NL9300124A - Improved antenna configuration in supermarket shoplifting detection systems. - Google Patents

Improved antenna configuration in supermarket shoplifting detection systems. Download PDF

Info

Publication number
NL9300124A
NL9300124A NL9300124A NL9300124A NL9300124A NL 9300124 A NL9300124 A NL 9300124A NL 9300124 A NL9300124 A NL 9300124A NL 9300124 A NL9300124 A NL 9300124A NL 9300124 A NL9300124 A NL 9300124A
Authority
NL
Netherlands
Prior art keywords
checkout
blocks
supermarket
row
transmitter
Prior art date
Application number
NL9300124A
Other languages
Dutch (nl)
Original Assignee
Nedap Nv
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Nedap Nv filed Critical Nedap Nv
Priority to NL9300124A priority Critical patent/NL9300124A/en
Priority to DE1994612871 priority patent/DE69412871T2/en
Priority to EP19940200142 priority patent/EP0608039B1/en
Publication of NL9300124A publication Critical patent/NL9300124A/en

Links

Classifications

    • GPHYSICS
    • G08SIGNALLING
    • G08BSIGNALLING OR CALLING SYSTEMS; ORDER TELEGRAPHS; ALARM SYSTEMS
    • G08B13/00Burglar, theft or intruder alarms
    • G08B13/22Electrical actuation
    • G08B13/24Electrical actuation by interference with electromagnetic field distribution
    • G08B13/2402Electronic Article Surveillance [EAS], i.e. systems using tags for detecting removal of a tagged item from a secure area, e.g. tags for detecting shoplifting
    • G08B13/2405Electronic Article Surveillance [EAS], i.e. systems using tags for detecting removal of a tagged item from a secure area, e.g. tags for detecting shoplifting characterised by the tag technology used
    • G08B13/2414Electronic Article Surveillance [EAS], i.e. systems using tags for detecting removal of a tagged item from a secure area, e.g. tags for detecting shoplifting characterised by the tag technology used using inductive tags
    • GPHYSICS
    • G08SIGNALLING
    • G08BSIGNALLING OR CALLING SYSTEMS; ORDER TELEGRAPHS; ALARM SYSTEMS
    • G08B13/00Burglar, theft or intruder alarms
    • G08B13/22Electrical actuation
    • G08B13/24Electrical actuation by interference with electromagnetic field distribution
    • G08B13/2402Electronic Article Surveillance [EAS], i.e. systems using tags for detecting removal of a tagged item from a secure area, e.g. tags for detecting shoplifting
    • G08B13/2465Aspects related to the EAS system, e.g. system components other than tags
    • G08B13/2468Antenna in system and the related signal processing
    • G08B13/2474Antenna or antenna activator geometry, arrangement or layout

Landscapes

  • Physics & Mathematics (AREA)
  • Engineering & Computer Science (AREA)
  • Automation & Control Theory (AREA)
  • Computer Security & Cryptography (AREA)
  • Electromagnetism (AREA)
  • General Physics & Mathematics (AREA)
  • Signal Processing (AREA)
  • Burglar Alarm Systems (AREA)

Description

P.J.W.M. van BreemenP.J.W.M. van Breemen

Verbeterde antenneconfiguratie bij winkeldiefstaldetectiesystemen in supermarkten.Improved antenna configuration in supermarket shoplifting detection systems.

De uitvinding betreft een winkeldiefstaldetectiesysteem van het hoogfrequente type. Bij de bekende winkeldiefstaldetectiesystemen genereert een zendspoel ("zendantennezuil") een magnetisch wissel-veld met een variërende frequentie. Deze frequentie ligt over het algemeen in het gebied tussen 1 en 10 Mhz.The invention relates to a shoplifting detection system of the high-frequency type. In the prior art shoplifting detection systems, a transmit coil ("transmit antenna column") generates a magnetic alternating field of varying frequency. This frequency is generally in the range between 1 and 10 MHz.

Aan de te beveiligen goederen worden zogenaamde detectielabels bevestigd. Deze labels, ook wel wafers genoemd, bevatten een resonan- \ tiekring bestaande uit een spoel, afgestemd met een condensator. Ze kunnen bijvoorbeeld zijn uitgevoerd als een kunststof doosje met daarin een luchtspoel, als een plaketiket, opgebouwd met een vlakke geprinte spoel en een foliecondensator, of als een kring met verdeelde capaciteit en zelfinductie.So-called detection labels are attached to the goods to be protected. These labels, also called wafers, contain a resonant circuit consisting of a coil tuned with a capacitor. For example, they can be designed as a plastic box containing an air coil, as a adhesive label, built up with a flat printed coil and a film capacitor, or as a circuit with distributed capacity and self-inductance.

Als zo'n label in het magnetisch wisselveld van de zendspoel wordt gebracht, gaat op de momenten dat de frequentie van het wisselveld gelijk is aan de resonantiefrequentie van de kring in de detectie-label, die kring energie absorberen en meeresoneren. Dit meeresoneren kan worden gedetecteerd door een ontvangerschakeling die óf met de zendantenne verbonden is in een zogenaamd absorptiesysteem, óf met een tweede (ontvang)antenne gekoppeld is in een zogenaamd transmissiesysteem. Deze winkeldiefstaldetectiesystemen zijn bekend, o.m. uit de Nederlandse octrooiaanvragen 8202951 en 8900658 van aanvraagster.When such a label is brought into the magnetic alternating field of the headpiece, at times when the frequency of the alternating field is equal to the resonant frequency of the circuit in the detection label, those circuit absorb and resonate circuit energy. This resonance can be detected by a receiver circuit which is either connected to the transmit antenna in a so-called absorption system or coupled to a second (receive) antenna in a so-called transmission system. These shoplifting detection systems are known, inter alia from the Dutch patent applications 8202951 and 8900658 of the applicant.

De zend/ontvangantennes van een compleet winkeldiefstaldetectiesysteem worden bijvoorbeeld gerealiseerd in een rij rechtopstaande of zelfdragende antennespoelconstructi.es, ook wel zuilen genoemd. De zender- en/of ontvangerelectronica bevindt zich meestal ergens in de zuil, bij voorkeur in de voet. Tot dusver worden deze zuilen vooral toegepast in winkels, zoals kledingzaken, waarbij de zuilenrij vlak voor de uitgang wordt geplaatst. De zuilen worden in zo'n omgeving rechtstreeks op de vloer gemonteerd, waarbij de directe omgeving van elke zuil vrij is van obstakels. De detectiezuilen genereren aan beide zijden een magnetisch wisselveld. Evenzo hebben de zuilen een gevoeligheidsgebied dat zich aan weerszijden van de zuil uitstrekt. Om bij detectie van een label zo goed mogelijk vast te kunnen stellen wie er één bij zich heeft, is een optische signalering per doorgang gewenst. Tn een transmissiesysteem kan een label links of rechts van een ontvangerzuil passeren. Het labelsignaal in de ontvanger is in beide gevallen identiek. Het maakt geen verschil of het label door de linker- of door de rechterzender wordt aangestraald.The transmit / receive antennas of a complete shoplifting detection system are realized, for example, in a row of upright or self-supporting antenna coil constructions, also referred to as columns. The transmitter and / or receiver electronics are usually located somewhere in the column, preferably in the base. Until now, these columns have mainly been used in shops, such as clothing stores, where the row of columns is placed just in front of the exit. In such an environment, the columns are mounted directly on the floor, the immediate area of each column being free from obstacles. The detection columns generate a magnetic alternating field on both sides. Likewise, the columns have a sensitivity area that extends on either side of the column. In order to be able to determine as best as possible who is carrying one when a label is detected, optical signaling per passage is desirable. A transmission system can pass a label to the left or right of a receiver column. The label signal in the receiver is identical in both cases. It makes no difference whether the label is emitted by the left or the right transmitter.

Om toch onderscheid te kunnen maken in de passage links of rechts van een ontvangerzuil, worden de twee zenders links en rechts van deze zuil, dus de even- en oneven genummerde zenders in de rij, afwisselend in- en uitgeschakeld: gemultiplexed.In order to make a distinction in the passage to the left or right of a receiver column, the two transmitters on the left and right of this column, ie the odd and even numbered transmitters in the row, are alternately switched on and off: multiplexed.

Uit de fase van het multiplexsignaal, het signaal dat de even- en oneven zenders beurtelings aanzet, wordt in de ontvanger afgeleid of het label zich links of rechts van de antenne bevindt. Met deze informatie wordt dan de bij de doorgang behorende signalering aangestuurd. Het multiplexen moet gebeuren op een frequentie die hoog genoeg is om de reactiesnelheid van het systeem niet nadelig te beïnvloeden. In de praktijk is de ondergrens 2 Hz en de bovengrens de halve zwaaifrequentie (multiplexen per volledige zwaaiperiode).From the phase of the multiplex signal, the signal which alternately turns on the odd and even transmitters, it is deduced in the receiver whether the label is to the left or right of the antenna. The signaling associated with the passage is then controlled with this information. The multiplexing must be done at a frequency high enough not to affect the response speed of the system. In practice, the lower limit is 2 Hz and the upper limit is half the swing frequency (multiplexing per full swing period).

Een andere toepassing van winkeldiefstaldetectiesystemen van het hoogfrequente type betreft die in supermarkten, waar de afrekening van de gekochte goederen plaatsvindt aan zogenaamde.kassablokken. Figuur 1 toont deze opstelling.Another application of shoplifting detection systems of the high-frequency type concerns those in supermarkets, where the settlement of the purchased goods takes place on so-called checkout blocks. Figure 1 shows this arrangement.

Kassablokken (1) zijn meestal geconstrueerd met behulp van metalen balken, metalen of houten vlakken, voorzien van een lopende band (2), een (computer)kasregister (3) en soms van een barcode scanner en/of een weegschaal (5). In zo'n kassablok (1) zit een cassière (4); de klanten lopen voor het blok langs (9), en zetten de af te rekenen goederen op het begin van de lopende band (2). De band voert de goederen aan bij de cassière, die ze al dan niet met behulp van de barcodescanner (5) invoert in het kasregister (3), waarna de afrekening plaatsvindt. De goederen zijn intussen verder geschoven naar een plaats op het kassablok achter de cassière, richting uitgang van de supermarkt. Er vindt dus een splitsing plaats van de stroom van af te rekenen goederen en de bijbehorende klanten. In een typische supermarktsituatie staat een serie van deze kassablokken (1) op een rij, waar de klanten tussendoor lopen (9), richting uitgang. In een middelgrote supermarkt staan al gauw meer dan tien kassablokken (1). Deze opstelling wordt ook wel aangeduid met de term "check-out-systeem". Om te controleren of klanten, die het kassablok passeren (9), goederen meenemen, die niet op de band worden gezet en dus niet worden afgerekend, moeten de klanten een de-tectieveld passeren. Daartoe worden in het gangpad, dat ontstaat tussen twee kassablokken en waar de klanten passeren, twee detectie-zuilen (6) geplaatst: een zuil met daarin ontvangerelectronica (7) en een zuil met daarin zenderelectronica (8). Een detectiesysteem in deze toepassing wordt bij voorkeur gebouwd met twee afgeschermde antennes.Checkout blocks (1) are usually constructed using metal bars, metal or wooden surfaces, fitted with a conveyor belt (2), a (computer) cash register (3) and sometimes with a barcode scanner and / or a scale (5). In such a cash register block (1) there is a cashier (4); the customers walk in front of the block (9), and put the goods to be settled on the beginning of the conveyor belt (2). The belt delivers the goods to the cashier, who enters them into the cash register (3) with or without the help of the barcode scanner (5), after which the settlement takes place. In the meantime, the goods have been moved further to a place on the cash register behind the cashier, towards the supermarket exit. So there is a split of the flow of goods to be settled and the associated customers. In a typical supermarket situation, a series of these checkout blocks (1) are lined up, where customers walk in between (9), towards the exit. More than ten checkout blocks can easily be found in a medium-sized supermarket (1). This arrangement is also referred to as the "check-out system". In order to check whether customers who pass through the cash register (9) take goods that are not put on the belt and are therefore not paid, customers must pass a detection field. To this end, two detection columns (6) are placed in the aisle, which arises between two checkout blocks and where the customers pass: a column containing receiver electronics (7) and a column containing transmitter electronics (8). A detection system in this application is preferably built with two shielded antennas.

Figuur 2 toont een gedetailleerder uitvoeringsvoorbeeld van figuur 1. De voornoemde electronica-units zijn onderling verbonden via kabels (12).Figure 2 shows a more detailed embodiment of Figure 1. The aforementioned electronics units are interconnected via cables (12).

Door het toepassen van antennes die aan de achterzijde zijn afgeschermd met een afscherming (10) wordt ongewenste elektromagnetische koppeling tussen de zend- of ontvangantennes en de elektrische geleiders in, op, of aan het kassablok, voorkomen. Multipadpropagatie verschijnselen en parasitaire resonanties in constructiedelen en bekabeling in de kassablokken kunnen anders aanleiding geven voor verminderde detectiegevoeligheid en valse alarmen.The use of antennas shielded at the rear with a shield (10) prevents undesired electromagnetic coupling between the transmitting or receiving antennas and the electrical conductors in, on or at the cash register block. Otherwise, multipath propagation phenomena and parasitic resonances in construction parts and cabling in the checkout blocks can lead to reduced detection sensitivity and false alarms.

Zulke antennes zijn bekend, onder meer uit de octrooiaanvrage 9001033 van aanvraagster. Deze antennes hebben tevens als voordeel dat geen labeldetectie aan de achterzijde, waar artikelen met nog niet ontwaarde labels op de transportband (2) passeren, plaatsvindt, zodat geen ongewenst alarm kan worden veroorzaakt. Er wordt alleen een magnetisch wisselveld gegenereerd aan de voorzijde van de antenne, in het gebied waar de klanten passeren (9). Doordat de ontvanger in deze configuratie alleen een labelsignaal kan ontvangen, dat wordt opgewekt door het veld van de bijbehorende zender aan de overzijde van het gangpad, is de detectie van labels inherent selectief per doorgang en is het niet nodig om te multiplexer!.Such antennas are known, inter alia from applicant's patent application 9001033. These antennas also have the advantage that no label detection takes place at the rear, where articles with not yet deprecated labels pass on the conveyor belt (2), so that no false alarm can be caused. A magnetic alternating field is only generated at the front of the antenna, in the area where the customers pass (9). Since the receiver in this configuration can only receive a label signal generated by the field of the associated transmitter across the aisle, the detection of labels is inherently selective per pass and no multiplexer!

Er is nu een situatie ontstaan met afwisselend doorgang - niet-door-gang waarbij de klanten door de doorgang lopen en de kassablokken de niet-doorgang vormen. In de niet-doorgang is detectie van labels ongewenst.A situation has now arisen with alternating passage - non-passage where the customers walk through the passage and the checkout blocks form the non-passage. Detection of labels is undesirable in the non-pass.

Doordat de antennes nu alleen een (gewenste) detectie aan één zijde -de voorzijde- hebben, is een afwisselende volgorde van zenders en ontvangers niet langer noodzakelijk.Because the antennas now only have a (desired) detection on one side - the front -, an alternating order of transmitters and receivers is no longer necessary.

De werking van de afscherming in een afgeschermde zuil is niet perfect. Er blijft altijd, door de afscherming heen, een resterende koppeling over van het detectieveld met in de kassablokken aanwezige geleiders.The function of the shielding in a shielded column is not perfect. There always remains, through the shielding, a residual coupling of the detection field with conductors present in the checkout blocks.

De gevoeligheid van een systeem voor de resterende ongewenste effecten van multipadpropagatie, veroorzaakt door o.a. koppeling van zenders, via geleiders en apparatuur, met ontvangers aan de andere kant van een kassablok, en door parasitaire resonanties van geleiders in de kassablokken, kan verder verminderd worden door aan weerszijden van een kassablok hetzelfde zuiltype te monteren: afwisselend dus twee zenderzuilen of twee ontvangerzuilen per kassa.The sensitivity of a system to the residual unwanted effects of multipath propagation, caused by, among other things, coupling of transmitters, via conductors and equipment, with receivers on the other side of a cash register, and by parasitic resonances of conductors in the cash blocks, can be further reduced by to mount the same column type on either side of a cash register block: alternately two transmitter columns or two receiver columns per cash register.

Het detectiebereik en de gevoeligheid voor ongewenste koppeling via het kassablok tussen twee zuilen van hetzelfde type is veel lager dan tussen een zender- en een ontvangerzuil. Daardoor geven gel abel- dfi artikelen op de lopende band van het kassablok minder aanleiding tot alarm.The detection range and the sensitivity for unwanted coupling via the cash register block between two columns of the same type is much lower than between a transmitter and a receiver column. As a result, gel abeldfi articles on the conveyor belt of the cash register block give less cause for alarm.

Naar de huidige stand van de techniek in een checkout·systeem is iedere antenne verbonden met de bij die antenne behorende zender- of ontvangerelektronica, al dan niet in de antennezuil gemonteerd.According to the current state of the art in a checkout system, each antenna is connected to the transmitter or receiver electronics associated with that antenna, whether or not mounted in the antenna column.

In een andere uitvoeringsvorm wordt een afgeschermde antenne met een coaxkabel (11, fig. 1) aangesloten op de bijbehorende ontvanger- of zenderelectronica-eenheid die zich dan in een aparte kast buiten de zuilen bevindt.In another embodiment, a shielded antenna is connected with a coaxial cable (11, Fig. 1) to the associated receiver or transmitter electronics unit, which is then located in a separate cabinet outside the columns.

Als een checkoutsysteem met afwisselend twee zendantennes of twee ontvangantennes per kassablok op deze wijze wordt opgebouwd, bevat een kassablok afwisselend twee zender- en twee ontvangerelectronica-units.If a checkout system with alternating two transmit antennas or two receive antennas per checkout block is constructed in this way, a checkout block will alternate between two transmitter and two receiver electronics units.

In de antenneconfiguratie volgens de uitvinding (zie figuur 2) wordt een sterke kostprijsreductie gerealiseerd door in plaats van twee electronica-units van het zender- of ontvangertype per kassablok nog slechts één electronica-unit te plaatsen die wordt aangesloten op de beide antennes aan weerszijden van het kassablok. (De uitvinding kan overigens ook worden toegepast in een systeem met niet-afgeschermde zuilen.)In the antenna configuration according to the invention (see figure 2), a strong cost price reduction is realized by instead of placing two electronics units of the transmitter or receiver type per cash block, only one electronics unit that is connected to the two antennas on either side of the the checkout block. (Incidentally, the invention can also be applied in a system with unshielded columns.)

In zijn eenvoudigste uitvoeringsvorm (principe schema in figuur 3) worden de beide antennes (6) met afscherming (10) aan een kassablok (1) parallel geschakeld op de corresponderende electronica-unit, bijvoorbeeld via een koppeltransformator, een powersplitter/combiner (13) of een richtingskoppeling. Door nu de zenderunits (8) te laten multiplexer), d.w.z. om en om afwisselend in te schakelen, volgens het principe dat is beschreven voor een vrijstaande rij zuilen, wordt bereikt dat gelijktijdig detectie plaatsvindt in de doorgangen aan beide zijden van kassablokken met daarin een zenderunit, waarbij kassablokken met in- en uitgeschakelde zenders elkaar afwisselen. Als de doorgangen opvolgend genummerd worden volgens de reeks 1, 2, 3, 4, 5, enz. is de detectie afwisselend ingeschakeld in de doorgangen 1, 2, 5, 6, 9, 10, enz. of in de doorgangen 3, 4, 7, 8, 11, 12, enz.In its simplest embodiment (principle diagram in figure 3), the two antennas (6) with shielding (10) on a checkout block (1) are connected in parallel to the corresponding electronics unit, for example via a torque transformer, a power splitter / combiner (13) or a directional coupling. By now having the transmitter units (8) multiplexer, ie alternately switching on, according to the principle described for a free-standing row of columns, it is achieved that detection takes place simultaneously in the passages on both sides of a cash block containing a transmitter unit, where cash blocks with transmitters switched on and off alternate. If the passages are sequentially numbered according to the sequence 1, 2, 3, 4, 5, etc., the detection is alternately enabled in the passages 1, 2, 5, 6, 9, 10, etc. or in the passages 3, 4 , 7, 8, 11, 12, etc.

Uit de fase van het multiplexsignaal wordt in de ontvangers afgeleid in welke doorgang er detectie plaatsvindt. Met deze informatie wordt de bij de doorgang horende signalering aangestuurd. De detectie in de doorgangen wordt dus twee om twee afwisselend ingeschakeld.From the phase of the multiplex signal it is deduced in the receivers in which passage detection takes place. The signaling associated with the passage is controlled with this information. The detection in the passages is therefore switched on alternately two by two.

Deze uitvoeringsvorm heeft enige elektrische verliezen tot gevolg, veroorzaakt door de parallelschakeling via een impedantietransforma-tor van twee antennes, hetgeen zich uit in een vermindering van detectiegevoeligheid van 2 x 3 dB.This embodiment results in some electrical losses caused by the parallel connection via an impedance transformer of two antennas, which results in a reduction of detection sensitivity of 2 x 3 dB.

Het multiplexen van de zenders zelf heeft, evenals in een vrijstaande zuilenrij, tot gevolg dat ze maar de helft van de tijd zijn ingeschakeld. Hierdoor is de hoeveelheid labelinformatie per tijdseenheid niet maximaal. Dit heeft een iets verminderde reactiesnelheid of gevoeligheid tot gevolg. In de praktijk is dit effect nauwelijks merkbaar.The multiplexing of the transmitters themselves, as in a freestanding column row, means that they are switched on only half the time. As a result, the amount of label information per unit time is not maximum. This results in a slightly reduced reaction speed or sensitivity. In practice, this effect is hardly noticeable.

Om deze verliezen te vermijden, heeft een andere uitvoeringsvorm van het systeem de voorkeur. Figuur 4 toont hiervan het principeschema. In deze variant wordt tussen twee antennes (6) en een zenderunit (8) of ontvangerunit (7) een bij voorkeur electronische schakelaar (14) geplaatst. Deze schakelaar gedraagt zich als een snel relais met een wissel contact en kan bijvoorbeeld worden gerealiseerd met PIN-diodes of FETS als schakelelement. Bij lage multiplexfrequenties is een electro-mechanisch relais ook mogelijk. Deze schakelaar komt in de plaats van de koppeltransformator die gebruikt wordt om twee antennes parallel te schakelen.To avoid these losses, another embodiment of the system is preferred. Figure 4 shows the schematic diagram of this. In this variant, a preferably electronic switch (14) is placed between two antennas (6) and a transmitter unit (8) or receiver unit (7). This switch behaves like a fast relay with a changeover contact and can, for example, be implemented with PIN diodes or FETS as switching element. An electro-mechanical relay is also possible at low multiplex frequencies. This switch replaces the torque transformer used to connect two antennas in parallel.

Op deze manier wordt bereikt dat afwisselend alleen die antennes worden doorverbonden die actief worden gebruikt voor detectie.In this way it is achieved that alternately only those antennas are connected that are actively used for detection.

Daarmee worden de verliezen, veroorzaakt door de parallel geschakelde antenne die op dat moment niet meedoet met de detectie, voorkomen. Tevens zijn de zenders continu ingeschakeld.This prevents losses caused by the parallel-connected antenna that is not currently participating in the detection. The channels are also switched on continuously.

De prestaties van een systeem dat op deze manier is opgebouwd, zijn vergelijkbaar met die van een vrijstaande, zuilenrij waarin wordt gemultiplexed door de even- en oneven zenders afwisselend in te schakelen, terwijl het aantal, electronica-units is gehalveerd.The performance of a system constructed in this way is comparable to that of a freestanding, column array multiplexed by alternately switching on the odd and odd transmitters, while the number of electronics units is halved.

In deze variant wordt gemultiplexed tussen even en oneven doorgangen links en rechts naast iedere kassa, en niet tussen de doorgangen twee om twee zoals in de variant zonder antenne-omschakelaars. Dit is niet van belang voor de werking van een systeem.In this variant, multiplexing takes place between even and odd passages to the left and right of each cash register, and not between passages two to two as in the variant without antenna switches. This is not important for the operation of a system.

In principe is het ook mogelijk om meer dan tweevoudig te multi-plexen, bijvoorbeeld 4-voudig. Dit spaart extra zenders en ontvangers. In de praktijk gaat dit weer ten koste van de reactiesnelheid en de gevoeligheid van het systeem. Deze eisen stellen een ondergrens aan de tijd dat eer ' ^elsignaal van minimurrsterktc. aanwezig moet zijn om een betrouwbare detectie mogelijk te maken. Ook zou een ingewikkelde bekabeling nodig zijn.In principle, it is also possible to multiplex more than two-fold, for example 4-fold. This saves extra transmitters and receivers. In practice, this is at the expense of the reaction speed and the sensitivity of the system. These requirements place a lower limit on the time that first signal of minimum strength. must be present to enable reliable detection. Complicated cabling would also be required.

Afhankelijk van de breedte van een doorgang en de kwaliteit, van de toegepaste labels kan een afweging worden gemaakt tussen kostprijs en systeemprestaties.Depending on the width of a passage and the quality of the labels used, a trade-off can be made between cost price and system performance.

Claims (3)

1. Een systeem voor het detecteren van winkeldiefstal in de doorgangen tussen een rij kassablokken in bijvoorbeeld een supermarkt, met het kenmerk, dat per kassaolok één electronica-unit wordt toegepast die slechts één ontvangerschakeling of één zen-derschakeling bevat, waarbij zowel de zender in het ene kassablok als ook de ontvanger in het naburige kassablok simultaan worden omgeschakeld tussen twee aan weerszijden van de betreffende kassablokken bevestigde antennesystemen, zodanig dat bij het detecteren van een labelsignaal kan worden vastgesteld in welke passage tussen twee aangrenzende kassablokken het betreffende label zich bevindt.A system for detecting shoplifting in the passageways between a row of checkout blocks in, for example, a supermarket, characterized in that one electronics unit is used per checkout counter, which contains only one receiver circuit or one transmitter circuit, whereby both the transmitter in the one checkout block as well as the receiver in the neighboring checkout block are simultaneously switched between two antenna systems mounted on either side of the respective checkout blocks, such that upon detecting a tag signal it can be determined in which passage between two adjacent checkout blocks the relevant tag is located. 2. Een systeem voor het detecteren van winkeldiefstal in de doorgangen tussen een rij kassablokken in bijvoorbeeld een supermarkt volgens conclusie 1, met het kenmerk, dat het in deze conclusie genoemde simultaan omschakelen continu repeterend plaatsvindt met behulp van electronische schakelaars of relais, met zodanig kleine tijdsintervallen, dat tijdens de passage van iemand met een label zeker detectie optreedt.A system for detecting shoplifting in the passages between a row of checkout blocks in, for example, a supermarket according to claim 1, characterized in that the simultaneous switching referred to in this claim takes place continuously with the aid of electronic switches or relays, with such small time intervals, that detection certainly occurs during the passage of someone with a label. 3. Een systeem voor het detecteren van winkeldiefstal in de doorgangen tussen een rij kassablokken in bijvoorbeeld een supermarkt volgens één of meerdere der voorgaande conclusies, met het kenmerk, dat per kassablok één electronica-unit wordt toegepast die slechts één ontvangerschakeling of één zenderschakeling bevat, waarbij twéé antennesystemen op iedere unit parallel worden geschakeld, eventueel met behulp van powersplitters of transformatoren, waarbij de selectiviteit ten aanzien van de doorgang waarin detectie van een labelsignaal plaatsvindt wordt bereikt door afwisselend de zender aan de Linkerzijde en de zender aan de rechterzijde van elke ontvanger in en uit te schakelen. Een systeem voor het detecteren van winkeldiefstal in de doorgangen tussen een rij kassablokken in bijvoorbeeld een supermarkt, volgens één of meerdere der voorgaande conclusies, met het kenmerk, dat de antennesystemen elk aan één zijde zijn voorzien van een electromagnetische afscherming, bijvoorbeeld bestaande uit metaalgaas. Een systeem voor het detecteren van winkeldiefstal in de doorgangen tussen een rij kassablokken in bijvoorbeeld een supermarkt, volgens één of meerdere der voorgaande conclusies, met het kenmerk, dat een soortgelijke opsplitsing van de antennesystemen als aangebracht aan weerszijden van een kassablok, wordt toegepast aan weerszijden van andere in het te beveiligen gebied aanwezige obstakels zoals bijvoorbeeld pilaren. Een systeem voor het detecteren van winkeldiefstal in de doorgangen tussen een rij kassablokken in bijvoorbeeld een supermarkt, volgens één of meerdere der voorgaande conclusies, met het kenmerk, dat een soortgelijke opsplitsing van de antennesystemen als aangebracht aan weerszijden van een kassablok, wordt toegepast om een gebied te overbruggen waar detectie van labels niet nodig of niet gewenst is.A system for detecting shoplifting in the passageways between a row of checkout blocks in, for example, a supermarket, according to one or more of the preceding claims, characterized in that one electronics unit is used per checkout block, containing only one receiver circuit or one transmitter circuit, with two antenna systems on each unit being connected in parallel, possibly using power splitters or transformers, the selectivity of the passage in which a label signal is detected being achieved by alternating the transmitter on the Left and the transmitter on the right of each receiver switch on and off. A system for detecting shoplifting in the passages between a row of checkout blocks in, for example, a supermarket, according to one or more of the preceding claims, characterized in that the antenna systems are each provided on one side with an electromagnetic shield, for instance consisting of metal mesh. A system for detecting shoplifting in the passageways between a row of checkout blocks in, for example, a supermarket, according to one or more of the preceding claims, characterized in that a similar division of the antenna systems as arranged on both sides of a checkout block is applied on both sides other obstacles present in the area to be protected, such as pillars. A system for detecting shoplifting in the passageways between a row of checkout blocks in, for example, a supermarket, according to one or more of the preceding claims, characterized in that a similar division of the antenna systems as arranged on either side of a checkout block is used to bridge an area where label detection is not needed or not desired.
NL9300124A 1993-01-22 1993-01-22 Improved antenna configuration in supermarket shoplifting detection systems. NL9300124A (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
NL9300124A NL9300124A (en) 1993-01-22 1993-01-22 Improved antenna configuration in supermarket shoplifting detection systems.
DE1994612871 DE69412871T2 (en) 1993-01-22 1994-01-21 Shoplifting detection system, particularly suitable for use in supermarkets, and a shop design with such a system
EP19940200142 EP0608039B1 (en) 1993-01-22 1994-01-21 A shoplifting detection system, in particular suitable for use in supermarkets, and a shop design comprising such a shoplifting detection system

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
NL9300124 1993-01-22
NL9300124A NL9300124A (en) 1993-01-22 1993-01-22 Improved antenna configuration in supermarket shoplifting detection systems.

Publications (1)

Publication Number Publication Date
NL9300124A true NL9300124A (en) 1994-08-16

Family

ID=19861956

Family Applications (1)

Application Number Title Priority Date Filing Date
NL9300124A NL9300124A (en) 1993-01-22 1993-01-22 Improved antenna configuration in supermarket shoplifting detection systems.

Country Status (3)

Country Link
EP (1) EP0608039B1 (en)
DE (1) DE69412871T2 (en)
NL (1) NL9300124A (en)

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7119692B2 (en) 2003-11-10 2006-10-10 3M Innovative Properties Company System for detecting radio-frequency identification tags
US7372364B2 (en) 2003-11-10 2008-05-13 3M Innovative Properties Company Algorithm for RFID security
FR2981547A1 (en) * 2011-10-24 2013-04-26 Jean Yves Patachek Quick simulation system for bracelet watch, has blister pack provided with theft protection device that is arranged in specific position in bracelet watch, where watch is arranged with space in which magnet is arranged

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4274090A (en) * 1980-02-19 1981-06-16 Knogo Corporation Detection of articles in adjacent passageways
NL9001033A (en) * 1990-05-01 1991-12-02 Nedap Nv SHOP THEFT DETECTION SYSTEM WITH PARTIALLY PROTECTED ANTENNAS.

Also Published As

Publication number Publication date
DE69412871D1 (en) 1998-10-15
DE69412871T2 (en) 1999-04-08
EP0608039B1 (en) 1998-09-02
EP0608039A1 (en) 1994-07-27

Similar Documents

Publication Publication Date Title
US6154135A (en) Apparatus for capturing data and deactivating electronic article surveillance tags
US5959531A (en) Optical interface between receiver and tag response signal analyzer in RFID system for detecting low power resonant tags
US7374092B2 (en) Combined data reader and electronic article surveillance (EAS) system
US5955950A (en) Low noise signal generator for use with an RFID system
AU595585B2 (en) Security tag deactivation system
CA1327841C (en) Load isolated article surveillance system and antenna assembly
US7310070B1 (en) Radio frequency identification shelf antenna with a distributed pattern for localized tag detection
US4870391A (en) Multiple frequency theft detection system
US20070075911A1 (en) Antenna device used in radio-communications within short communication range and article container
CA2197042A1 (en) Self-service checkout system
DE69519493T2 (en) Magnetomechanical goods surveillance label with tunable resonance frequency
NL9001033A (en) SHOP THEFT DETECTION SYSTEM WITH PARTIALLY PROTECTED ANTENNAS.
KR20020073486A (en) Security tag detection and localization system
NL8601326A (en) STANDARD FOR PRESENTING OBJECTS.
CA2187129A1 (en) Open shelf bar
NL9300124A (en) Improved antenna configuration in supermarket shoplifting detection systems.
CA2153097C (en) Electronic article surveillance input configuration control system employing expert system techniques for dynamic optimization
CA2175635A1 (en) Detection of goods on the bottom rack of a cart
ATE140813T1 (en) DETECTION DEVICE FOR THEFT DETECTION LABELS
AU753617B2 (en) Rfid system for detecting low power resonant tags
JP3897228B2 (en) Shoplifting prevention method and apparatus for display goods
CN210852602U (en) Intelligent shopping cart
JPH08138160A (en) Theft preventive device
WO2003096296A1 (en) Bulk activation/deactivation of eletronic article surveillance tags
GB2388472A (en) System for the bulk magnetisation or demagnetisation of security tags

Legal Events

Date Code Title Description
A1B A search report has been drawn up
BV The patent application has lapsed