). Hudstrimler farget med PAS for å identifisere slimutskillende celler er identifisert. Figure 13 shows a histological analysis of the epidermis of fish vaccinated with the various vaccines and their controls performed on days 40-50-80 and 120 during immunization and challenge (below). Skin strips stained with PAS to identify mucus-secreting cells are identified.
Figur 14: Figure 14:
Figur 14 er en appliseringsskjematidslinje som viser fiskers akklimatisering, immunisering, provokasjon med parasitten og prøvetaking. Figure 14 is an application schedule timeline showing fishermen's acclimatization, immunization, provocation with the parasite and sampling.
KORT BESKRIVELSE AV OPPFINNELSEN BRIEF DESCRIPTION OF THE INVENTION
Foreliggende oppfinnelse angår en vaksine som induserer en immunrespons mot kopepoder og/eller slimskjold hos fisk, omfattende peptidkombinasjonen SEQ ID NO. The present invention relates to a vaccine that induces an immune response against copepods and/or mucous shields in fish, comprising the peptide combination SEQ ID NO.
17, SEQ ID NO.18, SEQ ID NO.19 og SEQ ID NO.20, og eksipienter og adjuvanser. 17, SEQ ID NO.18, SEQ ID NO.19 and SEQ ID NO.20, and excipients and adjuvants.
Peptidet kan være konjugert til et antigent protein, for eksempel kan peptidet være kovalent konjugert til hemocyanin (KLH – keyhole limpet hemocyanin) fra Megathura crenulata, eller andre. The peptide can be conjugated to an antigenic protein, for example the peptide can be covalently conjugated to hemocyanin (KLH – keyhole limpet hemocyanin) from Megathura crenulata, or others.
Adjuvansene kan være enhver kjent adjuvans, for eksempel Megathura crenulata hemocyanin (nøkkelhullsnegl) (H8283-Sigma), et renset saponin, gjær β(1-3) D-glukaner, syntetiske eller naturlige mikrobielle derivater slik som monofosforyllipid A (MPL), virosomer, polylaktidglykolsyre-mikropartikler, Mycobacterium phleicelleveggskjelett, aminoalkylglukosaminidfosfat, syntetiske acetilerte monosakkarider, lipid A-derivater, flagelin, oligodeoksynukleotider som inneholder CpG-motiver, genetisk bakterielle modifiserte toksiner, koleratoksin fra Vibrio colerae, varmelabilt enterotoksin fra Escherichia coli, humane endogene immunmodulatorer, cytokin, kjemokiner, immunpotensiator, dobbelttrådet RNA, små immunpotensiatormolekyler slik som imikimod, resikimod. The adjuvants can be any known adjuvant, for example Megathura crenulata hemocyanin (keyhole snail) (H8283-Sigma), a purified saponin, yeast β(1-3) D-glucans, synthetic or natural microbial derivatives such as monophosphoryl lipid A (MPL), virosomes , polylactide glycolic acid microparticles, Mycobacterium phleic cell wall skeleton, aminoalkylglucosaminide phosphate, synthetic acetylated monosaccharides, lipid A derivatives, flagellin, oligodeoxynucleotides containing CpG motifs, genetically modified bacterial toxins, cholera toxin from Vibrio colerae, heat labile enterotoxin from Escherichia coli, human endogenous immunomodulators, cytokine, chemokines, immunopotentiator, double-stranded RNA, small immunopotentiator molecules such as imiquimod, resikimod.
Fortrinnsvis er vaksinen ifølge oppfinnelsen en emulsjon. Eksipienten er fortrinnsvis en ikke-mineralsk olje slik som Montanide ISA 763 Seppic. Preferably, the vaccine according to the invention is an emulsion. The excipient is preferably a non-mineral oil such as Montanide ISA 763 Seppic.
I en foretrukken utførelsesform er fisken som skal behandles valgt fra gruppen bestående av atlanterhavslaks (Salmo Salar), regnbueørret (Oncorhynchus mykiss), Coho-laks (Oncorhynchus kisutch), bekkeørret (Salmo trutta) og Chinook-laks (O. tshawytscha) og kopepodene tilhører Caligidae-familien. In a preferred embodiment, the fish to be treated is selected from the group consisting of Atlantic salmon (Salmo salar), rainbow trout (Oncorhynchus mykiss), Coho salmon (Oncorhynchus kisutch), brown trout (Salmo trutta) and Chinook salmon (O. tshawytscha) and the copepods belongs to the Caligidae family.
Kopepodene kan være, uten begrensning Caligus absens, Caligus acanthopagri, Caligus aduncus, Caligus aesopus, Caligus affinis, Caligus furcatus, Caligus alaihi, Caligus alatus, Caligus amblygenitalis, Caligus angustatus, Caligus antennatus, Caligus arii, Caligus ariicolus, Caligus asperimanus, Caligus asymmetricus, Caligus atromaculatus, Caligus balistae, Caligus belones, Caligus bennetti, Caligus berychis, Caligus biaculeatus, Caligus bicycletus, Caligus bifurcatus, Caligus bifurcus, Caligus biseriodentatus, Caligus bocki , Caligus bonito, Caligus brevicaudatus, Caligus brevicaudus, Caligus brevis, Caligus buechlerae, Caligus callaoensis, Caligus callyodoni, Caligus calotomi, Caligus carangis, Caligus caudatus, Caligus centrodonti, Caligus chaenichthyis, Caligus cheilodactyli, Caligus chelifer, Caligus chiastos, Caligus chorinemi, Caligus chrysophrysi, Caligus clavatus, Caligus clemensi, Caligus confusus, Caligus constrictus, Caligus cookeoli, Caligus cordiventris, Caligus cordyla, Caligus cornutus, Caligus coryphaenae, Caligus cossacki, Caligus costatus, Caligus cresseyorum, Caligus cristatus, Caligus crusmae, Caligus cunicephalus, Caligus curtus, Caligus cybii, Caligus dactylopteni, Caligus dactylus, Caligus dakari, Caligus dampieri, Caligus dasyaticus, Caligus debueni, Caligus deformis, Caligus diaphanus, Caligus dicentrarchi, Caligus dieuzeidei, Caligus digitatus, Caligus djedabae, Caligus dubius, Caligus eleutheronemi, Caligus elevatus, Caligus elongatus, Caligus engraulidis, Caligus enormes, Caligus epidemicus, Caligus epinepheli, Caligus equulae, Caligus eventilis, Caligus fistulariae, Caligus flexispina, Caligus fortis, Caligus fronsuganinus, Caligus fugu, Caligus furcisetifer, Caligus gayi, Caligus germoi, Caligus glacialis, Caligus glandifer, Caligus gracilis, Caligus grandiabdominalis, Caligus guerini, Caligus gurnardi, Caligus haemulonis, Caligus hamatus, Caligus hamruri, Caligus hemiconiati, Caligus hobsoni, Caligus hoplognathi, Caligus hottentotus, Caligus hyalinae, Caligus hyalinus, Caligus ignotus, Caligus inanis, Caligus infestans, Caligus inopinatus, Caligus irritans, Caligus isonyx, Caligus itacurussensis, Caligus jawahari, Caligus kabatae, Caligus kahawai, Caligus kala, Caligus kalumai, Caligus kanagurta, Caligus kapuhili, Caligus kirti, Caligus kirtiodes, Caligus klawei, Caligus kurochkini, Caligus kuwaitensis, Caligus labracis, Caligus lacustris, Caligus lalandei, Caligus laticaudus, Caligus latigenitalis, Caligus latus, Caligus lepidopi, Caligus lessonius, Caligus lethrinicola, Caligus lichiae, Caligus ligatus, Caligus ligusticus, Caligus littoralis, Caligus lobodes, Caligus lolligunculae, Caligus longiabdominis, Caligus longicaudatus, Caligus longicaudus, Caligus longicervicis, Caligus longipedis, Caligus longipennatus, Caligus longirostris, Caligus longispinosus, Caligus lunatus, Caligus lutjani, Caligus macarovi, Caligus macrurus, Caligus malabaricus, Caligus mercatorus, Caligus minimus, Caligus mordax, Caligus mortis, Caligus mugilis, Caligus multispinosus, Caligus murrayanus, Caligus musaicus, Caligus mutabilis, Caligus nanhaiensis, Caligus nengai, Caligus nibeae, Caligus nolani, Caligus novocaledonicus, Caligus nuenonnae, Caligus obscurus, Caligus oculicola, Caligus ocyurus, Caligus oligoplitisi, Caligus olsoni, Caligus omissus, Caligus orientalis, Caligus oviceps, Caligus pagelli, Caligus pageti, Caligus pagri, Caligus pagrosomi, Caligus pampi, Caligus parvilatus, Caligus patulus, Caligus pauliani, Caligus pectinatus, Caligus pelagicus, Caligus pelamydis, Caligus penrithi, Caligus phipsoni, Caligus piscinus, Caligus placidus, Caligus platurus, Caligus platytarsis, Caligus polycanthi, Caligus pomacentrus, Caligus pomadasi, Caligus praetextus, Caligus priacanthi, Caligus productos, Caligus pseudokalumai, Caligus pseudoproductus, Caligus pterois, Caligus punctatus, Caligus quadratus, Caligus randalli, Caligus raniceps, Caligus rapax, Caligus rectus, Caligus regalis, Caligus remorae, Caligus reniformis, Caligus robustus, Caligus rogercresseyi, Caligus rotundigenitalis, Caligus rufimaculatus, Caligus russellii, Caligus salmoneus, Caligus saucius, Caligus savala, Caligus schelegeli, Caligus schistonyx, Caligus sciaenops, Caligus sclerotinosus, Caligus scribae, Caligus sensilis, Caligus sensorius, Caligus sepetibensis, Caligus seriolae, Caligus serratus, Caligus sibogae, Caligus sicarius, Caligus similis, Caligus spinosurculus, Caligus spinosus, Caligus stokes, Caligus stromatei, Caligus suffuscus, Caligus tanago, Caligus temnodontis, Caligus tenax, Caligus tenuicaudatus, Caligus tenuifurcatus, Caligus tenuis, Caligus teres, Caligus tetrodontis, Caligus thyrsitae, Caligus torpedinis, Caligus trachynoti, Caligus triabdominalis , Caligus triangularis, Caligus trichiuri, Caligus tripedalis, Caligus truttae, Caligus tylosuri, Caligus undulatus, Caligus unguidentatus, Caligus uranoscopi, Caligus validus, Caligus ventrosetosus, Caligus vexator, Caligus willungae, Caligus wilsoni, Caligus xystercus, Caligus zei, Caligus zylanica, Lepeophtheirus europaensis, Lepeophtheirus grohmanni, Lepeophtheirus nordmannii, Lepeophtheirus pectoralis, Lepeophtheirus salmonis, Lepeophtheirus thompsoni, Tigriopus japonicus, Paracyclopina nana. Copepods can be, without limitation Caligus absens, Caligus acanthopagri, Caligus aduncus, Caligus aesopus, Caligus affinis, Caligus furcatus, Caligus alaihi, Caligus alatus, Caligus amblygenitalis, Caligus angustatus, Caligus antennatus, Caligus arii, Caligus ariicolus, Caligus asperimanus, Caligus asymmetricus . callaoensis, Caligus callyodoni, Caligus calotomi, Caligus carangis, Caligus caudatus, Caligus centrodonti, Caligus chaenichthyis, Caligus cheilodactyli, Caligus chelifer, Caligus chiastos, Caligus chorinemi, Caligus chrysophrysi, Caligus clavatus, Caligus clemensi, Caligus confusus, Caligus constrictus, Caligus cookeoli, Caligus cordiventris, Caligus cordyla, Ca ligus cornutus, Caligus coryphaenae, Caligus cossacki, Caligus costatus, Caligus cresseyorum, Caligus cristatus, Caligus crusmae, Caligus cunicephalus, Caligus curtus, Caligus cybii, Caligus dactylopteni, Caligus dactylus, Caligus dakari, Caligus dampieri, Caligus dasyaticus, Caligus debueni, Caligus deformis , Caligus diaphanus, Caligus dicentrarchi, Caligus dieuzeidei, Caligus digitatus, Caligus djedabae, Caligus dubius, Caligus eleutheronemi, Caligus elevatus, Caligus elongatus, Caligus engraulidis, Caligus enormes, Caligus epidemicus, Caligus epinepheli, Caligus equulae, Caligus eventilis, Caligus fistulariae, Caligus flexispina, Caligus fortis, Caligus fronsuganinus, Caligus fugu, Caligus furcisetifer, Caligus gayi, Caligus germoi, Caligus glacialis, Caligus glandifer, Caligus gracilis, Caligus grandiabdominalis, Caligus guerini, Caligus gurnardi, Caligus haemulonis, Caligus hamatus, Caligus hamruri, Caligus hemiconiati, Caligus hobsoni, Caligus hoplognathi, Caligus hottentotus, Ca ligus hyalinae, Caligus hyalinus, Caligus ignotus, Caligus inanis, Caligus infestans, Caligus inopinatus, Caligus irritans, Caligus isonyx, Caligus itacurussensis, Caligus jawahari, Caligus kabatae, Caligus kahawai, Caligus kala, Caligus kalumai, Caligus kanagurta, Caligus kapuhili, Caligus kirti , Caligus kirtiodes, Caligus klawei, Caligus kurochkini, Caligus kuwaitensis, Caligus labracis, Caligus lacustris, Caligus lalandei, Caligus laticaudus, Caligus latigenitalis, Caligus latus, Caligus lepidopi, Caligus lessonius, Caligus lethrinicola, Caligus lichiae, Caligus ligatus, Caligus ligusticus, Caligus littoralis, Caligus lobodes, Caligus lolligunculae, Caligus longiabdominis, Caligus longicaudatus, Caligus longicaudus, Caligus longicervicis, Caligus longipedis, Caligus longipennatus, Caligus longirostris, Caligus longispinosus, Caligus lunatus, Caligus lutjani, Caligus macarovi, Caligus macrurus, Caligus malabaricus, Caligus mercatorus, Caligus minimus, Caligus mordax, Caligus mortis, Caligus mugilis, Caligus multispinosus, Caligus murrayanus, Caligus musaicus, Caligus mutabilis, Caligus nanhaiensis, Caligus nengai, Caligus nibeae, Caligus nolani, Caligus novocaledonicus, Caligus nuenonnae, Caligus obscurus, Caligus oculicola, Caligus ocyurus, Caligus oligoplitisi, Caligus olsoni, Caligus omissus Caligus Orientalis placidus, Caligus platurus, Caligus platytarsis, Caligus polycanthi, Caligus pomacentrus, Caligus pomadasi, Caligus praetextus, Caligus priacanthi, Caligus productos, Caligus pseudokalumai, Caligus pseudoproductus, Caligus pterois, Caligus punctatus, Caligus quadratus, Caligus randalli, Caligus raniceps, Caligus rapax, Caligus rectus, Caligus regalis, Caligus remorae, Caligus reniform ice, Caligus robustus, Caligus rogercresseyi, Caligus rotundigenitalis, Caligus rufimaculatus, Caligus russellii, Caligus salmoneus, Caligus saucius, Caligus savala, Caligus schelegeli, Caligus schistonyx, Caligus sciaenops, Caligus sclerotinosus, Caligus scribae, Caligus sensilis, Caligus sensorius, Caligus sepetibensis, Caligus seriolae, Caligus serratus, Caligus sibogae, Caligus sicarius, Caligus similis, Caligus spinosurculus, Caligus spinosus, Caligus stokes, Caligus stromatei, Caligus suffuscus, Caligus tanago, Caligus temnodontis, Caligus tenax, Caligus tenuicaudatus, Caligus tenuifurcatus, Caligus tenuis, Caligus teres . willungae, Caligus wilsoni, Caligus x oystercus, Caligus zei, Caligus zylanica, Lepeophtheirus europaensis, Lepeophtheirus grohmanni, Lepeophtheirus nordmannii, Lepeophtheirus pectoralis, Lepeophtheirus salmonis, Lepeophtheirus thompsoni, Tigriopus japonicus, Paracyclopina nana.
Ytterligere tilveiebrakt er anvendelsen av peptidene som har minst 90% identitet med SEQ ID NO.17, SEQ ID NO.18, SEQ ID NO.19 og SEQ ID NO.20 for fremstilling av en vaksine som induserer en immunrespons hos fisk, eller for fremstilling av en sammensetning som genererer dannelsen av en slimskjoldbeskyttelse hos fisk. Further provided is the use of the peptides having at least 90% identity with SEQ ID NO.17, SEQ ID NO.18, SEQ ID NO.19 and SEQ ID NO.20 for the production of a vaccine that induces an immune response in fish, or for preparation of a composition which generates the formation of a mucus shield protection in fish.
Det beskrives også en vaksine mot fiskeinfestering med kopepoder omfattende proteinene til SEQ ID NO.1, SEQ ID NO.2, og SEQ ID NO.3; eksipienter og adjuvanser. There is also described a vaccine against fish infestation with copepods comprising the proteins of SEQ ID NO.1, SEQ ID NO.2, and SEQ ID NO.3; excipients and adjuvants.
Det beskrives også en fremgangsmåte for å modulere en immunrespons hos fisk omfattende administrering til fisken en nødvendig mengde av en vaksine omfattende minst ett peptid valgt fra gruppen bestående av SEQ ID NO.17, SEQ ID NO.18, SEQ ID NO.19, SEQ ID NO.20, SEQ ID NO.21, SEQ ID NO.22, SEQ ID NO.23, SEQ ID NO.24, SEQ ID NO.25, SEQ ID NO.26, SEQ ID NO.27, SEQ ID NO.28; og eksipienter. Fremgangsmåten omfatter å administrere fra 1 til 500 µg peptid. Når vaksinen omfatter 4 peptider, administreres 1 til 500 µg av hvert peptid. Peptidet kan være konjugert til et antigent protein, for eksempel KLH. There is also described a method for modulating an immune response in fish comprising administering to the fish a necessary amount of a vaccine comprising at least one peptide selected from the group consisting of SEQ ID NO.17, SEQ ID NO.18, SEQ ID NO.19, SEQ ID NO.20, SEQ ID NO.21, SEQ ID NO.22, SEQ ID NO.23, SEQ ID NO.24, SEQ ID NO.25, SEQ ID NO.26, SEQ ID NO.27, SEQ ID NO .28; and excipients. The method comprises administering from 1 to 500 µg of peptide. When the vaccine comprises 4 peptides, 1 to 500 µg of each peptide is administered. The peptide may be conjugated to an antigenic protein, for example KLH.
Det beskrives også en fremgangsmåte for å generere dannelsen av et slimskjold hos fisk omfattende å administrere til fisken en nødvendig mengde av en vaksine omfattende minst ett peptid som har minst 90 % identitet med en sekvens valgt fra gruppen bestående av SEQ ID NO.17, SEQ ID NO.18, SEQ ID NO.19, SEQ ID NO.20, SEQ ID NO.21, SEQ ID NO.22, SEQ ID NO.23, SEQ ID NO.24, SEQ ID NO.25, SEQ ID NO.26, SEQ ID NO.27, SEQ ID NO.28 og kombinasjoner derav; og eksipienter. For eksempel å administrere fra 1 til 500 µg av peptidet. Fisken kan være atlanterhavslaks (Salmo Salar), regnbueørret (Oncorhynchus mykiss) og Coho-laks (Oncorhynchus kisutch), bekkeørret (Salmo trutta) og Chinook-laks (O. tshawytscha) og kopepodene kan tilhøre Caligidae-familien. Peptidet kan være konjugert til et antigent protein, for eksempel Keyhole Limpet Hemocyanin fra Megathura crenulata. Also described is a method for generating the formation of a mucus shield in fish comprising administering to the fish a necessary amount of a vaccine comprising at least one peptide having at least 90% identity with a sequence selected from the group consisting of SEQ ID NO.17, SEQ ID NO.18, SEQ ID NO.19, SEQ ID NO.20, SEQ ID NO.21, SEQ ID NO.22, SEQ ID NO.23, SEQ ID NO.24, SEQ ID NO.25, SEQ ID NO .26, SEQ ID NO.27, SEQ ID NO.28 and combinations thereof; and excipients. For example, administering from 1 to 500 µg of the peptide. The fish can be Atlantic salmon (Salmo salar), rainbow trout (Oncorhynchus mykiss) and Coho salmon (Oncorhynchus kisutch), brown trout (Salmo trutta) and Chinook salmon (O. tshawytscha) and the copepods can belong to the Caligidae family. The peptide may be conjugated to an antigenic protein, for example Keyhole Limpet Hemocyanin from Megathura crenulata.
DETALJERT BESKRIVELSE AV OPPFINNELSEN DETAILED DESCRIPTION OF THE INVENTION
For den foreliggende oppfinnelsens formål henviser betegnelsen "vaksine" til en sammensetning som induserer en immunrespons hos et dyr, for eksempel hos fisk, og det henviser også til en sammensetning som induserer dannelsen av et slimskjold, der skjoldet er en biologisk beskyttelse mot infestering med kopepoder hos fisk. For the purposes of the present invention, the term "vaccine" refers to a composition that induces an immune response in an animal, for example in fish, and it also refers to a composition that induces the formation of a mucus shield, the shield being a biological protection against copepod infestation in fish.
Effektanalyser ble utført med multimere proteiner fra vitellogenin-familien som kandidatimmunogener for å utvikle en ny vaksine mot C. rogercresseyi og andre kopepoder. Efficacy analyzes were performed with multimeric proteins from the vitellogenin family as candidate immunogens to develop a new vaccine against C. rogercresseyi and other copepods.
Kandidater for løselige proteiner som immunogener ble separert ved elektroforese på 8 % natriumdodekylsulfatpolyakrylamid-geler fra en suspensjon av homogeniserte voksne Caligus rogercresseyi-parasitter. Candidate soluble proteins as immunogens were separated by electrophoresis on 8% sodium dodecyl sulfate polyacrylamide gels from a suspension of homogenized adult Caligus rogercresseyi parasites.
Ved utsettelse for elektroforese på natriumdodekylsulfatpolyakrylamid-geler under ikke-reduksjonsbetingelser, ble 3 prominente bånd på 220 kDa (SEQ ID NO.1), 212 kDa (SEQ ID NO.2) og 173 kDa (SEQ ID NO.3) fra de løselige proteinkonsentratene fra de homogeniserte voksne parasittene suspensjon observert. Under reduksjonsbetingelser ble 4 bånd som samsvarer med proteiner på 220 kDa, 173 kDa, 116 kDa og 97 kDa, observert (figur 1) . When subjected to electrophoresis on sodium dodecyl sulfate polyacrylamide gels under non-reducing conditions, 3 prominent bands of 220 kDa (SEQ ID NO.1), 212 kDa (SEQ ID NO.2) and 173 kDa (SEQ ID NO.3) from the soluble the protein concentrates from the homogenized adult parasite suspension observed. Under reducing conditions, 4 bands corresponding to proteins of 220 kDa, 173 kDa, 116 kDa and 97 kDa were observed (Figure 1).
Tryptisk spaltingsanalyse og matriseassistert laserdesorpsjon/-ionisering (Maldi-tof) av bånd ekstrahert fra gelen viste at de ulike peptidiske fraksjonene var svært homologe (>90 %) med aminosyresekvenser til multimere fosfolipoglykoproteiner fra vitellogenin-familien av kopepoder, slik som vitellogenin 1, vitellogenin 2 og vitellogenin-ligninger av henholdsvis Lepeophtheirus salmonis, Trigiopus japonicus, og Paracyclopina nana. Tryptic cleavage analysis and matrix-assisted laser desorption/ionization (Maldi-tof) of bands extracted from the gel showed that the various peptide fractions were highly homologous (>90%) to amino acid sequences of multimeric phospholipoglycoproteins from the vitellogenin family of copepods, such as vitellogenin 1, vitellogenin 2 and vitellogenin equations of Lepeophtheirus salmonis, Trigiopus japonicus, and Paracyclopina nana, respectively.
Sekvenser til de peptidiske fraksjonene ble analysert ved bruk av informasjonen tilgjengelig i GenBank. Resultatene viste at det var en korrelasjon mellom de isolerte proteinene anvendt i vaksinene ifølge oppfinnelsen og kjente proteiner fra vitellogeninfamilien (figur 2). Sequences of the peptidic fractions were analyzed using the information available in GenBank. The results showed that there was a correlation between the isolated proteins used in the vaccines according to the invention and known proteins from the vitellogenin family (figure 2).
Tabell 1 viser at aminosyresekvensene til Vitellogenin 1 [Lepeophtheirus salmonis], Vitellogenin 2 [Lepeophtheirus salmonis] og Vitellogenin-lignende proteiner [Lepeophtheirus salmonis] spesifiserer de identifiserte peptidenes homologi med de isolerte proteinene fra Caligus rogercresseyi. Table 1 shows that the amino acid sequences of Vitellogenin 1 [Lepeophtheirus salmonis], Vitellogenin 2 [Lepeophtheirus salmonis] and Vitellogenin-like proteins [Lepeophtheirus salmonis] specify the homology of the identified peptides with the isolated proteins from Caligus rogercresseyi.
Tabell 1 Table 1
Peptider oppnådd fra spaltingen av isolerte proteiner fra Caligus rogercresseyi korrelerte med kjente proteiner som tilhører vitellogenin-familien. Figur 2 viser sekvensene til Vitellogenin 1 [Lepeophtheirus salmonis], Vitellogenin 2 [Lepeophtheirus salmonis] og Vitellogenin-lignende proteiner [Lepeophtheirus salmonis]. Peptidene som viste seg å være en del av aminosyresekvensene til proteinene, er identifisert. Peptides obtained from the cleavage of isolated proteins from Caligus rogercresseyi correlated with known proteins belonging to the vitellogenin family. Figure 2 shows the sequences of Vitellogenin 1 [Lepeophtheirus salmonis], Vitellogenin 2 [Lepeophtheirus salmonis] and Vitellogenin-like proteins [Lepeophtheirus salmonis]. The peptides that were found to be part of the amino acid sequences of the proteins have been identified.
De isolerte proteinene fra C. rogercresseyi ble brukt til å fremstille ulike vaksiner for immunisering av fisk (ørret), der vaksinene omfatter: The isolated proteins from C. rogercresseyi were used to prepare various vaccines for the immunization of fish (trout), where the vaccines include:
Vaksine A: omfatter 1 µg av hvert av de følgende proteinene: 220 kDa (SEQ ID NO.1), 212 kDa (SEQ ID NO.2) og 173 kDa (SEQ ID NO.3) i en oljeemulsjon formulert med Montanide ISA 763 Seppic ikke-mineralsk olje (70 % volum/volum olje – 30 % volum/volum vann), og 10 µg Megathura crenulata hemocyanin (nøkkelhullsnegl) (H8283-Sigma). Vaccine A: comprises 1 µg of each of the following proteins: 220 kDa (SEQ ID NO.1), 212 kDa (SEQ ID NO.2) and 173 kDa (SEQ ID NO.3) in an oil emulsion formulated with Montanide ISA 763 Seppic non-mineral oil (70% v/v oil – 30% v/v water), and 10 µg Megathura crenulata hemocyanin (keyhole snail) (H8283-Sigma).
Ikke-spesifikk kontrollsammensetning: Hver dose inneholdt 3 µg BmSS (BmSS rekombinant protein fra Boophilus microplus gut) i en oljeemulsjon formulert med Montanide ISA 763 Seppic ikke-mineralsk olje (70 % volum/volum olje – 30 % volum/volum vann) og 10 µg Megathura crenulata hemocyanin (nøkkelhullsnegl) (H8283-Sigma). Non-specific control composition: Each dose contained 3 µg of BmSS (BmSS recombinant protein from Boophilus microplus gut) in an oil emulsion formulated with Montanide ISA 763 Seppic non-mineral oil (70% v/v oil – 30% v/v water) and 10 µg Megathura crenulata hemocyanin (keyhole snail) (H8283-Sigma).
Adjuvanskontrollsammensetninger: Hver dose inneholdt 30 µg PBS i en oljeemulsjon formulert med Montanide ISA 763 Seppic ikke-mineralsk olje (70 % volum/volum olje – 30 % volum/volum vann) og 10 µg Megathura crenulata hemocyanin (nøkkelhullsnegl) (H8283-Sigma). Adjuvant control compositions: Each dose contained 30 µg PBS in an oil emulsion formulated with Montanide ISA 763 Seppic non-mineral oil (70% v/v oil – 30% v/v water) and 10 µg Megathura crenulata hemocyanin (keyhole snail) (H8283-Sigma) .
PBS-kontrollsammensetning: Hver dose inneholdt bare 100 µl PBS. PBS control composition: Each dose contained only 100 µl of PBS.
Etter inokulering av fisk med vaksinen eller deres kontroller, ble fisken provosert med en infeksjon med C. rogercresseyi After inoculation of fish with the vaccine or their controls, the fish were challenged with an infection with C. rogercresseyi
Under fiskeimmuniserings-, provokasjons- og overvåkingsperioder ble det observert at vaksinene ikke forårsaket lokale, systemiske, inflammatoriske og/eller granulomatøse reaksjoner på administreringsstedet. Vaksinene viste seg ufarlige og trygge. Ingen av sammensetningene eller vaksinene modifiserte fiskens atferd eller appetitt. During fish immunization, challenge and monitoring periods, it was observed that the vaccines did not cause local, systemic, inflammatory and/or granulomatous reactions at the site of administration. The vaccines proved harmless and safe. None of the compounds or vaccines modified the fish's behavior or appetite.
For å verifisere kopepodenes fikseringsgrad ble det utført en telling av parasitteksemplarer 72 timer etter provokasjon på alle de provoserte fiskene. To verify the degree of fixation of the copepods, a count of parasite specimens was carried out 72 hours after provocation on all the provoked fish.
Kopepoditter var fiksert med den forventede raten. Vaksinenes beskyttelsesgrad ble uttrykt som reduksjonsprosenten av antall parasittiske stadier etter provokasjon hos ørret immunisert med hver av vaksinene sammenlignet med kontroller. Copepodites were fixed at the expected rate. The degree of protection of the vaccines was expressed as the reduction percentage of the number of parasitic stages after provocation in trout immunized with each of the vaccines compared to controls.
En signifikant og gradvis økning av utvikling av juvenile stadier og voksne av kopepodparasitter ble observert i kontrollgruppene. Bare vaksine A ifølge oppfinnelsen viste seg svært effektiv i å redusere antallet juvenile og voksne eksemplarer. Denne vaksinen viste en beskyttelse på fra 70 til 75 % avhengig av stadiet. I dammer med fisk behandlet med en ikke-spesifikk kontrollsammensetning nådde beskyttelse bare 25 og 32 %, mens i dammer med fisk behandlet med adjuvanskontrollsammensetning nådde beskyttelsen bare 19 til 20 %, i begge tilfeller i forhold til PBS-kontrollen (fig.3). A significant and gradual increase of development of juvenile stages and adults of copepod parasites was observed in the control groups. Only vaccine A according to the invention proved highly effective in reducing the number of juvenile and adult specimens. This vaccine showed a protection of from 70 to 75% depending on the stage. In ponds with fish treated with a non-specific control composition, protection reached only 25 and 32%, while in ponds with fish treated with an adjuvant control composition, protection reached only 19 to 20%, in both cases relative to the PBS control (Fig.3).
Gjennomsnittlig abundans ble beregnet som gjennomsnittet av voksne hann- og hunnparasitter per fisk, tatt i betraktning det totale antallet fisker i hver gruppe (fig.4). Det gjennomsnittlige antallet voksne hann- og hunnparasitter per fisk i PBS-kontrollgruppen var fra 4,1 til 4,6 ganger høyere enn antallet detektert hos fisk behandlet med vaksine A ifølge oppfinnelsen. Fisk immunisert med vaksine A viste mindre forskjell i abundans mellom hanner og hunner. Average abundance was calculated as the average of adult male and female parasites per fish, taking into account the total number of fish in each group (Fig. 4). The average number of adult male and female parasites per fish in the PBS control group was from 4.1 to 4.6 times higher than the number detected in fish treated with vaccine A according to the invention. Fish immunized with vaccine A showed less difference in abundance between males and females.
En sammenligning mellom det gjennomsnittlige antallet voksne hann- og hunnparasitter funnet i PBS-kontrollgruppen og i gruppene behandlet med ikke-spesifikke kontrollsammensetninger og adjuvanskontroll tilveiebrakte ingen signifikante forskjeller. A comparison between the mean number of adult male and female parasites found in the PBS control group and in the groups treated with non-specific control compounds and adjuvant control yielded no significant differences.
Det ble observert at immunisering med vaksine A og etterfølgende provokasjon av den vaksinerte fisken forårsaket en 75 % reduksjon i infesteringen med C. rogercresseyi, og videre at denne sammensetningen eller vaksinen viste seg å være trygg, ufarlig og effektiv. It was observed that immunization with vaccine A and subsequent challenge of the vaccinated fish caused a 75% reduction in infestation with C. rogercresseyi, and further that this composition or vaccine proved to be safe, harmless and effective.
Figur 5 viser spesifikke antistofftitere detektert ved ELISA i serum fra dyr behandlet med de ulike vaksinene. Bare vaksine A viste seg å være immunogen, og viste en signifikant forskjell med hensyn til antistofftitere for fisk inokulert med ikke-spesifikke, adjuvans- og PBS-kontroller. Figure 5 shows specific antibody titers detected by ELISA in serum from animals treated with the various vaccines. Only vaccine A was found to be immunogenic, showing a significant difference in antibody titers for fish inoculated with non-specific, adjuvant and PBS controls.
For å bestemme eksistensen av antistofftitere i gruppen med fisk behandlet ifølge figur 5, ble fiskene tappet for blod på ulike tidspunkter, og sera ble analysert ved ELISA som beskrevet i eksemplene. Som det kan ses i figur 5 var det bare vaksine A ifølge oppfinnelsen som induserte en spesifikk immunrespons som varte i minst 120 dager og var signifikant høyere enn den indusert av kontrollsammensetningene. To determine the existence of antibody titers in the group of fish treated according to Figure 5, the fish were bled at various times, and sera were analyzed by ELISA as described in the examples. As can be seen in figure 5, only vaccine A according to the invention induced a specific immune response which lasted for at least 120 days and was significantly higher than that induced by the control compositions.
Den foreliggende oppfinnelsen vedrører vaksiner omfattende peptider og kombinasjoner derav, konjugert eller ikke, i en oljet sammensetning eller vaksine for forebygging og/eller aktivering av en humoral immunrespons hos salmonider. Peptidene, eller en kombinasjon derav, øker slimtykkelse, antallet og diameteren til sekretoriske celler og epiteltykkelse, for derved å generere et biologisk skjold eller slim mot infesteringer med patogener, for eksempel med fiskelus C. rogercresseyi, for således å redusere med 80 % (i forhold til kontrollen) antallet fiskelus i juvenile stadier og voksne etter provokasjon med parasitten hos de behandlede salmonidene. The present invention relates to vaccines comprising peptides and combinations thereof, conjugated or not, in an oily composition or vaccine for the prevention and/or activation of a humoral immune response in salmonids. The peptides, or a combination thereof, increase mucus thickness, the number and diameter of secretory cells and epithelial thickness, thereby generating a biological shield or mucus against infestations with pathogens, for example with fish louse C. rogercresseyi, thus reducing by 80% (in relative to the control) the number of fish lice in juvenile stages and adults after provocation with the parasite in the treated salmonids.
For å finne immunogene peptider i proteinsekvensen ble det utført en analyse for å predikere lineære B-epitoper med BepiPred 1.0b (Danmarks Tekniske Universitet) i 220 kDa-proteinet (Vitellogenin 1 [Lepeophtheirus salmonis] (SEQ ID NO.1). Tolv peptider ble valgt. Deres sekvens er den som vises i figur 6. De valgte peptidene ble også konjugert til et hemocyanin ekstrahert fra bløtdyret betegnet nøkkelhullsnegl (KLH - Keyhole limpet hemocyanin [Lapa californiana]). To find immunogenic peptides in the protein sequence, an analysis was performed to predict linear B epitopes with BepiPred 1.0b (Technical University of Denmark) in the 220 kDa protein (Vitellogenin 1 [Lepeophtheirus salmonis] (SEQ ID NO.1). Twelve peptides were selected. Their sequence is shown in Figure 6. The selected peptides were also conjugated to a hemocyanin extracted from the mollusk called keyhole limpet hemocyanin (KLH - Keyhole limpet hemocyanin [Lapa californiana]).
Peptidsekvenser brukt til fremstilling av vaksinene var som følger: Peptide sequences used for the preparation of the vaccines were as follows:
Peptid 1: GYSPSYYGWAPSKEYVYEFE (SEQ ID NO.17). MV: 2525,75 D Cystein ble tilsatt til COOHt, og det ble konjugert til KLH. Peptide 1: GYSPSYYGWAPSKEYVYEFE (SEQ ID NO.17). MV: 2525.75 D Cysteine was added to COOHt, and it was conjugated to KLH.
Peptid 2: ESLFVEKDEPVVVTNWKKALL (SEQ ID NO.18). MV: 2548,01 Cystein ble tilsatt til COOHt, og det ble konjugert til KLH. Peptide 2: ESLFVEKDEPVVVTNWKKALL (SEQ ID NO.18). MV: 2548.01 Cysteine was added to COOHt, and it was conjugated to KLH.
Peptid 3: SQKEIHEVMEESGRACTGKQ (SEQ ID NO.19) MV: 2282,70 Peptide 3: SQKEIHEVMEESGRACTGKQ (SEQ ID NO.19) MV: 2282.70
Det ble konjugert til KLH ved cysteinet til sekvensen. It was conjugated to KLH at the cysteine of the sequence.
Peptid 4: STVSHQIPKPKTPKTVGNLF (SEQ ID NO.20) MV: 2282,70. Peptide 4: STVSHQIPKPKTPKTVGNLF (SEQ ID NO.20) MV: 2282.70.
Cystein ble tilsatt til COOHt, og det ble konjugert til KLH. Cysteine was added to COOHt, and it was conjugated to KLH.
Peptid 5: KTLKAKSPQLYYVSTVSFSD (SEQ ID NO.21) MV: 2282,70 Cystein ble tilsatt til COOHt, og det ble konjugert til KLH. Peptide 5: KTLKAKSPQLYYVSTVSFSD (SEQ ID NO.21) MV: 2282.70 Cysteine was added to COOHt and it was conjugated to KLH.
Peptid 6: QKITQKLQITPRTLQEPELS (SEQ ID NO.22) MV: 2282,70 Peptide 6: QKITQKLQITPRTLQEPELS (SEQ ID NO.22) MV: 2282.70
Cystein ble tilsatt til COOHt, og det ble konjugert til KLH. Cysteine was added to COOHt, and it was conjugated to KLH.
Peptid 7: HGLPFKYTKTRNFVDVQSVAPTASGFPVRIQ (SEQ ID NO.23) MV: 2282,70 Peptide 7: HGLPFKYTKTRNFVDVQSVAPTASGFPVRIQ (SEQ ID NO.23) MV: 2282.70
Cystein ble tilsatt til COOHt, og det ble konjugert til KLH. Cysteine was added to COOHt, and it was conjugated to KLH.
Peptid 8: CSQSSTNTVNPNTCEEKERS (SEQ ID NO.24) MV: 2282,70 Peptide 8: CSQSSTNTVNPNTCEEKERS (SEQ ID NO.24) MV: 2282.70
Det ble konjugert til KLH ved cysteinet til sekvensen. It was conjugated to KLH at the cysteine of the sequence.
Peptid 9: PVNESSGSSTPPSSTPGPLL (SEQ ID NO.25) MV: 2282,70 Peptide 9: PVNESSGSSTPPSSTPGPLL (SEQ ID NO.25) MV: 2282.70
Cystein ble tilsatt til COOHt, og det ble konjugert til KLH. Cysteine was added to COOHt, and it was conjugated to KLH.
Peptid 10: SCQGIPTPEEKTKFEKESHE (SEQ ID NO.26) MV: 2282,70 Peptide 10: SCQGIPTPEEKTKFEKESHE (SEQ ID NO.26) MV: 2282.70
Det ble konjugert til KLH ved cysteinet til sekvensen. It was conjugated to KLH at the cysteine of the sequence.
Peptid 11: PTTYNRMIEEASNCQSSSSSGSGMGGGS (SEQ ID NO.27) MV: Peptide 11: PTTYNRMIEEASNCQSSSSSSGSGMGGGS (SEQ ID NO.27) MV:
2282,70. Det ble konjugert til KLH ved cysteinet til sekvensen. 2282.70. It was conjugated to KLH at the cysteine of the sequence.
Peptid 12: SSPSSSDSSSHHAQPSTGRFQ (SEQ ID NO.28) MV: 2282,70 Cystein ble tilsatt til COOHt, og det ble konjugert til KLH. Peptide 12: SSPSSSDSSSHAQPSTGRFQ (SEQ ID NO.28) MV: 2282.70 Cysteine was added to COOHt and it was conjugated to KLH.
Peptid 1 til 4 motsvarer den aminoterminale sekvensen, peptid 5 til 8 motsvarer mellomregionen og peptid 9 til 12 motsvarer den karboksylterminale regionen av vitellogenin 1-proteinet (SEQ ID NO.1) til Lepeophtheirus salmonis. Peptides 1 to 4 correspond to the amino-terminal sequence, peptides 5 to 8 correspond to the intermediate region and peptides 9 to 12 correspond to the carboxyl-terminal region of the vitellogenin 1 protein (SEQ ID NO.1) of Lepeophtheirus salmonis.
Under immuniserings-, provokasjons- og overvåkingsperiodene for fisken ble det observert at vaksinene ikke forårsaket lokale, systemiske, inflammatoriske og/eller granulomatøse reaksjoner på administreringsstedet. During the immunization, provocation and monitoring periods for the fish, it was observed that the vaccines did not cause local, systemic, inflammatory and/or granulomatous reactions at the site of administration.
Vaksine 1 ifølge oppfinnelsen omfatter 50 µg av hvert av de konjugerte peptidene 1–4 (peptider til SEQ ID NO.17, SEQ ID NO.18, SEQ ID NO.19, og SEQ ID NO.20); Vaccine 1 according to the invention comprises 50 µg of each of the conjugated peptides 1–4 (peptides of SEQ ID NO.17, SEQ ID NO.18, SEQ ID NO.19, and SEQ ID NO.20);
Vaksine 2 omfatter 50 µg av hvert av de konjugerte peptidene 5–8 (peptider til SEQ ID NO. 21, SEQ ID NO.22, SEQ ID NO.23, og SEQ ID NO.24); Vaccine 2 comprises 50 µg of each of the conjugated peptides 5–8 (peptides of SEQ ID NO. 21, SEQ ID NO.22, SEQ ID NO.23, and SEQ ID NO.24);
Vaksine 3 omfatter 50 µg av hvert av de konjugerte peptidene 9–12 (peptider til SEQ ID NO. 25, SEQ ID NO.26, SEQ ID NO.27, og SEQ ID NO.28); Vaccine 3 comprises 50 µg of each of the conjugated peptides 9–12 (peptides of SEQ ID NO. 25, SEQ ID NO.26, SEQ ID NO.27, and SEQ ID NO.28);
Hver av vaksinene ble fremstilt som en emulsjon i Montanide ISA 763 Seppic ikkemineralsk olje (70 % volum/volum olje – 30 % volum/volum vann) og 10 µg hemocyanin keyhole limpet fra Megathura crenulata (H8283-Sigma) til et endelig volum på 0,05 ml. Each of the vaccines was prepared as an emulsion in Montanide ISA 763 Seppic non-mineral oil (70% v/v oil – 30% v/v water) and 10 µg hemocyanin keyhole limpet from Megathura crenulata (H8283-Sigma) to a final volume of 0 .05 ml.
Vaksine 5 ifølge oppfinnelsen omfatter 50 µg av hvert av de ikke-konjugerte peptidene 1–4 (peptider til SEQ ID NO.17, SEQ ID NO.18, SEQ ID NO.19, og SEQ ID NO. Vaccine 5 according to the invention comprises 50 µg of each of the non-conjugated peptides 1–4 (peptides of SEQ ID NO.17, SEQ ID NO.18, SEQ ID NO.19, and SEQ ID NO.
20); 20);
Vaksine 6 omfatter 50 µg av hvert av de ikke-konjugerte peptidene 5–8 (peptider til SEQ ID NO.21, SEQ ID NO.22, SEQ ID NO.23, og SEQ ID NO.24); Vaccine 6 comprises 50 µg of each of the non-conjugated peptides 5-8 (peptides of SEQ ID NO.21, SEQ ID NO.22, SEQ ID NO.23, and SEQ ID NO.24);
Vaksine 7 omfatter 50 µg av hvert av de ikke-konjugerte peptidene 9–12 (peptider til SEQ ID NO.25, SEQ ID NO.26, SEQ ID NO.27, og SEQ ID NO.28). Vaccine 7 comprises 50 µg of each of the non-conjugated peptides 9-12 (peptides of SEQ ID NO.25, SEQ ID NO.26, SEQ ID NO.27, and SEQ ID NO.28).
Hver av vaksinene ble fremstilt som en emulsjon i Montanide ISA 763 Seppic ikkemineralsk olje (70 % volum/volum olje – 30 % volum/volum vann) og 10 µg hemocyanin keyhole limpet fra Megathura crenulata (H8283-Sigma) til et endelig volum på 0,05 ml. Each of the vaccines was prepared as an emulsion in Montanide ISA 763 Seppic non-mineral oil (70% v/v oil – 30% v/v water) and 10 µg hemocyanin keyhole limpet from Megathura crenulata (H8283-Sigma) to a final volume of 0 .05 ml.
Sammensetning 8 er adjuvanskontrollsammensetningen: Hver dose inneholdt 30 µg PBS i en oljeemulsjon formulert med Montanide ISA 763 Seppic ikke-mineralsk olje (70 % volum/volum olje – 30 % volum/volum vann) og pluss 10 µg Megathura crenulata hemocyanin (nøkkelhullsnegl) (H8283-Sigma). Composition 8 is the adjuvant control composition: Each dose contained 30 µg PBS in an oil emulsion formulated with Montanide ISA 763 Seppic non-mineral oil (70% v/v oil – 30% v/v water) and plus 10 µg Megathura crenulata hemocyanin (keyhole snail) ( H8283-Sigma).
Sammensetning 9 motsvarer PBS-kontrollsammensetningen: Hver dose av PBS-kontrollvaksinen inneholdt bare 0,05 µl PBS. Composition 9 corresponds to the PBS control composition: each dose of the PBS control vaccine contained only 0.05 µl of PBS.
Vaksinene var alle ufarlige og trygge. Ingen av sammensetningene eller vaksinene modifiserte fiskens atferd eller appetitt. The vaccines were all harmless and safe. None of the compounds or vaccines modified the fish's behavior or appetite.
En telling av parasitteksemplarer ble utført 72 timer etter provokasjon hos alle de provoserte fiskene for å måle fiksering. Kopepoditter var fiksert med den forventede raten. Vaksinenes beskyttelsesgrad ble uttrykt som prosent reduksjonen av parasittiske stadier etter provokasjon hos laks immunisert med hver av vaksinene sammenlignet med kontroller. A count of parasite specimens was performed 72 hours after challenge in all the challenged fish to measure fixation. Copepodites were fixed at the expected rate. The degree of protection of the vaccines was expressed as the percentage reduction of parasitic stages after challenge in salmon immunized with each of the vaccines compared to controls.
Vaksine 1 og A viste seg å være de mest effektive. Vaksine 1 viste en reduksjon på henholdsvis 81 % og 77,7 %, og vaksine A på 72 og 68,5 % i antallet juvenile og voksne eksemplarer. Vaksine 2, 3, 4, 5, 6 og 7 viste mindre reduksjon i antallet eksemplarer (fig. 7). Vaccine 1 and A proved to be the most effective. Vaccine 1 showed a reduction of 81% and 77.7% respectively, and vaccine A of 72 and 68.5% in the number of juvenile and adult specimens. Vaccine 2, 3, 4, 5, 6 and 7 showed a smaller reduction in the number of specimens (Fig. 7).
Tellinger utført i dammer med fisk immunisert med vaksine 2 og 3 viste 11–24,2 % og 25–35,4 % effekt sammenlignet med kontrollen med PBS (fig.7). En beskyttelse på henholdsvis 18–28 %, 22–27 % og 28–24 % ble observert hos kontroller formulert med ikke-konjugerte peptider (vaksine 5-6-7), mens adjuvanskontrollsammensetningen viste 18–20 % mindre enn PBS-kontrollen (fig.7). Counts carried out in ponds with fish immunized with vaccine 2 and 3 showed 11–24.2% and 25–35.4% effect compared to the control with PBS (fig.7). A protection of 18–28%, 22–27% and 28–24%, respectively, was observed in controls formulated with non-conjugated peptides (vaccine 5-6-7), while the adjuvant control composition showed 18–20% less than the PBS control ( fig.7).
I tillegg ble gjennomsnittlig abundans per fisk bestemt. Gjennomsnittlig abundans motsvarer mengden voksne hann- og hunnparasitter funnet hos hver fisk sammenlignet med det totale antallet hos alle fisker i hver gruppe. Antallet voksne hann- og hunnparasitter funnet per fisk i PBS-kontrollgruppen var 5,5 og 3,88 ganger mer enn det som ble detektert hos fisk behandlet med vaksine 1 som omfattet peptid 1–4 konjugert med KLH, der den siste vaksinen viste den minste differansen i gjennomsnittlig abundans mellom hann- og hunnparasitter (fig. 8). In addition, the average abundance per fish was determined. Average abundance corresponds to the amount of adult male and female parasites found in each fish compared to the total number in all fish in each group. The number of adult male and female parasites found per fish in the PBS control group was 5.5 and 3.88 times more than that detected in fish treated with vaccine 1 comprising peptides 1–4 conjugated with KLH, where the last vaccine showed the the smallest difference in mean abundance between male and female parasites (Fig. 8).
En sammenligning av gjennomsnittlig abundans i PBS-kontrollgruppen med den for vaksine A viser en abundans 3,6 og 2,84 ganger høyere enn den siste. De observerte forskjellene var statistisk signifikante. A comparison of the average abundance in the PBS control group with that of vaccine A shows an abundance 3.6 and 2.84 times higher than the latter. The observed differences were statistically significant.
Det ble ikke observert noen signifikante forskjeller mellom antallet voksne hann- og hunnparasitter i PBS-kontrollgruppen og adjuvanskontrollgruppene og vaksine 5, 6 og 7. Det var imidlertid en relativt lavere abundans i gruppen behandlet med vaksine 2 og 3 sammenlignet med PBS-kontrollen. No significant differences were observed between the number of adult male and female parasites in the PBS control group and the adjuvant control groups and vaccine 5, 6 and 7. However, there was a relatively lower abundance in the group treated with vaccine 2 and 3 compared to the PBS control.
Det ble observert at gjennom immunisering med peptid 1–4 av den aminoterminale delen av C rogercresseyi-proteinet på 220 kDa (SEQ ID NO.1) konjugert med KLH ble det oppnådd en 78 % reduksjon av infestering indusert gjennom provokasjon med infestering av C rogercresseyi,og i tillegg er denne vaksinen trygg, ufarlig og effektiv. It was observed that through immunization with peptide 1-4 of the amino-terminal part of the C rogercresseyi protein of 220 kDa (SEQ ID NO.1) conjugated with KLH, a 78% reduction of infestation induced through provocation with infestation of C rogercresseyi was achieved , and in addition, this vaccine is safe, harmless and effective.
Det ble videre observert at effekten til vaksine 1 er noe overlegen den som ses hos fisk immunisert med vaksine A omfattende fullstendige proteiner. Videre er syntesen av slike små peptider, for eksempel ved fastfaseteknikker, en automatisert prosess og utføres enkelt. Konjugering med transportproteiner, for eksempel KLH, induserer en forbedret immunologisk respons og en adekvat beskyttelse for laks infestert med C rogercresseyi. It was further observed that the effect of vaccine 1 is somewhat superior to that seen in fish immunized with vaccine A comprising complete proteins. Furthermore, the synthesis of such small peptides, for example by solid phase techniques, is an automated process and is easily performed. Conjugation with transport proteins, for example KLH, induces an improved immunological response and an adequate protection for salmon infested with C rogercresseyi.
Sera ble titrert i 2-gangers seriefortynninger fra 1:4-fortynningene. Sera were titrated in 2-fold serial dilutions from the 1:4 dilutions.
Variasjonskoeffisienten for positive og negative sera ble beregnet i 12 bestemmelser som en intra-assay repeterbarhetsrate, som resulterte i verdier fra 4 til 19 %. The coefficient of variation for positive and negative sera was calculated in 12 determinations as an intra-assay repeatability rate, resulting in values ranging from 4 to 19%.
Resultatene viser at immunisering av atlanterhavslaks med en dose på 200 ug av peptid 1–4 (vaksine 1) induserer høye titere med spesifikke serumantistoffer, detektert ved ELISA (fig.9). En enkelt immunisering i vaksinert fisk var nok til å indusere serumtitere høyere enn 1,5 og 2 log mellom 20 og 40 dpv, hvilket økte til 3 log under immuniseringsforløpet. Serumtitere oppnådd fra fisk behandlet med vaksine 1 ble korrelert med en økning i spesifikke antistoffnivåer funnet i gruppen med fisk vaksinert med vaksine A. Vaksine 2-3-5-6 og 7 induserte lignende og lavere serumtitere enn de som ble observert med vaksine 1 og A. Kontroller med PBS og adjuvans induserte ikke en spesifikk antistoffrespons hos vaksinert fisk (fig.9). The results show that immunization of Atlantic salmon with a dose of 200 µg of peptide 1-4 (vaccine 1) induces high titers of specific serum antibodies, detected by ELISA (fig.9). A single immunization in vaccinated fish was sufficient to induce serum titers higher than 1.5 and 2 log between 20 and 40 dpv, which increased to 3 log during the course of immunization. Serum titers obtained from fish treated with vaccine 1 were correlated with an increase in specific antibody levels found in the group of fish vaccinated with vaccine A. Vaccines 2-3-5-6 and 7 induced similar and lower serum titers than those observed with vaccine 1 and A. Controls with PBS and adjuvant did not induce a specific antibody response in vaccinated fish (Fig.9).
Nivået av spesifikke antistoffer ble bestemt ved å måle absorbans ved 405 nm i slim ekstrahert fra vaksinert fisk (fig.10). Prøver ble analysert uten fortynning. Resultatene viser for eksempel at en enkelt immunisering av atlanterhavslaks med 200 ug av peptid 1–4 formulert med hemocyanin i ikke-mineralsk olje (vaksine 1) induserte produksjon av spesifikke antistoffer i slim som økte i løpet av immuniseringsperioden. Disse nivåene av antistoffer oppnådd ved immunisering av fisk med vaksine 1 ble korrelert med økningen i spesifikke antistoffnivåer funnet i slim fra gruppen med fisk vaksinert med vaksine A. Vaksine 2-3-5-6 og 7 induserte lavere nivåer av antistoffer. Kontroller med PBS og adjuvans induserte ikke spesifikk antistoffrespons i slim fra ubehandlet kontrollfisk (fig.10). The level of specific antibodies was determined by measuring absorbance at 405 nm in mucus extracted from vaccinated fish (fig.10). Samples were analyzed without dilution. The results show, for example, that a single immunization of Atlantic salmon with 200 µg of peptide 1–4 formulated with hemocyanin in non-mineral oil (vaccine 1) induced production of specific antibodies in mucus that increased during the immunization period. These levels of antibodies obtained by immunization of fish with vaccine 1 were correlated with the increase in specific antibody levels found in mucus from the group of fish vaccinated with vaccine A. Vaccines 2-3-5-6 and 7 induced lower levels of antibodies. Controls with PBS and adjuvant did not induce specific antibody responses in mucus from untreated control fish (Fig. 10).
Det vil være åpenbart for fagmannen at vaksinene ifølge oppfinnelsen kan brukes til immunisering mot enhver type kopepod, gitt at peptidene som brukes til dette, er omfattet i vitellogenin 1 fra for eksempel Lepeophtheirus salmonis eller andre kjente kopepoder. It will be obvious to the person skilled in the art that the vaccines according to the invention can be used for immunization against any type of copepod, given that the peptides used for this are included in vitellogenin 1 from, for example, Lepeophtheirus salmonis or other known copepods.
Tilstedeværelsen av spesifikke antistoffer i serum og slim fra fisk vaksinert med vaksine 1 og A er korrelert med en signifikant reduksjon i infesteringsprosent etter provokasjon av fisk med C. rogercresseyi. Vaksinen formulert med peptid 1–4 viste de beste resultatene. Disse resultatene antyder sterkt at detektering av serum-slim-antistoffer er et avgjørende verktøy for å demonstrere en vaksines potens, og at det er en korrelasjon mellom effektiv beskyttelse (som prosent reduksjon av infestering) og immunrespons (fig. 11). The presence of specific antibodies in serum and mucus from fish vaccinated with vaccine 1 and A is correlated with a significant reduction in infestation percentage after provocation of fish with C. rogercresseyi. The vaccine formulated with peptides 1–4 showed the best results. These results strongly suggest that the detection of serum-mucus antibodies is a crucial tool for demonstrating a vaccine's potency, and that there is a correlation between effective protection (as percent reduction of infestation) and immune response (Fig. 11).
Histologiske studier som evaluerer antallet slimutskillende celler, deres diameter, og tykkelse på epitel ble også utført ved analysering av tre felt per strimmel. En statistisk behandling av resultatene ble utført ifølge Kruskal Wallis-testen for forskjeller i medianene. På lignende vis ble det gjort korrelasjoner mellom reduksjon av infestering ved provokasjon med C rogercresseyi og SHIELD (skjold)-effekten dannet ved variasjon i antallet og diameteren til slimproduserende celler, samt variasjon av veggtykkelse. (Tabell 2 til 9) Histological studies evaluating the number of mucus-secreting cells, their diameter, and thickness of epithelium were also performed by analyzing three fields per strip. A statistical treatment of the results was carried out according to the Kruskal Wallis test for differences in the medians. In a similar way, correlations were made between the reduction of infestation by provocation with C rogercresseyi and the SHIELD (shield) effect formed by variation in the number and diameter of mucus-producing cells, as well as variation in wall thickness. (Tables 2 to 9)
Tabell 2. Tykkelse, antall og diameter til slimutskillende celler på tidspunkt 0 (før vaksinas on for ulike vaksiner o kontroll ru er. Table 2. Thickness, number and diameter of mucus-secreting cells at time 0 (before vaccination for various vaccines and control subjects.
Tabell 3. Tykkelse, antall og diameter til slimutskillende celler 10 dager etter vaksinas on for ulike vaksiner o kontroll ru er. Table 3. Thickness, number and diameter of mucus-secreting cells 10 days after vaccination for various vaccines and control animals.
Tabell 4. Tykkelse, antall og diameter til slimutskillende celler 20 dager etter vaksinason for ulike vaksiner o kontrollru er. Table 4. Thickness, number and diameter of mucus-secreting cells 20 days after the vaccination season for various vaccines and control animals.
Tabell 5. Tykkelse, antall og diameter til slimutskillende celler 30 dager etter vaksinason for ulike vaksiner o kontrollru er. Table 5. Thickness, number and diameter of mucus-secreting cells 30 days after the vaccination season for various vaccines and control animals.
Tabell 6. Tykkelse, antall og diameter til slimutskillende celler 40 dager etter vaksinason for ulike vaksiner o kontrollru er. Table 6. Thickness, number and diameter of mucus-secreting cells 40 days after the vaccination season for various vaccines and control animals.
Tabell 7. Tykkelse, antall og diameter til slimutskillende celler 50 dager etter vaksinason for ulike vaksiner o kontrollru er. Table 7. Thickness, number and diameter of mucus-secreting cells 50 days after the vaccination season for various vaccines and control animals.
Tabell 8. Tykkelse, antall og diameter til slimutskillende celler 80 dager etter vaksinasjon for ulike vaksiner og kontrollgrupper. Table 8. Thickness, number and diameter of mucus-secreting cells 80 days after vaccination for various vaccines and control groups.
Tabell 9. Tykkelse, antall og diameter til slimutskillende celler 120 dager etter vaksinas on for ulike vaksiner o kontroll ru er. Table 9. Thickness, number and diameter of mucus-secreting cells 120 days after vaccination for various vaccines and control animals.
På tidspunkt 0 ble histologiske prøver tatt fra fiskens abdominale og laterale sone farget med den samme intensiteten både PAS- og for PAS-Alcian Blue-farging, med prevalens av nøytrale mukopolysakkarider. Mellom dag 10 og 50 etter vaksinasjon ble slimet til fisken immunisert med Vaksine 1 og Vaksine A tykkere og surere (figur 12 og 13) At time 0, histological samples taken from the abdominal and lateral zone of the fish were stained with the same intensity for both PAS and PAS-Alcian Blue staining, with a prevalence of neutral mucopolysaccharides. Between days 10 and 50 after vaccination, the mucus of the fish immunized with Vaccine 1 and Vaccine A became thicker and more acidic (figures 12 and 13)
Tykkelsen på epitelet og antallet PAS+-celler viste ikke signifikante forskjeller mellom dag 0 og dag 20. Disse observasjonene er beskrevet i tabell 2 til 9 og er også vist i figur 12 og 13. The thickness of the epithelium and the number of PAS+ cells did not show significant differences between day 0 and day 20. These observations are described in Tables 2 to 9 and are also shown in Figures 12 and 13.
Ved dag 30 etter vaksinasjon ble det observert en signifikant fortykning av epitelet, samt en økning i antallet og diameteren til slimutskillende celler PAS+ i gruppene behandlet med vaksine 1 og A sammenlignet med dag 0 og sammenlignet med kontrollene (PBS og adjuvans). I tilfellet med vaksine 2-3-5-6 og 7 var verdiene lavere enn de som ble observert for vaksine 1 og A. Immunogen stimulering forårsaket også hyperplasi av begerceller. At day 30 after vaccination, a significant thickening of the epithelium was observed, as well as an increase in the number and diameter of mucus-secreting cells PAS+ in the groups treated with vaccine 1 and A compared to day 0 and compared to the controls (PBS and adjuvant). In the case of vaccine 2-3-5-6 and 7, the values were lower than those observed for vaccine 1 and A. Immunogenic stimulation also caused goblet cell hyperplasia.
På dag 40 etter vaksinasjon ble det observert aktivering av makrofager og en økning av lymfocyttisk infiltrasjon, og de ble ledsaget av en økning av spesifikke serumantistofftitere. På dag 50 etter vaksinasjon ble immunresponsen potensiert, hvilket ytterligere økte epiteltykkelsen, antallet PAS+-celler og deres diameter, hovedsakelig, men ikke utelukkende, hos fisk behandlet med vaksine 1 og A. At day 40 post-vaccination, activation of macrophages and an increase in lymphocytic infiltration were observed, and they were accompanied by an increase in specific serum antibody titers. At day 50 post-vaccination, the immune response was potentiated, further increasing the epithelial thickness, the number of PAS+ cells and their diameter, mainly, but not exclusively, in fish treated with vaccine 1 and A.
Fra dag 80 til dag 120 etter vaksinasjon ble det observert en signifikant økning i antallet og diameteren til celler, som opprettholder de samme verdiene som ble observert under provokasjon. En relativt signifikant økning av epiteltykkelse ble registrert sammenlignet med data fra dag 50. From day 80 to day 120 after vaccination, a significant increase in the number and diameter of cells was observed, maintaining the same values observed during challenge. A relatively significant increase in epithelial thickness was recorded compared to data from day 50.
Det var ingen statistisk signifikante forskjeller i epiteltykkelse, antall PAS+-celler og deres diameter i kontrollfisk. Det var imidlertid små variasjoner i fisk behandlet med vaksine 2-3-5-6 og 7. There were no statistically significant differences in epithelial thickness, number of PAS+ cells and their diameter in control fish. However, there were small variations in fish treated with vaccine 2-3-5-6 and 7.
Det vil være åpenbart for fagmannen at peptidene og vaksinene ifølge oppfinnelsen kan brukes som sammensetninger som er nyttige for å generere et slimskjold, og, som det er vist, reduserer slimskjoldet infestering med kopepoder hos behandlet fisk. It will be apparent to those skilled in the art that the peptides and vaccines of the invention can be used as compositions useful in generating a slime shield and, as shown, the slime shield reduces copepod infestation in treated fish.
Denne oppfinnelsen er bedre illustrert i de følgende eksemplene, som ikke skal fortolkes som å begrense dens omfang. Tvert imot skal det klart forstås at andre utførelsesformer, modifikasjoner og ekvivalenter derav kan være mulige etter lesing av den foreliggende beskrivelsen, som kan være foreslått av en fagmann uten å avvike fra den foreliggende oppfinnelsens formål og/eller omfanget til de medfølgende kravene. This invention is better illustrated in the following examples, which should not be construed as limiting its scope. On the contrary, it should be clearly understood that other embodiments, modifications and equivalents thereof may be possible after reading the present description, which may be suggested by a person skilled in the art without deviating from the purpose of the present invention and/or the scope of the accompanying claims.
Eksempler Examples
Eksempel 1: Isolering, prosessering, analyse og identifikasjon av proteiner og peptider Example 1: Isolation, processing, analysis and identification of proteins and peptides
Proteiner ble isolert fra en suspensjon med 0,5 g voksne eksemplarer av C. rogercresseyi i PBS-Tween 0,05 %. Prøver ble frosset og homogenisert ved hjelp av en Precellys 24 vevshomogeniserer (Bertin Technologies-France) ved bruk av 2 ml rør inneholdende keramiske kuler og glasskuler (forhåndsfylte kulerør kat. nr. Proteins were isolated from a suspension of 0.5 g of adult specimens of C. rogercresseyi in PBS-Tween 0.05%. Samples were frozen and homogenized using a Precellys 24 tissue homogenizer (Bertin Technologies-France) using 2 ml tubes containing ceramic beads and glass beads (pre-filled bead tubes cat. no.
03119.200.RD000 Precellys-France). To sykluser på 50 sek ved 6000 rpm ble utført, og så ved 5000 rpm i 15 min i en sentrifuge (Eppendorf Refrigerated Microcentrifuge Model 5417 R-USA). Supernatanten ble samlet inn og så konsentrert med CentriPlus YM50 (grenseverdi > 50 kDa) (Millipore-Fisher Sci) ved 2500 rpm i en Sorvallsentrifuge med SS34-rotor. 03119.200.RD000 Precellys-France). Two cycles of 50 sec at 6000 rpm were performed, and then at 5000 rpm for 15 min in a centrifuge (Eppendorf Refrigerated Microcentrifuge Model 5417 R-USA). The supernatant was collected and then concentrated with CentriPlus YM50 (cutoff > 50 kDa) (Millipore-Fisher Sci) at 2500 rpm in a Sorvall centrifuge with SS34 rotor.
De innsamlede løselige proteinene ble separert ved elektroforese på 8 % natriumdodekylsulfatpolyakrylamid-geler under reduksjons- og ikkereduksjonsbetingelser og farget med Coomassie Brilliant Blue G-250 som beskrevet av Laemmli et al 1970. The collected soluble proteins were separated by electrophoresis on 8% sodium dodecyl sulfate polyacrylamide gels under reducing and non-reducing conditions and stained with Coomassie Brilliant Blue G-250 as described by Laemmli et al 1970.
Tryptisk spalting etterfulgt av massespektrometri og Maldi-tof (Matrix-Assisted Laser Desorption/Ionization- time of flight). Tryptic cleavage followed by mass spectrometry and Maldi-tof (Matrix-Assisted Laser Desorption/Ionization- time of flight).
Bånd ekstrahert fra en 8 % natriumdodekylsulfatpolyakrylamid-gel ble avfarget ved hjelp av metanol-eddiksyre (20:7), fortynnet i 0,1 M med ammoniumkarbonat pH 8,0 og så redusert med 10 mM Ditiotreitol i 30 minutter ved romtemperatur, etterfulgt av alkylering med 50 mM jodacetamid. Tryptisk spalting og bidimensjonal separasjon ble utført ifølge Cordwell et al 1999. Et Thermo Electron LTQ-FT-spektrometer med et Protana-nanospraysystem som ionekilde ble brukt til massespektrometri. Phenomenex Jupiter 10/C18 reversfasekolonner ble brukt som interfase. Prøvene utsatt for tryptisk spalting ble injisert i kolonnen og peptider ble eluert med 0,1 M eddiksyre – 100 % acetonitril med en gradientstrømning på 0,4 µl/min i løpet av 2 timer. Nanospraykilden ble operert ved 2,5 kV. Analyse ved tryptisk spalting og massespektrometri Maldi-tof av de gel-ekstraherte båndene avslørte at ulike peptidiske fraksjoner var oppnådd som ble analysert ved hjelp av Sequest-algoritmen og NCBI NR -2006-databasen. Bands extracted from an 8% sodium dodecyl sulfate polyacrylamide gel were destained using methanol-acetic acid (20:7), diluted in 0.1 M ammonium carbonate pH 8.0, and then reduced with 10 mM dithiothreitol for 30 min at room temperature, followed by alkylation with 50 mM iodoacetamide. Tryptic cleavage and two-dimensional separation were performed according to Cordwell et al 1999. A Thermo Electron LTQ-FT spectrometer with a Protana nanospray ion source was used for mass spectrometry. Phenomenex Jupiter 10/C18 reverse phase columns were used as interphase. The samples subjected to tryptic digestion were injected into the column and peptides were eluted with 0.1 M acetic acid – 100% acetonitrile with a gradient flow of 0.4 µl/min during 2 h. The nanospray source was operated at 2.5 kV. Analysis by tryptic cleavage and Maldi-tof mass spectrometry of the gel-extracted bands revealed that different peptide fractions were obtained which were analyzed using the Sequest algorithm and the NCBI NR-2006 database.
Eksempel 2: Fremstilling av konjugerte peptider Example 2: Preparation of conjugated peptides
Konjugerte peptider ble oppnådd ved hjelp av fastfase kjemisk syntese (SPPS)-teknikker. SPPS følger et generelt mønster med repetitive sykluser av kobling-vaskingavbeskyttelse-vasking. Den frie aminoterminale enden av et peptid bundet til en fastfase ble koblet til én enkelt N-beskyttet aminosyreenhet. Denne enheten ble så avbeskyttet, for derved å vise en ny aminoterminal ende som kan binde til en annen aminosyre. Conjugated peptides were obtained using solid phase chemical synthesis (SPPS) techniques. SPPS follows a general pattern of repetitive cycles of coupling-washing-deprotection-washing. The free amino terminal end of a peptide bound to a solid phase was linked to a single N-protected amino acid unit. This unit was then deprotected, thereby showing a new amino terminal end that can bind to another amino acid.
Konjugeringen til KLH ble utført gjennom den frie cysteingruppen eller ved tilsetning ved hjelp av MBS-metoden (m-maleimidobenzoyl-N- hydroksysukkinimid Ester eller aktivert maileimid) som er foretrukket for kobling av aminosyrer ifølge Hermanson. Peptidene ble sekvensert ved hjelp av fremgangsmåten beskrevet av Merrifield The conjugation to KLH was carried out through the free cysteine group or by addition using the MBS method (m-maleimidobenzoyl-N-hydroxysuccinimide Ester or activated maleimide) which is preferred for linking amino acids according to Hermanson. The peptides were sequenced using the method described by Merrifield
Eksempel 3: Fremstilling av vaksinene Example 3: Production of the vaccines
Vaksine A: Tre løselige proteiner med høy molekylvekt ble valgt fra parasitthomogenatet. Proteinkvantifisering ble utført ved densitometri i et densitometer UV-P-system med BSA (V-Sigma-fraksjon) som referanse. Hver dose med vaksine A inneholdt 1 µg av hvert av proteinene på 220465,60 Da (SEQ ID NO.1), 212947,00 Da (SEQ ID NO.2) og 173132,50 Da (SEQ ID NO.3) i en oljeemulsjon formulert med Montanide ISA 763 Seppic ikke-mineralsk olje (70 % volum/volum olje – 30 % volum/volum vann), og 10 µg hemocyanin keyhole limpet fra Megathura crenulata (H8283-Sigma). Vaccine A: Three high molecular weight soluble proteins were selected from the parasite homogenate. Protein quantification was performed by densitometry in a densitometer UV-P system with BSA (V-Sigma fraction) as reference. Each dose of vaccine A contained 1 µg of each of the proteins of 220465.60 Da (SEQ ID NO.1), 212947.00 Da (SEQ ID NO.2) and 173132.50 Da (SEQ ID NO.3) in a oil emulsion formulated with Montanide ISA 763 Seppic non-mineral oil (70% v/v oil – 30% v/v water), and 10 µg hemocyanin keyhole limpet from Megathura crenulata (H8283-Sigma).
Ikke-spesifikk kontrollsammensetning: BmSS rekombinant protein fra Boophilus microplus-tarm ble brukt, som er svært immunogent og beskyttende i bovin infestering med hjemmehørende flått. Hver dose med vaksine inneholdt 3 µg BmSS i en oljeemulsjon formulert med Montanide ISA 763 Seppic ikke-mineralsk olje (70 % volum/volum olje – 30 % volum/volum vann) og 10 µg Megathura crenulata hemocyanin (nøkkelhullsnegl) (H8283-Sigma). Non-specific control composition: BmSS recombinant protein from Boophilus microplus intestine was used, which is highly immunogenic and protective in bovine infestation with resident ticks. Each dose of vaccine contained 3 µg BmSS in an oil emulsion formulated with Montanide ISA 763 Seppic non-mineral oil (70% v/v oil – 30% v/v water) and 10 µg Megathura crenulata hemocyanin (keyhole snail) (H8283-Sigma) .
Adjuvanskontrollsammensetninger: Hver dose med vaksineadjuvanskontroller inneholdt 30 µg PBS i en oljeemulsjon formulert med Montanide ISA 763 Seppic ikke-mineralsk olje (70 % volum/volum olje – 30 % volum/volum vann) og 10 µg Megathura crenulata hemocyanin (nøkkelhullsnegl) (H8283-Sigma). Adjuvant Control Compositions: Each dose of vaccine adjuvant controls contained 30 µg PBS in an oil emulsion formulated with Montanide ISA 763 Seppic non-mineral oil (70% v/v oil - 30% v/v water) and 10 µg Megathura crenulata hemocyanin (keyhole snail) (H8283- Sigma).
PBS-kontroll: Hver dose med PBS-kontrollvaksine inneholdt bare 100 µl PBS. PBS control: Each dose of PBS control vaccine contained only 100 µl of PBS.
Så snart peptidene var oppnådd, ble en del av det samme konjugert med det antigene proteinet KLH ved bruk av en væskefasekonjugeringsmetode slik som den beskrevet i eksemplene. Følgende vaksiner ble fremstilt: Once the peptides were obtained, a portion of the same was conjugated with the antigenic protein KLH using a liquid phase conjugation method such as that described in the examples. The following vaccines were produced:
Vaksine 1 omfattet 50 µg av hvert av de konjugerte peptidene 1–4 (peptider til SEQ ID NO. 17, SEQ ID NO.18, SEQ ID NO.19, og SEQ ID NO.20); Vaccine 1 comprised 50 µg of each of the conjugated peptides 1–4 (peptides of SEQ ID NO. 17, SEQ ID NO.18, SEQ ID NO.19, and SEQ ID NO.20);
Vaksine 2 omfattet 50 µg av hvert av de konjugerte peptidene 5–8 (peptider til SEQ ID NO. 21, SEQ ID NO.22, SEQ ID NO.23, og SEQ ID NO.24); Vaccine 2 comprised 50 µg of each of the conjugated peptides 5–8 (peptides of SEQ ID NO. 21, SEQ ID NO.22, SEQ ID NO.23, and SEQ ID NO.24);
Vaksine 3 omfattet 50 µg av hvert av de konjugerte peptidene 9–12 (peptider til SEQ ID NO. 25, SEQ ID NO.26, SEQ ID NO.27, og SEQ ID NO.28); Vaccine 3 comprised 50 µg of each of the conjugated peptides 9–12 (peptides of SEQ ID NO. 25, SEQ ID NO.26, SEQ ID NO.27, and SEQ ID NO.28);
Hver vaksine ble fremstilt som en emulsjon i Montanide ISA 763 Seppic ikke-mineralsk olje (70 % volum/volum olje – 30 % volum/volum vann) og 10 µg hemocyanin keyhole limpet fra Megathura crenulata (H8283-Sigma) til et endelig volum på 0,05 ml. Each vaccine was prepared as an emulsion in Montanide ISA 763 Seppic non-mineral oil (70% v/v oil – 30% v/v water) and 10 µg hemocyanin keyhole limpet from Megathura crenulata (H8283-Sigma) to a final volume of 0.05 ml.
Vaksine 5 omfattet 50 µg av hvert av de ikke-konjugerte peptidene 1–4; Vaccine 5 comprised 50 µg of each of the non-conjugated peptides 1–4;
Vaksine 6 omfattet 50 µg av hvert av de ikke-konjugerte peptidene 5–8; Vaccine 6 comprised 50 µg of each of the non-conjugated peptides 5–8;
Vaksine 7 omfattet 50 µg av hvert av de ikke-konjugerte peptidene 9–12. Vaccine 7 comprised 50 µg of each of the non-conjugated peptides 9–12.
Hver av dem ble fremstilt som en emulsjon i Montanide ISA 763 Seppic ikke-mineralsk olje (70 % volum/volum olje – 30 % volum/volum vann) og 10 µg hemocyanin keyhole limpet fra Megathura crenulata (H8283-Sigma) til et endelig volum på 0,05 ml. Each was prepared as an emulsion in Montanide ISA 763 Seppic non-mineral oil (70% v/v oil – 30% v/v water) and 10 µg hemocyanin keyhole limpet from Megathura crenulata (H8283-Sigma) to a final volume of 0.05 ml.
Sammensetning 8, adjuvanskontroller: Hver dose med vaksineadjuvanskontroller inneholdt 30 µg PBS i en oljeemulsjon formulert med Montanide ISA 763 Seppic ikkemineralsk olje (70 % volum/volum olje – 30 % volum/volum vann) og pluss 10 µg Megathura crenulata hemocyanin (nøkkelhullsnegl) (H8283-Sigma). Composition 8, Adjuvant Controls: Each dose of vaccine adjuvant controls contained 30 µg PBS in an oil emulsion formulated with Montanide ISA 763 Seppic non-mineral oil (70% v/v oil - 30% v/v water) plus 10 µg Megathura crenulata hemocyanin (keyhole snail) ( H8283-Sigma).
Sammensetning 9, PBS-kontroll: Hver dose med PBS-kontrollvaksine inneholdt bare 0,05 ml PBS. Composition 9, PBS control: Each dose of PBS control vaccine contained only 0.05 ml of PBS.
Eksempel 4: Analyser i fisk og provokasjon: Example 4: Analyzes in fish and provocation:
Analysen inkluderte artene som er mest sensitive overfor C. rogercresseyi: regnbueørreter (Oncorhynchus mykiss) på 30 g fri fra infestering (n = 50/gruppe) uten tidligere vaksinasjon og uten antibiotikabehandling før studien startet. The analysis included the species most sensitive to C. rogercresseyi: rainbow trout (Oncorhynchus mykiss) of 30 g free from infestation (n = 50/group) without previous vaccination and without antibiotic treatment before the start of the study.
Gruppe 1 ble vaksinert med vaksine A, gruppe 2 med den ikke-spesifikke kontrollsammensetningen, gruppe 3 med adjuvanskontrollsammensetningen og gruppe 4 bare med PBS. Group 1 was vaccinated with vaccine A, group 2 with the non-specific control composition, group 3 with the adjuvant control composition and group 4 with PBS only.
Analysene ble utført ved akvakulturenheten i byen Mercedes [Unidad de Acuicultura de la ciudad de Mercedes](provinsen Buenos Aires, Argentina). Dyrene ble akklimatisert i løpet av 4 dager i dammer på 200 l ferskvann ved en temperatur på 17–20 ºC, med 5 mg/l oksygen (minimum), med en omsetningsrate på 1 l/time og med en tetthet på opptil 20 kg/m3. The analyzes were carried out at the aquaculture unit of the city of Mercedes [Unidad de Acuicultura de la ciudad de Mercedes] (Province of Buenos Aires, Argentina). The animals were acclimatized during 4 days in ponds of 200 l fresh water at a temperature of 17–20 ºC, with 5 mg/l oxygen (minimum), with a turnover rate of 1 l/h and with a density of up to 20 kg/ m3.
Fisker ble anestetisert med 20 % benzokain med en dose på 50 ppm. En enkelt immunisering ble utført (0,1 ml/fisk) intraperitonealt i den ventrale midtlinjen ved bruk av en 1 ml sprøyte og 25G x 5/8" nål. Kontrollgruppen ble vaksinert med 0,1 ml/fisk med sterilt PBS og merket med et kutt i fettfinnen for senere identifisering. Ingen reaksjoner på injeksjonsstedet / vevsskade / overlevelse ble observert. Etter vaksinasjonen ble fiskene plassert i identifiserte dammer der de ble værende uten stressende forhold inntil deres immuniseringsperiode var fullført. Ved 450-500 UTA ble fisker flyttet til dammer med sjøvann (25 ppt), før provokasjonen med infiserende stadier av C. rogercresseyi. Temperaturen ble overvåket daglig gjennom hele denne perioden. Fish were anesthetized with 20% benzocaine at a dose of 50 ppm. A single immunization was performed (0.1 ml/fish) intraperitoneally in the ventral midline using a 1 ml syringe and 25G x 5/8" needle. The control group was vaccinated with 0.1 ml/fish of sterile PBS and labeled with a cut in the adipose fin for later identification. No injection site reactions/tissue damage/survival were observed. After vaccination, fish were placed in identified ponds where they remained without stressful conditions until their immunization period was complete. At 450-500 UTA, fish were moved to ponds with seawater (25 ppt), before the challenge with infective stages of C. rogercresseyi The temperature was monitored daily throughout this period.
I løpet av dagene med tilpasning og i løpet av immuniseringsperioden ble fiskene matet med en kommersiell diett på 3,5 % kroppsvekt hver dag. Immuniseringsplan og prøvetaking er vist i figur 14. During the days of adaptation and during the immunization period, the fish were fed a commercial diet at 3.5% body weight each day. The immunization plan and sampling are shown in Figure 14.
Serum- og slimprøver ble tatt før vaksinasjon, på provokasjonstidspunktet og hver 10. dag etter dette for å bestemme immunresponsen på vaksinen. Gjennomsnittlig parasittbelastning for provosert fisk ble bestemt. Serum and mucus samples were taken before vaccination, at the time of challenge and every 10 days thereafter to determine the immune response to the vaccine. The average parasite load for challenged fish was determined.
Provokasjon med C. rogercresseyi Provocation with C. rogercresseyi
For kulturen med C rogercresseyi, spesifikt stadiet med små kopepoder, ble eggbærende hunner samlet inn ukentlig fra et filter på et oppdrettsanlegg for atlanterhavslaks ved bruk av pinsett med spiss. Prøver ble sendt til laboratoriet transportert i plastbeholdere som inneholdt sjøvann, med konstant luftesystem. Etter klekking ble larvestadiene trukket ut og plassert i begre som inneholdt 600 ml filtrert og sterilisert sjøvann under konstant lufting. De ble holdt i et Hotcold-S-kulturkammer ved en gjennomsnittlig temperatur på 13 ºC, inntil kopepoditter dukket opp. Så snart infeksiøse stadier var oppnådd, ble telling utført i et Neubauer-kammer, og konsentrasjon av eksemplarene på 4000 kopepoditter / 600 ml filtrert vann. For the culture of C rogercresseyi, specifically the small copepod stage, egg-bearing females were collected weekly from a filter at an Atlantic salmon farm using pointed tweezers. Samples were sent to the laboratory transported in plastic containers containing seawater, with a constant aeration system. After hatching, the larval stages were pulled out and placed in beakers containing 600 ml of filtered and sterilized seawater under constant aeration. They were kept in a Hotcold-S culture chamber at an average temperature of 13 ºC until copepodites emerged. As soon as infective stages were achieved, counting was carried out in a Neubauer chamber, and concentration of the specimens at 4000 copepodites / 600 ml of filtered water.
Provokasjon fant sted da fisken nådde 600UTA, så introduksjon av 4000 kopepoditter (i det spesifiserte mengden filtrert sjøvann) inn i hver 50 fisker/dam, og forventende en 50 % fikseringsrate. Mengden vann ble redusert til 50 %, oksygenbobling og vannstrømning ble stoppet i 6 timer etter infisering (statisk strømning), og etter dette ble de gjenopptatt og vannstrømningsraten ble holdt på 0,5 liter/time for å unngå å påvirke fiksering av C rogercresseyi. Provocation took place when the fish reached 600UTA, so introducing 4000 copepodites (in the specified amount of filtered seawater) into each 50 fish/pond, expecting a 50% fixation rate. The amount of water was reduced to 50%, oxygen bubbling and water flow were stopped for 6 h after infection (static flow), after which they were resumed and the water flow rate was kept at 0.5 L/h to avoid affecting fixation of C rogercresseyi.
Parasittbelastning etter provokasjon og reduksjonseffekt av C rogercresseyibelastninger ble bestemt i vaksinerte versus kontrollgrupper på fikseringstidspunktet, på tidspunktet for utvikling av juvenile stadier (Chalimus I, II, III) og ved utvikling av chalimus IV, voksne hunner og hanner. Parasite load after challenge and reduction effect of C rogercresseyi loads were determined in vaccinated versus control groups at the time of fixation, at the time of development of juvenile stages (Chalimus I, II, III) and at development of chalimus IV, adult females and males.
Behandling med peptidvaksiner Treatment with peptide vaccines
Behandlingen ble utført i den mest kommersialiserte arten, atlanterhavslaks (Salmo salar), ved bruk av 30 g eksemplarer fri for infestering (n = 50/gruppe) uten forutgående vaksinering, uten en historikk med nylig tilstand og uten antibiotikabehandlinger før oppstart av analysen. Analysene ble utført ved akvakulturenheten i byen Mercedes [Unidad de Acuicultura de la ciudad de Mercedes](provinsen Buenos Aires, Argentina). Fisker ble anestetisert med 20 % benzokain med en dose på 50 ppm. En enkelt immunisering ble utført (0,1 ml/fisk) intraperitonealt i den ventrale midtlinjen ved bruk av en 1 ml sprøyte og 25G x 5/8" nål. Kontrollgruppen ble vaksinert med 0,1 ml/fisk med sterilt PBS og merket med et kutt utført i fettfinnen for senere identifisering. Ikke noen reaksjoner på injeksjonsstedet / vevsskade / overlevelse ble observert. Provokasjon ble utført da atlanterhavslaksen nådde en vekt på 80 g, ved 600UTA. The treatment was carried out in the most commercialized species, Atlantic salmon (Salmo salar), using 30 g specimens free of infestation (n = 50/group) without previous vaccination, without a history of recent condition and without antibiotic treatments before starting the analysis. The analyzes were carried out at the aquaculture unit of the city of Mercedes [Unidad de Acuicultura de la ciudad de Mercedes] (province of Buenos Aires, Argentina). Fish were anesthetized with 20% benzocaine at a dose of 50 ppm. A single immunization was performed (0.1 ml/fish) intraperitoneally in the ventral midline using a 1 ml syringe and 25G x 5/8" needle. The control group was vaccinated with 0.1 ml/fish of sterile PBS and labeled with a cut made in the adipose fin for later identification No injection site reactions / tissue damage / survival observed Provocation was performed when the Atlantic salmon reached a weight of 80g, at 600UTA.
Eksempel 5: Serum og histologiske analyser Example 5: Serum and histological analyses
Serum- og slimprøver ble samlet inn for å teste spesifikke antistofftitere ved hjelp av en ELISA fra dag 0 eller pre-immun, opptil 10, 20, 30, 40 dager, på provokasjonstidspunktet (50 dager) og hver 10. dag etter provokasjon frem til 120 dager etter vaksinasjon (dpv). Serum and mucus samples were collected to test specific antibody titers using an ELISA from day 0 or pre-immune, up to 10, 20, 30, 40 days, at the time of challenge (50 days) and every 10 days after challenge until 120 days after vaccination (dpv).
Proteiner på 220 kDa (SEQ ID NO.1), 212 kDa (SEQ ID NO.2) og 173 kDa (SEQ ID NO. 3) ble brukt som fengslingsantigener (eng.: capture antigens) i konsentrasjoner på 50 µg/ml. Som et sekundært antistoff ble et anti-IgM fra coho-laks (Oncorhyncus kisutch) (IgG1 monoklonal fraksjon) (Grupo Bios-Bios, Chile) benyttet, og som et konjugert antistoff et antimurint IgG merket med peroksidase (geite-antimurint, Dako, Danmark) og ABTS (2,2'-azino-bis(3-etylbenzotiazolin-6-sulfonsyre) som et substrat. Proteins of 220 kDa (SEQ ID NO.1), 212 kDa (SEQ ID NO.2) and 173 kDa (SEQ ID NO. 3) were used as capture antigens (eng.: capture antigens) in concentrations of 50 µg/ml. As a secondary antibody, an anti-IgM from coho salmon (Oncorhyncus kisutch) (IgG1 monoclonal fraction) (Grupo Bios-Bios, Chile) was used, and as a conjugated antibody an anti-mouse IgG labeled with peroxidase (goat anti-mouse, Dako, Denmark) and ABTS (2,2'-azino-bis(3-ethylbenzothiazoline-6-sulfonic acid)) as a substrate.
For den histologiske analysen ble prøver av fiskeepidermis tatt med en skalpell, med kutt i fiskens abdominale og laterale soner på dag 0-10-20-30-40-50, 80 og 120. Kuttene ble innkapslet i 4 % formalinbuffer, og de ble farget med PAS- (periodic acid- Shiff) og PAS–Alcian Blue-farger. For the histological analysis, samples of fish epidermis were taken with a scalpel, with cuts in the abdominal and lateral zones of the fish on days 0-10-20-30-40-50, 80 and 120. The cuts were encapsulated in 4% formalin buffer, and they were stained with PAS (periodic acid-Shiff) and PAS–Alcian Blue stains.
Slim ble oppnådd ved å skrape fiskens overflate med en skalpell. Det ekstraherte materialet ble plassert i 15 ml rør med 2 ml PBS+-proteaseinhibitorcocktail (Promega G6521 50X) for derved å oppnå en tett suspensjon. Det ble sentrifugert ved 3000 g i 10 minutter og supernatanten ble samlet inn og holdt på -20 ºC. Prøver ble analysert ikke-fortynnet og i duplikat.5 serum- og slimprøver ble tatt per gruppe og per prøvetidspunkt for serumanalysen, og 3 prøver ble brukt til den histologiske analysen. Slime was obtained by scraping the fish's surface with a scalpel. The extracted material was placed in 15 ml tubes with 2 ml of PBS+ protease inhibitor cocktail (Promega G6521 50X) to thereby obtain a dense suspension. It was centrifuged at 3000 g for 10 minutes and the supernatant was collected and kept at -20 ºC. Samples were analyzed undiluted and in duplicate. 5 serum and mucus samples were taken per group and per sample time for the serum analysis, and 3 samples were used for the histological analysis.
Referanser: References:
Laemmli UK. Cleavage of structural proteins during the assembly of the head of bacteriophage T4 Nature 1970 227 (5259): 680–685. Laemmli UK. Cleavage of structural proteins during the assembly of the head of bacteriophage T4 Nature 1970 227 (5259): 680–685.
Cordwell SJ, Wilkins MR, Cerpa-Poljak A, Gooley AA, Duncan M, Williams KL, Humphery-Smith I., Cross-species identification of proteins separated by twodimensional gel electrophoresis using matrix-assisted laser desorption ionisation/timeof-flight mass spectrometry and amino acid composition. Electrophoresis.1995 Mar;16(3):438-43. Cordwell SJ, Wilkins MR, Cerpa-Poljak A, Gooley AA, Duncan M, Williams KL, Humphery-Smith I., Cross-species identification of proteins separated by twodimensional gel electrophoresis using matrix-assisted laser desorption ionisation/time-of-flight mass spectrometry and amino acid composition. Electrophoresis. 1995 Mar;16(3):438-43.
Raynard RS; Bricknell IR ,Billingsley PF, Nisbet AJ, Vigneau A, Sommerville C Development of vaccines against sea lice. Pest Manag Sci 58:569-575. Raynard RS; Bricknell IR, Billingsley PF, Nisbet AJ, Vigneau A, Sommerville C Development of vaccines against sea lice. Pest Manag Sci 58:569-575.
Kollner B , Wasserrab B , Kotterba G , Fischer U Evaluation of immune functions of rainbow trout (Oncorhynchus mykiss)—how can environmental influences be detected? Toxicology Letters 131 (2002) 83–95. Kollner B , Wasserrab B , Kotterba G , Fischer U Evaluation of immune functions of rainbow trout (Oncorhynchus mykiss)—how can environmental influences be detected? Toxicology Letters 131 (2002) 83–95.
Alvarez-Pellitero P. Fish immunity and parasite infections: from innate immunity to immunoprophylactic prospects. Veterinary Immunology and Immunopathology Vet Immunol Immunopathol. 2008 Dec 15;126(3-4):171-98. Epub 2008 Aug 3. Alvarez-Pellitero P. Fish immunity and parasite infections: from innate immunity to immunoprophylactic prospects. Veterinary Immunology and Immunopathology Vet Immunol Immunopathol. 2008 Dec 15;126(3-4):171-98. Epub 2008 Aug 3.
Tadiso TM, Krasnov A, Skugor S, Afanasyev S, Hordvik I, Nilsen F. Gene expression analyses of immune responses in Atlantic salmon during early stages of infection by salmon louse (Lepeophtheirus salmonis) revealed bi-phasic responses coinciding with the copepod-chalimus transition. BMC Genomics 2011, 12:141 Tadiso TM, Krasnov A, Skugor S, Afanasyev S, Hordvik I, Nilsen F. Gene expression analyzes of immune responses in Atlantic salmon during early stages of infection by salmon louse (Lepeophtheirus salmonis) revealed bi-phasic responses coinciding with the copepod-chalimus transition. BMC Genomics 2011, 12:141
Bravo S.The reproductive output of sea lice Caligus rogercresseyi under controlled conditions. Experimental Parasitology 125 (2010) 51–54 Bravo S. The reproductive output of sea lice Caligus rogercresseyi under controlled conditions. Experimental Parasitology 125 (2010) 51–54
Hermanson, G.T. (2008). Bioconjugate Techniques. 2nd edition, Academic Press, New York. (Part No.20036). Chapter 19 discusses carrier protein uses and the maleimideactivation chemistry. Hermanson, G.T. (2008). Bioconjugate Techniques. 2nd edition, Academic Press, New York. (Part No.20036). Chapter 19 discusses carrier protein uses and the maleimide activation chemistry.
Solid Phase Peptide Synthesis. I. The Synthesis of a Tetrapeptide Merrifield B. Journal of the American Chemical Society 196385 (14): 2149 Solid Phase Peptide Synthesis. I. The Synthesis of a Tetrapeptide Merrifield B. Journal of the American Chemical Society 196385 (14): 2149
Claims (9)
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
PCT/IB2012/052487 WO2013171548A2 (en) | 2012-05-17 | 2012-05-17 | Peptides inducing an immune response against copepods and/or the development of a mucous shield in fish; vaccines, uses and methods for modulating the fish immune response and/or for inducing development of a mucous shield in fish |
Publications (2)
Publication Number | Publication Date |
---|---|
NO20141508A1 NO20141508A1 (en) | 2015-02-05 |
NO342822B1 true NO342822B1 (en) | 2018-08-13 |
Family
ID=49584397
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
NO20141508A NO342822B1 (en) | 2012-05-17 | 2014-12-12 | Vaccine inducing an immune response to copepods and / or a mucus shield in fish comprising peptide combinations, and the use of the peptides to produce a vaccine. |
Country Status (5)
Country | Link |
---|---|
AR (1) | AR092320A1 (en) |
CA (1) | CA2873599A1 (en) |
GB (1) | GB2522119A (en) |
NO (1) | NO342822B1 (en) |
WO (1) | WO2013171548A2 (en) |
Families Citing this family (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
NO343723B1 (en) * | 2016-06-10 | 2019-05-20 | Aqua Health As | Peptides for the inhibition of trypsin and sea lice infestation. |
NO343281B1 (en) * | 2016-12-30 | 2019-01-14 | Aqua Health As | Peptides for the inhibition of trypsin and sea lice infestation. |
NO20211347A1 (en) * | 2021-11-08 | 2023-05-09 | Kapp Det Gode Haap As | Peptides for the inhibition of parasite infection |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2006010265A1 (en) * | 2004-07-28 | 2006-02-02 | National Research Council Of Canada | Recombinant vaccines against caligid copepods (sea lice) and antigen sequences thereof |
EP2623114A1 (en) * | 2010-09-28 | 2013-08-07 | Centro De Ingenieria Genetica Y Biotecnologia | Vaccine composition for controlling ectoparasite infestations |
-
2012
- 2012-05-17 WO PCT/IB2012/052487 patent/WO2013171548A2/en active Application Filing
- 2012-05-17 CA CA2873599A patent/CA2873599A1/en not_active Abandoned
- 2012-05-17 GB GB1421363.1A patent/GB2522119A/en not_active Withdrawn
-
2013
- 2013-05-16 AR ARP130101697A patent/AR092320A1/en unknown
-
2014
- 2014-12-12 NO NO20141508A patent/NO342822B1/en unknown
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2006010265A1 (en) * | 2004-07-28 | 2006-02-02 | National Research Council Of Canada | Recombinant vaccines against caligid copepods (sea lice) and antigen sequences thereof |
EP2405003A1 (en) * | 2004-07-28 | 2012-01-11 | National Research Council Of Canada | Recombinant vaccines against caligid copepods (sea lice) and antigen sequences thereof |
EP2623114A1 (en) * | 2010-09-28 | 2013-08-07 | Centro De Ingenieria Genetica Y Biotecnologia | Vaccine composition for controlling ectoparasite infestations |
Also Published As
Publication number | Publication date |
---|---|
AR092320A1 (en) | 2015-04-15 |
GB2522119A (en) | 2015-07-15 |
CA2873599A1 (en) | 2013-11-21 |
GB201421363D0 (en) | 2015-01-14 |
NO20141508A1 (en) | 2015-02-05 |
WO2013171548A2 (en) | 2013-11-21 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Nisbet et al. | Immunity to Haemonchus contortus and vaccine development | |
Rahman et al. | The outer membrane fraction of Flavobacterium psychrophilum induces protective immunity in rainbow trout and ayu | |
Li et al. | Protective effects of chicken egg yolk antibody (IgY) against experimental Vibrio splendidus infection in the sea cucumber (Apostichopus japonicus) | |
US8207132B2 (en) | Recombinant vaccines against caligid copepods (sea lice) and antigen sequences thereof | |
US9085634B2 (en) | Vaccine composition for controlling ectoparasite infestations | |
Yan et al. | Vaccination of goats with DNA vaccine encoding Dim-1 induced partial protection against Haemonchus contortus: A preliminary experimental study | |
JPH02500799A (en) | vaccine | |
NO342822B1 (en) | Vaccine inducing an immune response to copepods and / or a mucus shield in fish comprising peptide combinations, and the use of the peptides to produce a vaccine. | |
Frenette et al. | Expression of Interleukin-1β protein in vitro, ex vivo and in vivo salmonid models | |
US20050281836A1 (en) | Synthetic vaccine for tick control | |
Hoan et al. | Identification and immunogenicity of microneme protein 2 (EbMIC2) of Eimeria brunetti | |
WO2016162672A2 (en) | Avian vaccine | |
Das et al. | Assessment of protective response induced by whole antigens of fish ectoparasite, Argulus siamensis in rohu, Labeo rohita | |
EP2767290A1 (en) | Amino acid sequences for controlling pathogens | |
US10105424B2 (en) | Cooperia vaccine | |
Zhu et al. | Identification and characterization of a cDNA clone-encoding antigen of Eimeria acervulina | |
DK202170436A1 (en) | Sea Lice Vaccines | |
CN108727505B (en) | Immune protection combined protein and immune vaccine thereof | |
US20210061866A1 (en) | Sea lice antigens and vaccines | |
CN110655564B (en) | Combined protein and application thereof | |
Fereig | Serosurveillance and vaccine development as a strategy for control of Toxoplasma infection | |
Vericimo et al. | Anisakis | |
BG99888A (en) | Aplication of antihelminthic vaccines in the treatment of parasitic diseases related to loss of natural immunity | |
Selvarayar Arunkumar | Immunoprotection in sheep against Haemonchus contortus using its thiol-purified excretory/secretory proteins. | |
Ryckaert | Heat shock proteins as protective agents against the enteric redmouth syndrome caused by Yersinia ruckeri |