NL1014684C2 - Method is for automatically switching off mobile telephone if user enters room where telephone may not transmit or receive involves inductively coupled beacon signal switching off telephone immediately it passes room entrance - Google Patents
Method is for automatically switching off mobile telephone if user enters room where telephone may not transmit or receive involves inductively coupled beacon signal switching off telephone immediately it passes room entrance Download PDFInfo
- Publication number
- NL1014684C2 NL1014684C2 NL1014684A NL1014684A NL1014684C2 NL 1014684 C2 NL1014684 C2 NL 1014684C2 NL 1014684 A NL1014684 A NL 1014684A NL 1014684 A NL1014684 A NL 1014684A NL 1014684 C2 NL1014684 C2 NL 1014684C2
- Authority
- NL
- Netherlands
- Prior art keywords
- telephone
- mobile
- beacon signal
- automatically switching
- phone
- Prior art date
Links
Classifications
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04W—WIRELESS COMMUNICATION NETWORKS
- H04W48/00—Access restriction; Network selection; Access point selection
- H04W48/02—Access restriction performed under specific conditions
- H04W48/04—Access restriction performed under specific conditions based on user or terminal location or mobility data, e.g. moving direction, speed
Landscapes
- Engineering & Computer Science (AREA)
- Computer Security & Cryptography (AREA)
- Computer Networks & Wireless Communication (AREA)
- Signal Processing (AREA)
- Near-Field Transmission Systems (AREA)
Abstract
Description
- 1 -5- 1 -5
Een methode om mobiele telefoons automatisch uit en weer aan te schakelen.A method to turn off and on mobile phones automatically.
Moderne mobiele telefoons, zoals van het GSM type, communiceren op geregelde tijden met basisstations opdat het mobiele netweik te allen tijde weet waar een abonnee zich bevindt Dit met het doel dat snel met 10 het toestel van de mobiele abonnee contact gemaakt kan worden als iemand hem/haar wil bereiken.Modern mobile phones, such as the GSM type, communicate with base stations at regular intervals so that the mobile network knows at all times where a subscriber is located. This with the aim of quickly contacting the mobile subscriber's device if someone / wants to reach her.
Dit impliceert dat het mobiele toestel op gezette tijden hoogfrequente energie uitzendt zonder dat de drager van de telefoon zich daarvan bewust is. Er kunnen dan ongewenste situaties optreden, waarin storing veroorzaakt wordt aan andere radioapparatuur of gevoelige elektronische apparatuur.This implies that the mobile device emits high-frequency energy at regular intervals without the telephone carrier being aware of it. Undesirable situations may then arise in which interference is caused to other radio equipment or sensitive electronic equipment.
Voorbeelden van plaatsen waar risico's op storing aanwezig zijn, zijn ziekenhuizen en vliegtuigen. Ook kan 15 er in sommige situaties sprake zijn van hinder als een mobiele telefoon hoorbaar over gaat, bijvoorbeeld in concertzalen, restaurants, bioscopen, etc..Hospitals and aircraft are examples of places where there are risks of interference. There may also be nuisance in some situations if a mobile phone rings audibly, for example in concert halls, restaurants, cinemas, etc.
Mobiele telefoons kunnen handmatig worden afgeschakeld. Echter soms wordt dat vergeten of zelfs bewust nagelaten.Mobile phones can be turned off manually. However, sometimes this is forgotten or even deliberately left behind.
2020
Het is het doel van de uitvinding om een mobiele telefoon automatisch te laten afschakelen als deze een zone binnen gaat waarin dat gewenst is en automatisch weer in te schakelen zodra die zone weer verlaten wordt 25 Hét automatisch uit- en inschakelen dient te gebeuren op scherp afgebakende plaatsen, zoals doorgangen naar de betreffende zones, bijv. gangen, deuren, de slurf naar een vliegtuig, etc. Een mobiele telefoon, die op korte afstand van zo'n toegang passeert, maar niet de betreffende zone binnen gaat, dient echter niet afgeschakeld te worden.It is the object of the invention to have a mobile phone switch off automatically when it enters a zone in which it is desired and to switch it on again automatically when that zone is left again. The automatic switch-off and switch-on must take place on clearly defined places, such as passageways to the relevant zones, eg corridors, doors, the trunk to an aircraft, etc. However, a mobile phone that passes a short distance from such an entrance, but does not enter the zone concerned, must not be switched off to become.
Dit betekent dat voor de overdracht van het af- of aanschakelcommando een medium gebruikt dient te 3 0 worden waarin de transmissie van het commandosignaal scherp begrensd is tot het gebied dat de drager van de mobiele telefoon passeert om de genoemde zones binnen te treden.This means that for the transmission of the switch-on or switch-on command, a medium must be used in which the transmission of the command signal is sharply limited to the area that the mobile phone bearer passes in order to enter the said zones.
Propagerende radiogolven, zoals de mobiele telefoon zelf gébruikt voor de verbinding met het basisstation, zijn daarvoor niet geschikt omdat de veldsterkte daarvan slechts langzaam met de afstand afheeraL 3 5 Bovendien zorgen reflecties tegen wanden en andere objecten in de omgeving voor reflecties, hetgeen het veldsterkteverloop zeer onregelmatig kan maken.Propagating radio waves, such as the mobile phone itself is used for the connection to the base station, are not suitable for this, because the field strength thereof only slowly decreases with the distance. irregular.
’ M $84 - 2 -M $ 84 - 2 -
Communicatie met behulp van infrarood licht is niet geschikt omdat dat niet door kleding heen gaat. Dit geldt ook voor akoestische signalen.Communication using infrared light is not suitable because it does not pass through clothing. This also applies to acoustic signals.
De magnetische inductievelden, zoals gegenereerd door bisantennes, vallen echter wel snel af met de 5 toenemende afstand. Op afstanden groter dan de afmetingen van de lus is deze afname evenredig met de derde macht van de afstand.However, the magnetic induction fields, as generated by bisantennas, quickly drop with the increasing distance. At distances greater than the dimensions of the loop, this decrease is proportional to the third power of the distance.
Dat maakt dat inductieve koppeling wel een goed medium is om in een goed gedefinieerde ruimte een afschakel- of een inschakelopdracht naar een passerende mobiele telefoon over te brengen.This means that inductive coupling is a good medium for transferring a switch-off or a switch-on command to a passing mobile phone in a well-defined room.
10 Figuur 1 toont het principeschema van een bakenzender volgens de uitvinding.Figure 1 shows the principle diagram of a beacon transmitter according to the invention.
Figuur 2 geeft een doorgang weer met twee bisantennes en de bakenzender.Figure 2 shows a passage with two bisantennas and the beacon transmitter.
Figuur 3 geeft het principeschema van een schakeling, die volgens de uitvinding toegevoegd wordt aan een mobiele telefoon.Figure 3 shows the basic diagram of a circuit, which is added according to the invention to a mobile telephone.
Figuur 4 toont modulatievormen zoals de bakensignalen volgens de uitvinding gemoduleerd kunnen zijn. 15 Figuur 5 toont een meer uitgebreide codering, waarmee de bakensignalen volgens de uitvinding gemoduleerd kunnen zijn.Figure 4 shows modulation forms such as the beacon signals according to the invention can be modulated. Figure 5 shows a more extensive coding, with which the beacon signals according to the invention can be modulated.
Figuur 6 toont het principeschema van een schakeling met drie antennespoelen, die volgens de uitvinding toegevoegd kan worden aan een mobiele telefoon.Figure 6 shows the principle diagram of a circuit with three antenna coils, which according to the invention can be added to a mobile telephone.
Figuur 7 toont een alternatieve doorgang met bisantennes aan de zijkanten.Figure 7 shows an alternative passage with bisantennas on the sides.
20 Figuur 8 toont een alternatieve doorgang met bisantennes op de vloer en aan het plafond.Figure 8 shows an alternative passage with bisantennas on the floor and on the ceiling.
In een oplossing volgens de uitvinding wordt door een bakenzender 1, zie figuur 1, in generator 2 een draaggolffrequentie opgewekt In modulator 3 wordt deze draaggolf gemoduleerd met een eerste specifieke 25 code uit codegenerator 4. Via versterker 5 wordt dit gemoduleerde signaal 6 aangeboden op uitgangsconnector 7.In a solution according to the invention, a carrier frequency is generated by a beacon transmitter 1, see figure 1, in generator 2. In modulator 3, this carrier wave is modulated with a first specific code from code generator 4. Via amplifier 5, this modulated signal 6 is offered at output connector. 7.
In een tweede modulator 8 wordt dezelfde draaggolf gemoduleerd met een tweede specifieke code, eveneens gegenereerd door codegenerator 4. Via versterker 9 wordt dit tweede gemoduleerde signaal 10 aangeboden op uitgangsconnector 11.In a second modulator 8, the same carrier wave is modulated with a second specific code, also generated by code generator 4. Via amplifier 9, this second modulated signal 10 is applied to output connector 11.
30 De bakenzender 1 is via uitgangsconnector 7 aangesloten op een bisantenne 12, die, zoals getekend in figuur 2, om een doorgang gemonteerd is. De dragers van mobiele telefoons lopen aldus door de bisantenne heen. De richting van de magnetische veldlijnen (H) is in deze opstelling evenwijdig aan de looprichting. Een tweede bisantenne 13, veibonden met uitgangsconnector 11, is evenwijdig aan en achter de eerste bisantenne geplaatst Het resultaat van deze opstelling is dat een mobiele telefoon 14 eerst het magnetische 35 veld van bisantenne 12 en vervolgens het veld van bisantenne 13 passeertThe beacon transmitter 1 is connected via output connector 7 to a bisantenna 12, which is mounted around a passage, as shown in figure 2. The carriers of mobile phones thus run through the bisantenna. The direction of the magnetic field lines (H) in this arrangement is parallel to the running direction. A second bisantenna 13, fiber bound with output connector 11, is placed parallel to and behind the first bisantennum. The result of this arrangement is that a mobile phone 14 first passes the magnetic field of bisantennum 12 and then the field of bisantennum 13.
De lusantennes 12 en 13 worden aldus gevoed met de gemoduleerde bakensignalen 6 en 10, waarvan de draaggolffrequenties gelijk en synchroon zijn, doch de gemoduleerde codes verschillend.The loop antennas 12 and 13 are thus fed with the modulated beacon signals 6 and 10, the carrier frequencies of which are equal and synchronous, but the modulated codes different.
.1 014 684 - 3 -.1 014 684 - 3 -
De mobiele telefoon 14 is uitgebreid met de schakeling van figuur 3. In antennespoel 15 wordt door het magnetische veld van de bisantennes een spanning opgewekt die in demodulator 16 wordt gedemoduleerd. De zo teruggewonnen codesignaal wordt in detector 17 gedecodeerd. Daarbij wordt gecheckt ten eerste of beide codes geldig is om een mobiele telefoon uit, cq. aan, te schakelen, en ten tweede in welke volgorde 5 beide codes gedetecteerd worden. Uit deze volgorde kan geconcludeerd worden of de mobiele telefoon eerst bisantenne 12 en daarna bisantenne 13 passeert, of in omgekeerde volgorde. Daaruit kan afgeleid worden of de telefoon de beschermde ruimte ingaat, dan wel verlaat, waaraan de acties "mobiele telefoon uitschakelen" dan wel "mobiele telefoon inschakelen" gekoppeld kunnen worden.The mobile telephone 14 has been extended with the circuit of figure 3. In antenna coil 15, a voltage is generated by the magnetic field of the bisantennas which is demodulated in demodulator 16. The code signal thus recovered is decoded in detector 17. In doing so, it is firstly checked whether both codes are valid for a mobile phone. on, and secondly, in which order both codes are detected. From this sequence, it can be concluded whether the mobile phone first passes bis-antenna 12 and then bis-antenna 13, or in reverse order. From this it can be deduced whether the telephone enters or leaves the protected area, to which the actions "switch off mobile phone" or "switch on mobile phone" can be linked.
10 Figuur 4 toont een voorbeeld van een eenvoudige uitvoering van twee modulatiecodes. Bovenaan is signaal 6 getekend, dat aan de eerste bisantenne 12 toegevoerd wordt. In het midden signaal 10, toegevoerd aan de tweede bisantenne 13.Figure 4 shows an example of a simple implementation of two modulation codes. At the top signal 6 is shown, which is applied to the first bisantenna 12. In the middle, signal 10 is applied to the second bisantenna 13.
Beide signalen in dit voorbeeld zijn amplitude gemoduleerd. Ook andere modulatievormen zijn toepasbaar, en worden geacht binnen de uitvinding te vallen. Ook de grootte van modulatiediepte, is niet beperkt tot de 15 in figuur 4 getekende waarde van 20 %, maar daarvoor kunnen alle gangbare waarden gekozen worden.Both signals in this example are amplitude modulated. Other modulation forms are also applicable and are considered to fall within the invention. The size of the modulation depth is also not limited to the value of 20% drawn in figure 4, but all common values can be chosen for this.
Het onderste deel van figuur 4 toont de modulatievorm 18 van de spanning die in spoel 15 wordt geïnduceerd door het magnetische veld van de eerste bisantenne 12 op het moment dat de mobiele telefoon deze antenne passeert Zodra de mobiele telefoon de tweede bisantenne passeert wordt een spanning met de modulatievorm 19 in spoel 15 geïnduceerd.The lower part of figure 4 shows the modulation form 18 of the voltage induced in coil 15 by the magnetic field of the first bisantenna 12 as the mobile phone passes this antenna. As soon as the mobile phone passes the second bisantenna, a voltage with the modulation form 19 induced in coil 15.
20 Bevindt de mobiele telefoon zich tussen beide bisantennes, leveren beide magnetische vélden een bijdrage aan de spanning over spoel 15. Midden tussen beide bisantennes zijn de veldsterkten even groot, en daar de modulaties, getekend in figuur 4, complementair zijn, compenseren de spanningsbijdragen van het veld van beide bisantennes elkaar en is er aldus geen modulatie meer aanwezig op de geïnduceerde spanning over spoel 15. Dit wordt in figuur 4 aangegeven met 20.20 If the mobile phone is located between both bisantennas, both magnetic fields contribute to the voltage across coil 15. In the middle between both bisantennas, the field strengths are the same, and since the modulations, shown in Figure 4, are complementary, the voltage contributions of the field of both bisantennas to one another and thus there is no longer any modulation on the induced voltage across coil 15. This is indicated by 20 in Figure 4.
2525
Het is niet noodzakelijk dat de modulatievormen van signaal 12 en van signaal 13 complementair zijn, doch dit gegeven is hier gebruikt om de werking van de uitvinding inzichtelijker te maken, en omdat codering op deze wijze het onderscheid tussen beide codes eenvoudig te detecteren is in detector 17, en daarmee de richting van de passage door de bisantennes.It is not necessary that the modulation forms of signal 12 and of signal 13 are complementary, but this fact has been used here to make the operation of the invention more transparent, and because coding in this way the distinction between the two codes is easily detectable in detector 17, and thus the direction of passage through the bisantennes.
3030
Een eenvoudige codering als getekend in figuur 4 heeft als nadeel dat er een risico bestaat dat magnetische velden van andere bronnen, bijvoorbeeld toegangscontrolesystemen, winkeldiefstaldetectiesystemen, etc., door detector 17 eveneens aangezien kunnen worden voor een bakensignaal, en daarmee ten onrechte de mobiele telefoon doen af schakelen.A simple coding as drawn in figure 4 has the drawback that there is a risk that magnetic fields from other sources, for example access control systems, shoplifting detection systems, etc., can also be mistaken for detector beacon by detector 17, and thereby wrongly do the mobile phone switch off.
3 5 Deze valse schakelacties zijn te voorkomen door de coderingen van de bakensignalen meer specifiek te maken. Een oplossing wordt gevormd door de codes dan te laten bestaan uit een serie bits, bijvoorbeeld 32 bits, waarvan een groot deel van de bits voor de codering van het eerste bakensignaal 6 gelijk is aan dezelfde bits in het tweede bakensignaal 10. Slechts een klein aantal bits is verschillend. De i 0 14 684 - 4 - gemeenschappelijke bits vormen samen een codewoord, dat door detector 17 eerst herkend moet worden, waarna een schakelactie geïnitieerd kan worden. De bits die verschillen, bepalen welk bakensignaal gedetecteerd wordt, en geven daarmee de passagerichting aan.3 5 These false switching actions can be prevented by making the coding of the beacon signals more specific. A solution is to make the codes then consist of a series of bits, for example 32 bits, of which a large part of the bits for encoding the first beacon signal 6 is equal to the same bits in the second beacon signal 10. Only a small number bits are different. The common bits together form a code word, which must first be recognized by detector 17, after which a switching action can be initiated. The bits that differ determine which beacon signal is detected, thereby indicating the passage direction.
Deze onderling verschillende bits kunnen evenals in de codering van figuur 4 complementair genomen 5 worden.These mutually different bits can be taken complementary as in the coding of figure 4.
Figuur 5 toont een voorbeeld van deze uitgebreidere en veiligere codering. Hierin is alleen de modulatie weergegeven, waarbij in het geval van amplitude modulatie als in figuur 4,1 overeenkomt met het maximale signaalniveau en 0 met het minimale signaalniveau.Figure 5 shows an example of this more extensive and more secure encryption. This only shows the modulation, where in the case of amplitude modulation as in figure 4.1 corresponds to the maximum signal level and 0 to the minimum signal level.
De code van het eerste bakensignaal 6 wordt gerepresenteerd door lijn 21 en de code van het tweede 10 bakensignaal 10 door lijn 22. Regel 23 geeft de bitnummers weer. Beide codes beginnen met een header 24 (bitnummers 1 t/m 8), gevolgd door het gemeenschappelijke codewoord 25 (bitnummers 9 t/m 25). De richtingbepalende codes wordt weergegeven door 26 (bitnummers 26 t/m 30). Tenslotte vormt 27 (bits 32 en 32) de trailer.The code of the first beacon signal 6 is represented by line 21 and the code of the second beacon signal 10 by line 22. Line 23 represents the bit numbers. Both codes start with a header 24 (bit numbers 1 to 8), followed by the common code word 25 (bit numbers 9 to 25). The direction-determining codes are represented by 26 (bit numbers 26 to 30). Finally, 27 (bits 32 and 32) forms the trailer.
De beide codes worden gelijktijdig en cyclisch uitgezonden, d.w.z. na bit 32 van de trailer begint de code 15 opnieuw met bit lvan de header.Both codes are transmitted simultaneously and cyclically, i.e. after bit 32 of the trailer, code 15 starts again with bit 1 of the header.
De codering, weergegeven in figuur 5, is slechts een voorbeeld dat aangeeft dat met uitgebreidere codes richtingafhankelijke detectie mogelijk is met een zeer kleine kans op valse detecties.The coding, shown in Figure 5, is just one example indicating that more extensive codes allow direction-dependent detection with a very small chance of false detections.
De codering van beide bakensignalen kan ook anders ingericht worden dan aangegeven in figuur 5 en kan 20 daarbij ook meer of minder bits bevatten. Deze varianten zijn bij de vakman bekend en worden geacht binnen de uitvinding te vallen.The coding of both beacon signals can also be arranged differently than indicated in figure 5 and can also contain more or fewer bits. These variants are known to the person skilled in the art and are understood to fall within the invention.
De additionele schakeling in de mobiele telefoon, zoals getekend in figuur 3, bevat één antennespoel 15. Deze antennespoel koppelt optimaal met de magnetische veldlijnen van de bakensignalen indien de as van 25 de windingen van de spoel evenwijdig lopen met de richting van de veldlijnen. Indien de as loodrecht staat op de richting van de veldlijnen is de koppeling afwezig. Dit betekent dat de detectiékans afhangt van de oriëntatie van de mobiele telefoon op het moment dat deze de lusantennes passeert.The additional circuit in the mobile phone, as shown in Figure 3, contains one antenna coil 15. This antenna coil couples optimally with the magnetic field lines of the beacon signals if the axis of the turns of the coil are parallel to the direction of the field lines. If the axis is perpendicular to the direction of the field lines, the coupling is absent. This means that the detection probability depends on the orientation of the mobile phone as it passes the loop antennas.
Om alle ruimtelijke oriëntaties af te kunnen dekken, dient de mobiele telefoon gevoelig te zijn voor hetzij bakensignalen waarvan de magnetische veldlijnen in één van de drie mogelijke ruimtelijke assen, de X-, de 30 Y-, en de Z-as, kunnen lopen, hetzij voor bakensignalen die voorkomen in alle drie genoemde ruimtelijke assen.In order to cover all spatial orientations, the mobile phone must be sensitive to either beacon signals whose magnetic field lines can run in one of the three possible spatial axes, the X, the 30 Y, and the Z axis, or for beacon signals that occur in all three spatial axes mentioned.
Figuur 6 geeft de schakeling voor een schakelcircuit voor een mobiele telefoon, die gevoelig is in drie assen voor bakensignalen waarvan de veldlijnen gericht zijn in één as. Naast antennespoel 15 en demodulator 16 3 5 zijn er nog twee antennespoelen 28 en 29 en twee demodulatoren 30, respectievelijk 31, geplaatst De assen van de antennespoelen 15,28 en 29 dienen onderling loodrecht op elkaar te staan.Figure 6 shows the circuit for a switching circuit for a mobile telephone, which is sensitive in three axes for beacon signals, the field lines of which are oriented in one axis. In addition to antenna coil 15 and demodulator 16 3, there are also two antenna coils 28 and 29 and two demodulators 30 and 31, respectively. The axes of the antenna coils 15,28 and 29 must be mutually perpendicular to each other.
; ü 14 684 - 5 -; ü 14 684 - 5 -
Een voorbeeld van een platte uitvoeringvorm daarvan wordt gevormd door een van de drie spoelen uit te voeren als een platte luchtspoel, en de twee andere spoelen te wikkelen op elk een ferrietstaaf, die dan onderling loodrecht geplaatst worden, maar beiden in het vlak van de luchtspoel.An example of a flat embodiment thereof is formed by designing one of the three coils as a flat air coil, and winding the other two coils on each a ferrite rod, which are then placed perpendicular to each other, but both in the plane of the air coil .
Ook hier zijn vele varianten in de uitvoering mogelijk, die allen worden geacht te vallen binnen het 5 raamwerk van de uitvinding.Here too many variants in the embodiment are possible, all of which are considered to fall within the framework of the invention.
In de tweede oplossing bevat de mobiele telefoon slechts één antennespoel, maar worden de magnetische velden van de bakensignalen in drie oriëntaties aangeboden. In de opstelling van figuur 2 zijn de veldlijnen van de bakensignalen horizontaal gericht in de passagerichting. Die richting wordt hier als de X-richting 10 gedefinieerd. Daarbij wordt de richting dwars op de passagerichting met de Y-richting aangegeven, en de verticale richting als de Z-richting.In the second solution, the mobile phone contains only one antenna coil, but the magnetic fields of the beacon signals are presented in three orientations. In the arrangement of Figure 2, the field lines of the beacon signals are oriented horizontally in the passage direction. That direction is here defined as the X direction 10. The direction transverse to the passage direction is indicated with the Y direction and the vertical direction as the Z direction.
Een lusantenneopstelling, die een veld in de Y-richting genereert, is getekend in figuur 7. De bisantenne bestaat uit twee delen, namelijk een rechterlusantenne 32, die gemonteerd is in de rechterwand van de 15 doorgang, en een linkerlusantenne 33, gemonteerd in de linkerwand. De richting van de veldlijnen is nu dwars op de looprichting en horizontaal. De bisantennes 34 en 35 genereren evenzo het veld voor het tweede bakensignaal.A loop antenna arrangement, which generates a field in the Y direction, is shown in Figure 7. The bisantenna consists of two parts, a right loop antenna 32 mounted in the right wall of the passage and a left loop antenna 33 mounted in the left wall. The direction of the field lines is now transverse to the running direction and horizontal. Likewise, the bisantennas 34 and 35 generate the field for the second beacon signal.
Een lusantenneopstelling, die een veld in de Z-richting genereert, wordt gegeven in figuur 8. Een vloerantenne 36 tezamen met een plafondantenne 37 genereren een verticaal gericht magnetisch veld. Ook 20 zij worden gevolgd door een tweede combinatie bisantennes 38 en 39.A loop antenna arrangement, which generates a field in the Z direction, is given in Figure 8. A floor antenna 36 together with a ceiling antenna 37 generate a vertically directed magnetic field. They are also followed by a second combination of bisantennas 38 and 39.
In principe is nu een oriëntatie onafhankelijke uit- en aanschakeling van de mobiele telefoon mogelijk door achtereenvolgens de lusantenne-opstellingen van de figuren 2, 7 en 8 te passeren. Echter doordat alle drie opstellingen achter elkaar geplaatst en goed gescheiden moeten worden, ontstaat een opstelling, die in zijn 25 totaliteit veel ruimte in beslag neemt Gedeeltelijk is dat probleem op te lossen door twee groepen bisantennes te combineren in een draaiveldopstelling. Daarbij worden bijvoorbeeld de antennes uit twee van de figuren 2,7 en 8 in elkaar geplaatst waarbij de antennes van de twee groepen met een onderling faseverschil van 90 graden tussen beide groepen aangestuurd worden.In principle, an orientation-independent switch-off and switch-on of the mobile telephone is now possible by successively bypassing the loop antenna arrangements of Figures 2, 7 and 8. However, because all three arrangements have to be placed one behind the other and must be well separated, an arrangement arises, which in its entirety takes up a lot of space. Partly that problem can be solved by combining two groups of bisantennas in a rotating field arrangement. For example, the antennas of two of Figures 2, 7 and 8 are placed in each other, the antennas of the two groups being controlled with a mutual phase difference of 90 degrees between the two groups.
Deze zogenaamde draaiveldtechnieken worden als bij de vakman bekend geacht en vallen in al hun 3 0 variaties binnen het raamwerk van de uitvinding.These so-called rotating field techniques are considered to be known to the person skilled in the art and in all their variations fall within the scope of the invention.
1 014 6841 014 684
Claims (7)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
NL1014684A NL1014684C2 (en) | 2000-03-17 | 2000-03-17 | Method is for automatically switching off mobile telephone if user enters room where telephone may not transmit or receive involves inductively coupled beacon signal switching off telephone immediately it passes room entrance |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
NL1014684 | 2000-03-17 | ||
NL1014684A NL1014684C2 (en) | 2000-03-17 | 2000-03-17 | Method is for automatically switching off mobile telephone if user enters room where telephone may not transmit or receive involves inductively coupled beacon signal switching off telephone immediately it passes room entrance |
Publications (1)
Publication Number | Publication Date |
---|---|
NL1014684C2 true NL1014684C2 (en) | 2001-09-19 |
Family
ID=19771031
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
NL1014684A NL1014684C2 (en) | 2000-03-17 | 2000-03-17 | Method is for automatically switching off mobile telephone if user enters room where telephone may not transmit or receive involves inductively coupled beacon signal switching off telephone immediately it passes room entrance |
Country Status (1)
Country | Link |
---|---|
NL (1) | NL1014684C2 (en) |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0880296A1 (en) * | 1997-05-21 | 1998-11-25 | Nec Corporation | Transmission restricting device, radio communication terminal equipment and transmission restricting system using these |
DE19739013A1 (en) * | 1997-09-06 | 1999-03-11 | Matuschek Mestechnik Gmbh | Executing safety switch-off of apparatus transmitting interfering pulses inside devices susceptible to such pulses, esp. aeroplanes |
GB2329794A (en) * | 1997-09-26 | 1999-03-31 | Motorola Gmbh | Disabling electronic equipment in hazardous areas |
-
2000
- 2000-03-17 NL NL1014684A patent/NL1014684C2/en not_active IP Right Cessation
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0880296A1 (en) * | 1997-05-21 | 1998-11-25 | Nec Corporation | Transmission restricting device, radio communication terminal equipment and transmission restricting system using these |
DE19739013A1 (en) * | 1997-09-06 | 1999-03-11 | Matuschek Mestechnik Gmbh | Executing safety switch-off of apparatus transmitting interfering pulses inside devices susceptible to such pulses, esp. aeroplanes |
GB2329794A (en) * | 1997-09-26 | 1999-03-31 | Motorola Gmbh | Disabling electronic equipment in hazardous areas |
Non-Patent Citations (1)
Title |
---|
PROUDLER G: "AUTOMATICALLY DISABLING MOBILE COMMUNICATIONS DEVICES IN SENSITIVE LOCATIONS", RESEARCH DISCLOSURE,GB,INDUSTRIAL OPPORTUNITIES LTD. HAVANT, no. 391, 1 November 1996 (1996-11-01), pages 729, XP000680926, ISSN: 0374-4353 * |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US6396438B1 (en) | System and method for locating radio frequency identification tags using three-phase antenna | |
US6693511B1 (en) | System and method for communicating with dormant radio frequency identification tags | |
US6853687B2 (en) | Proximity-based magnetic field generator for controlling operation of RF burst-transmitting tags of geolocation system | |
US5602556A (en) | Transmit and receive loop antenna | |
US4600829A (en) | Electronic proximity identification and recognition system with isolated two-way coupling | |
US6037870A (en) | Dector system for access control, and a detector assembly for implementing such a system | |
JP3441729B2 (en) | Transmitter / receiver antenna having oblique members | |
NZ250312A (en) | Radiofrequency transponder electronic article security system | |
US6452504B1 (en) | System and method for communication with radio frequency identification tags using tow message DFM protocol | |
US8451126B2 (en) | Combination electronic article surveillance/radio frequency identification antenna and method | |
JP2002237720A (en) | Antenna device | |
WO2012122380A1 (en) | Radio frequency access control system and method | |
JP5679125B2 (en) | Position detection system | |
NL1014684C2 (en) | Method is for automatically switching off mobile telephone if user enters room where telephone may not transmit or receive involves inductively coupled beacon signal switching off telephone immediately it passes room entrance | |
CN102769474A (en) | Radio frequency device and distance control method for low-frequency alternating magnetic field | |
WO2001022118A9 (en) | System and method for locating radio frequency identification tags using three-phase antenna | |
US4409590A (en) | Building security, communication and control system | |
CN103502998B (en) | The fetch equipment of contactless communication is carried out with head-end unit | |
JP2013125017A (en) | Location detection system | |
US5670941A (en) | Terminal for contactless communication with portable objects | |
WO2001069557A2 (en) | System and method for simplifying the life of a person | |
JP5541461B2 (en) | Communication device | |
NL1014126C2 (en) | Detection system recognizes passage of persons or goods through gate, combines advantages of inductive electromagnetic loop method with those of short wave radio method | |
JPH0676185A (en) | Individual power-feeding multiplex loop antenna for electronic guard system | |
GB2406469A (en) | A module for use with a mobile station and a method of operation |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PD2B | A search report has been drawn up | ||
VD1 | Lapsed due to non-payment of the annual fee |
Effective date: 20041001 |