NL2034221B1 - Anti-h1n1 subtype influenza virus nanoparticles based on self-assembled ferritin, preparation method and application thereof - Google Patents
Anti-h1n1 subtype influenza virus nanoparticles based on self-assembled ferritin, preparation method and application thereof Download PDFInfo
- Publication number
- NL2034221B1 NL2034221B1 NL2034221A NL2034221A NL2034221B1 NL 2034221 B1 NL2034221 B1 NL 2034221B1 NL 2034221 A NL2034221 A NL 2034221A NL 2034221 A NL2034221 A NL 2034221A NL 2034221 B1 NL2034221 B1 NL 2034221B1
- Authority
- NL
- Netherlands
- Prior art keywords
- signal peptide
- influenza virus
- nanoparticles
- seq
- subtype
- Prior art date
Links
- 241000712461 unidentified influenza virus Species 0.000 title claims abstract description 71
- 239000002105 nanoparticle Substances 0.000 title claims abstract description 55
- 238000008416 Ferritin Methods 0.000 title claims abstract description 38
- 108050000784 Ferritin Proteins 0.000 title claims abstract description 36
- 102000008857 Ferritin Human genes 0.000 title claims abstract description 36
- 238000002360 preparation method Methods 0.000 title claims abstract description 12
- 102000037865 fusion proteins Human genes 0.000 claims abstract description 29
- 108020001507 fusion proteins Proteins 0.000 claims abstract description 29
- 206010022000 influenza Diseases 0.000 claims abstract description 26
- 241000700605 Viruses Species 0.000 claims abstract description 20
- 239000000178 monomer Substances 0.000 claims abstract description 12
- 238000000338 in vitro Methods 0.000 claims abstract description 10
- 101710154606 Hemagglutinin Proteins 0.000 claims abstract description 9
- 101710093908 Outer capsid protein VP4 Proteins 0.000 claims abstract description 9
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 claims abstract description 9
- 101710176177 Protein A56 Proteins 0.000 claims abstract description 9
- 108090000623 proteins and genes Proteins 0.000 claims description 49
- 241000197306 H1N1 subtype Species 0.000 claims description 21
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 14
- 230000014509 gene expression Effects 0.000 claims description 14
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 13
- 238000000034 method Methods 0.000 claims description 13
- 108010075254 C-Peptide Proteins 0.000 claims description 5
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 4
- 239000003814 drug Substances 0.000 claims description 4
- 239000002773 nucleotide Substances 0.000 claims description 4
- 125000003729 nucleotide group Chemical group 0.000 claims description 4
- 239000013598 vector Substances 0.000 claims description 4
- 239000013613 expression plasmid Substances 0.000 claims description 3
- 230000002265 prevention Effects 0.000 abstract description 5
- 238000010353 genetic engineering Methods 0.000 abstract description 4
- 238000012544 monitoring process Methods 0.000 abstract description 4
- 210000004027 cell Anatomy 0.000 description 44
- 102000004169 proteins and genes Human genes 0.000 description 32
- 239000013612 plasmid Substances 0.000 description 21
- 239000003292 glue Substances 0.000 description 20
- 238000005406 washing Methods 0.000 description 16
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 14
- 238000006243 chemical reaction Methods 0.000 description 12
- 239000000243 solution Substances 0.000 description 12
- 108020004414 DNA Proteins 0.000 description 11
- 238000010586 diagram Methods 0.000 description 11
- 238000001962 electrophoresis Methods 0.000 description 11
- 239000000872 buffer Substances 0.000 description 10
- 102000036639 antigens Human genes 0.000 description 9
- 108091007433 antigens Proteins 0.000 description 9
- 238000001514 detection method Methods 0.000 description 9
- 238000012546 transfer Methods 0.000 description 9
- 238000001976 enzyme digestion Methods 0.000 description 8
- 238000007789 sealing Methods 0.000 description 8
- 241000699666 Mus <mouse, genus> Species 0.000 description 7
- 241000699670 Mus sp. Species 0.000 description 7
- 239000000427 antigen Substances 0.000 description 7
- 238000001262 western blot Methods 0.000 description 7
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 6
- 239000012634 fragment Substances 0.000 description 6
- 239000002609 medium Substances 0.000 description 6
- 238000002791 soaking Methods 0.000 description 6
- 230000027455 binding Effects 0.000 description 5
- 238000004113 cell culture Methods 0.000 description 5
- 239000000499 gel Substances 0.000 description 5
- 239000007788 liquid Substances 0.000 description 5
- 238000002156 mixing Methods 0.000 description 5
- 239000000203 mixture Substances 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- 239000006228 supernatant Substances 0.000 description 5
- 239000013638 trimer Substances 0.000 description 5
- 229920001817 Agar Polymers 0.000 description 4
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 4
- 230000003833 cell viability Effects 0.000 description 4
- 230000034994 death Effects 0.000 description 4
- 231100000517 death Toxicity 0.000 description 4
- 238000003745 diagnosis Methods 0.000 description 4
- 238000004520 electroporation Methods 0.000 description 4
- 230000004927 fusion Effects 0.000 description 4
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 4
- 208000015181 infectious disease Diseases 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 210000003928 nasal cavity Anatomy 0.000 description 4
- 239000002245 particle Substances 0.000 description 4
- 238000007747 plating Methods 0.000 description 4
- 230000035945 sensitivity Effects 0.000 description 4
- 238000000926 separation method Methods 0.000 description 4
- 239000000758 substrate Substances 0.000 description 4
- 229910021642 ultra pure water Inorganic materials 0.000 description 4
- 239000012498 ultrapure water Substances 0.000 description 4
- 238000011144 upstream manufacturing Methods 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- 101150074355 GS gene Proteins 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 239000006180 TBST buffer Substances 0.000 description 3
- 239000006285 cell suspension Substances 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 239000003636 conditioned culture medium Substances 0.000 description 3
- 238000005520 cutting process Methods 0.000 description 3
- 229940079593 drug Drugs 0.000 description 3
- 239000011521 glass Substances 0.000 description 3
- 230000012010 growth Effects 0.000 description 3
- 239000001963 growth medium Substances 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 229910052742 iron Inorganic materials 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 108090000765 processed proteins & peptides Proteins 0.000 description 3
- 238000012216 screening Methods 0.000 description 3
- 230000004083 survival effect Effects 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- 230000035899 viability Effects 0.000 description 3
- 229920000936 Agarose Polymers 0.000 description 2
- 241000282836 Camelus dromedarius Species 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- 206010069767 H1N1 influenza Diseases 0.000 description 2
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- KWYHDKDOAIKMQN-UHFFFAOYSA-N N,N,N',N'-tetramethylethylenediamine Chemical compound CN(C)CCN(C)C KWYHDKDOAIKMQN-UHFFFAOYSA-N 0.000 description 2
- 208000009620 Orthomyxoviridae Infections Diseases 0.000 description 2
- 238000002123 RNA extraction Methods 0.000 description 2
- 239000011543 agarose gel Substances 0.000 description 2
- 230000000840 anti-viral effect Effects 0.000 description 2
- 230000002155 anti-virotic effect Effects 0.000 description 2
- 238000009835 boiling Methods 0.000 description 2
- 229910002092 carbon dioxide Inorganic materials 0.000 description 2
- 239000001569 carbon dioxide Substances 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 238000007865 diluting Methods 0.000 description 2
- 230000000694 effects Effects 0.000 description 2
- 239000012909 foetal bovine serum Substances 0.000 description 2
- 238000001502 gel electrophoresis Methods 0.000 description 2
- 238000012224 gene deletion Methods 0.000 description 2
- HBTBNXFVJYRYGI-UHFFFAOYSA-M hexadecane-1-sulfinate Chemical compound CCCCCCCCCCCCCCCCS([O-])=O HBTBNXFVJYRYGI-UHFFFAOYSA-M 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 239000002091 nanocage Substances 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 238000001742 protein purification Methods 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 108091008146 restriction endonucleases Proteins 0.000 description 2
- 238000003757 reverse transcription PCR Methods 0.000 description 2
- 230000001932 seasonal effect Effects 0.000 description 2
- 230000002269 spontaneous effect Effects 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 201000010740 swine influenza Diseases 0.000 description 2
- 235000002198 Annona diversifolia Nutrition 0.000 description 1
- 241000282832 Camelidae Species 0.000 description 1
- 241000282828 Camelus bactrianus Species 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 230000004544 DNA amplification Effects 0.000 description 1
- 208000000059 Dyspnea Diseases 0.000 description 1
- 206010013975 Dyspnoeas Diseases 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 101710157275 Ferritin subunit Proteins 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 208000002979 Influenza in Birds Diseases 0.000 description 1
- 229940124873 Influenza virus vaccine Drugs 0.000 description 1
- 241000282842 Lama glama Species 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 239000002033 PVDF binder Substances 0.000 description 1
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 1
- 241000193996 Streptococcus pyogenes Species 0.000 description 1
- 101000815632 Streptococcus suis (strain 05ZYH33) Rqc2 homolog RqcH Proteins 0.000 description 1
- 241000725681 Swine influenza virus Species 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- 239000002250 absorbent Substances 0.000 description 1
- 230000002745 absorbent Effects 0.000 description 1
- 239000000980 acid dye Substances 0.000 description 1
- 239000008186 active pharmaceutical agent Substances 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 238000007605 air drying Methods 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 238000000137 annealing Methods 0.000 description 1
- 206010064097 avian influenza Diseases 0.000 description 1
- 230000005540 biological transmission Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 238000007664 blowing Methods 0.000 description 1
- 230000001680 brushing effect Effects 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 229910002091 carbon monoxide Inorganic materials 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 239000008367 deionised water Substances 0.000 description 1
- 229910021641 deionized water Inorganic materials 0.000 description 1
- 239000003398 denaturant Substances 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 238000003113 dilution method Methods 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 238000009509 drug development Methods 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 230000008020 evaporation Effects 0.000 description 1
- 230000017188 evasion or tolerance of host immune response Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 102000036072 fibronectin binding proteins Human genes 0.000 description 1
- 238000011049 filling Methods 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 238000013467 fragmentation Methods 0.000 description 1
- 238000006062 fragmentation reaction Methods 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 238000000227 grinding Methods 0.000 description 1
- 208000021760 high fever Diseases 0.000 description 1
- 239000000710 homodimer Substances 0.000 description 1
- MHAJPDPJQMAIIY-UHFFFAOYSA-N hydrogen peroxide Substances OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 239000012160 loading buffer Substances 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 239000011259 mixed solution Substances 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 210000004897 n-terminal region Anatomy 0.000 description 1
- 239000002539 nanocarrier Substances 0.000 description 1
- 239000002086 nanomaterial Substances 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 1
- 230000009465 prokaryotic expression Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 239000012264 purified product Substances 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 239000003161 ribonuclease inhibitor Substances 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 238000001338 self-assembly Methods 0.000 description 1
- 238000004904 shortening Methods 0.000 description 1
- 208000013220 shortness of breath Diseases 0.000 description 1
- 238000003998 size exclusion chromatography high performance liquid chromatography Methods 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 230000003068 static effect Effects 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 238000004114 suspension culture Methods 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 238000010998 test method Methods 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1018—Orthomyxoviridae, e.g. influenza virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/42—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum viral
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/44—Antibodies bound to carriers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B82—NANOTECHNOLOGY
- B82Y—SPECIFIC USES OR APPLICATIONS OF NANOSTRUCTURES; MEASUREMENT OR ANALYSIS OF NANOSTRUCTURES; MANUFACTURE OR TREATMENT OF NANOSTRUCTURES
- B82Y40/00—Manufacture or treatment of nanostructures
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B82—NANOTECHNOLOGY
- B82Y—SPECIFIC USES OR APPLICATIONS OF NANOSTRUCTURES; MEASUREMENT OR ANALYSIS OF NANOSTRUCTURES; MANUFACTURE OR TREATMENT OF NANOSTRUCTURES
- B82Y5/00—Nanobiotechnology or nanomedicine, e.g. protein engineering or drug delivery
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/315—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/22—Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/735—Fusion polypeptide containing domain for protein-protein interaction containing a domain for self-assembly, e.g. a viral coat protein (includes phage display)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/10—Plasmid DNA
- C12N2800/106—Plasmid DNA for vertebrates
- C12N2800/107—Plasmid DNA for vertebrates for mammalian
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/22—Vectors comprising a coding region that has been codon optimised for expression in a respective host
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Virology (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biochemistry (AREA)
- Nanotechnology (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pharmacology & Pharmacy (AREA)
- Microbiology (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Communicable Diseases (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Pulmonology (AREA)
- Public Health (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Mycology (AREA)
- Wood Science & Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- Epidemiology (AREA)
- Physics & Mathematics (AREA)
- Crystallography & Structural Chemistry (AREA)
- Toxicology (AREA)
- Condensed Matter Physics & Semiconductors (AREA)
- General Physics & Mathematics (AREA)
- Manufacturing & Machinery (AREA)
- Medical Informatics (AREA)
- Plant Pathology (AREA)
- Oncology (AREA)
Abstract
Disclosed are an anti-H1 N1 subtype influenza virus nanoparticles based on self-assembled 5 ferritin, a preparation method and an application thereof, and relate to the technical field of genetic engineering. The nanoparticles are formed by connecting a signal peptide-ST-FE fusion protein and a signal peptide-SC-HA-VHH fusion protein in vitro; the signal peptide-ST-FE fusion protein is obtained by connecting a signal peptide-SpyTag shown in SEQ ID NO: 3 to an N-terminal of a ferritin monomer subunit; the signal peptide-SC-HA-VHH fusion protein is obtained by connecting 10 the N-terminal of nano antibody against hemagglutinin protein of influenza type A (H1 N1) subtype virus with a signal peptide-SpyCatcher shown in SEQ ID NO: 4. The anti-H1 N1 subtype influenza virus nanoparticles of the present invention are of great significance for monitoring, prevention and treatment of the H1 N1 subtype influenza virus.
Description
ANTI-H1N1 SUBTYPE INFLUENZA VIRUS NANOPARTICLES BASED ON SELF-
ASSEMBLED FERRITIN, PREPARATION METHOD AND APPLICATION THEREOF
The invention relates to the technical field of genetic engineering, and in particular to an anti-H1N1 subtype influenza virus nanoparticles based on self-assembled ferritin, a preparation method and an application thereof.
Influenza is very common in actual production and life. It is caused by human or animal infection with influenza virus. The typical clinical symptoms of influenza include acute high fever, physical pain, fatigue and respiratory symptoms. Influenza itself has obvious seasonality, and it has a high incidence in autumn and winter. Some highly contagious viruses may cause influenza pandemic in a large scale or even in the world, and there are very serious complications and even individual deaths caused by different individual constitutions. Influenza viruses may be roughly divided into three different types, which are type A, type B and type C in turn.
H1N1 virus, a kind of influenza type A virus, is also one of the most commonly infected influenza viruses for humans. Many studies have found that influenza type A (H1N1) virus is a new type of influenza type A virus after mutation, and there are four sources of recombination in its genome, which is a mixture of human influenza, swine influenza and avian influenza virus genes. The PBI gene of this virus is derived from human influenza H3N2 virus, HA, NA, NP, NS and M genes are derived from swine influenza H1N1 virus, and PB2 and PA genes are derived from avian influenza H1N1 virus. Human influenza is mainly caused by influenza type A virus.
Seasonal influenza may cause 250,000 to 500,000 deaths worldwide every year, and the number of people who die from seasonal influenza in the United States may reach 3,000 to 49,000 every year. Influenza type A virus has many subtypes, and most antibodies induced by different subtypes may not play a cross-protection role.
For a long time, genetic engineering antibody is one of the main means and research hotspots for preventing and treating influenza type A (H1N1) virus. It is of great practical significance to develop anti-H1N1 subtype influenza virus nanoparticles based on self- assembled ferritin for the prevention and treatment of influenza type A (H1N1) influenza.
The objective of the present invention is to provide an anti-H1N1 subtype influenza virus nanoparticles based on self-assembled ferritin, and a preparation method and application thereof, so as to solve the problems existing in the prior art. The method combines the advantages of iron nanoparticles and anti-H1N1 subtype influenza virus nanoparticles to prepare anti-H1N1 subtype influenza virus nanoparticles, and it is of great significance for monitoring, prevention and treatment of the H1N1 subtype influenza virus.
In order to achieve the above objective, the present invention provides the following schemes.
The invention provides an anti-H1N1 subtype influenza virus nanoparticles based on self- assembled ferritin, wherein the nanoparticles are formed by connecting a signal peptide-ST-FE fusion protein and a signal peptide-SC-HA-VHH fusion protein in vitro; the signal peptide-ST-FE fusion protein is obtained by connecting a signal peptide-SpyTag shown in SEQ ID NO: 3 to an
N-terminal of a ferritin monomer subunit; the signal peptide-SC-HA-VHH fusion protein is obtained by connecting the N-terminal of nano antibody against hemagglutinin protein of influenza type A (H1N1) subtype virus with a signal peptide-SpyCatcher shown in SEQ ID NO: 4.
Further, an amino acid sequence of the signal peptide-SpyTag and the N-terminal connecting peptide of the ferritin monomer subunit is shown in SEQ ID NO: 5; the amino acid sequence of the N-terminal of the nano antibody against the hemagglutinin protein of influenza type A (H1N1) subtype virus and the connecting peptide of the signal peptide-SpyCatcher is shown in SEQ ID NO: 5.
Further, an amino acid sequence of the signal peptide-ST-FE fusion protein is shown in
SEQ ID NO: 1; and an amino acid sequence of the signal peptide-SC-HA-VHH fusion protein is shown in SEQ ID NO: 2.
Further, a nucleotide sequence encoding the signal peptide-ST-FE fusion protein is shown in SEQ ID NO: 10.
Further, a nucleotide sequence encoding the signal peptide-SC-HA-VHH fusion protein is shown in SEQ ID NO: 11.
The invention also provides a preparation method of the anti-H1N1 subtype influenza virus nanoparticles based on self-assembled ferritin, including the following steps: (1) respectively constructing genes encoding fusion proteins shown in SEQ ID NO: 1 and SEQ
ID NO: 2, then transferring the constructed genes into vectors to construct expression plasmids, and then transfecting to induce the expression of fusion proteins to obtain two kinds of fusion proteins; (2) connecting the two fusion proteins obtained in the step (1) in vitro to obtain the anti-H1N1 subtype influenza virus nanoparticles based on self-assembled ferritin.
Further, in the step (2), conditions of in vitro connection are: 4°C, and 16 h.
The invention also provides an application of the anti-H1N1 subtype influenza virus nanoparticles based on self-assembled ferritin in preparing medicines for treating H1N1 subtype influenza.
The fibronectin binding protein FbaB of Mlicrococcus scarlatinae contains a domain with spontaneous peptide bond between Lys and Asp. This protein contains two fragments: one is called SpyTag, and the other is called SpyCatcher. The reaction is carried out under different pH, temperature and buffer conditions. The reaction is simple and the yield is high. SpyTag may fuse at the end or inside, and produce specific reaction on the surface of mammalian cells.
Peptide binding may not be reversed by boiling or competing peptides.
There is a kind of natural heavy chain antibody (HCAb) that only contains heavy chain but not light chain in Camelidae (dromedary, bactrian camel, llama, etc.). Heavy chain antibody (HCAb) contains no L-chain polypeptide, and it is unique in that it lacks a first constant domain (CH1). In its N-terminal region, an H chain of homodimer protein contains a special variable domain called VHH, and the VHH is used to bind to homologous antigen of the HCAb.
After the variable region of HCAb in camel is cloned, a single domain antibody consisting of only one variable region of heavy chain is obtained, which is called variable domain of heavy chain of heavy chain antibody (VHH), with a diameter of 2.5 nm and a length of 4 nm, and is a smallest known unit that may bind the target antigen. Its molecular weight is only 1/10 of that of monoclonal antibody, and it is a smallest antibody unit with stable structure and antigen binding activity, so itis also called nanoantibody (Nb). As a small genetic engineering antibody, nanoantibody has the advantages of high expression, water solubility, stability, tissue penetration and weak immunogenicity, and these advantages make the antibody have broad application prospects in basic research and drug development. However, it is difficult to achieve the ideal therapeutic effect because of the phenomenon of immune escape of a single targeted nanoantibody of the nanoantibody.
Nanomaterials formed by self-assembled proteins not only have characteristics of good biocompatibility, uniform particle size and stability, but also have broad application prospects in cell imaging, lesion detection and drug sustained release.
Ferritin is an important functional protein that participates in and regulates storage and release of iron, and it is a kind of protein with high iron content which widely exists in animals, plants and microbial cells. Naturally synthesized ferritin mostly presents a hollow spherical nano-cage structure, with an outer diameter of 12 nm and an inner diameter of 8 nm. Its spherical structure consists of an inner core and an outer shell. The inner core is mainly composed of minerals, and the outer shell is assembled from 24 identical trimer subunits composed of every three ferritin subunits. When ferritin is used as a nano-carrier, it may wrap the target molecule inside the cage structure to realize the function of slow release or targeted release, and it may also fix the target molecule on the outer surface of the cage structure to realize the functions of stabilizing the structure and exposing the target protein.
The target protein is connected to the N-terminal of ferritin monomer subunit for fusion expression, so that the target antigen protein is anchored on the outer surface of the self- assembled ferritin nano-cage. Due to the unique assembly mode of ferritin subunit, it has obvious advantages for antigen expression with a natural conformation of trimer. With the self- assembly of ferritin monomer subunit into trimer, the N-terminal fusion expression antigen is very close in space, and it is easy to form a natural trimer structure. Such trimer reduces the natural conformation of antigen protein to the greatest extent, it is stable at the same time, and the immunogenicity is greatly enhanced compared with the single expression. Ferritin is resistant to high temperature and various denaturants because of its stability, and does not affect its natural structure.
The invention discloses the following technical effects.
A first objective of the present invention is to provide a method for realizing multimerization of nanoantibody, and another objective of the present invention is to provide nanoparticles that may be directly and specifically combined with the influenza type A (H1N1) virus.
In the invention, the signal peptide-SpyTag is connected to the N-terminal of ferritin monomer subunit for fusion expression by utilizing the spontaneous connection characteristic of
SpyTag and SpyCatcher in CnaB2 domain of Streptococcus pyogenes, and then the N-terminal of the nanoantibody of anti-H1N1 subtype influenza virus hemagglutinin protein is connected to the signal peptide-SpyCatcher for fusion expression. Finally, the two fusion proteins are connected in vitro, and the nanoantibody of anti-H1N1 subtype influenza virus hemagglutinin protein is displayed on the surface of self-assembled ferritin cage structure, thus achieving the preparation of the nanoparticles of anti-H1N1 subtype influenza virus.
Compared with prokaryotic expression, the expression product of CHO eukaryotic cell system expression is properly modified and distributed regionally, having weak immunogenicity and being not prone to rejection. In the process of protein expression, by introducing a signal peptide before the target protein, the target protein may be directly obtained in the cell culture solution, and this avoids cell fragmentation, improves the protein purification efficiency, is conducive to improving the purity of the protein, and further reduces the interference of non- target proteins, thus improving the connection efficiency between SpyTag and SpyCatcher.
Compared with traditional nanoantibodies, nanoparticles of anti-H1N1 subtype influenza virus hemagglutinin protein have higher sensitivity and therapeutic effect for the detection, diagnosis, prevention and treatment of the H1N1 subtype influenza virus. Anti-H1N1 subtype influenza virus nanoparticles may improve the accuracy and repeatability of detection and diagnosis of the H1N1 subtype influenza virus, being of great significance for monitoring the
H1N1 subtype influenza virus.
The anti-H1N1 subtype influenza virus nanoparticles based on self-assembled ferritin prepared by the invention are a kind of polymerized nanoantibody; compared with the H1N1 subtype influenza virus vaccine, the polymerized nanoantibody may directly treat diseases, thereby eliminating the immune process and shortening the treatment process; compared with the traditional nanoantibody, the polymerized nanoantibody has higher sensitivity and therapeutic effect on the detection, diagnosis, prevention and treatment of the H1N1 subtype influenza virus, especially the anti-H1N1 subtype influenza virus nanoparticles improve the accuracy and repeatability of the detection and diagnosis of the H1N1 subtype influenza virus, being of great significance for the monitoring of the H1N1 subtype influenza virus.
5 In order to explain the embodiment of the invention or the technical scheme in the prior art more clearly, the drawings used in the embodiment will be briefly introduced below. Obviously, the drawings in the following description are only some embodiments of the invention. For ordinary technicians in the field, other drawings may be obtained according to these drawings without making creative efforts.
Fig. 1 is a series structure diagram of gene signal peptide-ST-FE and signal peptide-SC-HA-
VHH.
Fig. 2 is an agar gel electrophoresis diagram of the target protein gene.
Fig. 3 is a linearized agar gel electrophoresis diagram of plasmid signal peptide-ST-FE and the signal peptide-SC-HA-VHH.
Fig. 4 is a protein Western Blot (WB) identification diagram of the target protein gene.
Fig. 5 is a cell expression identification diagram of signal peptide-ST-ferritin monomer subunit
RT-PCR.
Fig. 6 is a WB identification diagram of a connection between ferritin monomer subunit and
HA-VHH.
Fig. 7 is an electron microscope observation.
Fig. 8 is a cellular effect diagram of anti-H1N1 subtype influenza virus nanoparticles; PBS group is virus-free, PR8 is influenza virus-infected, and antivirus particles+PR8 are a combination incubation group of anti-virus particles and PR8 virus in vitro.
Fig. 9 is a trend diagram of weight change of mice.
Fig. 10 is a trend diagram of mouse survival rate.
Fig. 11 is an ELISA diagram of anti-H1N1 subtype influenza virus nanoparticle antigen recognition; Nbs-HA is a traditional nanoantibody against HA, and F-Nbs-HA is a nanoparticle against HA.
Fig. 12 is a comparison diagram of antigen recognition ability between anti-H1N1 subtype influenza virus nanoparticles and traditional nanoantibodies; Nbs-HA is a traditional nanoantibody against HA, and F-Nbs-HA is a nanoparticle against HA.
Various exemplary embodiments of the present invention will now be described in detail, which should not be regarded as a limitation of the present invention, but rather as a more detailed description of certain aspects, characteristics and embodiments of the present invention.
It should be understood that the terms described in the present invention are only for describing specific embodiments, and are not intended to limit the present invention. In addition, as for the numerical range in the present invention, it should be understood that every intermediate value between the upper limit and the lower limit of the range is also specifically disclosed. Intermediate values within any stated value or stated range and every smaller range between any other stated value or intermediate values within the stated range are also included in the present invention. The upper and lower limits of these smaller ranges may be independently included or excluded from the range.
Unless otherwise stated, all technical and scientific terms used herein have the same meanings as commonly understood by those skilled in the art to which the present invention relates. Although the present invention only describes preferred methods and materials, any methods and materials similar or equivalent to those described herein may be used in the practice or testing of the present invention. All documents mentioned in this specification are incorporated by reference to disclose and describe methods and/or materials related to the documents. In case of conflict with any incorporated documents, the contents of this specification shall prevail.
Without departing from the scope or spirit of the invention, it is obvious to those skilled in the art that many modifications and changes may be made to the specific embodiments of the specification of the invention. Other embodiments derived from the description of the present invention will be apparent to the skilled person. The specification and examples of this application are only exemplary.
As used herein, the terms “including”, “comprising”, “having”, “containing”, etc. are all open terms, and they mean including but not limited to.
Unless otherwise specified, the test methods used in the following embodiments are all conventional methods; the experimental materials and reagents used are commercially available unless otherwise specified.
Embodiment 1
Construction of plasmid signal peptide-SpyTag-ferritin monomer subunit (signal peptide-
ST-FE) and signal peptide-SpyCatcher-nano-antibody (signal peptide -SC-HA-VHH) against hemagglutinin protein of H1N1 subtype influenza virus.
Firstly, the gene signal peptide-ST-FE and signal peptide-SC-HA-VHH are synthesized.
Their gene serial structure is shown in Fig. 1, optimized by codon of CHO eukaryotic expression system, and is synthesized by Kingsley Biotechnology Co., Ltd. The amino acid sequence of the signal peptide-ST-FE (SEQ ID NO: 1) is as follows:
MGWSCIILFLVATATGVHSAHIVMVDAYKPTKGGGSGGGSGGGSRMLKALNDQLNR
ELYSAYLYFAMAAYFEDLGLEGFANWMKAQAEEEIGHALRFYNYIYDRNGRVELDEIP
KPPKEWESPLKAFEAAYEHEKFISKSIYELAALAEEEKDYSTRAFLEWFINEQVEEEAS
VKKILDKLKFAKDSPQILFMLDKELSARAPKLPGLLMQGGE.
The amino acid sequence of the signal peptide-SC-HA-VHH (SEQ ID NO: 2) is as follows:
MGWSCIILFLVATATGVHSSYYHHHHHHDYDIPTTENLYFQGSATHIKFSKRDEDGKE
LAGATMELRDSSGKTISTWISDGQVKDFYLYPGKYTFVETAAPDGYEVATAITFTVNE
QGAVTVNGKATKGDAHIGGGSGGGSGGGSQVOLVESGGGLVQSGGSLRLSCAASG
SMSRITMGWYRQAPGMERELVAVIGNNDNTVYGDSVQGRFTVSRDNAKNTAYLQM
NSLNAEDTAMYYCKISTLTPPHEYWGQGTQVTVSSHHHHHH.
The amino acid sequence (SEQ ID NO: 3) of the signal peptide-SpyTag is as follows:
MGWSCIILFLVATATGVHSAHIVMVDAYKPTK.
The amino acid sequence (SEQ ID NO: 4) of the signal peptide-SpyCatcher is as follows:
MGWSCIILFLVATATGVHSSYYHHHHHHDYDIPTTENLYFQGSATHIKFSKRDEDGKE
LAGATMELRDSSGKTISTWISDGQVKDFYLYPGKYTFVETAAPDGYEVATAITFTVNE
QGQVTVNGKATKGDAHI.
The amino acid sequence of the connecting peptide (SEQ ID NO: 5) is as follows:
GGGSGGGSGGGS.
The amino acid sequence of the signal peptide (SEQ ID NO: 6) is as follows:
MGWSCIILFLVATATGVHS.
After the synthesis of signal peptide-ST-FE and signal peptide-SC-HA-VHH genes, the target fragment is amplified by PCR using the synthesized genes as a template, and the amplification primers are as follows: signal peptide-ST-FE: upstream primer sequence(SEQ ID NO: 7):
AATCTCTAGAATGGGCTGGAGCTGCAT; downstream primer sequence (SEQ ID NO: 8):
AATCAAGCTTTTACTCGCCGCCCTGCAT; signal peptide-SC-HA-VHH: upstream primer sequence: AATCTCTAGAATGGGCTGGAGCTGCAT, downstream primer sequence (SEQ ID NO: 9):
AATCAAGCTTTTAGTGGTGGTGGTGGTG.
The nucleotide sequences of signal peptide -ST-FE and signal peptide -SC-HA-VHH genes are as follows: signal peptide -ST-FE (SEQ ID NO: 10):
GAATTCATGGGTTGGAGTTGCATCATCCTATTTCTAGTGGCCACCGCTACCGGCG
TGCACTCTGCCCACATCGTGATGGTGGACGCCTACAAGCCCACAAAGGGCGGAG
GCAGCGGCGGCGGCTCTGGCGGAGGATCTCGGATGCTGAAGGCCCTGAACGAC
CAGCTGAATCGGGAGCTGTACTCCGCCTACCTGTACTTTGCCATGGCCGCTTACT
TOGAGGACCTGGGCCTGGAGGGCTTCGCCAACTGGATGAAAGCTCAGGCCGAG
GAAGAGATCGGCCACGCCTTGAGATTCTACAACTACATCTACGACAGAAACGGCA
GAGTGGAACTGGATGAGATTCCTAAGCCTCCAAAAGAGTGGGAGAGCCCCCTGA
AGGCTTTCGAGGCTGCTTACGAGCATGAGAAGTTCATCTCCAAGTCCATCTACGA
GCTGGCTGCTCTGGCAGAGGAAGAAAAGGATTATTCCACCAGAGCCTTCCTGGAA
TGGTTCATCAACGAGCAAGTCGAAGAAGAGGCCTCCGTGAAGAAGATCCTGGACA
AGCTGAAGTTTGCCAAGGACTCCCCTCAGATCCTGTTCATGCTCGATAAAGAACT
GTCTGCTCGGGCCCCTAAGCTGCECTGGCCTGCTGATGCAGGGCGGCGAGTGAG
GATCC; signal peptide -SC-HA-VHH (SEQ ID NO: 11):
GAATTCATGGGTTGGAGTTGCATCATCCTATTTCTAGTGGCCACCGCTACCGGCGTGC
ACTCCTCCTACTACCACCACCACCACCACCACGACTACGACATTCCCACCACCGAGAACCT
GTACTTCCAGGGCTCCGCCACACACATCAAGTTCTCCAAGAGAGACGAGGATGGCAAAGA
GCTGGCTGGCGCTACAATGGAACTGAGAGATAGCTCTGGCAAAACAATCTCTACCTGGAT
CAGCGACGGCCAAGTGAAGGACTTCTACCTCTATCCTGGCAAGTACACCTTCGTGGAAAC
AGCTGCTCCTGATGGCTACGAGGTGGCTACCGCCATCACCTTTACCGTGAACGAGCAGGG
CCAGGTCACCGTGAACGGCAAGGCCACCAAGGGCGATGCCCACATCGGCGGAGGATCTG
GCGGAGGCTCCGGCGGAGGCTCTCAGGTGCAGCTGGTGGAATCTGGAGGTGGCCTGGT
GCAGTCCGGCGGCAGCCTGCGGCTGTCCTGTGCCGCTTCTGGCTCCATGAGCCGGATCA
TCACCATGGGCTGGTACAGACAGGCCCCAGGCATGGAACGCGAGCTGGTCGCCGTGATC
GGCAACAACGACAATACCGTTTACGGCGACTCCGTGCAAGGCAGATTCACCGTGTCTCGG
GACAATGCCAAGAACACCGCTTATCTGCAGATGAACTCCCTGAACGCCGAGGACACCGCC
ATGTACTACTGCAAGATCTCCACCCTGACACCTCCTCACGAGTACTGGGGCCAGGGCACC
CAGGTGACCGTGTCCTCTCACCATCACCACCATCATTGAGGATCC.
Table 1: The target gene amplification system
Component Volume
DNA Template tag
Upstream primer 2 ul
Downstream primer 2 ul 10xEx Taq Buffer 5 HI dNTP Mixture 4 pl
Ex Taq 1 pl
Water, nuclease-free 36 ul
Total system 50 ul
Table 2: The PCR reaction procedure of the target gene
Steps = Procedure Time 1 Pre-denaturationat95°C ~~ 5min 2 Denaturing at 94°C 30 sec 3 Annealing at 58°C 30 sec 4 Extending at 72°C 30 sec
GOTO Step 2 33x 6 Final extension at 72°C 10 min 7 Storing at 12°C oo
The amplified product is electrophoresed with 1% agar gel, and the results are shown as
Fig. 2, which are the same as the expected fragment length. 5 The PCR products are recovered, and the two kinds of target fragments recovered from
PCR glue are digested with eukaryotic expression plasmid P3 using restriction endonucleases
Xba | and Hind III, respectively. T4 DNA Ligase is used to connect the above two Enzymatic fragments to construct two kinds of target gene vector plasmids, namely, plasmid signal peptide-ST-FE (p3-ST-FE) and signal peptide-SC-HA-VHH (p3-SC-HA-VHH), and they are stored at -20°C.
Embodiment 2
Linearization of plasmid signal peptide-ST-FE and signal peptide-SC-HA-VHH
The plasmid signal peptide-ST-FE and signal peptide-SC-HA-VHH stored at -20°C are taken out, and their concentrations are measured with NanoDrop one as 1200 ng/ul and 890 ng/k, respectively. The restriction endonuclease Pvu | is used for single digestion. The specific reaction systems are shown in Tables 3 and 4 below.
Table 3: Single enzyme digestion reaction system of plasmid signal peptide-ST-FE
Component Voume ~~ psST-FE s4u(oone)
Pvu | 10 pl 10xNEB Buffer 20 pl
Water, nuclease-free 86 ul
Total system 200 pl
Table 4 Single enzyme digestion reaction system of plasmid signal peptide-SC-HA-VHH -— Component elume ~~ p3SC-HAVHH 113ul(toopg
Pvu | 10 pl 10xNEB Buffer 20 pl
Water, nuclease-free 57 ul
Total system 200 pl
According to the single enzyme digestion reaction system table, the components are added and digested in a water bath at 37°C for 2 h.
During enzyme digestion, 1% agarose gel is prepared. First, the gel plate is prepared, the comb is selected and inserted according to the total system of enzyme digestion, then 0.5 g of agarose is weighed in a 100 ml beaker, 50 ml of 1 x TAE is weighed with a measuring cylinder, they are mixed well and put in a microwave oven, heated for 30 s, and taken out to observe the dissolution of agarose; then they are repeatedly heated to make them fully dissolved, then 2 u L of Gold View | nucleic acid dye is added, and is gently shaken evenly (at this time, the force is even to avoid bubbles), and the gel is poured; the gel is completely solidified by placing at room temperature for 40 min. Then, the products of single enzyme digestion are mixed well with a proper amount of 6xLoading Buffer and all of them are added to the gel wells. The plasmid without single enzyme digestion and DL 10000 DNA Marker are used as controls, and the electrophoresis conditions are constant pressure of 110 V, 600 mA and 30 min. After electrophoresis, the rubber block is gently taken out and placed in a blue light glue cutter for glue cutting. According to the instructions of San Prep Column DNA Gel Extraction Kit, the vector after single enzyme digestion is recovered and purified. The concentration and
OD260/280 of the recovered and purified products are determined with NanoDrop one, and the products are stored at -20°C. 1% agarose gel is shown in Fig. 3. The electrophoresis speed of linearized plasmid is slower than that of circular plasmid, which is in line with expectations.
Embodiment 3
Electroporation of linear signal peptide-ST-FE and signal peptide-SC-HA-VHH into GS gene- deficient CHO cells (1) Preparation of CHO suspension cells with GS gene deletion before electrotransformation: inoculating the cells in a 125 ml triangular shake flask with a living cell density of 5 x 10° cells/ml 24 h before electrotransformation, with a culture volume of 30 ml, and setting a rotating speed of the carbon dioxide shaking incubator at 110 rpm. (2) Collection of CHO suspension cells with GS gene deletion: on the day of electrotransformation, calculating the density and viability (98%) of living cells in suspension culture; calculating and placing the volume of cell suspension needed to collect 1x10 living cells in a sterile centrifuge tube at 1000 rpm for 5 min, and then resuspending in 400 HI of 302 medium (containing glutamine). (3) Cells and plasmids incubation: adding 40 ug of linear knockout plasmid (linear plasmid p3-ST-FE or linear plasmid p3-SC-HA-VHH) into the above-mentioned cell suspension, gently blowing and mixing, and incubating at room temperature for 10 min.
(4) Electric shock: setting the parameters of the electrometer in advance, wherein the electric shock conditions are: voltage 280 V, electric shock time 20 ms, and electric shock once; incubating at room temperature for 10 min, then quickly adding the cell plasmid mixture into a precooled 4 mm electric shock cup for electric shock once. (5) Cell treatment after electric shock: after the end of electric shock, quickly transferring the cells after electric shock to 20 ml of 302 preheated medium {containing glutamine), and culturing T75 cells in a flask for 24 h. (6) Calculating and recording cell viability after 24 h of electric shock: the cell viability of linear plasmid p3-ST-FE is 48% after 24 h of electroporation, and that of linear plasmid p3-SC-
HA-VHH is 52% after 24 h of electroporation. (7) Continuing to culture with a medium containing no glutamine until the cell viability is above 95%.
Embodiment 4
Screening of cell lines after electrotransformation of plasmid signal peptide-ST-F and plasmid signal peptide-SC-HA-VHH
After electrotransformation for 24 h, the static culture cell pool is a mixed group of stably transfected cells, which contains the cell lines that it is needed to stably express the target protein. Because the cells contain GS gene after successful electrotransformation of plasmid, glutamine-free culture medium is used for screening, and monoclonal cell lines are selected by limited dilution method. The specific steps are as follows: (1) preparation of subclone plate-laying conditioned medium: 24 h before subclone plating, inoculating the suspended cells after electroporation in 125 ml triangular shake flask according to 1 x 10° cells/ml, with a rotation speed of 110 rpm, and a culture volume of 30 ml. (2) On the day of subcloning, placing the cells inoculated and cultured in the step 1 in a 50 ml sterile centrifuge tube at 1000 rpm for 5 min, and filtering the cell debris in the supernatant of the cell culture solution by a 0.2 um sterile disposable filter and using as conditioned medium for later use. (3) Layout method of paving medium: 60% fresh 302 medium {without glutamine)+30% conditioned medium+10% foetal bovine serum (FBS)+streptomycin (PS), and the above ingredients are mixed evenly and preheated at 37°C for later use. (4) Plating: the cell density and viability are calculated according to the steps of cell counting: screening monoclonal cell lines by using 96-well cell culture plates; considering the possibility of death during the growth of monoclonal cells, the cells are continuously diluted in the plating medium for 24 h to the final density of 1 cell per 100 pl, and the diluted cell suspension is added to the 96-well cell culture plates according to 100 pl/well with a multi- channel pipette; five 96-well cell culture plates are all paved and cultured in a 5% CO: incubator at 37°C.
(5) On the 7" day of subclone plating, the growth of the clone is observed under the microscope, and the monoclonal cells radiated outward from the central point like round cells, and both the monoclonal and polyclonal holes are marked. According to the need, the culture medium is changed in the monoclonal hole once every 5-7 days. (6) Cell strains with good growth condition are selected for later use.
Embodiment 5 Protein Western Blot (WB) identification of target protein. 5 x 105 cells/ml of the selected cell lines is inoculated into a 125 ml triangular shake flask for shaking culture, the culture volume is 30 ml, and the rotating speed of the carbon dioxide shaking incubator is set at 110 rpm. The viability of cell lines is determined every 12 h. When the cell viability reaches 70%, the cell supernatant is taken for WB identification of the target protein, as shown in Fig. 4, which meets the expected stripe size. Signal peptide-ST-FE has no
HIS tag and no band, and signal peptide-SC-HA-VHH has signal peptide display band. (1) Glue mixing: the lower layer glue is 10% separation glue, and the upper glue is 5% concentrated glue.
Washing the comb and putting it in a natural air-drying place; brushing the glass plate clean and leaning against the glue rack to dry the water. (Ultra-pure water washing)
Using ultra-pure water to conduct leak detection, then preparing the separation glue according to the formula; pouring out the leaked water when it is added to 10%SDS, blotting it with filter paper, and then continuing to add the remaining 10%APS and TEMED and mixing well.
Adding the prepared separation glue along one part of the glass, with each piece of about 4.5 ml, and immediately sealing it with ultra-pure water (making the glue surface smooth); waiting until an obvious refraction surface is formed between the separation glue and water, and starting to prepare according to the formula of concentrated glue; pouring off the water sealed when it is added to 10%SDS, drying it with filter paper, and then continuing to add and mix the remaining 10%APS and TEMED.
Pouring the prepared concentrated glue into the plate, quickly inserting the comb, pulling out the comb after the upper glue is completely solidified, and putting the glue and the glass plate in an electrophoresis tank for electrophoresis, or putting it in an electrophoresis buffer and putting it in a refrigerator at 4°Cfor later use. (2) Sampling
Mixing the samples with appropriate amount of loading buffer and boiling for 5 min, then adding 10 - 15 pl to each empty space; replacing the blank hole with 1xSDS buffer. (3) Running electrophoresis
Setting the voltage to 100V; generally, electrophoresis lasts for 90-120 min, depending on the electrophoresis progress.
During running electrophoresis, it is necessary to prepare things for membrane transfer and prepare membrane transfer buffer (stored and reserved at 4°C).
Film cutting: slightly cutting the film by one more hole according to the number of samples.
Soaking film: firstly, soaking the film in methanol for ten more seconds, then rinsing it with ultra-pure water (just once), then soaking it in the buffer solution of the rotary film and putting it in the refrigerator for later use.
Soaking the filter paper: putting the filter paper in the tray, soaking it in the rotary film buffer lotion, and putting it in the refrigerator for use; getting the ice when there are more than ten minutes from the rotary film. (4) Film transfer
Putting the tank for film transfer into a box filled with ice, taking the film out of the refrigerator at -20°C and putting it into the tank, pouring the film transfer buffer into the tank, and taking out all the film transfer articles that are originally put into the refrigerator; the order of placing during film transfer: because protein electrophoreses from the negative electrode to the positive electrode, they are placed from the positive electrode to the negative electrode respectively: sponge—two layers of filter paper—PVDF film—glue—two layers of filter paper— sponge (preventing air bubbles between glue and filter paper, between glue and film, and between glue and filter paper).
Stacking several layers and putting them into the groove, setting the current to 300 mA, turning the key to the time shift, and conducting film transfer for 120 min; preparing 5% BSA sealing solution (sealing solution: dissolving 2 g of BSA in 40 ml of TBST) when there are ten more minutes left after film transfer. (5) Sealing
Taking out the film, turning it over, soaking it in 5% BSA, and shaking it in a refrigerator at 4°C for 1 h; or sealing at room temperature for 1 h (depending on the room temperature at that time). (6) Primary resistance
The diluent of primary antibody is 1% BSA; taking a suitable volume of HIS primary antibody (mouse source) and diluting it according to 1 : 800 - 1000; incubating overnight in the shaking bed of 4°C refrigerator. (7) Washing
Washing with TBST for three times, 5 min each time, and preparing the second antibody at that time, wherein the second antibody is rabbit anti-mouse antibody. (8) Secondary antibody: incubating in a light-proof room temperature shaking table for 1 h. (9) Washing: washing with TBST for three times, with 5 min each time. (10) Exposure.
Embodiment 6 RT-PCR detection of signal peptide -ST-FE
Since the signal peptide-ST-FE protein does not contain HIS tag, its RNA is extracted to detect whether it is transcribed. The result is shown in Fig. 5, which is in line with the expected size.
(1) Centrifuging cells (107 cells) to discard the culture medium and washing twice with PBS; discarding PBS and sucking it clean. (2) Adding 1 ml of TOIZOL (total RNA extraction reagent) and grinding. (3) Adding 250 um of chloroform, shaking violently for 30 s, and placing on ice for 12 min. (4) Centrifuging at 4°C and 13500 rpm/min for 15 min. (5) Taking 400 pl of supernatant and the same amount of isopropanol, and fully mixing them with the new EP tube, and refrigerating at 4°C for 35 min; then centrifuging at 4°C and 13500 rpm/min for 10 min. (6) Discarding the supernatant, adding 1 ml of 75% ethanol and shaking gently; centrifuging at 4°C and 10600 rpm/min for 5 min. (7) Discarding the supernatant, and placing it or blotting it with filter paper; adding 10 pl of deionized water to dissolve for later use or store at -80°C. (8) Reversing the extracted RNA transcribed according to Table 5, with the result of electrophoresis with 1% agar gel shown in Fig. 5, which is the same as the expected fragment length.
Table 5: RNA reverse transcription ~~ Component ~~ Volume
Total RNA extraction solutions ~~ spl
Upstream primer (same as Table 1) 1 HI
Downstream primer (same as Table 1) 1 HI
RNase Inhibitor 1 HI dNTP Mixture 2 ul
Reverse Transcoriptase M-MLV 1 HI 5xM-MLV Buffer 4 ul
Water, nuclease-free 5 HI
Total system 20 pul
Embodiment 7
Purification of Target Protein
ST-FE protein is purified by size exclusion HPLC. SC-HA-VHH protein is purified by HIS protein purification column, and imidazole is removed by 3KD dialysis membrane. Finally, 0.5 mg/ml of ST-FE protein and 0.45 mg/ml of SC-HA-VHH protein are obtained.
Embodiment 8 In vitro connection and electron microscopic observation of the target protein
The protein of ST-FE monomer and the protein of SC-HA-VHH are mixed in the same molar amount, and connected continuously at 4°C for 16 h to obtain anti-H1N1 subtype influenza virus nanoparticles. According to the characteristics of HIS tags, WB is used to detect the connection between them. As shown in Fig. 6, the connection is displayed, which meets the expected size. ST-FE protein and FE-HA-VHH linker are observed by transmission electron microscope. As shown in Fig. 7, under the same magnification, the diameter of FE-HA-VHH connector particles is obviously larger than that of FE protein, which is in line with expectations.
Embodiment 9 Cell-level antiviral identification of anti-H1N1 subtype influenza virus nanoparticles
Before the experiment, 1 x 108 MDCK cells are prepared and transmitted to 6 empty plates.
The obtained anti-H1N1 subtype influenza virus nanoparticles are mixed with H1N1 subtype influenza virus (PR8) in equal amount into a mixed solution of 0.5 ml, and incubated at 37°C for 15 min, with the virus amount of 10° PFU. The results are observed after 72 h, as shown in Fig. 8. The results show that the anti-H1N1 subtype influenza virus nanoparticles may effectively bind to the H1N1 subtype influenza virus (PR8) and inhibit the infection of the H1N1 subtype influenza virus (PR8) to MDCK cells.
Embodiment 10 In vivo antiviral identification of anti-H1N1 subtype influenza virus nanoparticles
Female SPF mice of 6-8 weeks old are divided into 2 groups, 8 in each group. One group is PBS group, and the other group is anti-H1N1 subtype influenza virus nanoparticle treatment group. Four hours before the infection of the H1N1 subtype influenza virus (PR8), 200 ul of PBS is instilled into the nasal cavity of each mouse in PBS group, and 200 pl of anti-H1N1 subtype influenza virus nanoparticles (50 ug) are instilled into the nasal cavity of each mouse in anti-
H1N1 subtype influenza virus nanoparticles treatment group. The virus infection amount of each mouse is 2 x LD50. 24 hours after infection, 200 pl of PBS is instilled into the nasal cavity of each mouse in PBS group, and 200 pl of anti-H1N1 subtype influenza virus nanoparticles (50
Hg) are instilled into the nasal cavity of each mouse in anti-H1N1 subtype influenza virus nanoparticles treatment group. The weight and survival rate of mice are recorded. The experimental results are shown in Fig. 9 and Fig. 10, which show the weight change and survival rate of mice. The weight of mice in the anti-H1N1 subtype influenza virus nanoparticles treatment group has no obvious change, no abnormality and no death. The clinical symptoms of mice in PBS control group are obvious, such as rough hair, shortness of breath, hunchback, slow activity and clustering, and their weight decreases obviously, and all mice die within 8 days.
Embodiment 11
Detection of binding ability of anti-H1N1 subtype influenza virus nanoparticles to virus
Firstly, the binding ability of anti-H1N1 subtype influenza virus nanoparticles with the H1N1 subtype influenza virus (PR8) is tested: diluting the H1N1 subtype influenza virus (PR8) to 10°
PFU, adding 50 ul each well to the ELISA plate and placing at 37°C for 2 h or 4°C for 24 h; discarding the liquid in the hole (to avoid evaporation, the plate should be covered or placed flat in a metal wet box with wet gauze at the bottom); sealing the enzyme-labelled reaction well: adding 2% BSA to 200 pl/well, and sealing at 37°C for 60 min or 4°C for 24 h; removing bubbles in each hole, washing the hole with washing liquid for 3 times after sealing, each time for 3 min; washing method: sucking up the reaction solution in the hole, filling the plate hole with the washing solution, and then adding the washing solution again after suction, and repeating for 3 times; pouring off the liquid and patting it to dry on absorbent paper with washing times of 3. The anti-
H1N1 subtype influenza virus nanoparticles are 50 pl per hole, and three gradients are set, placed at 37°C for 40-60 min. The holes are washed with washing liquid for 3 times, 3 min each time;
HIS antibody is added at 4°C overnight, and the washing is as before. Enzyme-labelled antibody (secondary antibody) is added, and dilution is performed according to the reference work provided by the enzyme conjugate provider, at 37°C, for 30-60 min, added 50 pl to each hole; the washing is the same as before; the substrate solution (currently prepared) is added, TMB-urea hydrogen peroxide solution is the first choice, followed by OPD-hydrogen peroxide substrate solution system. Substrate dosage: 50 pul of the substrate is added per well, placed at 37°C in the dark for 3-5 min, and stop liquid is added to develop colour. Termination of the reaction: 50ul of termination solution is added to each well to terminate the reaction, and the experimental results are determined within 20 min. The results show that the wavelength of 492 nm is used after OPD colour development, and 450 nm is required for TMB reaction product detection. At the same time, the positive group and the negative group are set with 3 replicates in each group. The traditional nanoantibody treatment is the same as above. The results show that the anti-H1N1 subtype influenza virus nanoparticles may combine with the H1N1 subtype influenza virus (PR8), and the sensitivity is superior to that of traditional nanoantibodies, as shown in Fig. 11.
Then, the H1N1 subtype influenza virus (PR8) is set with six gradients, which are 10° PFU, 5x 105 PFU, 2 x 105 PFU, 1 x 105 PFU, 5 x 10% PFU, 103PFU and PBS as control, and the same amount of anti-H1N1 subtype influenza virus nanoparticles are combined. The steps are the same as above. Traditional nanoantibody treatment is the same as above. The results show that the maximum specific binding of anti-H1N1 subtype influenza virus nanoparticles is better than that of traditional nanoantibody, and the binding sensitivity of anti-H1N1 subtype influenza virus nanoparticles is 7.18 times higher than that of traditional nanoantibody, as shown in Fig. 12.
The above-mentioned embodiments only describe the preferred mode of the present invention, and do not limit the scope of the present invention. Without departing from the design spirit of the present invention, all kinds of modifications and improvements made by ordinary technicians in the field to the technical scheme of the present invention should fall within the protection scope determined by the claims of the present invention.
i xml versicn=Nl, ON encoding=TUTFE-8" 7 2 <!DOCTYPE ST26SequenceListing PUBLIC "-//WIPO//DTD Sequence Listing 1.3//EN" "ST265equenceListing V1 3.dtd"> 3 <3T268equencelisting dudVarsion="Vi 35 filsNamec="InïluenzaPart Ni Segiist min soïtwaceNems=*WIPO Segvencen zscoïtwareVension="2 8,05 vrodoolicnDeie="2odSdds2aN>
A <Applicatioconidentiiflcatlon> <IPOfficeCode>NL</IPOfficelode> & <ApplicationNumerTezt></ApplicetionNumberText»> 7 <FiliogDate></FilingDaLter 8 </Ppplicationidentification> 3 <Applicant¥FileReference>»SHX-InfluenzaPart NL</ApplicantFileReference> <BarliiestPricritvipplicationidentification> il <IPOfEiceloderCN</TIPOfflceloderx 12 <ApplicationNumberText>202210548788.4</ApplicaticnlunberText> 13 <FilinglDate>2022-05-20</Filingiates> 14 </FarliestPriorityApplicationidentification> in <AppiicantNems languageïcde=Ven">The Second Hospital of Nanjing (Nanjing
Hospital affiliated to Nanjing University of Traditional Chinese
Medicine) </ApplicantNane> 18 <InventionTitle languagalode="en">ANTI-HIN1l SUBTYPE INFLUENZA VIRUS
NANOPARTICLES BASED ON SELF-ASSEMBLED FERRITIN, PREPARATION METHOD AND
APPLICATION THEREOF</InventiocnTitle i <SequenceTotalduantitys>ll</SeguenceToralOuantity> 1B <SequenceData seguantasibNunbayr="ins ie <INSDSegr zl “INSDSeqg length>214</INSDSeg Length» 2l <INSDSeq moltype>AA“/INSDSeg moltype> 22 <IN3DSeq division»PAT</INSD3eq division» 23 <INSDSeq feature-table> 24 <INSDFeabture> 25 <INSDFeature key>source</INIDFeature key> “6 <INSDFeature location>l..214</IN3DFeature location» 2 <INSDFeature qguals> u 28 <INSDQualifier» 23 <INSDQualifier name>mol type</iNSDQualifier name> <IN3DQualifier value>protein“/INSDQualifier value» 3 </INSDOQuali fier 32 <INSDQualifler 1d=Vgly>» 33 <INSDQualifier namerorganism</INSDQualiifier name> 34 <INSDQualifier valuersynthetic construct“/INSDQualifien value» </INSDOualifier> 248 </IN3DFeature gualsd 27 </INSDFearure» 38 </INSDSeg features table» 38 <iNSDSeg sequence>MGWSCIILFLVATATGVHSAHIVMVDAYKPTKGGGSGGGSGGGSRMLKALNDQLNR
ELYSAYLYFAMAAYFEDLGLEGFANWMKAQAEEEIGHALRFYNYIYDRNGRVELDEI PKPPKEWESPLKAFEAA
YEHEKFISKSIYELAALAEEEKDY STRAFLEWF INEQVEEEASVKKILDKLKFAKDSPQILFMILDKELSARAPK
LPGLIMOGGE</INSTSeq sequenced </INSDSep äl </SeguenceData> 42 <SeguenceData sapuencelDNumber="2%> 473 <INSDSedg> 44 <INSDSeq length>268</INSDSeq length» <INSDSeq molityvpe>BAA</IN3DSeq moltype> 445 <INSDSeq division>PAT</INSDSeq division» 47 <INSDSeq feature-iable> a8 <INSDPeature»> 43 <IN3DFeature key>source</IiN3DFeature key» <IN3DFeature lowation>»l..268</INSDFeaturs location»
SL <INSDFeature guals>
I <INSDOualifier>
DS <INSDQualifier name>mol type</INSDQualifier name>
Sd <“INSDoualifier valuesprotein</INSDQualifier value» </INSDOualifier> 54 <INSDOualifier id="qd4"> 57 <IN3DQualifier namerorganism</INSDQualifiesr name>
Ha <INSDQualifier valuersynthetic construct</INSDQuallifier value» 54 </INSDQualifier> ae </INSDFeaturs quals> a </IN3DFeature>
SE “/INSDSeqg fesature-table> <iNSDseq segquence>MGWSCIILFLVATATGVHSSYYHHHHHHDYDIPTTENLYFQGSATHIKFSKRDEDG
KELAGATMELRDSSGKTISTWISDGQOVKDFYLYPGKYTFVETAAPDGYEVATAITFTVNEQGOVTVNGKATKGD
AHI GGGSGGGSGGGSQVQLVESGGGLVQSGGSLRLSCAASGSMSRI ITMGWYRQAPGMERELVAVIGNNDNTVY
GDSVQGRFTVSRDNAKNTAY LOQMNSLNAEDTAMYYCKISTLTPPHEYWGQGTQVTVSSHHHHHH</ INSDSey sequencer
G4 </IN3SDSaq>
S5 </SaquenceData> aa “SequenceData seguencellNMumber="37> 87 <INSDSeg> an <INSDSeg length>»32</INSDSeq length» eo <INSDSeg moliype>AAc/INSDSeqg moltype>
JO <INSDSeq division>PAT</INSDSeg division»
JL <INSDSeq feature-table>
Td <INSDFeature> 73 <INSDFeaturs keyrsource</INSDFeaturs key
Fd <INSDFeature locaction»l..32</INSDFeature location» ih <INSDFeature guals>
Ta <INSDQualifiar> 7 <IN3DQualifier name>mol type“/INSDQuali fier name> js <INSDQualifier values»protein</INSDQualifier value»
Fh </INSDOualifier> ai <INSDQualifler ia=’g5"> 81 <INSDQualifier name>organism</INSDQualifier name> 82 <IN3DQualifier value>synthetic construct</INSDQualifier value» a3 </INSDOQuali fier 54 </INSDFsature guals> 55 </INSDFeature> 5E </INSDSeg feacture-taebhle> a7 <INSDSeq sequence>MGWSCIILFLVATATGVHSAHIVMVDAYKPTK</INSDSeq sequences ad </INSDSeg> 83 </Seguencedata> 3 <SequenceData sequence lDNumben="4%>
SL <INSDSeq>
Sz <INSDSeag Lengith>133</INSDSeq length»
G3 <INSDSeq moliype>BAA</INSDSeq moltype»
G4 <INSDSeq division>PAT</INSDSeg division» <INSDSeq feature-table> 36 <INZDFeature> 37 <INSDFeature key>sourcec/INSDFeature key» a8 <IN3DFeature location>l..133</INSDFeaturs location» 38 <INSDFeature guals> 100 <INSDOualifien>
LOL <INSDQualifier name>mol type“/INSDQualifier name>
Laz <INSDQualifier valuerprotein</IN3DQualifier value> 103 </INSDOualiLfier»> 10d <INSDQualifler in="g8"> 105 <INSDQualifier name>organism</iNSDQualifier name> ijs <IiNSDgualifier value>synthetic construct</INSDQualifier valued»
LOF </INSDQuali fier» 108 </INSDFeature quals>
LOS </IN3DFeature>
LLG </INSDSeg feature-table> <INSDSeq sequence>MGWSCIILFLVATATGVHSSYYHHHHHHDYDIPTTENLYFQGSATHIKFSKRDEDG
KELAGATMELRDSSGKTISTWISDGQVKDFYLYPGKY TFVETAAPDGYEVATAI TFTVNEQGQVTVNGKATKGD
AHI</INSDSeq sequencer ile </INSDSeg>
Lis </SegusnceData»>
Lig <Sequencebata seguenasibNumbar=nits
LE <INSDSeg> ils “INSDSeq length>12</IN3DSeq Length> iijë <INSDSeq moltype>AA“/INSDSeg moltype> iis <IN3DSeq division»PAT</INSD3eq division»
Lis <INSDSeq fearure-tabier 120 <INSDFeabture>
Lal <INSDFeature key>source“/INSDFeature key>
Ld <INSDFeature location»l..12</INSDFeature lozation>
HR <INSDFeaturs qualsy
Lad <INSDQualifier»> 125 <INSDQualifier name>mol type</iNSDQualifier name> 186 <IN3DQualifier value>protein“/INSDQualifier value» 127 </INSDOQuali fier 128 <INSDQualifier id="gi0nx> 12% <INSDQualifier namerorganism</INSDQualiifier name> 130 <INSDQualifier valuersynthetic construct“/INSDQualifien value»
HCH </INSDOualifier> 132 </IN3DFeature gualsd 123 </INSDFeature> u 124 </INSDSeg features table» 135 <IN3DSeqy sequencs>GGGSGGGSGGGS/INSTSeq sequenced
LE </INSDSeg> 137 </SequenceData> 138 <SequernceData seguancaiDNunbhao="E% > 13% <INSDSeqg> 1440 <INSDSeq length>19</INSDSeq length>
Lidl <IN3DSeq moltype>AA/INSDSeqg moltype> 142 ZINSDSeq division>PAT</INSDSeq division» 1473 <INSDSeq feabure-table> idd <“INSDFesrure»>
LAL <INSDFeature key>source</INSDFeature key> 146 <INSDFeature location>l..19</INSDFeature locations 147 <INSDFealurse guals> 148 <INSDOQualifier» 143 <IN3DQualifier namedmol type</INSDQualifisr name> 158 <IN3DQualifier valuedprotein</INSDQualifisr value»
LSL </INSDQuali fier» 152 <INSDguelifier id="gië*> as <INSDOQualifier namerorganism</INSDQualifier name>
Lhd <INSDQualiflsr value>synthetic construct /INSDQualifier value> 155 </INSDOualifier> 154 </INBDFeature gvals> 157% </THSDFeatura> 155 </INSDSegy featurs-table> 150 <INSDSeq sequence>MGWSCIILFLVATATGVHS</INSDSeq seguenced
LEU </INSDSeg> iel </SequenceData>
LEE <SequsrceData segusnceliNumbec="7%> 182 <INSDSeqg> iad <IN3DSeq length»27</INSDSeq length» 18h ZINSDSegq molitypes>DNAC/INSDSeq moltyper>
Le6 <INSDSeag divisior>PAT</INSDIeqg division»
Lo? <INSDSeq feature-table>
Len <INSDFeature>
LEE <INSDFeaturs keyrsource</INSDFeaturs Key»
LEG <INSDFeature location>l..27</IN3DFeature location» ijd <INSDhFeature quels» 172 <INSDQualifier> 173 <IN3DQualifier name>mol type</INSDQualifisr name> 14 <INSDQualifiler valuerother DNA</INGDGualifier value»
LS <{INSDQualifier»
HE <INSDQualifier id="gidx>
VET CINSDQualifisr namerorganism</INsSDQualifier name> 17a <INSDQualifier valus>synthetic construct /INSDGualifier value ijs </INSDQualifier> u i848 </INSDFeature guals>
LSL </INSDFealure> 182 </INSDSey feature-tabled
TEs <INSDSeqg sequance>aatctectagaatgggetggagetgeat</INSDS=g sequences
Lad </IN3SDSaq> 185 </SaquenceData> ia “SequenceData seguencellNumber="8%> 487 <INSDSeg>
LEE <INSDSeg length>»28</INSDSeq length>
LS <IN3DSeq moltype>DNA</INSDSeq moltyper
Led <INSDSeq division>PAT</INSDSeg division»
Lal <INSDSeq feature-table>
Lud <INSDFeature> 193 <INSDFeaturs keyrsource</INSDFeaturs key» ijd <INSDFeature locaction»1..28</INSDFeature location» 135 <INSDFeature guals> 134 <INSDOualifier>
Le <IN3DQualifier name>mol type“/INSDQuali fier name>
RSE <INSDQualifier valuerother DNA</INSDQualifier value»
LGG «</INSDOQualifier»> ad <INSDQualifler ia="gië>
ZO: “INSDoualifier name>organism</INSDQualifier name> 202 <IN3DQualifier value>synthetic construct /INSDQualifier values 203 </INSDOQuali fier u 204 </INSDFesature duals» 20% </INSDFeature> 208 </INSDSeg feacture-taebhle> ai <INSDSeq sequencevaatcaagettttactegeegecctgeat/INSDSeq sequence 20H </INSDSeg> 203 </Seguencedata> zin <SequenceData semiencelDNunbern=NB#> 21d <INSDSeq> 212 <IN3DESeqy lLengibh>»27</INSDSeq length 213 <INSDSeq moltype>DNA</INSDSeg moltype»
Zid <INSDSeq division>PAT</INSDSeg division» ais <INSDSeq feature-table> 218 <INZDFeature> 217 <INSDFeature key>sourcec/INSDFeature key» 218 <INSDFearure location>l..27</INSDFeature location» 218 <INSDFeature guals> 220 <INSDOualifien> 220 <INSDOQualifier name>mol type“/INSDQualifier name>
ZEE <INSDQualifier valuerother DNA</INSDQualifier value»
PS </INSDOualifiers zit <INSDQualiifler id="g18"> 225 <INSDQualifier name>organism</iNSDQualifier name> 288 <IN3DQualifier value>synthetic construct</INSDQualifier valued» 2277 </INSDQuali fier» 223 </INSDFearure quals> 226 </INSDFeature>
Ete </INSDSeg feature-table> 231 <INSDSeq sequencevaatetetagaatgggetggagetgcat/INSDSeq sequence 232 </INSDSeg> 223 </SeguenceData> 2324 <SeguenceData soquencelDNunmbey="10"> 235 <INSDSeq> 23% <INSDSeq length>657</INSDSeq length» 237 <INSDSeq molitype>DNA</IN3DSeq moltype>
Sd <INSDSeq division>PAT</INSDSeq divisicn> 230 <INSDSeq feature-iable> 240 <INSDFeaturer» 241 <IN3DFeature key>source</IiN3DFeature key» 242 <IN3DFeature lovation>l..657</INSDFeature location» 2473 <INSDFeature guals> 244 <INSDOualifier>
SAR <INSDOualifier namevmol type</INSDQualifier name>
LAE <INSDQualifisr value>other DNA</INSDQualifier value»
Ea </INSDQualifiers> aas <INSDOQualifier id="q20%> 243 <IN3DQualifier namevorganism“/INSDQualifier name> 2580 <INSDQualifier valuersynthetic construct</INSDoualifier value» 25% </INSDQualifiers> u 252 </INSDFeature quals> wss </IN3DFeature> u did “/INSDSeqg fesature-table> <iN3D3eq sequence>gaattcatgggttggagttgcatcatcctatttctagtggccaccgctaccggegt gcactctgcccacatcgtgatggtggacgcctacaagcccacaaagggcggaggcagcggcggecggctctggeg gaggatctcggatgctgaaggccctgaacgaccagctgaatcgggagctgtactcegcctacctgtactttgce atggccgcttacttcgaggacctgggcctggagggcttcgccaactggatgaaagctcaggccgaggaagagat cggccacgccttgagattctacaactacatctacgacagaaacggcagagtggaactggatgagattcctaagc ctccaaaagagtgggagagccccctgaaggetttcgaggctgecttacgagcatgagaagttcatctccaagtcec atctacgagctggctgctctggcagaggaagaaaaggattattccaccagagccttcctggaatggttcatcaa cgagcaagtcgaagaagaggcctcecgtgaagaagatcctggacaagctgaagtttgccaaggactcccctcaga tcctgttcatgectcgataaagaactgtctgctecgggcccctaagctgcctggcectgectgatgcagggcggcgag tgaggatcc-/INSDS=q seguence> 258 </INSDSeg> 25% </Zequencebatar 203 <Sequencebata seguengsiiNuombar="iilis 25S <IN3DSeq>
Ze “INSDSeqg length>819</INSDSeg Length» 251 <INSDSeq moltype>DNA</INSDSeq moltype> 262 <IN3DSeq division»PAT</INSD3eq division» 263 <INSDSeq feature-table> 284 <INSDFeaturs> 28% <INSDFeature key>source</INIDFeature key>
Zet <INSDFeature location>1..819</INSDFeature location» “ET <INSDFearure gualsr
HER <INSDQualifier»>
Zo <INSDQualifier name>mol type</iNSDQualifier name> zin <IiNSDgualifier value>other DNA-/INSDguelifier value» 274 </THNSDOQualifiar> 292 <INSDQualifier id='"g22"x> 273 <INSDQualifier namerorganism</INSDQualiifier name>
ZA <INSDQualifier valuersynthetic construct“/INSDQualifien valuex>
ZIE </INSDOualifier> 278 </INSDFeature guals> </INSDFeature> 278 </INSDSeg features table» <INSDSeq sequencergaattcatgggttggagttgcatcatcctatttctagtggccaccgctaccggegt gcactcctcctactaccaccaccaccaccaccacgactacgacattcccaccaccgagaacctgtacttccagg gcetecgccacacacatcaagttctccaagagagacgaggatggcaaagagctggctggcgctacaatggaactg agagatagctctggcaaaacaatctctacctggatcagcgacggccaagtgaaggacttctacctctatcctgg caagtacaccttcgtggaaacagctgctcectgatggctacgaggtggctaccgccatcacctttaccgtgaacg agcagggccaggtcaccgtgaacggcaaggccaccaagggcgatgcccacatcggcggaggatctggcggagge tccggcggaggctctcaggtgcagctggtggaatctggaggtggcctggtgcagtceggcggcagcctgegget gtcetgtgcegcttctggctccatgagcecggatcatcaccatgggctggtacagacaggccccaggcatggaac gegagctggtegcecgtgatcggcaacaacgacaataccgtttacggcgacteccgtgcaaggcagattcaccgtg tctcgggacaatgccaagaacaccgcttatctgcagatgaactccctgaacgccgaggacaccgccatgtacta ctgcaagatctccaccctgacacctcctcacgagtactggggccagggcacccaggtgaccgtgtectetcacc atcaccaccatcattgaggatcc“/INSDSeq sequences 2d </INSDSeg> 281 </SeguenceData> 82 </5T268eguencalisting>
Claims (8)
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202210548788.4A CN114805608B (en) | 2022-05-20 | 2022-05-20 | Self-assembled ferritin-based nanoparticle for resisting H1N1 subtype influenza A virus as well as preparation method and application thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| NL2034221B1 true NL2034221B1 (en) | 2023-09-11 |
Family
ID=82516262
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| NL2034221A NL2034221B1 (en) | 2022-05-20 | 2023-02-24 | Anti-h1n1 subtype influenza virus nanoparticles based on self-assembled ferritin, preparation method and application thereof |
Country Status (2)
| Country | Link |
|---|---|
| CN (1) | CN114805608B (en) |
| NL (1) | NL2034221B1 (en) |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013030604A1 (en) * | 2011-09-02 | 2013-03-07 | Health Protection Agency | Influenza virus antibody compositions |
| CN108434450A (en) * | 2018-02-06 | 2018-08-24 | 中国科学院生物物理研究所 | Vaccine and preparation method thereof based on ferritin nano particle |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN111825768B (en) * | 2019-04-16 | 2022-07-26 | 中国农业科学院生物技术研究所 | Self-assembly ferritin-based nano antigen particle, influenza vaccine and preparation method |
| CN110776564B (en) * | 2019-10-30 | 2022-02-08 | 西北农林科技大学 | Two-strain anti-newcastle disease virus nano antibody and expression preparation method and application thereof |
| CN112010984B (en) * | 2020-08-04 | 2021-10-12 | 广州千扬生物医药技术有限公司 | Novel coronavirus S protein polymer nano vaccine based on helicobacter pylori ferritin |
| CN111991556B (en) * | 2020-10-29 | 2021-03-02 | 中山大学 | SARS-CoV-2 RBD conjugated nano particle vaccine |
-
2022
- 2022-05-20 CN CN202210548788.4A patent/CN114805608B/en active Active
-
2023
- 2023-02-24 NL NL2034221A patent/NL2034221B1/en active
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013030604A1 (en) * | 2011-09-02 | 2013-03-07 | Health Protection Agency | Influenza virus antibody compositions |
| CN108434450A (en) * | 2018-02-06 | 2018-08-24 | 中国科学院生物物理研究所 | Vaccine and preparation method thereof based on ferritin nano particle |
Non-Patent Citations (8)
| Title |
|---|
| DANIEL HATLEM ET AL: "Catching a SPY: Using the SpyCatcher-SpyTag and Related Systems for Labeling and Localizing Bacterial Proteins", INTERNATIONAL JOURNAL OF MOLECULAR SCIENCES, vol. 20, no. 9, 30 April 2019 (2019-04-30), pages 2129, XP055618464, DOI: 10.3390/ijms20092129 * |
| DEL ROSARIO JOANNE MARIE ET AL: "Suppl. Material: Protection from Influenza by intramuscular gene vector delivery of a broadly neutralizing nanobody does not depend on antibody dependent cellular cytotoxicity", FRONT. IMMUNOL., 29 May 2020 (2020-05-29), XP093066843, Retrieved from the Internet <URL:https://www.frontiersin.org/articles/10.3389/fimmu.2020.00627/full> [retrieved on 20230724], DOI: 10.3389/fimmu.2020.00627 * |
| DEL ROSARIO JOANNE MARIE M. ET AL: "Protection from Influenza by intramuscular gene vector delivery of a broadly neutralizing nanobody does not depend on antibody dependent cellular cytotoxicity", 29 May 2020 (2020-05-29), pages 1 - 15, XP055871760, Retrieved from the Internet <URL:https://www.frontiersin.org/articles/10.3389/fimmu.2020.00627/full> [retrieved on 20211210] * |
| FAN KELONG ET AL: "Fenobody: A Ferritin-Displayed Nanobody with High Apparent Affinity and Half-Life Extension", ANAL. CHEM., vol. 90, no. 9, 4 April 2018 (2018-04-04), pages 5671 - 5677, XP055967959, DOI: 10.1021/acs.analchem.7b05217 * |
| MASARU KANEKIYO ET AL: "Self-assembling influenza nanoparticle vaccines elicit broadly neutralizing H1N1 antibodies", NATURE, SPRINGER NATURE PUBLISHING AG, LONDON, vol. 499, no. 7456, 4 July 2013 (2013-07-04), pages 102 - 106, XP002755795, ISSN: 1476-4687, [retrieved on 20130522], DOI: 10.1038/NATURE12202 * |
| PRÖSCHEL MARLENE ET AL: "Probing the potential of CnaB-type domains for the design of tag/catcher systems", PLOS ONE, vol. 12, no. 6, 27 June 2017 (2017-06-27), pages e0179740, XP093066800, DOI: 10.1371/journal.pone.0179740 * |
| VORONINA DARIA V. ET AL: "Development of Neutralizing Nanobodies to the Hemagglutinin Stem Domain of Influenza A Viruses", ACTA NATURAE, vol. 13, no. 4, 15 December 2021 (2021-12-15), Russia, pages 33 - 41, XP093066852, ISSN: 2075-8243, Retrieved from the Internet <URL:https://actanaturae.ru/2075-8251/article/viewFile/11495/pdf_1> DOI: 10.32607/actanaturae.11495 * |
| WANG WENJUN ET AL: "Ferritin nanoparticle-based SpyTag/SpyCatcher-enabled click vaccine for tumor immunotherapy", NANOMEDICINE: NANOTECHNOLOGY, BIOLOGY, AND MEDICINE, vol. 16, 1 February 2019 (2019-02-01), AMSTERDAM, NL, pages 69 - 78, XP093066544, ISSN: 1549-9634, DOI: 10.1016/j.nano.2018.11.009 * |
Also Published As
| Publication number | Publication date |
|---|---|
| CN114805608B (en) | 2023-05-19 |
| CN114805608A (en) | 2022-07-29 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP6231099B2 (en) | Extraction, production and application of plant microribonucleic acid | |
| CN104769112A (en) | Methods and products for expressing proteins in cells | |
| CN108486108A (en) | It is a kind of knock out people's HMGB1 genes cell strain and its application | |
| CN105567641B (en) | A kind of preparation method and applications carrying anti-tumor protein targeting exosome | |
| CN103813808A (en) | System for cargo delivery into cells | |
| CN103849601B (en) | A kind of induced fibroblast transdifferentiation is method and the application thereof of neuronal cell | |
| CN112920989B (en) | Liver organoid model, establishment method and application thereof, and pharmaceutical composition for treating hepatocyte iron death | |
| CN108118070A (en) | A kind of slow virus preparation method | |
| CN107794280B (en) | Targeted cell-penetrating peptide gene vector and application thereof | |
| NL2034221B1 (en) | Anti-h1n1 subtype influenza virus nanoparticles based on self-assembled ferritin, preparation method and application thereof | |
| CN104694576B (en) | A kind of method of IFNAR1 genes in 1 cell lines of silence DF | |
| KR20200005345A (en) | kidney spheroid and method of preparing the same | |
| EA023541B1 (en) | Insulin-like growth factor 1 receptor binding peptides | |
| WO2020125576A1 (en) | Method for delivering gene in cells | |
| CN104611343B (en) | The carp antiviral natural immune protein TRIM32 and antiviral activity of separation | |
| CN107034201A (en) | Apparent modification enzyme SETD2 antivirus action and its application | |
| CN112941020B (en) | Application of chicken circular RNA in promoting proliferation of myoblasts | |
| TW202334437A (en) | Viral vectors and their applications | |
| CN111803646B (en) | Solid tumor combination treatment composition | |
| CN109266684B (en) | Method for constructing animal model with pathogen infection sensitivity | |
| CN109536452B (en) | Visual nasopharyngeal carcinoma cell and application thereof | |
| CN109423522B (en) | Identification and application of molecular breeding marker of functional mutation site of porcine CD4 gene | |
| CN111926015A (en) | Oligonucleotide, viral vector and application thereof and RNAi pharmaceutical preparation | |
| CN114134181B (en) | Expression unit, recombinant lentivirus expression vector, recombinant lentivirus, and preparation method and application thereof | |
| CN113061190B (en) | HIV N peptide fusion peptide inhibitor MTQ-N36 and application thereof |