MXPA06003677A - Human epo mimetic hinge core mimetibodies, compositions, methods and uses - Google Patents
Human epo mimetic hinge core mimetibodies, compositions, methods and usesInfo
- Publication number
- MXPA06003677A MXPA06003677A MXPA/A/2006/003677A MXPA06003677A MXPA06003677A MX PA06003677 A MXPA06003677 A MX PA06003677A MX PA06003677 A MXPA06003677 A MX PA06003677A MX PA06003677 A MXPA06003677 A MX PA06003677A
- Authority
- MX
- Mexico
- Prior art keywords
- epo
- central
- hinge region
- mimic
- seq
- Prior art date
Links
- 239000000203 mixture Substances 0.000 title claims abstract description 202
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 76
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 75
- 230000003278 mimic Effects 0.000 claims description 151
- 239000003814 drug Substances 0.000 claims description 133
- 210000004027 cells Anatomy 0.000 claims description 123
- 229940079593 drugs Drugs 0.000 claims description 123
- 108090001123 antibodies Proteins 0.000 claims description 78
- 102000004965 antibodies Human genes 0.000 claims description 78
- 230000027455 binding Effects 0.000 claims description 72
- 229920001184 polypeptide Polymers 0.000 claims description 65
- 150000001413 amino acids Chemical class 0.000 claims description 57
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 claims description 53
- 102000018358 Immunoglobulins Human genes 0.000 claims description 51
- 108060003951 Immunoglobulins Proteins 0.000 claims description 51
- 239000000243 solution Substances 0.000 claims description 49
- 239000003446 ligand Substances 0.000 claims description 45
- 230000000694 effects Effects 0.000 claims description 43
- 229920000023 polynucleotide Polymers 0.000 claims description 33
- 239000002157 polynucleotide Substances 0.000 claims description 33
- 238000004519 manufacturing process Methods 0.000 claims description 29
- 239000003085 diluting agent Substances 0.000 claims description 27
- 210000001519 tissues Anatomy 0.000 claims description 23
- 210000000056 organs Anatomy 0.000 claims description 21
- 150000001875 compounds Chemical class 0.000 claims description 20
- 210000003169 Central Nervous System Anatomy 0.000 claims description 17
- 125000005647 linker group Chemical group 0.000 claims description 16
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 15
- 230000003042 antagnostic Effects 0.000 claims description 15
- 239000005557 antagonist Substances 0.000 claims description 15
- 230000000975 bioactive Effects 0.000 claims description 15
- 239000000725 suspension Substances 0.000 claims description 14
- 210000000748 cardiovascular system Anatomy 0.000 claims description 13
- 238000000338 in vitro Methods 0.000 claims description 13
- 210000003403 Autonomic Nervous System Anatomy 0.000 claims description 11
- 241000282412 Homo Species 0.000 claims description 11
- 239000007788 liquid Substances 0.000 claims description 11
- 230000000699 topical Effects 0.000 claims description 11
- 230000003302 anti-idiotype Effects 0.000 claims description 10
- 230000000295 complement Effects 0.000 claims description 10
- 239000003792 electrolyte Substances 0.000 claims description 10
- 239000000839 emulsion Substances 0.000 claims description 10
- 230000001809 detectable Effects 0.000 claims description 9
- 239000000843 powder Substances 0.000 claims description 9
- 238000002360 preparation method Methods 0.000 claims description 9
- 238000007920 subcutaneous administration Methods 0.000 claims description 9
- 210000004369 Blood Anatomy 0.000 claims description 8
- 230000002924 anti-infective Effects 0.000 claims description 8
- 239000008280 blood Substances 0.000 claims description 8
- 239000012530 fluid Substances 0.000 claims description 8
- 238000007918 intramuscular administration Methods 0.000 claims description 8
- 238000001990 intravenous administration Methods 0.000 claims description 8
- 239000005022 packaging material Substances 0.000 claims description 8
- 230000003054 hormonal Effects 0.000 claims description 7
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 claims description 6
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 claims description 6
- 206010025323 Lymphomas Diseases 0.000 claims description 6
- 206010025310 Other lymphomas Diseases 0.000 claims description 6
- 206010035226 Plasma cell myeloma Diseases 0.000 claims description 6
- 239000007789 gas Substances 0.000 claims description 6
- 230000002489 hematologic Effects 0.000 claims description 6
- 230000002519 immonomodulatory Effects 0.000 claims description 6
- 238000011065 in-situ storage Methods 0.000 claims description 6
- 210000002345 respiratory system Anatomy 0.000 claims description 6
- 238000000185 intracerebroventricular Methods 0.000 claims description 5
- 238000007919 intrasynovial administration Methods 0.000 claims description 5
- 239000000084 colloidal system Substances 0.000 claims description 4
- 239000003937 drug carrier Substances 0.000 claims description 4
- 108020001507 fusion proteins Proteins 0.000 claims description 4
- 102000037240 fusion proteins Human genes 0.000 claims description 4
- 238000007912 intraperitoneal administration Methods 0.000 claims description 4
- 201000000050 myeloid neoplasm Diseases 0.000 claims description 4
- 101700066277 COS-1 Proteins 0.000 claims description 3
- 210000001035 Gastrointestinal Tract Anatomy 0.000 claims description 3
- 230000000118 anti-eoplastic Effects 0.000 claims description 3
- 239000000430 cytokine receptor antagonist Substances 0.000 claims description 3
- 230000003834 intracellular Effects 0.000 claims description 3
- 235000016709 nutrition Nutrition 0.000 claims description 3
- 239000001961 anticonvulsive agent Substances 0.000 claims description 2
- 238000003745 diagnosis Methods 0.000 claims description 2
- 230000002496 gastric Effects 0.000 claims description 2
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 claims 3
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 claims 3
- 125000002485 formyl group Chemical group [H]C(*)=O 0.000 claims 3
- 102000004854 Immunoglobulin M Human genes 0.000 claims 1
- 108090001096 Immunoglobulin M Proteins 0.000 claims 1
- 230000002950 deficient Effects 0.000 claims 1
- 238000007917 intracranial administration Methods 0.000 claims 1
- 230000001225 therapeutic Effects 0.000 abstract description 24
- 241001465754 Metazoa Species 0.000 abstract description 7
- 108090000394 Erythropoietin Proteins 0.000 description 321
- 102000003951 Erythropoietin Human genes 0.000 description 321
- 229940105423 erythropoietin Drugs 0.000 description 319
- -1 ARNhn Polymers 0.000 description 90
- 235000018102 proteins Nutrition 0.000 description 87
- 102000004169 proteins and genes Human genes 0.000 description 87
- 108090000623 proteins and genes Proteins 0.000 description 87
- VEXZGXHMUGYJMC-UHFFFAOYSA-N HCl Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 60
- 235000001014 amino acid Nutrition 0.000 description 57
- 230000035492 administration Effects 0.000 description 53
- 239000003795 chemical substances by application Substances 0.000 description 37
- 101710040537 TNF Proteins 0.000 description 36
- 201000010099 disease Diseases 0.000 description 35
- 229940083542 Sodium Drugs 0.000 description 33
- KEAYESYHFKHZAL-UHFFFAOYSA-N sodium Chemical compound [Na] KEAYESYHFKHZAL-UHFFFAOYSA-N 0.000 description 33
- 229910052708 sodium Inorganic materials 0.000 description 33
- 239000011734 sodium Substances 0.000 description 33
- 102100009534 TNF Human genes 0.000 description 31
- 238000009472 formulation Methods 0.000 description 31
- UIIMBOGNXHQVGW-UHFFFAOYSA-M NaHCO3 Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 30
- 235000014113 dietary fatty acids Nutrition 0.000 description 30
- 239000000194 fatty acid Substances 0.000 description 30
- 230000000051 modifying Effects 0.000 description 29
- 229960005486 vaccines Drugs 0.000 description 27
- 238000000034 method Methods 0.000 description 24
- 208000007502 Anemia Diseases 0.000 description 23
- 230000014509 gene expression Effects 0.000 description 23
- 102000003298 Tumor Necrosis Factor Receptors Human genes 0.000 description 22
- 108060008683 Tumor Necrosis Factor Receptors Proteins 0.000 description 22
- 239000011780 sodium chloride Substances 0.000 description 22
- 230000002335 preservative Effects 0.000 description 19
- 239000003755 preservative agent Substances 0.000 description 19
- 102000005962 receptors Human genes 0.000 description 19
- 108020003175 receptors Proteins 0.000 description 19
- 239000002253 acid Substances 0.000 description 18
- 150000004665 fatty acids Chemical class 0.000 description 17
- 230000000474 nursing Effects 0.000 description 16
- 150000003839 salts Chemical class 0.000 description 16
- 230000000875 corresponding Effects 0.000 description 15
- 239000000047 product Substances 0.000 description 15
- 238000006467 substitution reaction Methods 0.000 description 14
- 210000003743 Erythrocytes Anatomy 0.000 description 13
- 239000000443 aerosol Substances 0.000 description 13
- 239000002245 particle Substances 0.000 description 13
- 229920001223 polyethylene glycol Polymers 0.000 description 13
- 102000004196 processed proteins & peptides Human genes 0.000 description 13
- 108090000765 processed proteins & peptides Proteins 0.000 description 13
- 238000010367 cloning Methods 0.000 description 12
- 229920003013 deoxyribonucleic acid Polymers 0.000 description 12
- 241000196324 Embryophyta Species 0.000 description 11
- 102000004190 Enzymes Human genes 0.000 description 11
- 108090000790 Enzymes Proteins 0.000 description 11
- 239000002202 Polyethylene glycol Substances 0.000 description 11
- 210000002966 Serum Anatomy 0.000 description 11
- 239000000654 additive Substances 0.000 description 11
- 150000001720 carbohydrates Chemical group 0.000 description 11
- 230000004927 fusion Effects 0.000 description 11
- 230000002401 inhibitory effect Effects 0.000 description 11
- 239000006199 nebulizer Substances 0.000 description 11
- 229960005069 Calcium Drugs 0.000 description 10
- 229940088597 Hormone Drugs 0.000 description 10
- 229940091252 Sodium supplements Drugs 0.000 description 10
- 239000004599 antimicrobial Substances 0.000 description 10
- OYPRJOBELJOOCE-UHFFFAOYSA-N calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 10
- 229910052791 calcium Inorganic materials 0.000 description 10
- 239000011575 calcium Substances 0.000 description 10
- 235000014633 carbohydrates Nutrition 0.000 description 10
- 239000000969 carrier Substances 0.000 description 10
- 239000005556 hormone Substances 0.000 description 10
- 229920000642 polymer Polymers 0.000 description 10
- QAOWNCQODCNURD-UHFFFAOYSA-L sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 10
- 238000002560 therapeutic procedure Methods 0.000 description 10
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 10
- 229940088598 Enzyme Drugs 0.000 description 9
- 231100000765 Toxin Toxicity 0.000 description 9
- WVDDGKGOMKODPV-UHFFFAOYSA-N benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 9
- 238000002156 mixing Methods 0.000 description 9
- 239000008194 pharmaceutical composition Substances 0.000 description 9
- 230000002685 pulmonary Effects 0.000 description 9
- 239000003053 toxin Substances 0.000 description 9
- 108020003112 toxins Proteins 0.000 description 9
- 229920001405 Coding region Polymers 0.000 description 8
- 101710007887 DHFR Proteins 0.000 description 8
- 230000036499 Half live Effects 0.000 description 8
- 241000124008 Mammalia Species 0.000 description 8
- 230000000845 anti-microbial Effects 0.000 description 8
- 239000002246 antineoplastic agent Substances 0.000 description 8
- 239000003246 corticosteroid Substances 0.000 description 8
- 230000002708 enhancing Effects 0.000 description 8
- 230000001965 increased Effects 0.000 description 8
- 239000003112 inhibitor Substances 0.000 description 8
- 239000003550 marker Substances 0.000 description 8
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 8
- 229920001282 polysaccharide Polymers 0.000 description 8
- 239000004094 surface-active agent Substances 0.000 description 8
- 230000035897 transcription Effects 0.000 description 8
- 102000004127 Cytokines Human genes 0.000 description 7
- 108090000695 Cytokines Proteins 0.000 description 7
- 102100005838 DHFR Human genes 0.000 description 7
- 101710017500 MitHPPK/DHPS Proteins 0.000 description 7
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 7
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 7
- 108010001801 Tumor Necrosis Factor-alpha Proteins 0.000 description 7
- 238000004166 bioassay Methods 0.000 description 7
- 108091006028 chimera Proteins 0.000 description 7
- 239000003623 enhancer Substances 0.000 description 7
- 229960000890 hydrocortisone Drugs 0.000 description 7
- 239000007924 injection Substances 0.000 description 7
- 238000003780 insertion Methods 0.000 description 7
- 230000001402 polyadenylating Effects 0.000 description 7
- 239000003380 propellant Substances 0.000 description 7
- 238000000746 purification Methods 0.000 description 7
- FAPWRFPIFSIZLT-UHFFFAOYSA-M sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 7
- 239000002904 solvent Substances 0.000 description 7
- 238000003786 synthesis reaction Methods 0.000 description 7
- 229920000160 (ribonucleotides)n+m Polymers 0.000 description 6
- 101710027066 ALB Proteins 0.000 description 6
- 102100001249 ALB Human genes 0.000 description 6
- 102100006400 CSF2 Human genes 0.000 description 6
- JYGXADMDTFJGBT-VWUMJDOOSA-N Cortisol Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 6
- 241000701022 Cytomegalovirus Species 0.000 description 6
- FBPFZTCFMRRESA-KAZBKCHUSA-N D-Mannitol Natural products OC[C@@H](O)[C@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KAZBKCHUSA-N 0.000 description 6
- 229920002307 Dextran Polymers 0.000 description 6
- ULGZDMOVFRHVEP-RWJQBGPGSA-N Erythromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)C(=O)[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 ULGZDMOVFRHVEP-RWJQBGPGSA-N 0.000 description 6
- BFPYWIDHMRZLRN-SLHNCBLASA-N Etivex Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@](CC4)(O)C#C)[C@@H]4[C@@H]3CCC2=C1 BFPYWIDHMRZLRN-SLHNCBLASA-N 0.000 description 6
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 6
- FBPFZTCFMRRESA-KVTDHHQDSA-N Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 6
- IWDCLRJOBJJRNH-UHFFFAOYSA-N P-Cresol Chemical compound CC1=CC=C(O)C=C1 IWDCLRJOBJJRNH-UHFFFAOYSA-N 0.000 description 6
- 230000037165 Serum Concentration Effects 0.000 description 6
- QTBSBXVTEAMEQO-UHFFFAOYSA-N acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 6
- 229940050528 albumin Drugs 0.000 description 6
- 230000001430 anti-depressive Effects 0.000 description 6
- 239000000935 antidepressant agent Substances 0.000 description 6
- 239000000427 antigen Substances 0.000 description 6
- 239000011230 binding agent Substances 0.000 description 6
- 238000002512 chemotherapy Methods 0.000 description 6
- 230000001419 dependent Effects 0.000 description 6
- 201000009910 diseases by infectious agent Diseases 0.000 description 6
- 150000002148 esters Chemical class 0.000 description 6
- 229960002568 ethinylestradiol Drugs 0.000 description 6
- 150000004676 glycans Polymers 0.000 description 6
- DHMQDGOQFOQNFH-UHFFFAOYSA-N glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 6
- 238000009396 hybridization Methods 0.000 description 6
- 229920001477 hydrophilic polymer Polymers 0.000 description 6
- 230000002458 infectious Effects 0.000 description 6
- 238000002347 injection Methods 0.000 description 6
- VZCYOOQTPOCHFL-UPHRSURJSA-L maleate(2-) Chemical compound [O-]C(=O)\C=C/C([O-])=O VZCYOOQTPOCHFL-UPHRSURJSA-L 0.000 description 6
- 239000000594 mannitol Substances 0.000 description 6
- 235000010355 mannitol Nutrition 0.000 description 6
- 229960000485 methotrexate Drugs 0.000 description 6
- CSNNHWWHGAXBCP-UHFFFAOYSA-L mgso4 Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 6
- 239000000842 neuromuscular blocking agent Substances 0.000 description 6
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 6
- 239000005017 polysaccharide Substances 0.000 description 6
- 150000004804 polysaccharides Polymers 0.000 description 6
- 229920000053 polysorbate 80 Polymers 0.000 description 6
- 230000035939 shock Effects 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- HCHKCACWOHOZIP-UHFFFAOYSA-N zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 6
- 229910052725 zinc Inorganic materials 0.000 description 6
- 239000011701 zinc Substances 0.000 description 6
- 208000008787 Cardiovascular Disease Diseases 0.000 description 5
- 229920002676 Complementary DNA Polymers 0.000 description 5
- UCTWMZQNUQWSLP-VIFPVBQESA-N Epinephrine Chemical compound CNC[C@H](O)C1=CC=C(O)C(O)=C1 UCTWMZQNUQWSLP-VIFPVBQESA-N 0.000 description 5
- 241000588724 Escherichia coli Species 0.000 description 5
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 5
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 5
- 210000004408 Hybridomas Anatomy 0.000 description 5
- 206010021425 Immune system disease Diseases 0.000 description 5
- GUBGYTABKSRVRQ-UUNJERMWSA-N Lactose Natural products O([C@@H]1[C@H](O)[C@H](O)[C@H](O)O[C@@H]1CO)[C@H]1[C@@H](O)[C@@H](O)[C@H](O)[C@H](CO)O1 GUBGYTABKSRVRQ-UUNJERMWSA-N 0.000 description 5
- 229940071648 Metered Dose Inhaler Drugs 0.000 description 5
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 5
- 210000002381 Plasma Anatomy 0.000 description 5
- OIGNJSKKLXVSLS-VWUMJDOOSA-N Prednisolone Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 OIGNJSKKLXVSLS-VWUMJDOOSA-N 0.000 description 5
- 206010037742 Rabies Diseases 0.000 description 5
- NBIIXXVUZAFLBC-UHFFFAOYSA-K [O-]P([O-])([O-])=O Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 5
- 239000002249 anxiolytic agent Substances 0.000 description 5
- 229960000626 benzylpenicillin Drugs 0.000 description 5
- 239000002299 complementary DNA Substances 0.000 description 5
- 239000002552 dosage form Substances 0.000 description 5
- 229960005139 epinephrine Drugs 0.000 description 5
- 229960003276 erythromycin Drugs 0.000 description 5
- 230000001861 immunosuppresant Effects 0.000 description 5
- 239000003018 immunosuppressive agent Substances 0.000 description 5
- 238000002955 isolation Methods 0.000 description 5
- 239000008101 lactose Substances 0.000 description 5
- GUBGYTABKSRVRQ-XLOQQCSPSA-N lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 5
- 210000004962 mammalian cells Anatomy 0.000 description 5
- 239000003158 myorelaxant agent Substances 0.000 description 5
- 230000003533 narcotic Effects 0.000 description 5
- 229940021182 non-steroidal anti-inflammatory drugs Drugs 0.000 description 5
- 235000021317 phosphate Nutrition 0.000 description 5
- 239000010452 phosphate Substances 0.000 description 5
- 239000007787 solid Substances 0.000 description 5
- 235000000346 sugar Nutrition 0.000 description 5
- 201000010874 syndrome Diseases 0.000 description 5
- 239000003981 vehicle Substances 0.000 description 5
- WQZGKKKJIJFFOK-VFUOTHLCSA-N β-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 5
- VOXZDWNPVJITMN-ZBRFXRBCSA-N 17β-estradiol Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 VOXZDWNPVJITMN-ZBRFXRBCSA-N 0.000 description 4
- 229940034982 ANTINEOPLASTIC AGENTS Drugs 0.000 description 4
- AVKUERGKIZMTKX-NJBDSQKTSA-N Ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 4
- 208000006673 Asthma Diseases 0.000 description 4
- 241000894006 Bacteria Species 0.000 description 4
- 206010007521 Cardiac arrhythmias Diseases 0.000 description 4
- WHTVZRBIWZFKQO-UHFFFAOYSA-N Chloroquine Chemical compound ClC1=CC=C2C(NC(C)CCCN(CC)CC)=CC=NC2=C1 WHTVZRBIWZFKQO-UHFFFAOYSA-N 0.000 description 4
- 210000000349 Chromosomes Anatomy 0.000 description 4
- CZMRCDWAGMRECN-UGDNZRGBSA-N D-sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 4
- 229960003957 Dexamethasone Drugs 0.000 description 4
- UREBDLICKHMUKA-CXSFZGCWSA-N Dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 4
- 241000556215 Frangula purshiana Species 0.000 description 4
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 4
- 108010051696 Growth Hormone Proteins 0.000 description 4
- 102000018997 Growth Hormone Human genes 0.000 description 4
- 102000008100 Human Serum Albumin Human genes 0.000 description 4
- 108091006822 Human Serum Albumin Proteins 0.000 description 4
- 102000000646 Interleukin-3 Human genes 0.000 description 4
- 108010002386 Interleukin-3 Proteins 0.000 description 4
- 229920002459 Intron Polymers 0.000 description 4
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 4
- XUJNEKJLAYXESH-REOHCLBHSA-N L-cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 4
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 4
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 4
- RLSSMJSEOOYNOY-UHFFFAOYSA-N M-Cresol Chemical compound CC1=CC=CC(O)=C1 RLSSMJSEOOYNOY-UHFFFAOYSA-N 0.000 description 4
- 108020004999 Messenger RNA Proteins 0.000 description 4
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L MgCl2 Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 4
- 229920001850 Nucleic acid sequence Polymers 0.000 description 4
- WLJNZVDCPSBLRP-UHFFFAOYSA-N Pamoic acid Chemical compound C1=CC=C2C(CC=3C4=CC=CC=C4C=C(C=3O)C(=O)O)=C(O)C(C(O)=O)=CC2=C1 WLJNZVDCPSBLRP-UHFFFAOYSA-N 0.000 description 4
- 229920001451 Polypropylene glycol Polymers 0.000 description 4
- 229920001213 Polysorbate 20 Polymers 0.000 description 4
- WIKYUJGCLQQFNW-UHFFFAOYSA-N Prochlorperazine Chemical compound C1CN(C)CCN1CCCN1C2=CC(Cl)=CC=C2SC2=CC=CC=C21 WIKYUJGCLQQFNW-UHFFFAOYSA-N 0.000 description 4
- 210000003324 RBC Anatomy 0.000 description 4
- CZMRCDWAGMRECN-GDQSFJPYSA-N Sucrose Natural products O([C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](CO)O1)[C@@]1(CO)[C@H](O)[C@@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-GDQSFJPYSA-N 0.000 description 4
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 4
- 229920002397 Thermoplastic olefin Polymers 0.000 description 4
- 229940033663 Thimerosal Drugs 0.000 description 4
- RTKIYNMVFMVABJ-UHFFFAOYSA-L Thiomersal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 4
- QORWJWZARLRLPR-UHFFFAOYSA-H Tricalcium phosphate Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 4
- SGTNSNPWRIOYBX-UHFFFAOYSA-N Verapamil Chemical compound C1=C(OC)C(OC)=CC=C1CCN(C)CCCC(C#N)(C(C)C)C1=CC=C(OC)C(OC)=C1 SGTNSNPWRIOYBX-UHFFFAOYSA-N 0.000 description 4
- 241000700605 Viruses Species 0.000 description 4
- 239000006096 absorbing agent Substances 0.000 description 4
- DLFVBJFMPXGRIB-UHFFFAOYSA-N acetamide Chemical compound CC(N)=O DLFVBJFMPXGRIB-UHFFFAOYSA-N 0.000 description 4
- 230000003213 activating Effects 0.000 description 4
- 230000001154 acute Effects 0.000 description 4
- 239000003732 agents acting on the eye Substances 0.000 description 4
- 235000004279 alanine Nutrition 0.000 description 4
- 239000002168 alkylating agent Substances 0.000 description 4
- 150000001412 amines Chemical class 0.000 description 4
- 125000000539 amino acid group Chemical group 0.000 description 4
- 229960000723 ampicillin Drugs 0.000 description 4
- 230000003444 anaesthetic Effects 0.000 description 4
- 230000000202 analgesic Effects 0.000 description 4
- 230000003474 anti-emetic Effects 0.000 description 4
- 230000003110 anti-inflammatory Effects 0.000 description 4
- 239000003146 anticoagulant agent Substances 0.000 description 4
- 239000002111 antiemetic agent Substances 0.000 description 4
- 108091007172 antigens Proteins 0.000 description 4
- 102000038129 antigens Human genes 0.000 description 4
- 239000003435 antirheumatic agent Substances 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- VTYYLEPIZMXCLO-UHFFFAOYSA-L calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 4
- 239000001506 calcium phosphate Substances 0.000 description 4
- 229910000389 calcium phosphate Inorganic materials 0.000 description 4
- 229960001714 calcium phosphate Drugs 0.000 description 4
- 235000011010 calcium phosphates Nutrition 0.000 description 4
- 201000011510 cancer Diseases 0.000 description 4
- 150000001780 cephalosporins Chemical class 0.000 description 4
- 238000003776 cleavage reaction Methods 0.000 description 4
- 230000002255 enzymatic Effects 0.000 description 4
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 4
- 239000000122 growth hormone Substances 0.000 description 4
- 230000003053 immunization Effects 0.000 description 4
- 238000002649 immunization Methods 0.000 description 4
- 230000001976 improved Effects 0.000 description 4
- 229910052500 inorganic mineral Inorganic materials 0.000 description 4
- XMBWDFGMSWQBCA-UHFFFAOYSA-M iodide Chemical compound [I-] XMBWDFGMSWQBCA-UHFFFAOYSA-M 0.000 description 4
- 239000011630 iodine Substances 0.000 description 4
- 229910052740 iodine Inorganic materials 0.000 description 4
- PNDPGZBMCMUPRI-UHFFFAOYSA-N iodine Chemical compound II PNDPGZBMCMUPRI-UHFFFAOYSA-N 0.000 description 4
- XEEYBQQBJWHFJM-UHFFFAOYSA-N iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 4
- 150000002632 lipids Chemical class 0.000 description 4
- 239000002502 liposome Substances 0.000 description 4
- 239000003589 local anesthetic agent Substances 0.000 description 4
- 239000003120 macrolide antibiotic agent Substances 0.000 description 4
- 239000002609 media Substances 0.000 description 4
- 230000001404 mediated Effects 0.000 description 4
- 229920002106 messenger RNA Polymers 0.000 description 4
- 235000010755 mineral Nutrition 0.000 description 4
- 239000011707 mineral Substances 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 238000006011 modification reaction Methods 0.000 description 4
- 239000000041 non-steroidal anti-inflammatory agent Substances 0.000 description 4
- 238000007911 parenteral administration Methods 0.000 description 4
- 230000001575 pathological Effects 0.000 description 4
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 4
- 229960003111 prochlorperazine Drugs 0.000 description 4
- XBDQKXXYIPTUBI-UHFFFAOYSA-M propionate Chemical compound CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 4
- 239000012217 radiopharmaceutical Substances 0.000 description 4
- 230000002799 radiopharmaceutical Effects 0.000 description 4
- 238000003259 recombinant expression Methods 0.000 description 4
- 230000002829 reduced Effects 0.000 description 4
- 230000001624 sedative Effects 0.000 description 4
- 239000000932 sedative agent Substances 0.000 description 4
- PUZPDOWCWNUUKD-UHFFFAOYSA-M sodium fluoride Chemical compound [F-].[Na+] PUZPDOWCWNUUKD-UHFFFAOYSA-M 0.000 description 4
- 239000005720 sucrose Substances 0.000 description 4
- 238000001890 transfection Methods 0.000 description 4
- XSQUKJJJFZCRTK-UHFFFAOYSA-N urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 4
- PMATZTZNYRCHOR-CGLBZJNRSA-N (3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(E,1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17 Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 3
- ATADHKWKHYVBTJ-FVGYRXGTSA-N (R)-adrenaline hydrochloride Chemical compound [H+].[Cl-].CNC[C@H](O)C1=CC=C(O)C(O)=C1 ATADHKWKHYVBTJ-FVGYRXGTSA-N 0.000 description 3
- 229930000680 A04AD01 - Scopolamine Natural products 0.000 description 3
- 229940074728 ANTIINFECTIVE OPHTHALMOLOGICS Drugs 0.000 description 3
- 206010000565 Acquired immunodeficiency syndrome Diseases 0.000 description 3
- 229940021383 Antiinfective irrigating solutions Drugs 0.000 description 3
- 229960005475 Antiinfectives Drugs 0.000 description 3
- 206010003119 Arrhythmia Diseases 0.000 description 3
- 229960002028 Atropine Sulfate Drugs 0.000 description 3
- 206010060945 Bacterial infection Diseases 0.000 description 3
- 108010067213 Basiliximab Proteins 0.000 description 3
- JPKKQJKQTPNWTR-CHYDPLAESA-N CHEMBL3182372 Chemical compound O.OS(O)(=O)=O.O([C@H]1C[C@H]2CC[C@@H](C1)N2C)C(=O)C(CO)C1=CC=CC=C1.O([C@H]1C[C@H]2CC[C@@H](C1)N2C)C(=O)C(CO)C1=CC=CC=C1 JPKKQJKQTPNWTR-CHYDPLAESA-N 0.000 description 3
- 210000001736 Capillaries Anatomy 0.000 description 3
- 239000010369 Cascara Substances 0.000 description 3
- 229940071704 Cascara sagrada Drugs 0.000 description 3
- 229960005091 Chloramphenicol Drugs 0.000 description 3
- WIIZWVCIJKGZOK-RKDXNWHRSA-N Chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 3
- 208000009863 Chronic Kidney Failure Diseases 0.000 description 3
- 108020004705 Codon Proteins 0.000 description 3
- 241000699802 Cricetulus griseus Species 0.000 description 3
- IMZMKUWMOSJXDT-UHFFFAOYSA-N Cromoglicic acid Chemical compound O1C(C(O)=O)=CC(=O)C2=C1C=CC=C2OCC(O)COC1=CC=CC2=C1C(=O)C=C(C(O)=O)O2 IMZMKUWMOSJXDT-UHFFFAOYSA-N 0.000 description 3
- 108010036949 Cyclosporine Proteins 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N D-Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- 108010084740 Daclizumab Proteins 0.000 description 3
- 206010012601 Diabetes mellitus Diseases 0.000 description 3
- 206010013023 Diphtheria Diseases 0.000 description 3
- 229960000533 Dornase alfa Drugs 0.000 description 3
- XQTWDDCIUJNLTR-CVHRZJFOSA-N Doxycycline Chemical compound O.O=C1C2=C(O)C=CC=C2[C@H](C)[C@@H]2C1=C(O)[C@]1(O)C(=O)C(C(N)=O)=C(O)[C@@H](N(C)C)[C@@H]1[C@H]2O XQTWDDCIUJNLTR-CVHRZJFOSA-N 0.000 description 3
- 102100016635 EPOR Human genes 0.000 description 3
- 231100000655 Enterotoxin Toxicity 0.000 description 3
- 210000003013 Erythroid Precursor Cells Anatomy 0.000 description 3
- 108010075944 Erythropoietin Receptors Proteins 0.000 description 3
- 229960005309 Estradiol Drugs 0.000 description 3
- 229960004666 Glucagon Drugs 0.000 description 3
- 108060003199 Glucagon Proteins 0.000 description 3
- MASNOZXLGMXCHN-ZLPAWPGGSA-N Glucagonum Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 MASNOZXLGMXCHN-ZLPAWPGGSA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 102000003886 Glycoproteins Human genes 0.000 description 3
- 108090000288 Glycoproteins Proteins 0.000 description 3
- LNEPOXFFQSENCJ-UHFFFAOYSA-N Haloperidol Chemical compound C1CC(O)(C=2C=CC(Cl)=CC=2)CCN1CCCC(=O)C1=CC=C(F)C=C1 LNEPOXFFQSENCJ-UHFFFAOYSA-N 0.000 description 3
- ZFGMDIBRIDKWMY-PASTXAENSA-N Heparin Chemical compound CC(O)=N[C@@H]1[C@@H](O)[C@H](O)[C@@H](COS(O)(=O)=O)O[C@@H]1O[C@@H]1[C@@H](C(O)=O)O[C@@H](O[C@H]2[C@@H]([C@@H](OS(O)(=O)=O)[C@@H](O[C@@H]3[C@@H](OC(O)[C@H](OS(O)(=O)=O)[C@H]3O)C(O)=O)O[C@@H]2O)CS(O)(=O)=O)[C@H](O)[C@H]1O ZFGMDIBRIDKWMY-PASTXAENSA-N 0.000 description 3
- STECJAGHUSJQJN-GAUPFVANSA-N Hyoscine Natural products C1([C@H](CO)C(=O)OC2C[C@@H]3N([C@H](C2)[C@@H]2[C@H]3O2)C)=CC=CC=C1 STECJAGHUSJQJN-GAUPFVANSA-N 0.000 description 3
- 108090001095 Immunoglobulin G Proteins 0.000 description 3
- GSDSWSVVBLHKDQ-UHFFFAOYSA-N Levofloxacin Chemical compound FC1=CC(C(C(C(O)=O)=C2)=O)=C3N2C(C)COC3=C1N1CCN(C)CC1 GSDSWSVVBLHKDQ-UHFFFAOYSA-N 0.000 description 3
- 229940091250 Magnesium supplements Drugs 0.000 description 3
- 229960000951 Mycophenolic Acid Drugs 0.000 description 3
- 240000008962 Nicotiana tabacum Species 0.000 description 3
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 3
- QWVGKYWNOKOFNN-UHFFFAOYSA-N O-Cresol Chemical compound CC1=CC=CC=C1O QWVGKYWNOKOFNN-UHFFFAOYSA-N 0.000 description 3
- 229960001699 Ofloxacin Drugs 0.000 description 3
- CFKMVGJGLGKFKI-UHFFFAOYSA-N P-Chlorocresol Chemical compound CC1=CC(O)=CC=C1Cl CFKMVGJGLGKFKI-UHFFFAOYSA-N 0.000 description 3
- 229940049954 Penicillin Drugs 0.000 description 3
- 229960003733 Phenylephrine Hydrochloride Drugs 0.000 description 3
- 108010039918 Polylysine Proteins 0.000 description 3
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 3
- 229960004604 Propranolol Hydrochloride Drugs 0.000 description 3
- LOUPRKONTZGTKE-LHHVKLHASA-N Quinidine Chemical compound C([C@H]([C@H](C1)C=C)C2)C[N@@]1[C@H]2[C@@H](O)C1=CC=NC2=CC=C(OC)C=C21 LOUPRKONTZGTKE-LHHVKLHASA-N 0.000 description 3
- MUPFEKGTMRGPLJ-ZQSKZDJDSA-N Raffinose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO[C@@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O2)O)O1 MUPFEKGTMRGPLJ-ZQSKZDJDSA-N 0.000 description 3
- MUPFEKGTMRGPLJ-RMMQSMQOSA-N Raffinose Natural products O(C[C@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O[C@@]2(CO)[C@H](O)[C@@H](O)[C@@H](CO)O2)O1)[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 MUPFEKGTMRGPLJ-RMMQSMQOSA-N 0.000 description 3
- 108010033725 Recombinant Proteins Proteins 0.000 description 3
- 102000007312 Recombinant Proteins Human genes 0.000 description 3
- STECJAGHUSJQJN-FWXGHANASA-N Scopolamine Chemical compound C1([C@@H](CO)C(=O)O[C@H]2C[C@@H]3N([C@H](C2)[C@@H]2[C@H]3O2)C)=CC=CC=C1 STECJAGHUSJQJN-FWXGHANASA-N 0.000 description 3
- 210000003491 Skin Anatomy 0.000 description 3
- FVAUCKIRQBBSSJ-UHFFFAOYSA-M Sodium iodide Chemical compound [Na+].[I-] FVAUCKIRQBBSSJ-UHFFFAOYSA-M 0.000 description 3
- 229920002472 Starch Polymers 0.000 description 3
- FDDDEECHVMSUSB-UHFFFAOYSA-N Sulfanilamide Chemical compound NC1=CC=C(S(N)(=O)=O)C=C1 FDDDEECHVMSUSB-UHFFFAOYSA-N 0.000 description 3
- 239000000150 Sympathomimetic Substances 0.000 description 3
- 102100003095 TNFRSF1A Human genes 0.000 description 3
- 229960002180 Tetracycline Drugs 0.000 description 3
- OFVLGDICTFRJMM-WESIUVDSSA-N Tetracycline Chemical compound C1=CC=C2[C@](O)(C)[C@H]3C[C@H]4[C@H](N(C)C)C(O)=C(C(N)=O)C(=O)[C@@]4(O)C(O)=C3C(=O)C2=C1O OFVLGDICTFRJMM-WESIUVDSSA-N 0.000 description 3
- 239000004098 Tetracycline Substances 0.000 description 3
- 210000001685 Thyroid Gland Anatomy 0.000 description 3
- HDTRYLNUVZCQOY-LIZSDCNHSA-N Trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 3
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 3
- 241000607598 Vibrio Species 0.000 description 3
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 3
- 239000004480 active ingredient Substances 0.000 description 3
- 201000005510 acute lymphocytic leukemia Diseases 0.000 description 3
- 230000000996 additive Effects 0.000 description 3
- 230000001800 adrenalinergic Effects 0.000 description 3
- 230000002776 aggregation Effects 0.000 description 3
- 238000004220 aggregation Methods 0.000 description 3
- 239000000556 agonist Substances 0.000 description 3
- 125000003277 amino group Chemical group 0.000 description 3
- 230000003321 amplification Effects 0.000 description 3
- 230000001195 anabolic Effects 0.000 description 3
- 239000003263 anabolic agent Substances 0.000 description 3
- 230000001142 anti-diarrhea Effects 0.000 description 3
- 230000000692 anti-sense Effects 0.000 description 3
- 230000002303 anti-venom Effects 0.000 description 3
- 239000007864 aqueous solution Substances 0.000 description 3
- 229960004669 basiliximab Drugs 0.000 description 3
- 235000019445 benzyl alcohol Nutrition 0.000 description 3
- 125000004432 carbon atoms Chemical group C* 0.000 description 3
- 230000015556 catabolic process Effects 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 229960002242 chlorocresol Drugs 0.000 description 3
- 238000004587 chromatography analysis Methods 0.000 description 3
- 230000001684 chronic Effects 0.000 description 3
- 229960001265 ciclosporin Drugs 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 238000002648 combination therapy Methods 0.000 description 3
- 229960000265 cromoglicic acid Drugs 0.000 description 3
- 229960002806 daclizumab Drugs 0.000 description 3
- 230000004069 differentiation Effects 0.000 description 3
- 238000004090 dissolution Methods 0.000 description 3
- 108010067396 dornase alfa Proteins 0.000 description 3
- 238000004520 electroporation Methods 0.000 description 3
- 229960003072 epinephrine hydrochloride Drugs 0.000 description 3
- RTZKZFJDLAIYFH-UHFFFAOYSA-N ether Substances CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 3
- 125000005313 fatty acid group Chemical group 0.000 description 3
- VZCYOOQTPOCHFL-UHFFFAOYSA-N fumaric acid Chemical compound OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 3
- 239000000499 gel Substances 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 229960003878 haloperidol Drugs 0.000 description 3
- 230000002607 hemopoietic Effects 0.000 description 3
- 229920000669 heparin Polymers 0.000 description 3
- 239000007943 implant Substances 0.000 description 3
- 230000000670 limiting Effects 0.000 description 3
- 231100000053 low toxicity Toxicity 0.000 description 3
- FYYHWMGAXLPEAU-UHFFFAOYSA-N magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 3
- 239000011777 magnesium Substances 0.000 description 3
- 229910052749 magnesium Inorganic materials 0.000 description 3
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 3
- 229960003390 magnesium sulfate Drugs 0.000 description 3
- 235000019341 magnesium sulphate Nutrition 0.000 description 3
- 230000003211 malignant Effects 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 201000005505 measles Diseases 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 239000011859 microparticle Substances 0.000 description 3
- 108010045030 monoclonal antibodies Proteins 0.000 description 3
- 102000005614 monoclonal antibodies Human genes 0.000 description 3
- 201000006417 multiple sclerosis Diseases 0.000 description 3
- 230000035772 mutation Effects 0.000 description 3
- HPNSFSBZBAHARI-RUDMXATFSA-N mycophenolic acid Chemical compound OC1=C(C\C=C(/C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-RUDMXATFSA-N 0.000 description 3
- 230000002911 mydriatic Effects 0.000 description 3
- 201000003793 myelodysplastic syndrome Diseases 0.000 description 3
- 229960004927 neomycin Drugs 0.000 description 3
- 230000003000 nontoxic Effects 0.000 description 3
- 231100000252 nontoxic Toxicity 0.000 description 3
- 238000003199 nucleic acid amplification method Methods 0.000 description 3
- 239000003921 oil Substances 0.000 description 3
- 235000019198 oils Nutrition 0.000 description 3
- 229910052760 oxygen Inorganic materials 0.000 description 3
- 239000001301 oxygen Substances 0.000 description 3
- MYMOFIZGZYHOMD-UHFFFAOYSA-N oxygen Chemical compound O=O MYMOFIZGZYHOMD-UHFFFAOYSA-N 0.000 description 3
- 230000002093 peripheral Effects 0.000 description 3
- OCYSGIYOVXAGKQ-FVGYRXGTSA-N phenylephrine hydrochloride Chemical compound [H+].[Cl-].CNC[C@H](O)C1=CC=CC(O)=C1 OCYSGIYOVXAGKQ-FVGYRXGTSA-N 0.000 description 3
- 239000008363 phosphate buffer Substances 0.000 description 3
- 239000002504 physiological saline solution Substances 0.000 description 3
- 229920000656 polylysine Polymers 0.000 description 3
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 3
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 3
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 3
- 229960005205 prednisolone Drugs 0.000 description 3
- 230000035755 proliferation Effects 0.000 description 3
- ZMRUPTIKESYGQW-UHFFFAOYSA-N propranolol hydrochloride Chemical compound [H+].[Cl-].C1=CC=C2C(OCC(O)CNC(C)C)=CC=CC2=C1 ZMRUPTIKESYGQW-UHFFFAOYSA-N 0.000 description 3
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 3
- 230000001603 reducing Effects 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 229960002646 scopolamine Drugs 0.000 description 3
- 230000011664 signaling Effects 0.000 description 3
- 150000003384 small molecules Chemical class 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 239000007921 spray Substances 0.000 description 3
- 125000001424 substituent group Chemical group 0.000 description 3
- 150000008163 sugars Chemical class 0.000 description 3
- 229960001663 sulfanilamide Drugs 0.000 description 3
- 229910052717 sulfur Inorganic materials 0.000 description 3
- 230000002459 sustained Effects 0.000 description 3
- 230000001975 sympathomimetic Effects 0.000 description 3
- 230000002194 synthesizing Effects 0.000 description 3
- 235000019364 tetracycline Nutrition 0.000 description 3
- 239000005495 thyroid hormone Substances 0.000 description 3
- 201000008297 typhoid fever Diseases 0.000 description 3
- 241000712461 unidentified influenza virus Species 0.000 description 3
- MECHNRXZTMCUDQ-RKHKHRCZSA-N vitamin D2 Chemical compound C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)/C=C/[C@H](C)C(C)C)=C\C=C1\C[C@@H](O)CCC1=C MECHNRXZTMCUDQ-RKHKHRCZSA-N 0.000 description 3
- 150000003751 zinc Chemical class 0.000 description 3
- CAVQBDOACNULDN-KHFUBBAMSA-N (1R,2S)-2-(methylamino)-1-phenylpropan-1-ol;sulfuric acid Chemical compound OS(O)(=O)=O.CN[C@@H](C)[C@H](O)C1=CC=CC=C1.CN[C@@H](C)[C@H](O)C1=CC=CC=C1 CAVQBDOACNULDN-KHFUBBAMSA-N 0.000 description 2
- GSDSWSVVBLHKDQ-JTQLQIEISA-N (2S)-7-fluoro-2-methyl-6-(4-methylpiperazin-1-yl)-10-oxo-4-oxa-1-azatricyclo[7.3.1.0^{5,13}]trideca-5(13),6,8,11-tetraene-11-carboxylic acid Chemical compound C([C@@H](N1C2=C(C(C(C(O)=O)=C1)=O)C=C1F)C)OC2=C1N1CCN(C)CC1 GSDSWSVVBLHKDQ-JTQLQIEISA-N 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N (3β)-Cholest-5-en-3-ol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- DKSZLDSPXIWGFO-BLOJGBSASA-N (4R,4aR,7S,7aR,12bS)-9-methoxy-3-methyl-2,4,4a,7,7a,13-hexahydro-1H-4,12-methanobenzofuro[3,2-e]isoquinoline-7-ol;phosphoric acid;hydrate Chemical compound O.OP(O)(O)=O.OP(O)(O)=O.C([C@H]1[C@H](N(CC[C@@]112)C)C3)=C[C@H](O)[C@@H]1OC1=C2C3=CC=C1OC.C([C@H]1[C@H](N(CC[C@@]112)C)C3)=C[C@H](O)[C@@H]1OC1=C2C3=CC=C1OC DKSZLDSPXIWGFO-BLOJGBSASA-N 0.000 description 2
- OHJKXVLJWUPWQG-IUYNYSEKSA-J (4S,6R)-6-[(2R,4R)-4,6-dihydroxy-5-(sulfonatoamino)-2-(sulfonatooxymethyl)oxan-3-yl]oxy-3,4-dihydroxy-5-sulfonatooxyoxane-2-carboxylate Chemical compound O[C@@H]1C(NS([O-])(=O)=O)C(O)O[C@H](COS([O-])(=O)=O)C1O[C@H]1C(OS([O-])(=O)=O)[C@@H](O)C(O)C(C([O-])=O)O1 OHJKXVLJWUPWQG-IUYNYSEKSA-J 0.000 description 2
- OOPLWEDSEDELIX-TYYBGVCCSA-N (E)-but-2-enedioic acid;iron Chemical compound [Fe].OC(=O)\C=C\C(O)=O OOPLWEDSEDELIX-TYYBGVCCSA-N 0.000 description 2
- KWTSXDURSIMDCE-QMMMGPOBSA-N (S)-amphetamine Chemical compound C[C@H](N)CC1=CC=CC=C1 KWTSXDURSIMDCE-QMMMGPOBSA-N 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N 1-[(1S,2R,3R,4S,5R,6R)-3-carbamimidamido-6-{[(2R,3R,4R,5S)-3-{[(2S,3S,4S,5R,6S)-4,5-dihydroxy-6-(hydroxymethyl)-3-(methylamino)oxan-2-yl]oxy}-4-formyl-4-hydroxy-5-methyloxolan-2-yl]oxy}-2,4,5-trihydroxycyclohexyl]guanidine Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- MHWLWQUZZRMNGJ-UHFFFAOYSA-N 1-ethyl-7-methyl-4-oxo-1,4-dihydro-1,8-naphthyridine-3-carboxylic acid Chemical compound C1=C(C)N=C2N(CC)C=C(C(O)=O)C(=O)C2=C1 MHWLWQUZZRMNGJ-UHFFFAOYSA-N 0.000 description 2
- KRKNYBCHXYNGOX-UHFFFAOYSA-K 2qpq Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 2
- AIKVCUNQWYTVTO-UHFFFAOYSA-N 5-O-[2-[benzyl(methyl)amino]ethyl] 3-O-methyl 2,6-dimethyl-4-(3-nitrophenyl)-1,4-dihydropyridine-3,5-dicarboxylate;hydron;chloride Chemical compound Cl.COC(=O)C1=C(C)NC(C)=C(C(=O)OCCN(C)CC=2C=CC=CC=2)C1C1=CC=CC([N+]([O-])=O)=C1 AIKVCUNQWYTVTO-UHFFFAOYSA-N 0.000 description 2
- FYBXRCFPOTXTJF-RFVHGSKJSA-N 5-[(2R)-3-(tert-butylamino)-2-hydroxypropoxy]-3,4-dihydro-1H-quinolin-2-one;hydrochloride Chemical compound Cl.N1C(=O)CCC2=C1C=CC=C2OC[C@H](O)CNC(C)(C)C FYBXRCFPOTXTJF-RFVHGSKJSA-N 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N ADRIAMYCIN Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 206010000880 Acute myeloid leukaemia Diseases 0.000 description 2
- 241000607534 Aeromonas Species 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- 206010003591 Ataxia Diseases 0.000 description 2
- 210000002960 BFU-E Anatomy 0.000 description 2
- APKFDSVGJQXUKY-INPOYWNPSA-N BRL-49594 Chemical compound O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1/C=C/C=C/C=C/C=C/C=C/C=C/C=C/[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-INPOYWNPSA-N 0.000 description 2
- KUVIULQEHSCUHY-XYWKZLDCSA-N Beclometasone dipropionate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(Cl)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)COC(=O)CC)(OC(=O)CC)[C@@]1(C)C[C@@H]2O KUVIULQEHSCUHY-XYWKZLDCSA-N 0.000 description 2
- 229940092703 Beclomethasone Dipropionate Drugs 0.000 description 2
- 229960000686 Benzalkonium Chloride Drugs 0.000 description 2
- SRSXLGNVWSONIS-UHFFFAOYSA-N Benzenesulfonic acid Chemical compound OS(=O)(=O)C1=CC=CC=C1 SRSXLGNVWSONIS-UHFFFAOYSA-N 0.000 description 2
- 229960001950 Benzethonium Chloride Drugs 0.000 description 2
- UREZNYTWGJKWBI-UHFFFAOYSA-M Benzethonium chloride Chemical compound [Cl-].C1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 UREZNYTWGJKWBI-UHFFFAOYSA-M 0.000 description 2
- 210000000601 Blood Cells Anatomy 0.000 description 2
- 210000001185 Bone Marrow Anatomy 0.000 description 2
- 229960004436 Budesonide Drugs 0.000 description 2
- VOVIALXJUBGFJZ-VXKMTNQYSA-N Budesonide Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1C[C@H]3O[C@@H](CCC)O[C@@]3(C(=O)CO)[C@@]1(C)C[C@@H]2O VOVIALXJUBGFJZ-VXKMTNQYSA-N 0.000 description 2
- SNPPWIUOZRMYNY-UHFFFAOYSA-N Bupropion Chemical compound CC(C)(C)NC(C)C(=O)C1=CC=CC(Cl)=C1 SNPPWIUOZRMYNY-UHFFFAOYSA-N 0.000 description 2
- 229960004367 Bupropion Hydrochloride Drugs 0.000 description 2
- 229960004484 CARBACHOL Drugs 0.000 description 2
- WTGQALLALWYDJH-MOUKNHLCSA-N CHEMBL3185877 Chemical compound Br.C1([C@@H](CO)C(=O)O[C@H]2C[C@@H]3N([C@H](C2)[C@@H]2[C@H]3O2)C)=CC=CC=C1 WTGQALLALWYDJH-MOUKNHLCSA-N 0.000 description 2
- 229960003563 Calcium Carbonate Drugs 0.000 description 2
- AIXAANGOTKPUOY-UHFFFAOYSA-N Carbachol Chemical compound [Cl-].C[N+](C)(C)CCOC(N)=O AIXAANGOTKPUOY-UHFFFAOYSA-N 0.000 description 2
- 208000005846 Cardiomyopathy Diseases 0.000 description 2
- 229960002165 Carteolol Hydrochloride Drugs 0.000 description 2
- 229960004978 Chloroquine hydrochloride Drugs 0.000 description 2
- 229960001657 Chlorpromazine hydrochloride Drugs 0.000 description 2
- 206010008958 Chronic lymphocytic leukaemia Diseases 0.000 description 2
- MYSWGUAQZAJSOK-UHFFFAOYSA-N Ciprofloxacin Chemical compound C12=CC(N3CCNCC3)=C(F)C=C2C(=O)C(C(=O)O)=CN1C1CC1 MYSWGUAQZAJSOK-UHFFFAOYSA-N 0.000 description 2
- OROGSEYTTFOCAN-DNJOTXNNSA-N Codeine Chemical compound C([C@H]1[C@H](N(CC[C@@]112)C)C3)=C[C@H](O)[C@@H]1OC1=C2C3=CC=C1OC OROGSEYTTFOCAN-DNJOTXNNSA-N 0.000 description 2
- 229960004415 Codeine Phosphate Drugs 0.000 description 2
- 229960003871 Codeine sulfate Drugs 0.000 description 2
- 229920000062 Coding strand Polymers 0.000 description 2
- 102000008186 Collagen Human genes 0.000 description 2
- 108010035532 Collagen Proteins 0.000 description 2
- 229920000453 Consensus sequence Polymers 0.000 description 2
- 229940064701 Corticosteroid nasal preparations for topical use Drugs 0.000 description 2
- 229960001334 Corticosteroids Drugs 0.000 description 2
- 102400000739 Corticotropin Human genes 0.000 description 2
- 101800000414 Corticotropin Proteins 0.000 description 2
- 229940009997 Cromolyn Drugs 0.000 description 2
- 229940119017 Cyclosporine Drugs 0.000 description 2
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 2
- 206010012289 Dementia Diseases 0.000 description 2
- NIJJYAXOARWZEE-UHFFFAOYSA-N Depacane Chemical compound CCCC(C(O)=O)CCC NIJJYAXOARWZEE-UHFFFAOYSA-N 0.000 description 2
- RPLCPCMSCLEKRS-BPIQYHPVSA-N Desogestrel Chemical compound C1CC[C@@H]2[C@H]3C(=C)C[C@](CC)([C@](CC4)(O)C#C)[C@@H]4[C@@H]3CCC2=C1 RPLCPCMSCLEKRS-BPIQYHPVSA-N 0.000 description 2
- XLMALTXPSGQGBX-GCJKJVERSA-N Dextropropoxyphene Chemical compound C([C@](OC(=O)CC)([C@H](C)CN(C)C)C=1C=CC=CC=1)C1=CC=CC=C1 XLMALTXPSGQGBX-GCJKJVERSA-N 0.000 description 2
- AAOVKJBEBIDNHE-UHFFFAOYSA-N Diazepam Chemical compound N=1CC(=O)N(C)C2=CC=C(Cl)C=C2C=1C1=CC=CC=C1 AAOVKJBEBIDNHE-UHFFFAOYSA-N 0.000 description 2
- MUCZHBLJLSDCSD-UHFFFAOYSA-N Diisopropyl fluorophosphate Chemical compound CC(C)OP(F)(=O)OC(C)C MUCZHBLJLSDCSD-UHFFFAOYSA-N 0.000 description 2
- 229960005316 Diltiazem Hydrochloride Drugs 0.000 description 2
- 229960000525 Diphenhydramine Hydrochloride Drugs 0.000 description 2
- ADEBPBSSDYVVLD-UHFFFAOYSA-N Donepezil Chemical compound O=C1C=2C=C(OC)C(OC)=CC=2CC1CC(CC1)CCN1CC1=CC=CC=C1 ADEBPBSSDYVVLD-UHFFFAOYSA-N 0.000 description 2
- ODQWQRRAPPTVAG-GZTJUZNOSA-N Doxepin Chemical compound C1OC2=CC=CC=C2C(=C/CCN(C)C)/C2=CC=CC=C21 ODQWQRRAPPTVAG-GZTJUZNOSA-N 0.000 description 2
- 229960002861 Doxepin Hydrochloride Drugs 0.000 description 2
- 229960003722 Doxycycline Drugs 0.000 description 2
- 229960002549 ENOXACIN Drugs 0.000 description 2
- 229940110715 ENZYMES FOR TREATMENT OF WOUNDS AND ULCERS Drugs 0.000 description 2
- IDYZIJYBMGIQMJ-UHFFFAOYSA-N Enoxacin Chemical compound N1=C2N(CC)C=C(C(O)=O)C(=O)C2=CC(F)=C1N1CCNCC1 IDYZIJYBMGIQMJ-UHFFFAOYSA-N 0.000 description 2
- 241000991587 Enterovirus C Species 0.000 description 2
- 229960004842 Ephedrine sulfate Drugs 0.000 description 2
- 108010074604 Epoetin Alfa Proteins 0.000 description 2
- 229960003388 Epoetin alfa Drugs 0.000 description 2
- PJMPHNIQZUBGLI-UHFFFAOYSA-N Fentanyl Chemical compound C=1C=CC=CC=1N(C(=O)CC)C(CC1)CCN1CCC1=CC=CC=C1 PJMPHNIQZUBGLI-UHFFFAOYSA-N 0.000 description 2
- 229960000225 Ferrous fumarate Drugs 0.000 description 2
- XSFJVAJPIHIPKU-XWCQMRHXSA-N Flunisolide Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]2(C)C[C@@H]1O XSFJVAJPIHIPKU-XWCQMRHXSA-N 0.000 description 2
- SYTBZMRGLBWNTM-UHFFFAOYSA-N Flurbiprofen Chemical compound FC1=CC(C(C(O)=O)C)=CC=C1C1=CC=CC=C1 SYTBZMRGLBWNTM-UHFFFAOYSA-N 0.000 description 2
- BJHIKXHVCXFQLS-UYFOZJQFSA-N Fructose Natural products OC[C@@H](O)[C@@H](O)[C@H](O)C(=O)CO BJHIKXHVCXFQLS-UYFOZJQFSA-N 0.000 description 2
- 208000001130 Gallstone Diseases 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- RGHNJXZEOKUKBD-SQOUGZDYSA-N Gluconic acid Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)=O RGHNJXZEOKUKBD-SQOUGZDYSA-N 0.000 description 2
- DDUHZTYCFQRHIY-RBHXEPJQSA-N Griseofulvin Chemical compound COC1=CC(=O)C[C@@H](C)[C@@]11C(=O)C(C(OC)=CC(OC)=C2Cl)=C2O1 DDUHZTYCFQRHIY-RBHXEPJQSA-N 0.000 description 2
- 206010018987 Haemorrhage Diseases 0.000 description 2
- 229960002897 Heparin Drugs 0.000 description 2
- 229960002738 Hydromorphone Hydrochloride Drugs 0.000 description 2
- 206010020772 Hypertension Diseases 0.000 description 2
- 206010021143 Hypoxia Diseases 0.000 description 2
- 229940072221 IMMUNOGLOBULINS Drugs 0.000 description 2
- 229960000310 ISOLEUCINE Drugs 0.000 description 2
- 206010022114 Injury Diseases 0.000 description 2
- 108090001061 Insulin Proteins 0.000 description 2
- 102000004877 Insulin Human genes 0.000 description 2
- 229940076264 Interleukin-3 Drugs 0.000 description 2
- BAUYGSIQEAFULO-UHFFFAOYSA-L Iron(II) sulfate Chemical compound [Fe+2].[O-]S([O-])(=O)=O BAUYGSIQEAFULO-UHFFFAOYSA-L 0.000 description 2
- QRXWMOHMRWLFEY-UHFFFAOYSA-N Isoniazid Chemical compound NNC(=O)C1=CC=NC=C1 QRXWMOHMRWLFEY-UHFFFAOYSA-N 0.000 description 2
- 210000003734 Kidney Anatomy 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 229940001447 Lactate Drugs 0.000 description 2
- 206010024324 Leukaemias Diseases 0.000 description 2
- 208000000429 Leukemia, Lymphocytic, Chronic, B-Cell Diseases 0.000 description 2
- 208000008456 Leukemia, Myelogenous, Chronic, BCR-ABL Positive Diseases 0.000 description 2
- 208000007046 Leukemia, Myeloid, Acute Diseases 0.000 description 2
- 229960004338 Leuprorelin Drugs 0.000 description 2
- KWGKDLIKAYFUFQ-UHFFFAOYSA-M Lithium chloride Chemical compound [Li+].[Cl-] KWGKDLIKAYFUFQ-UHFFFAOYSA-M 0.000 description 2
- 210000004072 Lung Anatomy 0.000 description 2
- 206010025169 Lyme disease Diseases 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 102000038027 MAP kinase family Human genes 0.000 description 2
- 108091007472 MAP kinase family Proteins 0.000 description 2
- 229940014456 MYCOPHENOLATE Drugs 0.000 description 2
- VTHJTEIRLNZDEV-UHFFFAOYSA-L Magnesium hydroxide Chemical compound [OH-].[OH-].[Mg+2] VTHJTEIRLNZDEV-UHFFFAOYSA-L 0.000 description 2
- GUBGYTABKSRVRQ-YOLKTULGSA-N Maltose Natural products O([C@@H]1[C@H](O)[C@@H](O)[C@H](O)O[C@H]1CO)[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 GUBGYTABKSRVRQ-YOLKTULGSA-N 0.000 description 2
- 241000712079 Measles morbillivirus Species 0.000 description 2
- FEWJPZIEWOKRBE-XIXRPRMCSA-N Mesotartaric acid Chemical compound OC(=O)[C@@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-XIXRPRMCSA-N 0.000 description 2
- 108090000823 Mitogen-Activated Protein Kinases Proteins 0.000 description 2
- 241000711386 Mumps virus Species 0.000 description 2
- 208000010125 Myocardial Infarction Diseases 0.000 description 2
- 229960004255 Nadolol Drugs 0.000 description 2
- VWPOSFSPZNDTMJ-UCWKZMIHSA-N Nadolol Chemical compound C1[C@@H](O)[C@@H](O)CC2=C1C=CC=C2OCC(O)CNC(C)(C)C VWPOSFSPZNDTMJ-UCWKZMIHSA-N 0.000 description 2
- 229960000210 Nalidixic Acid Drugs 0.000 description 2
- NPAGDVCDWIYMMC-IZPLOLCNSA-N Nandrolone Chemical compound O=C1CC[C@@H]2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 NPAGDVCDWIYMMC-IZPLOLCNSA-N 0.000 description 2
- DJDFFEBSKJCGHC-UHFFFAOYSA-N Naphazoline Chemical compound Cl.C=1C=CC2=CC=CC=C2C=1CC1=NCCN1 DJDFFEBSKJCGHC-UHFFFAOYSA-N 0.000 description 2
- 229960004760 Naphazoline Hydrochloride Drugs 0.000 description 2
- 229940100662 Nasal Drops Drugs 0.000 description 2
- 206010058116 Nephrogenic anaemia Diseases 0.000 description 2
- 208000009025 Nervous System Disease Diseases 0.000 description 2
- 229940029345 Neupogen Drugs 0.000 description 2
- 206010029305 Neurological disorder Diseases 0.000 description 2
- 229960002289 Nicardipine hydrochloride Drugs 0.000 description 2
- HYIMSNHJOBLJNT-UHFFFAOYSA-N Nifedipine Chemical compound COC(=O)C1=C(C)NC(C)=C(C(=O)OC)C1C1=CC=CC=C1[N+]([O-])=O HYIMSNHJOBLJNT-UHFFFAOYSA-N 0.000 description 2
- 229960001597 Nifedipine Drugs 0.000 description 2
- OGJPXUAPXNRGGI-UHFFFAOYSA-N Norfloxacin Chemical compound C1=C2N(CC)C=C(C(O)=O)C(=O)C2=CC(F)=C1N1CCNCC1 OGJPXUAPXNRGGI-UHFFFAOYSA-N 0.000 description 2
- 229960001180 Norfloxacin Drugs 0.000 description 2
- TVMXDCGIABBOFY-UHFFFAOYSA-N Octane Chemical compound CCCCCCCC TVMXDCGIABBOFY-UHFFFAOYSA-N 0.000 description 2
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N Oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 2
- 210000001672 Ovary Anatomy 0.000 description 2
- 101710043203 P23p89 Proteins 0.000 description 2
- 108060006601 PRM1 Proteins 0.000 description 2
- 229940090048 Pen Injector Drugs 0.000 description 2
- OQGYMIIFOSJQSF-DTOXXUQYSA-N Pentazocine HCl Chemical compound Cl.C1C2=CC=C(O)C=C2[C@@]2(C)[C@@H](C)[C@@H]1N(CC=C(C)C)CC2 OQGYMIIFOSJQSF-DTOXXUQYSA-N 0.000 description 2
- 229960003809 Pentazocine Hydrochloride Drugs 0.000 description 2
- WEXRUCMBJFQVBZ-UHFFFAOYSA-N Pentobarbital Chemical compound CCCC(C)C1(CC)C(=O)NC(=O)NC1=O WEXRUCMBJFQVBZ-UHFFFAOYSA-N 0.000 description 2
- 229960001412 Pentobarbital Drugs 0.000 description 2
- 229960000762 Perphenazine Drugs 0.000 description 2
- 229960005190 Phenylalanine Drugs 0.000 description 2
- QCHFTSOMWOSFHM-WPRPVWTQSA-N Pilopine HS Chemical compound C1OC(=O)[C@@H](CC)[C@H]1CC1=CN=CN1C QCHFTSOMWOSFHM-WPRPVWTQSA-N 0.000 description 2
- 229960005264 Piperacillin Sodium Drugs 0.000 description 2
- 231100000614 Poison Toxicity 0.000 description 2
- 229950005134 Polycarbophil Drugs 0.000 description 2
- 229920000148 Polycarbophil calcium Polymers 0.000 description 2
- 239000004698 Polyethylene (PE) Substances 0.000 description 2
- 229920000954 Polyglycolide Polymers 0.000 description 2
- 229940068977 Polysorbate 20 Drugs 0.000 description 2
- 229940068968 Polysorbate 80 Drugs 0.000 description 2
- 229960003975 Potassium Drugs 0.000 description 2
- 229960002244 Promethazine Hydrochloride Drugs 0.000 description 2
- 229940107568 Pulmozyme Drugs 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- 206010037912 Raynaud's phenomenon Diseases 0.000 description 2
- 239000008156 Ringer's lactate solution Substances 0.000 description 2
- 241000714474 Rous sarcoma virus Species 0.000 description 2
- 229940081645 Rubella virus vaccine Drugs 0.000 description 2
- NDAUXUAQIAJITI-UHFFFAOYSA-N Salbutamol Chemical compound CC(C)(C)NCC(O)C1=CC=C(O)C(CO)=C1 NDAUXUAQIAJITI-UHFFFAOYSA-N 0.000 description 2
- 241000607142 Salmonella Species 0.000 description 2
- 229960004499 Scopolamine Hydrobromide Drugs 0.000 description 2
- 208000007056 Sickle Cell Anemia Diseases 0.000 description 2
- 239000004288 Sodium dehydroacetate Substances 0.000 description 2
- DZZWHBIBMUVIIW-DTORHVGOSA-N Sparfloxacin Chemical compound C1[C@@H](C)N[C@@H](C)CN1C1=C(F)C(N)=C2C(=O)C(C(O)=O)=CN(C3CC3)C2=C1F DZZWHBIBMUVIIW-DTORHVGOSA-N 0.000 description 2
- 229960002385 Streptomycin Sulfate Drugs 0.000 description 2
- KDYFGRWQOYBRFD-UHFFFAOYSA-N Succinic acid Chemical compound OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 2
- 229940032484 Sulfisoxazole Drugs 0.000 description 2
- NHUHCSRWZMLRLA-UHFFFAOYSA-N Sulfizole Chemical compound CC1=NOC(NS(=O)(=O)C=2C=CC(N)=CC=2)=C1C NHUHCSRWZMLRLA-UHFFFAOYSA-N 0.000 description 2
- 239000000219 Sympatholytic Substances 0.000 description 2
- 108060008443 TPPP Proteins 0.000 description 2
- 206010044248 Toxic shock syndrome Diseases 0.000 description 2
- 231100000650 Toxic shock syndrome Toxicity 0.000 description 2
- RGCVKNLCSQQDEP-UHFFFAOYSA-N Tranquisan Chemical compound C1CN(CCO)CCN1CCCN1C2=CC(Cl)=CC=C2SC2=CC=CC=C21 RGCVKNLCSQQDEP-UHFFFAOYSA-N 0.000 description 2
- GFNANZIMVAIWHM-OBYCQNJPSA-N Triamcinolone Chemical compound O=C1C=C[C@]2(C)[C@@]3(F)[C@@H](O)C[C@](C)([C@@]([C@H](O)C4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 GFNANZIMVAIWHM-OBYCQNJPSA-N 0.000 description 2
- KWIUHFFTVRNATP-UHFFFAOYSA-N Trimethylglycine Chemical compound C[N+](C)(C)CC([O-])=O KWIUHFFTVRNATP-UHFFFAOYSA-N 0.000 description 2
- 229960005021 Trovafloxacin mesylate Drugs 0.000 description 2
- 229940045136 Urea Drugs 0.000 description 2
- 229960000881 Verapamil hydrochloride Drugs 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Vitamin C Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- HEBKCHPVOIAQTA-SCDXWVJYSA-N Xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 2
- 229960002675 Xylitol Drugs 0.000 description 2
- 240000008042 Zea mays Species 0.000 description 2
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 229960004150 aciclovir Drugs 0.000 description 2
- 230000002378 acidificating Effects 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- MKUXAQIIEYXACX-UHFFFAOYSA-N acyclovir Chemical compound N1C(N)=NC(=O)C2=C1N(COCCO)C=N2 MKUXAQIIEYXACX-UHFFFAOYSA-N 0.000 description 2
- 238000007792 addition Methods 0.000 description 2
- 230000001058 adult Effects 0.000 description 2
- 235000010443 alginic acid Nutrition 0.000 description 2
- 229920000615 alginic acid Polymers 0.000 description 2
- 125000000217 alkyl group Chemical group 0.000 description 2
- 229960002734 amfetamine Drugs 0.000 description 2
- LSQZJLSUYDQPKJ-NJBDSQKTSA-N amoxicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=C(O)C=C1 LSQZJLSUYDQPKJ-NJBDSQKTSA-N 0.000 description 2
- 229960003022 amoxicillin Drugs 0.000 description 2
- KLOHDWPABZXLGI-YWUHCJSESA-M ampicillin sodium Chemical compound [Na+].C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C([O-])=O)(C)C)=CC=CC=C1 KLOHDWPABZXLGI-YWUHCJSESA-M 0.000 description 2
- 239000003098 androgen Substances 0.000 description 2
- 239000000730 antalgic agent Substances 0.000 description 2
- 230000001396 anti-anti-diuretic Effects 0.000 description 2
- 230000002429 anti-coagulation Effects 0.000 description 2
- 239000002260 anti-inflammatory agent Substances 0.000 description 2
- 230000002402 anti-lipaemic Effects 0.000 description 2
- 230000000078 anti-malarial Effects 0.000 description 2
- 230000000111 anti-oxidant Effects 0.000 description 2
- 230000000648 anti-parkinson Effects 0.000 description 2
- 230000000561 anti-psychotic Effects 0.000 description 2
- 230000003356 anti-rheumatic Effects 0.000 description 2
- 230000000767 anti-ulcer Effects 0.000 description 2
- 230000000840 anti-viral Effects 0.000 description 2
- 239000003430 antimalarial agent Substances 0.000 description 2
- 239000003963 antioxidant agent Substances 0.000 description 2
- 235000006708 antioxidants Nutrition 0.000 description 2
- 239000003096 antiparasitic agent Substances 0.000 description 2
- 239000000939 antiparkinson agent Substances 0.000 description 2
- 229940019336 antithrombotic Enzymes Drugs 0.000 description 2
- 239000003443 antiviral agent Substances 0.000 description 2
- 230000000949 anxiolytic Effects 0.000 description 2
- 235000010323 ascorbic acid Nutrition 0.000 description 2
- 229960005070 ascorbic acid Drugs 0.000 description 2
- 239000011668 ascorbic acid Substances 0.000 description 2
- 238000000889 atomisation Methods 0.000 description 2
- 229950000210 beclometasone dipropionate Drugs 0.000 description 2
- QIGBRXMKCJKVMJ-UHFFFAOYSA-N benzohydroquinone Chemical compound OC1=CC=C(O)C=C1 QIGBRXMKCJKVMJ-UHFFFAOYSA-N 0.000 description 2
- JCXGWMGPZLAOME-UHFFFAOYSA-N bismuth Chemical compound [Bi] JCXGWMGPZLAOME-UHFFFAOYSA-N 0.000 description 2
- 229910052797 bismuth Inorganic materials 0.000 description 2
- 239000003914 blood derivative Substances 0.000 description 2
- CPELXLSAUQHCOX-UHFFFAOYSA-M bromide Chemical compound [Br-] CPELXLSAUQHCOX-UHFFFAOYSA-M 0.000 description 2
- 230000003182 bronchodilatating Effects 0.000 description 2
- 239000008366 buffered solution Substances 0.000 description 2
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 2
- RYYVLZVUVIJVGH-UHFFFAOYSA-N caffeine Chemical compound CN1C(=O)N(C)C(=O)C2=C1N=CN2C RYYVLZVUVIJVGH-UHFFFAOYSA-N 0.000 description 2
- BBBFJLBPOGFECG-VJVYQDLKSA-N calcitonin Chemical compound N([C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(N)=O)C(C)C)C(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1 BBBFJLBPOGFECG-VJVYQDLKSA-N 0.000 description 2
- 229910000019 calcium carbonate Inorganic materials 0.000 description 2
- 229960000539 carbamide Drugs 0.000 description 2
- 239000004202 carbamide Substances 0.000 description 2
- 235000013877 carbamide Nutrition 0.000 description 2
- YZBQHRLRFGPBSL-RXMQYKEDSA-N carbapenem Chemical compound C1C=CN2C(=O)C[C@H]21 YZBQHRLRFGPBSL-RXMQYKEDSA-N 0.000 description 2
- 229910052799 carbon Inorganic materials 0.000 description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 2
- 150000007942 carboxylates Chemical class 0.000 description 2
- 201000008031 cardiomyopathy Diseases 0.000 description 2
- 239000005018 casein Substances 0.000 description 2
- 235000021240 caseins Nutrition 0.000 description 2
- 239000001913 cellulose Substances 0.000 description 2
- 229920002678 cellulose Polymers 0.000 description 2
- 230000002490 cerebral Effects 0.000 description 2
- 125000003636 chemical group Chemical group 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-M chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 2
- 229960002328 chloroquine phosphate Drugs 0.000 description 2
- FBSMERQALIEGJT-UHFFFAOYSA-N chlorpromazine hydrochloride Chemical compound [H+].[Cl-].C1=C(Cl)C=C2N(CCCN(C)C)C3=CC=CC=C3SC2=C1 FBSMERQALIEGJT-UHFFFAOYSA-N 0.000 description 2
- 201000001883 cholelithiasis Diseases 0.000 description 2
- 230000001713 cholinergic Effects 0.000 description 2
- 201000006934 chronic myeloid leukemia Diseases 0.000 description 2
- 229960003405 ciprofloxacin Drugs 0.000 description 2
- 229920001436 collagen Polymers 0.000 description 2
- 229960005188 collagen Drugs 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 229920001577 copolymer Polymers 0.000 description 2
- 229910052802 copper Inorganic materials 0.000 description 2
- 239000010949 copper Substances 0.000 description 2
- RYGMFSIKBFXOCR-UHFFFAOYSA-N copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 2
- 235000005822 corn Nutrition 0.000 description 2
- 235000005824 corn Nutrition 0.000 description 2
- 229960000258 corticotropin Drugs 0.000 description 2
- IDLFZVILOHSSID-OVLDLUHVSA-N corticotropin Chemical compound C([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)NC(=O)[C@@H](N)CO)C1=CC=C(O)C=C1 IDLFZVILOHSSID-OVLDLUHVSA-N 0.000 description 2
- 239000006071 cream Substances 0.000 description 2
- RMRCNWBMXRMIRW-BYFNXCQMSA-M cyanocobalamin Chemical compound N#C[Co+]N([C@]1([H])[C@H](CC(N)=O)[C@]\2(CCC(=O)NC[C@H](C)OP(O)(=O)OC3[C@H]([C@H](O[C@@H]3CO)N3C4=CC(C)=C(C)C=C4N=C3)O)C)C/2=C(C)\C([C@H](C/2(C)C)CCC(N)=O)=N\C\2=C\C([C@H]([C@@]/2(CC(N)=O)C)CCC(N)=O)=N\C\2=C(C)/C2=N[C@]1(C)[C@@](C)(CC(N)=O)[C@@H]2CCC(N)=O RMRCNWBMXRMIRW-BYFNXCQMSA-M 0.000 description 2
- 230000003500 cycloplegic Effects 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- 108010004073 cysteinylcysteine Proteins 0.000 description 2
- 230000001472 cytotoxic Effects 0.000 description 2
- 231100000433 cytotoxic Toxicity 0.000 description 2
- 230000034994 death Effects 0.000 description 2
- 230000004059 degradation Effects 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 229960004976 desogestrel Drugs 0.000 description 2
- PLCQGRYPOISRTQ-FCJDYXGNSA-L dexamethasone sodium phosphate Chemical compound [Na+].[Na+].C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)COP([O-])([O-])=O)(O)[C@@]1(C)C[C@@H]2O PLCQGRYPOISRTQ-FCJDYXGNSA-L 0.000 description 2
- 229960004193 dextropropoxyphene Drugs 0.000 description 2
- 239000008121 dextrose Substances 0.000 description 2
- 238000000502 dialysis Methods 0.000 description 2
- 229960003529 diazepam Drugs 0.000 description 2
- 150000001991 dicarboxylic acids Chemical class 0.000 description 2
- KPHWPUGNDIVLNH-UHFFFAOYSA-M diclofenac sodium Chemical compound [Na+].[O-]C(=O)CC1=CC=CC=C1NC1=C(Cl)C=CC=C1Cl KPHWPUGNDIVLNH-UHFFFAOYSA-M 0.000 description 2
- 230000001079 digestive Effects 0.000 description 2
- 102000004419 dihydrofolate reductase family Human genes 0.000 description 2
- 108020001096 dihydrofolate reductase family Proteins 0.000 description 2
- HDRXZJPWHTXQRI-BHDTVMLSSA-N diltiazem hydrochloride Chemical compound [Cl-].C1=CC(OC)=CC=C1[C@H]1[C@@H](OC(C)=O)C(=O)N(CC[NH+](C)C)C2=CC=CC=C2S1 HDRXZJPWHTXQRI-BHDTVMLSSA-N 0.000 description 2
- PCHPORCSPXIHLZ-UHFFFAOYSA-N diphenhydramine hydrochloride Chemical compound [Cl-].C=1C=CC=CC=1C(OCC[NH+](C)C)C1=CC=CC=C1 PCHPORCSPXIHLZ-UHFFFAOYSA-N 0.000 description 2
- 150000002016 disaccharides Chemical class 0.000 description 2
- QXNVGIXVLWOKEQ-UHFFFAOYSA-N disodium Chemical compound [Na][Na] QXNVGIXVLWOKEQ-UHFFFAOYSA-N 0.000 description 2
- ZBBCUBMBMZNEME-QBGWIPKPSA-N disodium;(2S,5R,6R)-6-[[(2R)-2-carboxy-2-thiophen-3-ylacetyl]amino]-3,3-dimethyl-7-oxo-4-thia-1-azabicyclo[3.2.0]heptane-2-carboxylic acid Chemical compound [Na+].[Na+].C=1([C@@H](C(O)=O)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)C=CSC=1 ZBBCUBMBMZNEME-QBGWIPKPSA-N 0.000 description 2
- 239000002934 diuretic Substances 0.000 description 2
- 229960003530 donepezil Drugs 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N edta Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 230000005684 electric field Effects 0.000 description 2
- 201000000523 end stage renal failure Diseases 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 239000000147 enterotoxin Substances 0.000 description 2
- 239000000262 estrogen Substances 0.000 description 2
- XNWFRZJHXBZDAG-UHFFFAOYSA-N ethylene glycol monomethyl ether Chemical compound COCCO XNWFRZJHXBZDAG-UHFFFAOYSA-N 0.000 description 2
- 125000002534 ethynyl group Chemical group [H]C#C* 0.000 description 2
- 150000002191 fatty alcohols Chemical class 0.000 description 2
- 239000011773 ferrous fumarate Substances 0.000 description 2
- 235000002332 ferrous fumarate Nutrition 0.000 description 2
- 229960001781 ferrous sulfate Drugs 0.000 description 2
- 239000011790 ferrous sulphate Substances 0.000 description 2
- 235000003891 ferrous sulphate Nutrition 0.000 description 2
- 239000000796 flavoring agent Substances 0.000 description 2
- 229960000676 flunisolide Drugs 0.000 description 2
- 229910052731 fluorine Inorganic materials 0.000 description 2
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 2
- 235000013355 food flavoring agent Nutrition 0.000 description 2
- 235000003599 food sweetener Nutrition 0.000 description 2
- WSFSSNUMVMOOMR-UHFFFAOYSA-N formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 230000002068 genetic Effects 0.000 description 2
- 210000004602 germ cell Anatomy 0.000 description 2
- PEDCQBHIVMGVHV-UHFFFAOYSA-N glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 2
- 235000011187 glycerol Nutrition 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- 229960002867 griseofulvin Drugs 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 229940020899 hematological Enzymes Drugs 0.000 description 2
- 125000005842 heteroatoms Chemical group 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- XHILEZUETWRSHC-NRGUFEMZSA-N hydromorphone hydrochloride Chemical compound [H+].[Cl-].O([C@H]1C(CC[C@H]23)=O)C4=C5[C@@]12CCN(C)[C@@H]3CC5=CC=C4O XHILEZUETWRSHC-NRGUFEMZSA-N 0.000 description 2
- 230000002209 hydrophobic Effects 0.000 description 2
- YOZNUFWCRFCGIH-BYFNXCQMSA-L hydroxocobalamin Chemical compound O[Co+]N([C@]1([H])[C@H](CC(N)=O)[C@]\2(CCC(=O)NC[C@H](C)OP(O)(=O)OC3[C@H]([C@H](O[C@@H]3CO)N3C4=CC(C)=C(C)C=C4N=C3)O)C)C/2=C(C)\C([C@H](C/2(C)C)CCC(N)=O)=N\C\2=C\C([C@H]([C@@]/2(CC(N)=O)C)CCC(N)=O)=N\C\2=C(C)/C2=N[C@]1(C)[C@@](C)(CC(N)=O)[C@@H]2CCC(N)=O YOZNUFWCRFCGIH-BYFNXCQMSA-L 0.000 description 2
- 230000000147 hypnotic Effects 0.000 description 2
- 230000001146 hypoxic Effects 0.000 description 2
- 230000016784 immunoglobulin production Effects 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 230000000977 initiatory Effects 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 230000000968 intestinal Effects 0.000 description 2
- 229910052742 iron Inorganic materials 0.000 description 2
- 229910000359 iron(II) sulfate Inorganic materials 0.000 description 2
- 230000001678 irradiating Effects 0.000 description 2
- 201000006370 kidney failure Diseases 0.000 description 2
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 2
- 230000002475 laxative Effects 0.000 description 2
- 239000008141 laxative Substances 0.000 description 2
- 229960003376 levofloxacin Drugs 0.000 description 2
- KXEBLAPZMOQCKO-UHFFFAOYSA-N lomefloxacin hydrochloride Chemical compound Cl.FC1=C2N(CC)C=C(C(O)=O)C(=O)C2=CC(F)=C1N1CCNC(C)C1 KXEBLAPZMOQCKO-UHFFFAOYSA-N 0.000 description 2
- 229960003814 lomefloxacin hydrochloride Drugs 0.000 description 2
- 229910001629 magnesium chloride Inorganic materials 0.000 description 2
- 229960002337 magnesium chloride Drugs 0.000 description 2
- 239000000347 magnesium hydroxide Substances 0.000 description 2
- 229910001862 magnesium hydroxide Inorganic materials 0.000 description 2
- 235000012254 magnesium hydroxide Nutrition 0.000 description 2
- CPLXHLVBOLITMK-UHFFFAOYSA-N magnesium oxide Chemical compound [Mg]=O CPLXHLVBOLITMK-UHFFFAOYSA-N 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 238000003328 mesylation reaction Methods 0.000 description 2
- VPKDCDLSJZCGKE-UHFFFAOYSA-N methanediimine Chemical compound N=C=N VPKDCDLSJZCGKE-UHFFFAOYSA-N 0.000 description 2
- AFVFQIVMOAPDHO-UHFFFAOYSA-N methanesulfonic acid Chemical group CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 2
- 239000004005 microsphere Substances 0.000 description 2
- 230000000394 mitotic Effects 0.000 description 2
- 150000002772 monosaccharides Chemical class 0.000 description 2
- 201000009251 multiple myeloma Diseases 0.000 description 2
- 229960004719 nandrolone Drugs 0.000 description 2
- 239000007923 nasal drop Substances 0.000 description 2
- 230000000926 neurological Effects 0.000 description 2
- 230000003472 neutralizing Effects 0.000 description 2
- PXHVJJICTQNCMI-UHFFFAOYSA-N nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 2
- DFPAKSUCGFBDDF-UHFFFAOYSA-N nicotinamide Chemical compound NC(=O)C1=CC=CN=C1 DFPAKSUCGFBDDF-UHFFFAOYSA-N 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 239000000346 nonvolatile oil Substances 0.000 description 2
- 235000015097 nutrients Nutrition 0.000 description 2
- 230000000050 nutritive Effects 0.000 description 2
- 239000000014 opioid analgesic Substances 0.000 description 2
- 229940050957 opium tincture Drugs 0.000 description 2
- 125000000962 organic group Chemical group 0.000 description 2
- 230000003204 osmotic Effects 0.000 description 2
- 230000001499 parasympathomimetic Effects 0.000 description 2
- 239000000816 peptidomimetic Substances 0.000 description 2
- 239000011886 peripheral blood Substances 0.000 description 2
- 239000000546 pharmaceutic aid Substances 0.000 description 2
- 230000000275 pharmacokinetic Effects 0.000 description 2
- 238000001050 pharmacotherapy Methods 0.000 description 2
- WRLGYAWRGXKSKG-UHFFFAOYSA-M phenobarbital sodium Chemical compound [Na+].C=1C=CC=CC=1C1(CC)C(=O)NC([O-])=NC1=O WRLGYAWRGXKSKG-UHFFFAOYSA-M 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- WCMIIGXFCMNQDS-IDYPWDAWSA-M piperacillin sodium Chemical compound [Na+].O=C1C(=O)N(CC)CCN1C(=O)N[C@H](C=1C=CC=CC=1)C(=O)N[C@@H]1C(=O)N2[C@@H](C([O-])=O)C(C)(C)S[C@@H]21 WCMIIGXFCMNQDS-IDYPWDAWSA-M 0.000 description 2
- 229920000747 poly(lactic acid) polymer Polymers 0.000 description 2
- 229920001515 polyalkylene glycol Polymers 0.000 description 2
- 229920000573 polyethylene Polymers 0.000 description 2
- 239000004633 polyglycolic acid Substances 0.000 description 2
- 239000004626 polylactic acid Substances 0.000 description 2
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 2
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 2
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 2
- 239000011591 potassium Substances 0.000 description 2
- 229910052700 potassium Inorganic materials 0.000 description 2
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 2
- 239000002244 precipitate Substances 0.000 description 2
- 229960002943 prednisolone sodium phosphate Drugs 0.000 description 2
- 108010066381 preproinsulin Proteins 0.000 description 2
- 201000007914 proliferative diabetic retinopathy Diseases 0.000 description 2
- XXPDBLUZJRXNNZ-UHFFFAOYSA-N promethazine hydrochloride Chemical compound Cl.C1=CC=C2N(CC(C)N(C)C)C3=CC=CC=C3SC2=C1 XXPDBLUZJRXNNZ-UHFFFAOYSA-N 0.000 description 2
- 229940048914 protamine Drugs 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 238000001959 radiotherapy Methods 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 239000003638 reducing agent Substances 0.000 description 2
- 230000001105 regulatory Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 230000000241 respiratory Effects 0.000 description 2
- 108010038379 sargramostim Proteins 0.000 description 2
- 229960002530 sargramostim Drugs 0.000 description 2
- 239000006152 selective media Substances 0.000 description 2
- 231100000486 side effect Toxicity 0.000 description 2
- 235000017557 sodium bicarbonate Nutrition 0.000 description 2
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 2
- 229960001407 sodium bicarbonate Drugs 0.000 description 2
- 229940079839 sodium dehydroacetate Drugs 0.000 description 2
- 235000019259 sodium dehydroacetate Nutrition 0.000 description 2
- 239000011775 sodium fluoride Substances 0.000 description 2
- 235000013024 sodium fluoride Nutrition 0.000 description 2
- 239000001488 sodium phosphate Substances 0.000 description 2
- 235000011008 sodium phosphates Nutrition 0.000 description 2
- 239000000600 sorbitol Substances 0.000 description 2
- 229960004954 sparfloxacin Drugs 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 235000019698 starch Nutrition 0.000 description 2
- 210000000130 stem cell Anatomy 0.000 description 2
- 150000003431 steroids Chemical class 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 229940086735 succinate Drugs 0.000 description 2
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 2
- IHCDKJZZFOUARO-UHFFFAOYSA-M sulfacetamide sodium Chemical compound O.[Na+].CC(=O)[N-]S(=O)(=O)C1=CC=C(N)C=C1 IHCDKJZZFOUARO-UHFFFAOYSA-M 0.000 description 2
- SEEPANYCNGTZFQ-UHFFFAOYSA-N sulfadiazine Chemical compound C1=CC(N)=CC=C1S(=O)(=O)NC1=NC=CC=N1 SEEPANYCNGTZFQ-UHFFFAOYSA-N 0.000 description 2
- 229960004306 sulfadiazine Drugs 0.000 description 2
- 229960000654 sulfafurazole Drugs 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 230000001629 suppression Effects 0.000 description 2
- 239000003765 sweetening agent Substances 0.000 description 2
- 230000000948 sympatholitic Effects 0.000 description 2
- 239000003826 tablet Substances 0.000 description 2
- 229960001367 tartaric acid Drugs 0.000 description 2
- 239000011975 tartaric acid Substances 0.000 description 2
- 235000002906 tartaric acid Nutrition 0.000 description 2
- 230000002537 thrombolytic Effects 0.000 description 2
- WYWHKKSPHMUBEB-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 2
- 230000000287 tissue oxygenation Effects 0.000 description 2
- 229940083878 topical for treatment of hemorrhoids and anal fissures Corticosteroids Drugs 0.000 description 2
- 229960005294 triamcinolone Drugs 0.000 description 2
- ZMANZCXQSJIPKH-UHFFFAOYSA-N triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 2
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical class [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 2
- DYNZICQDCVYXFW-AHZSKCOESA-N trovafloxacin mesylate Chemical compound CS(O)(=O)=O.C([C@H]1[C@@H]([C@H]1C1)N)N1C(C(=CC=1C(=O)C(C(O)=O)=C2)F)=NC=1N2C1=CC=C(F)C=C1F DYNZICQDCVYXFW-AHZSKCOESA-N 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 230000002485 urinary Effects 0.000 description 2
- NQPDZGIKBAWPEJ-UHFFFAOYSA-M valerate Chemical compound CCCCC([O-])=O NQPDZGIKBAWPEJ-UHFFFAOYSA-M 0.000 description 2
- 229940070710 valerate Drugs 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 229960000604 valproic acid Drugs 0.000 description 2
- 229960001722 verapamil Drugs 0.000 description 2
- 235000013343 vitamin Nutrition 0.000 description 2
- 239000011782 vitamin Substances 0.000 description 2
- 229930003231 vitamins Natural products 0.000 description 2
- 239000000811 xylitol Substances 0.000 description 2
- 235000010447 xylitol Nutrition 0.000 description 2
- GDLBFKVLRPITMI-UHFFFAOYSA-N (+-)-Isoprenaline Chemical compound ClC1=CC=C2NC(C)=NS(=O)(=O)C2=C1 GDLBFKVLRPITMI-UHFFFAOYSA-N 0.000 description 1
- HMJIYCCIJYRONP-UHFFFAOYSA-N (+-)-Isradipine Chemical compound COC(=O)C1=C(C)NC(C)=C(C(=O)OC(C)C)C1C1=CC=CC2=NON=C12 HMJIYCCIJYRONP-UHFFFAOYSA-N 0.000 description 1
- SFLSHLFXELFNJZ-QMMMGPOBSA-N (-)-norepinephrine Chemical compound NC[C@H](O)C1=CC=C(O)C(O)=C1 SFLSHLFXELFNJZ-QMMMGPOBSA-N 0.000 description 1
- VNYBTNPBYXSMOO-UHFFFAOYSA-M (1-methylpyridin-1-ium-3-yl) N,N-dimethylcarbamate;bromide Chemical compound [Br-].CN(C)C(=O)OC1=CC=C[N+](C)=C1 VNYBTNPBYXSMOO-UHFFFAOYSA-M 0.000 description 1
- GMRQFYUYWCNGIN-NKMMMXOESA-N (1R,3S,5Z)-5-{2-[(1R,3aS,4E,7aR)-1-[(2R)-6-hydroxy-6-methylheptan-2-yl]-7a-methyl-octahydro-1H-inden-4-ylidene]ethylidene}-4-methylidenecyclohexane-1,3-diol Chemical compound C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@@H](CCCC(C)(C)O)C)=C\C=C1\C[C@@H](O)C[C@H](O)C1=C GMRQFYUYWCNGIN-NKMMMXOESA-N 0.000 description 1
- CAVQBDOACNULDN-NRCOEFLKSA-N (1S,2S)-2-(methylamino)-1-phenylpropan-1-ol;sulfuric acid Chemical compound OS(O)(=O)=O.CN[C@@H](C)[C@@H](O)C1=CC=CC=C1.CN[C@@H](C)[C@@H](O)C1=CC=CC=C1 CAVQBDOACNULDN-NRCOEFLKSA-N 0.000 description 1
- BLFQGGGGFNSJKA-KELGLJHESA-N (1S,4R)-4-(3,4-dichlorophenyl)-N-methyl-1,2,3,4-tetrahydronaphthalen-1-amine;hydrochloride Chemical compound Cl.C1([C@H]2CC[C@@H](C3=CC=CC=C32)NC)=CC=C(Cl)C(Cl)=C1 BLFQGGGGFNSJKA-KELGLJHESA-N 0.000 description 1
- OABOXRPGTFRBFZ-IMJSIDKUSA-N (2R)-2-[[(2R)-2-amino-3-sulfanylpropanoyl]amino]-3-sulfanylpropanoic acid Chemical compound SC[C@H](N)C(=O)N[C@@H](CS)C(O)=O OABOXRPGTFRBFZ-IMJSIDKUSA-N 0.000 description 1
- ARAIBEBZBOPLMB-UFGQHTETSA-N (2R,3R,4S)-4-[(diaminomethylidene)amino]-3-acetamido-2-[(1R,2R)-1,2,3-trihydroxypropyl]-3,4-dihydro-2H-pyran-6-carboxylic acid Chemical compound CC(=O)N[C@@H]1[C@@H](N=C(N)N)C=C(C(O)=O)O[C@H]1[C@H](O)[C@H](O)CO ARAIBEBZBOPLMB-UFGQHTETSA-N 0.000 description 1
- LNAZSHAWQACDHT-XIYTZBAFSA-N (2R,3R,4S,5R,6S)-4,5-dimethoxy-2-(methoxymethyl)-3-[(2S,3R,4S,5R,6R)-3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxy-6-[(2R,3R,4S,5R,6R)-4,5,6-trimethoxy-2-(methoxymethyl)oxan-3-yl]oxyoxane Chemical compound CO[C@@H]1[C@@H](OC)[C@H](OC)[C@@H](COC)O[C@H]1O[C@H]1[C@H](OC)[C@@H](OC)[C@H](O[C@H]2[C@@H]([C@@H](OC)[C@H](OC)O[C@@H]2COC)OC)O[C@@H]1COC LNAZSHAWQACDHT-XIYTZBAFSA-N 0.000 description 1
- YGULWPYYGQCFMP-NPHUUBOGSA-N (2R,3S)-2,3-dihydroxybutanedioic acid;1-[4-(2-methoxyethyl)phenoxy]-3-(propan-2-ylamino)propan-2-ol Chemical compound OC(=O)[C@@H](O)[C@@H](O)C(O)=O.COCCC1=CC=C(OCC(O)CNC(C)C)C=C1.COCCC1=CC=C(OCC(O)CNC(C)C)C=C1 YGULWPYYGQCFMP-NPHUUBOGSA-N 0.000 description 1
- BZPWXVJDMRBCMD-ZEDZUCNESA-N (2S)-2-[[4-[(2-amino-5-formyl-4-oxo-1,6,7,8-tetrahydropteridin-6-yl)methylamino]benzoyl]amino]pentanedioic acid;calcium Chemical compound [Ca].O=CN1C=2C(=O)NC(N)=NC=2NCC1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 BZPWXVJDMRBCMD-ZEDZUCNESA-N 0.000 description 1
- NLRUDGHSXOEXCE-PPHPATTJSA-N (2S)-2-amino-3-(3,4-dihydroxyphenyl)-2-methylpropanoic acid;hydrochloride Chemical compound Cl.OC(=O)[C@](N)(C)CC1=CC=C(O)C(O)=C1 NLRUDGHSXOEXCE-PPHPATTJSA-N 0.000 description 1
- IVTMXOXVAHXCHI-YXLMWLKOSA-N (2S)-2-amino-3-(3,4-dihydroxyphenyl)propanoic acid;(2S)-3-(3,4-dihydroxyphenyl)-2-hydrazinyl-2-methylpropanoic acid Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C(O)=C1.NN[C@@](C(O)=O)(C)CC1=CC=C(O)C(O)=C1 IVTMXOXVAHXCHI-YXLMWLKOSA-N 0.000 description 1
- MVORZMQFXBLMHM-QWRGUYRKSA-N (2S)-6-amino-2-[[(2S)-2-[(2-aminoacetyl)amino]-3-(1H-imidazol-5-yl)propanoyl]amino]hexanoic acid Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)CN)CC1=CN=CN1 MVORZMQFXBLMHM-QWRGUYRKSA-N 0.000 description 1
- XUFXOAAUWZOOIT-WVJZLWNXSA-N (2S,3R,4R,5S,6R)-5-[(2R,3R,4R,5S,6R)-5-[(2R,3R,4S,5S,6R)-3,4-dihydroxy-6-methyl-5-[[(1S,4R,5S,6S)-4,5,6-trihydroxy-3-(hydroxymethyl)cyclohex-2-en-1-yl]amino]oxan-2-yl]oxy-3,4-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-6-(hydroxymethyl)oxane-2,3,4-triol Chemical compound O([C@H]1O[C@H](CO)[C@H]([C@@H]([C@H]1O)O)O[C@H]1O[C@@H]([C@H]([C@H](O)[C@H]1O)N[C@@H]1[C@@H]([C@@H](O)[C@H](O)C(CO)=C1)O)C)[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O XUFXOAAUWZOOIT-WVJZLWNXSA-N 0.000 description 1
- CFCUWKMKBJTWLW-BGLFSJPPSA-N (2S,3S)-2-[(2S,4R,5R,6R)-4-[(2S,4R,5R,6R)-4-[(2S,4S,5R,6R)-4,5-dihydroxy-4,6-dimethyloxan-2-yl]oxy-5-hydroxy-6-methyloxan-2-yl]oxy-5-hydroxy-6-methyloxan-2-yl]oxy-3-[(1S,3S,4R)-3,4-dihydroxy-1-methoxy-2-oxopentyl]-6-[(2S,4R,5S,6R)-4-[(2S,4R,5S,6R)-4,5-dih Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BGLFSJPPSA-N 0.000 description 1
- AUODDLQVRAJAJM-XJQDNNTCSA-N (2S,4R)-N-[(1S,2S)-2-chloro-1-[(2R,3R,4S,5R,6R)-3,4,5-trihydroxy-6-methylsulfanyloxan-2-yl]propyl]-1-methyl-4-propylpyrrolidine-2-carboxamide;hydrochloride Chemical compound Cl.CN1C[C@H](CCC)C[C@H]1C(=O)N[C@H]([C@H](C)Cl)[C@@H]1[C@H](O)[C@H](O)[C@@H](O)[C@@H](SC)O1 AUODDLQVRAJAJM-XJQDNNTCSA-N 0.000 description 1
- BIDNLKIUORFRQP-XYGFDPSESA-N (2S,4S)-4-cyclohexyl-1-[2-[[(1S)-2-methyl-1-propanoyloxypropoxy]-(4-phenylbutyl)phosphoryl]acetyl]pyrrolidine-2-carboxylic acid Chemical compound C([P@@](=O)(O[C@H](OC(=O)CC)C(C)C)CC(=O)N1[C@@H](C[C@H](C1)C1CCCCC1)C(O)=O)CCCC1=CC=CC=C1 BIDNLKIUORFRQP-XYGFDPSESA-N 0.000 description 1
- SGVORSZSYKDVFT-ZBJAFUORSA-N (2S,5R,6R)-3,3-dimethyl-6-[[(2R)-2-[(3-methylsulfonyl-2-oxoimidazolidine-1-carbonyl)amino]-2-phenylacetyl]amino]-7-oxo-4-thia-1-azabicyclo[3.2.0]heptane-2-carboxylic acid;sodium Chemical compound [Na].N([C@@H](C(=O)N[C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C=1C=CC=CC=1)C(=O)N1CCN(S(C)(=O)=O)C1=O SGVORSZSYKDVFT-ZBJAFUORSA-N 0.000 description 1
- OOIBFPKQHULHSQ-UHFFFAOYSA-N (3-hydroxy-1-adamantyl) 2-methylprop-2-enoate Chemical compound C1C(C2)CC3CC2(O)CC1(OC(=O)C(=C)C)C3 OOIBFPKQHULHSQ-UHFFFAOYSA-N 0.000 description 1
- RLLPVAHGXHCWKJ-HKUYNNGSSA-N (3-phenoxyphenyl)methyl (1R,3R)-3-(2,2-dichloroethenyl)-2,2-dimethylcyclopropane-1-carboxylate Chemical compound CC1(C)[C@@H](C=C(Cl)Cl)[C@H]1C(=O)OCC1=CC=CC(OC=2C=CC=CC=2)=C1 RLLPVAHGXHCWKJ-HKUYNNGSSA-N 0.000 description 1
- PRZXEPJJHQYOGF-GNAZCLTHSA-N (3S,4R)-3-ethyl-4-[(3-methylimidazol-4-yl)methyl]oxolan-2-one;nitric acid Chemical compound O[N+]([O-])=O.C1OC(=O)[C@@H](CC)[C@H]1CC1=CN=CN1C PRZXEPJJHQYOGF-GNAZCLTHSA-N 0.000 description 1
- FJLGEFLZQAZZCD-JUFISIKESA-N (3S,5R)-fluvastatin Chemical compound C12=CC=CC=C2N(C(C)C)C(\C=C\[C@H](O)C[C@H](O)CC(O)=O)=C1C1=CC=C(F)C=C1 FJLGEFLZQAZZCD-JUFISIKESA-N 0.000 description 1
- RGPDIGOSVORSAK-STHHAXOLSA-N (4R,4aS,7aR,12bS)-4a,9-dihydroxy-3-prop-2-enyl-1,2,3,4,5,6,7a,13-octahydro-4,12-methanobenzofuro[3,2-e]isoquinoline-3-ium-7-one;chloride Chemical compound Cl.O=C([C@@H]1O2)CC[C@@]3(O)[C@H]4CC5=CC=C(O)C2=C5[C@@]13CCN4CC=C RGPDIGOSVORSAK-STHHAXOLSA-N 0.000 description 1
- DEQANNDTNATYII-MEUDYGGUSA-N (4R,7S,10S,13R,16S,19R)-10-(4-aminobutyl)-19-[[(2R)-2-amino-3-phenylpropanoyl]amino]-16-benzyl-N-(1,3-dihydroxybutan-2-yl)-7-[(1R)-1-hydroxyethyl]-13-(1H-indol-3-ylmethyl)-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentazacycloicosane-4-carboxamide Chemical compound C([C@@H](N)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](CC=2C3=CC=CC=C3NC=2)NC(=O)[C@H](CC=2C=CC=CC=2)NC1=O)C(=O)NC(CO)C(O)C)C1=CC=CC=C1 DEQANNDTNATYII-MEUDYGGUSA-N 0.000 description 1
- OZRNSSUDZOLUSN-LBPRGKRZSA-M (4S)-4-[[4-[(2-amino-4-oxo-7,8-dihydro-1H-pteridin-6-yl)methylamino]benzoyl]amino]-5-hydroxy-5-oxopentanoate Chemical compound N=1C=2C(=O)NC(N)=NC=2NCC=1CNC1=CC=C(C(=O)N[C@@H](CCC([O-])=O)C(O)=O)C=C1 OZRNSSUDZOLUSN-LBPRGKRZSA-M 0.000 description 1
- PTNZGHXUZDHMIQ-CVHRZJFOSA-N (4S,4aR,5S,5aR,6R,12aR)-4-(dimethylamino)-1,5,10,11,12a-pentahydroxy-6-methyl-3,12-dioxo-4a,5,5a,6-tetrahydro-4H-tetracene-2-carboxamide;hydrochloride Chemical compound Cl.C1=CC=C2[C@H](C)[C@@H]([C@H](O)[C@@H]3[C@](C(O)=C(C(N)=O)C(=O)[C@H]3N(C)C)(O)C3=O)C3=C(O)C2=C1O PTNZGHXUZDHMIQ-CVHRZJFOSA-N 0.000 description 1
- YCIHPQHVWDULOY-FMZCEJRJSA-N (4S,4aS,5aS,6S,12aR)-4-(dimethylamino)-1,6,10,11,12a-pentahydroxy-6-methyl-3,12-dioxo-4,4a,5,5a-tetrahydrotetracene-2-carboxamide;hydrochloride Chemical compound Cl.C1=CC=C2[C@](O)(C)[C@H]3C[C@H]4[C@H](N(C)C)C(=O)C(C(N)=O)=C(O)[C@@]4(O)C(=O)C3=C(O)C2=C1O YCIHPQHVWDULOY-FMZCEJRJSA-N 0.000 description 1
- OMJKFYKNWZZKTK-POHAHGRESA-N (5Z)-5-(dimethylaminohydrazinylidene)imidazole-4-carboxamide Chemical compound CN(C)N\N=C1/N=CN=C1C(N)=O OMJKFYKNWZZKTK-POHAHGRESA-N 0.000 description 1
- JFPVXVDWJQMJEE-IZRZKJBUSA-N (6R,7R)-3-[(carbamoyloxy)methyl]-7-[(2Z)-2-(furan-2-yl)-2-(methoxyimino)acetamido]-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid Chemical compound N([C@@H]1C(N2C(=C(COC(N)=O)CS[C@@H]21)C(O)=O)=O)C(=O)\C(=N/OC)C1=CC=CO1 JFPVXVDWJQMJEE-IZRZKJBUSA-N 0.000 description 1
- RTXOFQZKPXMALH-GHXIOONMSA-N (6R,7R)-7-[(2Z)-2-(2-amino-1,3-thiazol-4-yl)-2-(N-hydroxyimino)acetamido]-3-ethenyl-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid Chemical compound S1C(N)=NC(C(=N\O)\C(=O)N[C@@H]2C(N3C(=C(C=C)CS[C@@H]32)C(O)=O)=O)=C1 RTXOFQZKPXMALH-GHXIOONMSA-N 0.000 description 1
- WDLWHQDACQUCJR-AGGBKSKLSA-N (6R,7R)-7-[[(2R)-2-azaniumyl-2-(4-hydroxyphenyl)acetyl]amino]-8-oxo-3-[(Z)-prop-1-enyl]-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylate Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)\C=C/C)C(O)=O)=CC=C(O)C=C1 WDLWHQDACQUCJR-AGGBKSKLSA-N 0.000 description 1
- ORFOPKXBNMVMKC-DWVKKRMSSA-O (6R,7R)-7-[[(2Z)-2-(2-amino-1,3-thiazol-4-yl)-2-(2-carboxypropan-2-yloxyimino)acetyl]amino]-8-oxo-3-(pyridin-1-ium-1-ylmethyl)-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)\C(=N/OC(C)(C)C(O)=O)C=2N=C(N)SC=2)CC=1C[N+]1=CC=CC=C1 ORFOPKXBNMVMKC-DWVKKRMSSA-O 0.000 description 1
- GPYKKBAAPVOCIW-HSASPSRMSA-N (6R,7S)-7-[[(2R)-2-amino-2-phenylacetyl]amino]-3-chloro-8-oxo-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid;hydrate Chemical compound O.C1([C@H](C(=O)N[C@@H]2C(N3C(=C(Cl)CC[C@@H]32)C(O)=O)=O)N)=CC=CC=C1 GPYKKBAAPVOCIW-HSASPSRMSA-N 0.000 description 1
- MWWSFMDVAYGXBV-FGBSZODSSA-N (7S,9S)-7-[(2R,4S,5R,6S)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7H-tetracene-5,12-dione;hydron;chloride Chemical compound Cl.O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 MWWSFMDVAYGXBV-FGBSZODSSA-N 0.000 description 1
- JVHPTYWUBOQMBP-RVFAQHLVSA-N (7S,9S)-9-acetyl-7-[(2R,4S,5S,6S)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-8,10-dihydro-7H-tetracene-5,12-dione;hydrochloride Chemical compound Cl.C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 JVHPTYWUBOQMBP-RVFAQHLVSA-N 0.000 description 1
- DWSGTFTVBLXELC-UHFFFAOYSA-N (8-methyl-8-azoniabicyclo[3.2.1]octan-3-yl) 2-hydroxy-2-phenylacetate;bromide Chemical compound Br.CN1C(C2)CCC1CC2OC(=O)C(O)C1=CC=CC=C1 DWSGTFTVBLXELC-UHFFFAOYSA-N 0.000 description 1
- RZPZLFIUFMNCLY-WLHGVMLRSA-N (E)-but-2-enedioic acid;1-(propan-2-ylamino)-3-[4-(2-propan-2-yloxyethoxymethyl)phenoxy]propan-2-ol Chemical compound OC(=O)\C=C\C(O)=O.CC(C)NCC(O)COC1=CC=C(COCCOC(C)C)C=C1 RZPZLFIUFMNCLY-WLHGVMLRSA-N 0.000 description 1
- WESWYMRNZNDGBX-SBKWZQTDSA-N (R)-[2,8-bis(trifluoromethyl)quinolin-4-yl]-[(2S)-piperidin-2-yl]methanol;hydrochloride Chemical compound Cl.C([C@H]1[C@H](O)C=2C3=CC=CC(=C3N=C(C=2)C(F)(F)F)C(F)(F)F)CCCN1 WESWYMRNZNDGBX-SBKWZQTDSA-N 0.000 description 1
- METKIMKYRPQLGS-GFCCVEGCSA-N (R)-atenolol Chemical compound CC(C)NC[C@@H](O)COC1=CC=C(CC(N)=O)C=C1 METKIMKYRPQLGS-GFCCVEGCSA-N 0.000 description 1
- AKYHKWQPZHDOBW-KYNMMFKBSA-N (S)-[(2R,5R)-5-ethenyl-1-azabicyclo[2.2.2]octan-2-yl]-(6-methoxyquinolin-4-yl)methanol;sulfuric acid Chemical compound OS(O)(=O)=O.C1C([C@H](C2)C=C)CCN2[C@H]1[C@@H](O)C1=CC=NC2=CC=C(OC)C=C21 AKYHKWQPZHDOBW-KYNMMFKBSA-N 0.000 description 1
- PYHRZPFZZDCOPH-QXGOIDDHSA-N (S)-amphetamine sulfate Chemical compound [H+].[H+].[O-]S([O-])(=O)=O.C[C@H](N)CC1=CC=CC=C1.C[C@H](N)CC1=CC=CC=C1 PYHRZPFZZDCOPH-QXGOIDDHSA-N 0.000 description 1
- WLRMANUAADYWEA-NWASOUNVSA-N (S)-timolol maleate Chemical compound OC(=O)\C=C/C(O)=O.CC(C)(C)NC[C@H](O)COC1=NSN=C1N1CCOCC1 WLRMANUAADYWEA-NWASOUNVSA-N 0.000 description 1
- SECXUXOCDLQOBI-MKFZHGHUSA-N (Z)-8aH-phthalazin-1-ylidenehydrazine;hydrochloride Chemical compound Cl.C1=CC=CC2C(=N/N)/N=NC=C21 SECXUXOCDLQOBI-MKFZHGHUSA-N 0.000 description 1
- LFMYNZPAVPMEGP-PIDGMYBPSA-N (Z)-but-2-enedioic acid;2-[(E)-[5-methoxy-1-[4-(trifluoromethyl)phenyl]pentylidene]amino]oxyethanamine Chemical compound OC(=O)\C=C/C(O)=O.COCCCC\C(=N/OCCN)C1=CC=C(C(F)(F)F)C=C1 LFMYNZPAVPMEGP-PIDGMYBPSA-N 0.000 description 1
- YFMFNYKEUDLDTL-UHFFFAOYSA-N 1,1,1,2,3,3,3-Heptafluoropropane Chemical compound FC(F)(F)C(F)C(F)(F)F YFMFNYKEUDLDTL-UHFFFAOYSA-N 0.000 description 1
- LVGUZGTVOIAKKC-UHFFFAOYSA-N 1,1,1,2-Tetrafluoroethane Chemical compound FCC(F)(F)F LVGUZGTVOIAKKC-UHFFFAOYSA-N 0.000 description 1
- SNIOPGDIGTZGOP-UHFFFAOYSA-N 1,2,3-propanetrioltrinitrate Chemical compound [O-][N+](=O)OCC(O[N+]([O-])=O)CO[N+]([O-])=O SNIOPGDIGTZGOP-UHFFFAOYSA-N 0.000 description 1
- 150000005207 1,3-dihydroxybenzenes Chemical class 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N 1,4-Butanediol, dimethanesulfonate Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- MCCACAIVAXEFAL-UHFFFAOYSA-N 1-[2-(2,4-dichlorophenyl)-2-[(2,4-dichlorophenyl)methoxy]ethyl]imidazole;nitric acid Chemical compound O[N+]([O-])=O.ClC1=CC(Cl)=CC=C1COC(C=1C(=CC(Cl)=CC=1)Cl)CN1C=NC=C1 MCCACAIVAXEFAL-UHFFFAOYSA-N 0.000 description 1
- DDXORDQKGIZAME-UHFFFAOYSA-N 1-[2-[(4-chlorophenyl)methoxy]-2-(2,4-dichlorophenyl)ethyl]imidazole;nitric acid Chemical compound O[N+]([O-])=O.C1=CC(Cl)=CC=C1COC(C=1C(=CC(Cl)=CC=1)Cl)CN1C=NC=C1 DDXORDQKGIZAME-UHFFFAOYSA-N 0.000 description 1
- KEJCWVGMRLCZQQ-DJMWJSSGSA-N 1-acetyloxyethyl (6R,7R)-3-(carbamoyloxymethyl)-7-[[(2E)-2-(furan-2-yl)-2-methoxyiminoacetyl]amino]-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylate Chemical compound N([C@@H]1C(N2C(=C(COC(N)=O)CS[C@@H]21)C(=O)OC(C)OC(C)=O)=O)C(=O)/C(=N/OC)C1=CC=CO1 KEJCWVGMRLCZQQ-DJMWJSSGSA-N 0.000 description 1
- MBGXILHMHYLZJT-UHFFFAOYSA-N 1-ethyl-4-(2-morpholin-4-ium-4-ylethyl)-3,3-diphenylpyrrolidin-2-one;chloride Chemical compound [Cl-].C=1C=CC=CC=1C1(C=2C=CC=CC=2)C(=O)N(CC)CC1CC[NH+]1CCOCC1 MBGXILHMHYLZJT-UHFFFAOYSA-N 0.000 description 1
- LNETULKMXZVUST-UHFFFAOYSA-N 1-naphthoic acid Chemical compound C1=CC=C2C(C(=O)O)=CC=CC2=C1 LNETULKMXZVUST-UHFFFAOYSA-N 0.000 description 1
- OHMHBGPWCHTMQE-UHFFFAOYSA-N 2,2-Dichloro-1,1,1-trifluoroethane Chemical compound FC(F)(F)C(Cl)Cl OHMHBGPWCHTMQE-UHFFFAOYSA-N 0.000 description 1
- BVDRUCCQKHGCRX-UHFFFAOYSA-N 2,3-dihydroxypropyl formate Chemical compound OCC(O)COC=O BVDRUCCQKHGCRX-UHFFFAOYSA-N 0.000 description 1
- GJSURZIOUXUGAL-UHFFFAOYSA-N 2-((2,6-Dichlorophenyl)imino)imidazolidine Chemical compound ClC1=CC=CC(Cl)=C1NC1=NCCN1 GJSURZIOUXUGAL-UHFFFAOYSA-N 0.000 description 1
- VPSRQEHTHIMDQM-FDOHDBATSA-N 2-[(3R)-3-[[(2S)-1-ethoxy-1-oxo-4-phenylbutan-2-yl]amino]-2-oxo-4,5-dihydro-3H-1-benzazepin-1-yl]acetic acid;hydrochloride Chemical compound Cl.C([C@@H](C(=O)OCC)N[C@H]1C(N(CC(O)=O)C2=CC=CC=C2CC1)=O)CC1=CC=CC=C1 VPSRQEHTHIMDQM-FDOHDBATSA-N 0.000 description 1
- YGWFCQYETHJKNX-UHFFFAOYSA-N 2-[(4-tert-butyl-2,6-dimethylphenyl)methyl]-4,5-dihydro-1H-imidazol-3-ium;chloride Chemical compound [Cl-].CC1=CC(C(C)(C)C)=CC(C)=C1CC1=NCC[NH2+]1 YGWFCQYETHJKNX-UHFFFAOYSA-N 0.000 description 1
- ITPDYQOUSLNIHG-UHFFFAOYSA-N 2-[4-(2-butyl-1-benzofuran-3-carbonyl)-2,6-diiodophenoxy]ethyl-diethylazanium;chloride Chemical compound [Cl-].CCCCC=1OC2=CC=CC=C2C=1C(=O)C1=CC(I)=C(OCC[NH+](CC)CC)C(I)=C1 ITPDYQOUSLNIHG-UHFFFAOYSA-N 0.000 description 1
- JCBIVZZPXRZKTI-UHFFFAOYSA-N 2-[4-[(7-chloroquinolin-4-yl)amino]pentyl-ethylamino]ethanol;sulfuric acid Chemical compound OS(O)(=O)=O.ClC1=CC=C2C(NC(C)CCCN(CCO)CC)=CC=NC2=C1 JCBIVZZPXRZKTI-UHFFFAOYSA-N 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- WROUWQQRXUBECT-UHFFFAOYSA-N 2-ethylacrylic acid Chemical compound CCC(=C)C(O)=O WROUWQQRXUBECT-UHFFFAOYSA-N 0.000 description 1
- AOHMFUYIHARAGR-UHFFFAOYSA-N 2-hydroxypropane-1,2,3-tricarboxylic acid;magnesium Chemical compound [Mg].[Mg].[Mg].OC(=O)CC(O)(C(O)=O)CC(O)=O.OC(=O)CC(O)(C(O)=O)CC(O)=O AOHMFUYIHARAGR-UHFFFAOYSA-N 0.000 description 1
- MBWXNTAXLNYFJB-NKFFZRIASA-N 2-methyl-3-[(2E,7R,11R)-3,7,11,15-tetramethylhexadec-2-en-1-yl]-1,4-dihydronaphthalene-1,4-dione Chemical compound C1=CC=C2C(=O)C(C/C=C(C)/CCC[C@H](C)CCC[C@H](C)CCCC(C)C)=C(C)C(=O)C2=C1 MBWXNTAXLNYFJB-NKFFZRIASA-N 0.000 description 1
- HMFKFHLTUCJZJO-UHFFFAOYSA-N 2-{2-[3,4-bis(2-hydroxyethoxy)oxolan-2-yl]-2-(2-hydroxyethoxy)ethoxy}ethyl dodecanoate Chemical compound CCCCCCCCCCCC(=O)OCCOCC(OCCO)C1OCC(OCCO)C1OCCO HMFKFHLTUCJZJO-UHFFFAOYSA-N 0.000 description 1
- 101710028559 23 Proteins 0.000 description 1
- SHAYBENGXDALFF-UHFFFAOYSA-N 3-(5,6-dihydrodibenzo[2,1-b:2',1'-f][7]annulen-11-ylidene)propyl-methylazanium;chloride Chemical compound [Cl-].C1CC2=CC=CC=C2C(=CCC[NH2+]C)C2=CC=CC=C21 SHAYBENGXDALFF-UHFFFAOYSA-N 0.000 description 1
- UZFPOOOQHWICKY-UHFFFAOYSA-N 3-[13-[1-[1-[8,12-bis(2-carboxyethyl)-17-(1-hydroxyethyl)-3,7,13,18-tetramethyl-21,24-dihydroporphyrin-2-yl]ethoxy]ethyl]-18-(2-carboxyethyl)-8-(1-hydroxyethyl)-3,7,12,17-tetramethyl-22,23-dihydroporphyrin-2-yl]propanoic acid Chemical compound N1C(C=C2C(=C(CCC(O)=O)C(C=C3C(=C(C)C(C=C4N5)=N3)CCC(O)=O)=N2)C)=C(C)C(C(C)O)=C1C=C5C(C)=C4C(C)OC(C)C1=C(N2)C=C(N3)C(C)=C(C(O)C)C3=CC(C(C)=C3CCC(O)=O)=NC3=CC(C(CCC(O)=O)=C3C)=NC3=CC2=C1C UZFPOOOQHWICKY-UHFFFAOYSA-N 0.000 description 1
- WUIABRMSWOKTOF-PATWWPTKSA-N 3-[[2-[2-[2-[[(2R,3R)-2-[[(2R,3R,4S)-4-[[(2S)-2-[[6-amino-2-[(1S)-3-amino-1-[[(2R)-2,3-diamino-3-oxopropyl]amino]-3-oxopropyl]-5-methylpyrimidine-4-carbonyl]amino]-3-[(2S,3R,4R,5R,6R)-3-[(2R,3S,4S,5R,6R)-4-carbamoyloxy-3,5-dihydroxy-6-(hydroxymethyl)oxan- Chemical compound OS([O-])(=O)=O.N([C@H](C(=O)N[C@@H](C)[C@H](O)[C@@H](C)C(=O)N[C@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)C(O[C@@H]1[C@@H]([C@H](O)[C@@H](O)[C@@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1NC=NC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@@H](N)C(N)=O)=NC(N)=C1C WUIABRMSWOKTOF-PATWWPTKSA-N 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-M 3-carboxy-2,3-dihydroxypropanoate Chemical compound OC(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-M 0.000 description 1
- GQWNECFJGBQMBO-UHFFFAOYSA-N 3-ethyl-2-methyl-5-(morpholin-4-ium-4-ylmethyl)-1,5,6,7-tetrahydroindol-4-one;chloride Chemical compound Cl.O=C1C=2C(CC)=C(C)NC=2CCC1CN1CCOCC1 GQWNECFJGBQMBO-UHFFFAOYSA-N 0.000 description 1
- WTDRDQBEARUVNC-LURJTMIESA-N 3-hydroxy-L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C(O)=C1 WTDRDQBEARUVNC-LURJTMIESA-N 0.000 description 1
- CTENFNNZBMHDDG-UHFFFAOYSA-N 4-(2-aminoethyl)benzene-1,2-diol;hydron;chloride Chemical compound Cl.NCCC1=CC=C(O)C(O)=C1 CTENFNNZBMHDDG-UHFFFAOYSA-N 0.000 description 1
- ATBUNPBAFFCFKY-FERBBOLQSA-N 4-[(1R)-1-hydroxy-2-[4-(4-hydroxyphenyl)butylamino]ethyl]benzene-1,2-diol;hydrochloride Chemical compound Cl.C([C@H](O)C=1C=C(O)C(O)=CC=1)NCCCCC1=CC=C(O)C=C1 ATBUNPBAFFCFKY-FERBBOLQSA-N 0.000 description 1
- IMBXEJJVJRTNOW-XYMSELFBSA-N 4-[2-[(6S,8S,9S,10R,11S,13S,14S,17R)-11,17-dihydroxy-6,10,13-trimethyl-3-oxo-7,8,9,11,12,14,15,16-octahydro-6H-cyclopenta[a]phenanthren-17-yl]-2-oxoethoxy]-4-oxobutanoic acid Chemical compound C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2[C@@H](O)C[C@]2(C)[C@@](O)(C(=O)COC(=O)CCC(O)=O)CC[C@H]21 IMBXEJJVJRTNOW-XYMSELFBSA-N 0.000 description 1
- DJSLTDBPKHORNY-UWRQUICRSA-N 4-[[2-butyl-5-[(Z)-2-carboxy-3-thiophen-2-ylprop-1-enyl]imidazol-1-yl]methyl]benzoic acid;methanesulfonic acid Chemical compound CS(O)(=O)=O.C=1C=C(C(O)=O)C=CC=1CN1C(CCCC)=NC=C1\C=C(C(O)=O)\CC1=CC=CS1 DJSLTDBPKHORNY-UWRQUICRSA-N 0.000 description 1
- JTEGQNOMFQHVDC-NKWVEPMBSA-N 4-amino-1-[(2R,5S)-2-(hydroxymethyl)-1,3-oxathiolan-5-yl]-1,2-dihydropyrimidin-2-one Chemical compound O=C1N=C(N)C=CN1[C@H]1O[C@@H](CO)SC1 JTEGQNOMFQHVDC-NKWVEPMBSA-N 0.000 description 1
- RKWGIWYCVPQPMF-UHFFFAOYSA-N 4-chloro-N-[(propylamino)carbonyl]benzenesulfonamide Chemical compound CCCNC(=O)NS(=O)(=O)C1=CC=C(Cl)C=C1 RKWGIWYCVPQPMF-UHFFFAOYSA-N 0.000 description 1
- PJVWKTKQMONHTI-UHFFFAOYSA-N 4-hydroxy-3-(3-oxo-1-phenylbutyl)-1-benzopyran-2-one Chemical compound OC=1C2=CC=CC=C2OC(=O)C=1C(CC(=O)C)C1=CC=CC=C1 PJVWKTKQMONHTI-UHFFFAOYSA-N 0.000 description 1
- YJISHJVIRFPGGN-UHFFFAOYSA-N 5-[5-[3,4-dihydroxy-6-(hydroxymethyl)-5-methoxyoxan-2-yl]oxy-6-[[3,4-dihydroxy-6-(hydroxymethyl)-5-methoxyoxan-2-yl]oxymethyl]-3,4-dihydroxyoxan-2-yl]oxy-6-(hydroxymethyl)-2-methyloxane-3,4-diol Chemical compound O1C(CO)C(OC)C(O)C(O)C1OCC1C(OC2C(C(O)C(OC)C(CO)O2)O)C(O)C(O)C(OC2C(OC(C)C(O)C2O)CO)O1 YJISHJVIRFPGGN-UHFFFAOYSA-N 0.000 description 1
- CWSZBVAUYPTXTG-UHFFFAOYSA-N 5-[6-[[3,4-dihydroxy-6-(hydroxymethyl)-5-methoxyoxan-2-yl]oxymethyl]-3,4-dihydroxy-5-[4-hydroxy-3-(2-hydroxyethoxy)-6-(hydroxymethyl)-5-methoxyoxan-2-yl]oxyoxan-2-yl]oxy-6-(hydroxymethyl)-2-methyloxane-3,4-diol Chemical compound O1C(CO)C(OC)C(O)C(O)C1OCC1C(OC2C(C(O)C(OC)C(CO)O2)OCCO)C(O)C(O)C(OC2C(OC(C)C(O)C2O)CO)O1 CWSZBVAUYPTXTG-UHFFFAOYSA-N 0.000 description 1
- GJOHLWZHWQUKAU-UHFFFAOYSA-N 5-azaniumylpentan-2-yl-(6-methoxyquinolin-8-yl)azanium;dihydrogen phosphate Chemical compound OP(O)(O)=O.OP(O)(O)=O.N1=CC=CC2=CC(OC)=CC(NC(C)CCCN)=C21 GJOHLWZHWQUKAU-UHFFFAOYSA-N 0.000 description 1
- QZHBYNSSDLTCRG-LREBCSMRSA-N 5-bromo-N-(4,5-dihydro-1H-imidazol-2-yl)quinoxalin-6-amine;(2R,3R)-2,3-dihydroxybutanedioic acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O.C1=CC2=NC=CN=C2C(Br)=C1NC1=NCCN1 QZHBYNSSDLTCRG-LREBCSMRSA-N 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N 5-flurouricil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- PSGRLCOSIXJUAL-ZPQKBBRKSA-N 71YF100S3H Chemical compound CS(O)(=O)=O.C1=CC=C2C(C(OC3C[C@@H]4CC5C[C@@H](N4CC5=O)C3)=O)=CNC2=C1 PSGRLCOSIXJUAL-ZPQKBBRKSA-N 0.000 description 1
- OIRDTQYFTABQOQ-GAWUUDPSSA-N 9-β-D-XYLOFURANOSYL-ADENINE Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@H](O)[C@H]1O OIRDTQYFTABQOQ-GAWUUDPSSA-N 0.000 description 1
- 229930006677 A03BA01 - Atropine Natural products 0.000 description 1
- NMTWKEWYQXZGCI-LYOWLMOVSA-N AC1L1NHR Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O.C([C@H]1C(=O)N2CCC[C@H]2[C@]2(O)O[C@@](C(N21)=O)(C)NC(=O)[C@H]1CN([C@H]2C(C=3C=CC=C4NC=C(C=34)C2)=C1)C)C1=CC=CC=C1 NMTWKEWYQXZGCI-LYOWLMOVSA-N 0.000 description 1
- 229960004308 ACETYLCYSTEINE Drugs 0.000 description 1
- 101710039825 ADORA2B Proteins 0.000 description 1
- 229940033496 AGENTS AGAINST AMOEBIASIS AND OTHER PROTOZOAL DISEASES Drugs 0.000 description 1
- 229940100198 ALKYLATING AGENTS Drugs 0.000 description 1
- 229940030486 ANDROGENS Drugs 0.000 description 1
- 229940005513 ANTIDEPRESSANTS Drugs 0.000 description 1
- 101700001858 ANXA2 Proteins 0.000 description 1
- 102100004600 ANXA2 Human genes 0.000 description 1
- 102100007804 ANXA4 Human genes 0.000 description 1
- 101700019970 ANXA4 Proteins 0.000 description 1
- 229960003917 ARBUTAMINE HYDROCHLORIDE Drugs 0.000 description 1
- 229960003272 ASPARAGINASE Drugs 0.000 description 1
- 108060000679 ATG12 Proteins 0.000 description 1
- 108010004463 Abciximab Proteins 0.000 description 1
- 244000215068 Acacia senegal Species 0.000 description 1
- 241000238876 Acari Species 0.000 description 1
- 229960003830 Acebutolol Hydrochloride Drugs 0.000 description 1
- 229940022659 Acetaminophen Drugs 0.000 description 1
- 229960000526 Acetazolamide sodium Drugs 0.000 description 1
- 229960004266 Acetylcholine chloride Drugs 0.000 description 1
- 108010013043 Acetylesterase Proteins 0.000 description 1
- YAJCHEVQCOHZDC-QMMNLEPNSA-N Actrapid Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@H]1CSSC[C@H]2C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H](C(N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3C=CC(O)=CC=3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3N=CNC=3)NC(=O)[C@H](CO)NC(=O)CNC1=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H]([C@H](C)O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@H](C)O)C(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O)=O)CSSC[C@@H](C(N2)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](NC(=O)CN)[C@H](C)CC)[C@H](C)CC)[C@H](C)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CC=1C=CC=CC=1)C(C)C)C(N)=O)C1=CNC=N1 YAJCHEVQCOHZDC-QMMNLEPNSA-N 0.000 description 1
- 206010000830 Acute leukaemia Diseases 0.000 description 1
- 229940023040 Acyclovir Drugs 0.000 description 1
- 229940008235 Acyclovir Sodium Drugs 0.000 description 1
- 208000009956 Adenocarcinoma Diseases 0.000 description 1
- OIRDTQYFTABQOQ-SXVXDFOESA-N Adenosine Natural products Nc1ncnc2c1ncn2[C@@H]3O[C@@H](CO)[C@H](O)[C@@H]3O OIRDTQYFTABQOQ-SXVXDFOESA-N 0.000 description 1
- 108010085273 Adenosine A2B receptor Proteins 0.000 description 1
- 102000007470 Adenosine A2B receptor Human genes 0.000 description 1
- 241000607516 Aeromonas caviae Species 0.000 description 1
- 241000607528 Aeromonas hydrophila Species 0.000 description 1
- 241000607522 Aeromonas sobria Species 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 229940023808 Albuterol Drugs 0.000 description 1
- 208000007848 Alcoholism Diseases 0.000 description 1
- 229960005380 Alfentanil hydrochloride Drugs 0.000 description 1
- XJKJWTWGDGIQRH-BFIDDRIFSA-N Alginic acid Chemical compound O1[C@@H](C(O)=O)[C@@H](OC)[C@H](O)[C@H](O)[C@@H]1O[C@@H]1[C@@H](C(O)=O)O[C@@H](C)[C@@H](O)[C@H]1O XJKJWTWGDGIQRH-BFIDDRIFSA-N 0.000 description 1
- VREFGVBLTWBCJP-UHFFFAOYSA-N Alprazolam Chemical compound C12=CC(Cl)=CC=C2N2C(C)=NN=C2CN=C1C1=CC=CC=C1 VREFGVBLTWBCJP-UHFFFAOYSA-N 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K Aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 229940024545 Aluminum Hydroxide Drugs 0.000 description 1
- 229940118662 Aluminum carbonate Drugs 0.000 description 1
- 206010001897 Alzheimer's disease Diseases 0.000 description 1
- 229960001280 Amantadine Hydrochloride Drugs 0.000 description 1
- 229960001656 Amikacin Sulfate Drugs 0.000 description 1
- 229960004104 Amiloride Hydrochloride Drugs 0.000 description 1
- FQPFAHBPWDRTLU-UHFFFAOYSA-N Aminophylline Chemical compound NCCN.O=C1N(C)C(=O)N(C)C2=C1NC=N2.O=C1N(C)C(=O)N(C)C2=C1NC=N2 FQPFAHBPWDRTLU-UHFFFAOYSA-N 0.000 description 1
- 229960003556 Aminophylline Drugs 0.000 description 1
- 229960003234 Amiodarone hydrochloride Drugs 0.000 description 1
- 229960004005 Amlodipine Besylate Drugs 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N Ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- QWGDMFLQWFTERH-UHFFFAOYSA-N Amoxapine Chemical compound C12=CC(Cl)=CC=C2OC2=CC=CC=C2N=C1N1CCNCC1 QWGDMFLQWFTERH-UHFFFAOYSA-N 0.000 description 1
- 229960002519 Amoxapine Drugs 0.000 description 1
- 229940025084 Amphetamine Drugs 0.000 description 1
- 229940008238 Amphetamine Sulfate Drugs 0.000 description 1
- 229960001931 Ampicillin Sodium Drugs 0.000 description 1
- YMARZQAQMVYCKC-OEMFJLHTSA-N Amprenavir Chemical compound C([C@@H]([C@H](O)CN(CC(C)C)S(=O)(=O)C=1C=CC(N)=CC=1)NC(=O)O[C@@H]1COCC1)C1=CC=CC=C1 YMARZQAQMVYCKC-OEMFJLHTSA-N 0.000 description 1
- 235000019890 Amylum Nutrition 0.000 description 1
- 206010002068 Anaemia neonatal Diseases 0.000 description 1
- 208000005367 Anemia, Hypoplastic, Congenital Diseases 0.000 description 1
- 206010002329 Aneurysm Diseases 0.000 description 1
- 206010002383 Angina pectoris Diseases 0.000 description 1
- 206010002388 Angina unstable Diseases 0.000 description 1
- 108010064733 Angiotensins Proteins 0.000 description 1
- 102000015427 Angiotensins Human genes 0.000 description 1
- 229960000983 Anistreplase Drugs 0.000 description 1
- 108010058207 Anistreplase Proteins 0.000 description 1
- 210000002226 Anterior Horn Cells Anatomy 0.000 description 1
- 210000000709 Aorta Anatomy 0.000 description 1
- 210000000702 Aorta, Abdominal Anatomy 0.000 description 1
- 206010002895 Aortic dissection Diseases 0.000 description 1
- YZXBAPSDXZZRGB-DOFZRALJSA-N Arachidonic acid Chemical compound CCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(O)=O YZXBAPSDXZZRGB-DOFZRALJSA-N 0.000 description 1
- 102000004452 Arginases Human genes 0.000 description 1
- 108020001204 Arginases Proteins 0.000 description 1
- 206010060963 Arterial disease Diseases 0.000 description 1
- 210000001367 Arteries Anatomy 0.000 description 1
- 206010003210 Arteriosclerosis Diseases 0.000 description 1
- 206010003226 Arteriovenous fistula Diseases 0.000 description 1
- 206010053555 Arthritis bacterial Diseases 0.000 description 1
- 108010024976 Asparaginase Proteins 0.000 description 1
- 102000015790 Asparaginase Human genes 0.000 description 1
- 229960001230 Asparagine Drugs 0.000 description 1
- IAOZJIPTCAWIRG-QWRGUYRKSA-N Aspartame Chemical compound OC(=O)C[C@H](N)C(=O)N[C@H](C(=O)OC)CC1=CC=CC=C1 IAOZJIPTCAWIRG-QWRGUYRKSA-N 0.000 description 1
- 108010011485 Aspartame Proteins 0.000 description 1
- 229960003438 Aspartame Drugs 0.000 description 1
- 229940009098 Aspartate Drugs 0.000 description 1
- 229960005261 Aspartic Acid Drugs 0.000 description 1
- 229960002274 Atenolol Drugs 0.000 description 1
- 206010003658 Atrial fibrillation Diseases 0.000 description 1
- 206010003668 Atrial tachycardia Diseases 0.000 description 1
- 206010003671 Atrioventricular block Diseases 0.000 description 1
- 229960000396 Atropine Drugs 0.000 description 1
- RKUNBYITZUJHSG-SPUOUPEWSA-N Atropine Chemical compound O([C@H]1C[C@H]2CC[C@@H](C1)N2C)C(=O)C(CO)C1=CC=CC=C1 RKUNBYITZUJHSG-SPUOUPEWSA-N 0.000 description 1
- 229960005207 Auranofin Drugs 0.000 description 1
- XHVAWZZCDCWGBK-WYRLRVFGSA-M Aurothioglucose Chemical compound OC[C@H]1O[C@H](S[Au])[C@H](O)[C@@H](O)[C@@H]1O XHVAWZZCDCWGBK-WYRLRVFGSA-M 0.000 description 1
- 229960002170 Azathioprine Drugs 0.000 description 1
- BDJRBEYXGGNYIS-UHFFFAOYSA-N Azelaic acid Chemical compound OC(=O)CCCCCCCC(O)=O BDJRBEYXGGNYIS-UHFFFAOYSA-N 0.000 description 1
- MQTOSJVFKKJCRP-BICOPXKESA-N Azithromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)N(C)C[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 MQTOSJVFKKJCRP-BICOPXKESA-N 0.000 description 1
- WZPBZJONDBGPKJ-VEHQQRBSSA-N Aztreonam Chemical compound O=C1N(S([O-])(=O)=O)[C@@H](C)[C@@H]1NC(=O)C(=N/OC(C)(C)C(O)=O)\C1=CSC([NH3+])=N1 WZPBZJONDBGPKJ-VEHQQRBSSA-N 0.000 description 1
- 229960003644 Aztreonam Drugs 0.000 description 1
- 210000003719 B-Lymphocytes Anatomy 0.000 description 1
- 229960004689 BCG Vaccine Drugs 0.000 description 1
- 101710039869 BC_0920 Proteins 0.000 description 1
- 241000304886 Bacilli Species 0.000 description 1
- 229960003071 Bacitracin Drugs 0.000 description 1
- 108010001478 Bacitracin Proteins 0.000 description 1
- KPYSYYIEGFHWSV-UHFFFAOYSA-N Baclofen Chemical compound OC(=O)CC(CN)C1=CC=C(Cl)C=C1 KPYSYYIEGFHWSV-UHFFFAOYSA-N 0.000 description 1
- 229960000794 Baclofen Drugs 0.000 description 1
- 231100000699 Bacterial toxin Toxicity 0.000 description 1
- 210000004227 Basal Ganglia Anatomy 0.000 description 1
- 229960003619 Benazepril hydrochloride Drugs 0.000 description 1
- JUHORIMYRDESRB-UHFFFAOYSA-N Benzathine Chemical compound C=1C=CC=CC=1CNCCNCC1=CC=CC=C1 JUHORIMYRDESRB-UHFFFAOYSA-N 0.000 description 1
- BVGLIYRKPOITBQ-ANPZCEIESA-N Benzathine benzylpenicillin Chemical compound C=1C=CC=CC=1C[NH2+]CC[NH2+]CC1=CC=CC=C1.N([C@H]1[C@H]2SC([C@@H](N2C1=O)C([O-])=O)(C)C)C(=O)CC1=CC=CC=C1.N([C@H]1[C@H]2SC([C@@H](N2C1=O)C([O-])=O)(C)C)C(=O)CC1=CC=CC=C1 BVGLIYRKPOITBQ-ANPZCEIESA-N 0.000 description 1
- GIJXKZJWITVLHI-PMOLBWCYSA-N Benzatropine Chemical compound O([C@H]1C[C@H]2CC[C@@H](C1)N2C)C(C=1C=CC=CC=1)C1=CC=CC=C1 GIJXKZJWITVLHI-PMOLBWCYSA-N 0.000 description 1
- 229940050390 Benzoate Drugs 0.000 description 1
- 229940093239 Benztropine Drugs 0.000 description 1
- 229960004347 Betaxolol Hydrochloride Drugs 0.000 description 1
- 229960002123 Bethanechol Chloride Drugs 0.000 description 1
- 229960000749 Biperiden Hydrochloride Drugs 0.000 description 1
- ZREIPSZUJIFJNP-UHFFFAOYSA-K Bismuth subsalicylate Chemical compound C1=CC=C2O[Bi](O)OC(=O)C2=C1 ZREIPSZUJIFJNP-UHFFFAOYSA-K 0.000 description 1
- 229960005400 Bisoprolol Fumarate Drugs 0.000 description 1
- 229960004395 Bleomycin Sulfate Drugs 0.000 description 1
- 210000001124 Body Fluids Anatomy 0.000 description 1
- 208000003432 Bone Disease Diseases 0.000 description 1
- 239000004135 Bone phosphate Substances 0.000 description 1
- KGBXLFKZBHKPEV-UHFFFAOYSA-N Boric acid Chemical compound OB(O)O KGBXLFKZBHKPEV-UHFFFAOYSA-N 0.000 description 1
- 229960001724 Brimonidine tartrate Drugs 0.000 description 1
- 229960002802 Bromocriptine Drugs 0.000 description 1
- MAEIEVLCKWDQJH-UHFFFAOYSA-N Bumetanide Chemical compound CCCCNC1=CC(C(O)=O)=CC(S(N)(=O)=O)=C1OC1=CC=CC=C1 MAEIEVLCKWDQJH-UHFFFAOYSA-N 0.000 description 1
- 210000004375 Bundle of His Anatomy 0.000 description 1
- 229960001889 Buprenorphine hydrochloride Drugs 0.000 description 1
- 208000009899 Burkitt Lymphoma Diseases 0.000 description 1
- IFKLAQQSCNILHL-QHAWAJNXSA-N Butorphanol Chemical compound N1([C@@H]2CC3=CC=C(C=C3[C@@]3([C@]2(CCCC3)O)CC1)O)CC1CCC1 IFKLAQQSCNILHL-QHAWAJNXSA-N 0.000 description 1
- 229960001113 Butorphanol Drugs 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- 239000002947 C09CA04 - Irbesartan Substances 0.000 description 1
- 229960005084 CALCITRIOL Drugs 0.000 description 1
- QWOJMRHUQHTCJG-UHFFFAOYSA-N CC([CH2-])=O Chemical compound CC([CH2-])=O QWOJMRHUQHTCJG-UHFFFAOYSA-N 0.000 description 1
- 108010034751 CDP 571 Proteins 0.000 description 1
- 229960002129 CEFIXIME Drugs 0.000 description 1
- 101700083500 CTX1 Proteins 0.000 description 1
- OEYIOHPDSNJKLS-UHFFFAOYSA-N C[N+](C)(C)CCO Chemical compound C[N+](C)(C)CCO OEYIOHPDSNJKLS-UHFFFAOYSA-N 0.000 description 1
- JWUBBDSIWDLEOM-DTOXIADCSA-N Calcifediol Chemical compound C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@@H](CCCC(C)(C)O)C)=C\C=C1\C[C@@H](O)CCC1=C JWUBBDSIWDLEOM-DTOXIADCSA-N 0.000 description 1
- 235000021318 Calcifediol Nutrition 0.000 description 1
- 229960004015 Calcitonin Drugs 0.000 description 1
- 102400000113 Calcitonin Human genes 0.000 description 1
- 108060001064 Calcitonin Proteins 0.000 description 1
- 229960004494 Calcium Gluconate Drugs 0.000 description 1
- NEEHYRZPVYRGPP-IYEMJOQQSA-L Calcium gluconate Chemical compound [Ca+2].OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O.OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O NEEHYRZPVYRGPP-IYEMJOQQSA-L 0.000 description 1
- MKJXYGKVIBWPFZ-UHFFFAOYSA-L Calcium lactate Chemical compound [Ca+2].CC(O)C([O-])=O.CC(O)C([O-])=O MKJXYGKVIBWPFZ-UHFFFAOYSA-L 0.000 description 1
- GHOSNRCGJFBJIB-UHFFFAOYSA-N Candesartan cilexetil Chemical compound C=12N(CC=3C=CC(=CC=3)C=3C(=CC=CC=3)C3=NNN=N3)C(OCC)=NC2=CC=CC=1C(=O)OC(C)OC(=O)OC1CCCCC1 GHOSNRCGJFBJIB-UHFFFAOYSA-N 0.000 description 1
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 1
- 229960004117 Capecitabine Drugs 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- FAKRSMQSSFJEIM-RQJHMYQMSA-N Captopril Chemical compound SC[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O FAKRSMQSSFJEIM-RQJHMYQMSA-N 0.000 description 1
- FFGPTBGBLSHEPO-UHFFFAOYSA-N Carbamazepine Chemical compound C1=CC2=CC=CC=C2N(C(=O)N)C2=CC=CC=C21 FFGPTBGBLSHEPO-UHFFFAOYSA-N 0.000 description 1
- 239000004215 Carbon black (E152) Substances 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-N Carbonic acid Chemical compound OC(O)=O BVKZGUZCCUSVTD-UHFFFAOYSA-N 0.000 description 1
- PFKFTWBEEFSNDU-UHFFFAOYSA-N Carbonyldiimidazole Chemical compound C1=CN=CN1C(=O)N1C=CN=C1 PFKFTWBEEFSNDU-UHFFFAOYSA-N 0.000 description 1
- 206010007554 Cardiac failure Diseases 0.000 description 1
- 206010007559 Cardiac failure congestive Diseases 0.000 description 1
- 208000000135 Cardiovascular Syphilis Diseases 0.000 description 1
- OFZCIYFFPZCNJE-UHFFFAOYSA-N Carisoprodol Chemical compound NC(=O)OCC(C)(CCC)COC(=O)NC(C)C OFZCIYFFPZCNJE-UHFFFAOYSA-N 0.000 description 1
- 229960004587 Carisoprodol Drugs 0.000 description 1
- NPAKNKYSJIDKMW-UHFFFAOYSA-N Carvedilol Chemical compound COC1=CC=CC=C1OCCNCC(O)COC1=CC=CC2=NC3=CC=C[CH]C3=C12 NPAKNKYSJIDKMW-UHFFFAOYSA-N 0.000 description 1
- AHOUBRCZNHFOSL-YOEHRIQHSA-N Casbol Chemical compound C1=CC(F)=CC=C1[C@H]1[C@H](COC=2C=C3OCOC3=CC=2)CNCC1 AHOUBRCZNHFOSL-YOEHRIQHSA-N 0.000 description 1
- 102000011632 Caseins Human genes 0.000 description 1
- 108010076119 Caseins Proteins 0.000 description 1
- 235000006693 Cassia laevigata Nutrition 0.000 description 1
- 244000025596 Cassia laevigata Species 0.000 description 1
- 229960005361 Cefaclor Drugs 0.000 description 1
- 229960004841 Cefadroxil Drugs 0.000 description 1
- ZAIPMKNFIOOWCQ-UEKVPHQBSA-N Cefalexin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)C)C(O)=O)=CC=CC=C1 ZAIPMKNFIOOWCQ-UEKVPHQBSA-N 0.000 description 1
- 229960003408 Cefazolin Sodium Drugs 0.000 description 1
- HVFLCNVBZFFHBT-ZKDACBOMSA-N Cefepime Chemical compound S([C@@H]1[C@@H](C(N1C=1C([O-])=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1C[N+]1(C)CCCC1 HVFLCNVBZFFHBT-ZKDACBOMSA-N 0.000 description 1
- OKBVVJOGVLARMR-QSWIMTSFSA-N Cefixime Chemical compound S1C(N)=NC(C(=N\OCC(O)=O)\C(=O)N[C@@H]2C(N3C(=C(C=C)CS[C@@H]32)C(O)=O)=O)=C1 OKBVVJOGVLARMR-QSWIMTSFSA-N 0.000 description 1
- 229960002417 Cefoperazone Sodium Drugs 0.000 description 1
- WYUSVOMTXWRGEK-HBWVYFAYSA-N Cefpodoxime Chemical compound N([C@H]1[C@@H]2N(C1=O)C(=C(CS2)COC)C(O)=O)C(=O)C(=N/OC)\C1=CSC(N)=N1 WYUSVOMTXWRGEK-HBWVYFAYSA-N 0.000 description 1
- RDLPVSKMFDYCOR-UEKVPHQBSA-N Cefradine Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)C)C(O)=O)=CCC=CC1 RDLPVSKMFDYCOR-UEKVPHQBSA-N 0.000 description 1
- 229960002588 Cefradine Drugs 0.000 description 1
- 229960000484 Ceftazidime Drugs 0.000 description 1
- 229960000636 Ceftizoxime Sodium Drugs 0.000 description 1
- 229960000479 Ceftriaxone Sodium Drugs 0.000 description 1
- 229960000534 Cefuroxime sodium Drugs 0.000 description 1
- RZEKVGVHFLEQIL-UHFFFAOYSA-N Celecoxib Chemical compound C1=CC(C)=CC=C1C1=CC(C(F)(F)F)=NN1C1=CC=C(S(N)(=O)=O)C=C1 RZEKVGVHFLEQIL-UHFFFAOYSA-N 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 229940047526 Cephalexin Monohydrate Drugs 0.000 description 1
- 229940106192 Cephradine Drugs 0.000 description 1
- 206010008531 Chills Diseases 0.000 description 1
- 229920002101 Chitin Polymers 0.000 description 1
- 229920001661 Chitosan Polymers 0.000 description 1
- 229960004630 Chlorambucil Drugs 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N Chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 229960004782 Chlordiazepoxide Drugs 0.000 description 1
- ANTSCNMPPGJYLG-UHFFFAOYSA-N Chlordiazepoxide Chemical compound O=N=1CC(NC)=NC2=CC=C(Cl)C=C2C=1C1=CC=CC=C1 ANTSCNMPPGJYLG-UHFFFAOYSA-N 0.000 description 1
- 229960004725 Chlordiazepoxide Hydrochloride Drugs 0.000 description 1
- 229960004926 Chlorobutanol Drugs 0.000 description 1
- OSASVXMJTNOKOY-UHFFFAOYSA-N Chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 1
- 229940107080 Chlorpheniramine Drugs 0.000 description 1
- 229960001761 Chlorpropamide Drugs 0.000 description 1
- JIVPVXMEBJLZRO-UHFFFAOYSA-N Chlortalidone Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC(C2(O)C3=CC=CC=C3C(=O)N2)=C1 JIVPVXMEBJLZRO-UHFFFAOYSA-N 0.000 description 1
- 229940107084 Chlorthalidone Drugs 0.000 description 1
- TZFWDZFKRBELIQ-UHFFFAOYSA-N Chlorzoxazone Chemical compound ClC1=CC=C2OC(O)=NC2=C1 TZFWDZFKRBELIQ-UHFFFAOYSA-N 0.000 description 1
- 229960003633 Chlorzoxazone Drugs 0.000 description 1
- 229940107111 Cholecalciferol Drugs 0.000 description 1
- 229960005004 Cholera Vaccine Drugs 0.000 description 1
- 229940107161 Cholesterol Drugs 0.000 description 1
- 229960001231 Choline Drugs 0.000 description 1
- 229960000724 Cidofovir Drugs 0.000 description 1
- VWFCHDSQECPREK-LURJTMIESA-N Cidofovirum Chemical compound NC=1C=CN(C[C@@H](CO)OCP(O)(O)=O)C(=O)N=1 VWFCHDSQECPREK-LURJTMIESA-N 0.000 description 1
- 229960001380 Cimetidine Drugs 0.000 description 1
- CCGSUNCLSOWKJO-UHFFFAOYSA-N Cimetidine Chemical compound N#CNC(=N/C)\NCCSCC1=NC=N[C]1C CCGSUNCLSOWKJO-UHFFFAOYSA-N 0.000 description 1
- 229960001229 Ciprofloxacin Hydrochloride Drugs 0.000 description 1
- 229940001468 Citrate Drugs 0.000 description 1
- MXECDIYZUGKBTI-UHFFFAOYSA-N Cl.NC(=O)NO Chemical compound Cl.NC(=O)NO MXECDIYZUGKBTI-UHFFFAOYSA-N 0.000 description 1
- PTOAARAWEBMLNO-KVQBGUIXSA-N Cladribine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 PTOAARAWEBMLNO-KVQBGUIXSA-N 0.000 description 1
- HEMJJKBWTPKOJG-UHFFFAOYSA-N Clearol Chemical compound CC1=CC=C(C)C(OCCCC(C)(C)C(O)=O)=C1 HEMJJKBWTPKOJG-UHFFFAOYSA-N 0.000 description 1
- 229960002689 Clemastine Fumarate Drugs 0.000 description 1
- KDLRVYVGXIQJDK-AWPVFWJPSA-N Clindamycin Chemical compound CN1C[C@H](CCC)C[C@H]1C(=O)N[C@H]([C@H](C)Cl)[C@@H]1[C@H](O)[C@H](O)[C@@H](O)[C@@H](SC)O1 KDLRVYVGXIQJDK-AWPVFWJPSA-N 0.000 description 1
- 229960001200 Clindamycin Hydrochloride Drugs 0.000 description 1
- WDQPAMHFFCXSNU-BGABXYSRSA-N Clofazimine Chemical compound C12=CC=CC=C2N=C2C=C(NC=3C=CC(Cl)=CC=3)C(=N/C(C)C)/C=C2N1C1=CC=C(Cl)C=C1 WDQPAMHFFCXSNU-BGABXYSRSA-N 0.000 description 1
- GDLIGKIOYRNHDA-UHFFFAOYSA-N Clomipramine Chemical compound C1CC2=CC=C(Cl)C=C2N(CCCN(C)C)C2=CC=CC=C21 GDLIGKIOYRNHDA-UHFFFAOYSA-N 0.000 description 1
- 229960001564 Clomipramine Hydrochloride Drugs 0.000 description 1
- DGBIGWXXNGSACT-UHFFFAOYSA-N Clonazepam Chemical compound C12=CC([N+](=O)[O-])=CC=C2NC(=O)CN=C1C1=CC=CC=C1Cl DGBIGWXXNGSACT-UHFFFAOYSA-N 0.000 description 1
- 229960003958 Clopidogrel bisulfate Drugs 0.000 description 1
- 241000193163 Clostridioides difficile Species 0.000 description 1
- 241000193403 Clostridium Species 0.000 description 1
- 241000193155 Clostridium botulinum Species 0.000 description 1
- 229940038704 Clostridium perfringens Drugs 0.000 description 1
- 241000193468 Clostridium perfringens Species 0.000 description 1
- 229960003026 Cloxacillin Sodium Drugs 0.000 description 1
- QZUDBNBUXVUHMW-UHFFFAOYSA-N Clozapine Chemical compound C1CN(C)CCN1C1=NC2=CC(Cl)=CC=C2NC2=CC=CC=C12 QZUDBNBUXVUHMW-UHFFFAOYSA-N 0.000 description 1
- 210000001072 Colon Anatomy 0.000 description 1
- 206010010356 Congenital anomaly Diseases 0.000 description 1
- 206010010445 Congenital disorder Diseases 0.000 description 1
- 206010056370 Congestive cardiomyopathy Diseases 0.000 description 1
- 108010060123 Conjugate Vaccines Proteins 0.000 description 1
- 210000000795 Conjunctiva Anatomy 0.000 description 1
- 210000004087 Cornea Anatomy 0.000 description 1
- MFYSYFVPBJMHGN-ZPOLXVRWSA-N Cortisone Chemical compound O=C1CC[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 MFYSYFVPBJMHGN-ZPOLXVRWSA-N 0.000 description 1
- 241000557626 Corvus corax Species 0.000 description 1
- 229940108999 Cosyntropin Drugs 0.000 description 1
- 108010091893 Cosyntropin Proteins 0.000 description 1
- 229940120894 Cromolyn Sodium Drugs 0.000 description 1
- DNTGGZPQPQTDQF-XBXARRHUSA-N Crotamiton Chemical compound C/C=C/C(=O)N(CC)C1=CC=CC=C1C DNTGGZPQPQTDQF-XBXARRHUSA-N 0.000 description 1
- 206010011703 Cyanosis Diseases 0.000 description 1
- 208000000280 Cyclic neutropenia Diseases 0.000 description 1
- 229960000500 Cyclobenzaprine hydrochloride Drugs 0.000 description 1
- 229920000858 Cyclodextrin Polymers 0.000 description 1
- 229940097362 Cyclodextrins Drugs 0.000 description 1
- 229960000710 Cyclopentolate hydrochloride Drugs 0.000 description 1
- 229960004397 Cyclophosphamide Drugs 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- 229960000684 Cytarabine Drugs 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytosar Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- GZCGUPFRVQAUEE-KCDKBNATSA-N D-(+)-Galactose Natural products OC[C@@H](O)[C@H](O)[C@H](O)[C@@H](O)C=O GZCGUPFRVQAUEE-KCDKBNATSA-N 0.000 description 1
- GUBGYTABKSRVRQ-CUHNMECISA-N D-Cellobiose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-CUHNMECISA-N 0.000 description 1
- DYDCUQKUCUHJBH-UWTATZPHSA-N D-cycloserine Chemical compound N[C@@H]1CONC1=O DYDCUQKUCUHJBH-UWTATZPHSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- QIVBCDIJIAJPQS-SECBINFHSA-N D-tryptophane Chemical compound C1=CC=C2C(C[C@@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-SECBINFHSA-N 0.000 description 1
- STQGQHZAVUOBTE-VGBVRHCVSA-N DAUNOMYCIN Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 1
- 229940030606 DIURETICS Drugs 0.000 description 1
- CKLJMWTZIZZHCS-UHFFFAOYSA-N DL-aspartic acid Chemical compound OC(=O)C(N)CC(O)=O CKLJMWTZIZZHCS-UHFFFAOYSA-N 0.000 description 1
- 229960004082 DOXYCYCLINE HYDROCHLORIDE Drugs 0.000 description 1
- 101700011961 DPOM Proteins 0.000 description 1
- 229960000640 Dactinomycin Drugs 0.000 description 1
- 108010092160 Dactinomycin Proteins 0.000 description 1
- 229940018872 Dalteparin Sodium Drugs 0.000 description 1
- 229960004776 Danaparoid sodium Drugs 0.000 description 1
- POZRVZJJTULAOH-LHZXLZLDSA-N Danazol Chemical compound C1[C@]2(C)[C@H]3CC[C@](C)([C@](CC4)(O)C#C)[C@@H]4[C@@H]3CCC2=CC2=C1C=NO2 POZRVZJJTULAOH-LHZXLZLDSA-N 0.000 description 1
- 229960000860 Dapsone Drugs 0.000 description 1
- 229960003109 Daunorubicin Hydrochloride Drugs 0.000 description 1
- 229940041983 Daunorubicin Liposomal Drugs 0.000 description 1
- 229960000475 Delavirdine Mesylate Drugs 0.000 description 1
- 229960005104 Demeclocycline Hydrochloride Drugs 0.000 description 1
- 206010012310 Dengue fever Diseases 0.000 description 1
- 206010044037 Dental disorder Diseases 0.000 description 1
- 229960003829 Desipramine Hydrochloride Drugs 0.000 description 1
- AKUJBENLRBOFTD-RPRRAYFGSA-N Dexamethasone acetate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)COC(C)=O)(O)[C@@]1(C)C[C@@H]2O AKUJBENLRBOFTD-RPRRAYFGSA-N 0.000 description 1
- 229960004833 Dexamethasone phosphate Drugs 0.000 description 1
- 229960002344 Dexamethasone sodium phosphate Drugs 0.000 description 1
- SOYKEARSMXGVTM-HNNXBMFYSA-N Dexchlorpheniramine Chemical compound C1([C@H](CCN(C)C)C=2N=CC=CC=2)=CC=C(Cl)C=C1 SOYKEARSMXGVTM-HNNXBMFYSA-N 0.000 description 1
- MJIHNNLFOKEZEW-UHFFFAOYSA-N Dexlansoprazole Chemical compound CC1=C(OCC(F)(F)F)C=CN=C1CS(=O)C1=NC2=CC=CC=C2N1 MJIHNNLFOKEZEW-UHFFFAOYSA-N 0.000 description 1
- 229940119751 Dextroamphetamine Sulfate Drugs 0.000 description 1
- MQJKPEGWNLWLTK-UHFFFAOYSA-N Di(p-aminophenyl)sulphone Chemical compound C1=CC(N)=CC=C1S(=O)(=O)C1=CC=C(N)C=C1 MQJKPEGWNLWLTK-UHFFFAOYSA-N 0.000 description 1
- PXBRQCKWGAHEHS-UHFFFAOYSA-N Dichlorodifluoromethane Chemical compound FC(F)(Cl)Cl PXBRQCKWGAHEHS-UHFFFAOYSA-N 0.000 description 1
- 239000004338 Dichlorodifluoromethane Substances 0.000 description 1
- JZUFKLXOESDKRF-UHFFFAOYSA-N Dichlothiazide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC2=C1NCNS2(=O)=O JZUFKLXOESDKRF-UHFFFAOYSA-N 0.000 description 1
- 229960004060 Dicloxacillin Sodium Drugs 0.000 description 1
- 229940110321 Dicyclomine Hydrochloride Drugs 0.000 description 1
- 229960002777 Dicycloverine Drugs 0.000 description 1
- HUPFGZXOMWLGNK-UHFFFAOYSA-N Diflunisal Chemical compound C1=C(O)C(C(=O)O)=CC(C=2C(=CC(F)=CC=2)F)=C1 HUPFGZXOMWLGNK-UHFFFAOYSA-N 0.000 description 1
- LTMHDMANZUZIPE-PUGKRICDSA-N Digoxin Chemical compound C1[C@H](O)[C@H](O)[C@@H](C)O[C@H]1O[C@@H]1[C@@H](C)O[C@@H](O[C@@H]2[C@H](O[C@@H](O[C@@H]3C[C@@H]4[C@]([C@@H]5[C@H]([C@]6(CC[C@@H]([C@@]6(C)[C@H](O)C5)C=5COC(=O)C=5)O)CC4)(C)CC3)C[C@@H]2O)C)C[C@@H]1O LTMHDMANZUZIPE-PUGKRICDSA-N 0.000 description 1
- LTMHDMANZUZIPE-AMTYYWEZSA-N Digoxin Natural products O([C@H]1[C@H](C)O[C@H](O[C@@H]2C[C@@H]3[C@@](C)([C@@H]4[C@H]([C@]5(O)[C@](C)([C@H](O)C4)[C@H](C4=CC(=O)OC4)CC5)CC3)CC2)C[C@@H]1O)[C@H]1O[C@H](C)[C@@H](O[C@H]2O[C@@H](C)[C@H](O)[C@@H](O)C2)[C@@H](O)C1 LTMHDMANZUZIPE-AMTYYWEZSA-N 0.000 description 1
- 229960000807 Dihydroergotamine Mesylate Drugs 0.000 description 1
- 229960004993 Dimenhydrinate Drugs 0.000 description 1
- MCWXGJITAZMZEV-UHFFFAOYSA-N Dimethoate Chemical compound CNC(=O)CSP(=S)(OC)OC MCWXGJITAZMZEV-UHFFFAOYSA-N 0.000 description 1
- 229960001188 Diphtheria Antitoxin Drugs 0.000 description 1
- 108010050169 Diphtheria Antitoxin Proteins 0.000 description 1
- 102000016607 Diphtheria Toxin Human genes 0.000 description 1
- 108010053187 Diphtheria Toxin Proteins 0.000 description 1
- 229940090570 Dipivefrin hydrochloride Drugs 0.000 description 1
- 229960002768 Dipyridamole Drugs 0.000 description 1
- IZEKFCXSFNUWAM-UHFFFAOYSA-N Dipyridamole Chemical compound C=12N=C(N(CCO)CCO)N=C(N3CCCCC3)C2=NC(N(CCO)CCO)=NC=1N1CCCCC1 IZEKFCXSFNUWAM-UHFFFAOYSA-N 0.000 description 1
- UVTNFZQICZKOEM-UHFFFAOYSA-N Disopyramide Chemical compound C=1C=CC=NC=1C(C(N)=O)(CCN(C(C)C)C(C)C)C1=CC=CC=C1 UVTNFZQICZKOEM-UHFFFAOYSA-N 0.000 description 1
- 229960001863 Disopyramide Phosphate Drugs 0.000 description 1
- 229940028937 Divalproex Sodium Drugs 0.000 description 1
- 229960001654 Dobutamine Hydrochloride Drugs 0.000 description 1
- DGXRZJSPDXZJFG-UHFFFAOYSA-N Docosanedioic acid Chemical compound OC(=O)CCCCCCCCCCCCCCCCCCCCC(O)=O DGXRZJSPDXZJFG-UHFFFAOYSA-N 0.000 description 1
- 229960003135 Donepezil hydrochloride Drugs 0.000 description 1
- 229960001149 Dopamine Hydrochloride Drugs 0.000 description 1
- 102000015554 Dopamine receptor family Human genes 0.000 description 1
- 108050004812 Dopamine receptor family Proteins 0.000 description 1
- 229940075057 Doral Drugs 0.000 description 1
- 229960002506 Dorzolamide hydrochloride Drugs 0.000 description 1
- 201000010374 Down syndrome Diseases 0.000 description 1
- 229960003450 Doxacurium Chloride Drugs 0.000 description 1
- APADFLLAXHIMFU-LGIHQUBZSA-L Doxacurium chloride Chemical compound [Cl-].[Cl-].COC1=C(OC)C(OC)=CC(C[C@@H]2[N@@+](CCC3=C2C(=C(OC)C(OC)=C3)OC)(C)CCCOC(=O)CCC(=O)OCCC[N@@+]2(C)[C@@H](C3=C(OC)C(OC)=C(OC)C=C3CC2)CC=2C=C(OC)C(OC)=C(OC)C=2)=C1 APADFLLAXHIMFU-LGIHQUBZSA-L 0.000 description 1
- 229960003891 Doxapram Hydrochloride Drugs 0.000 description 1
- 229960000220 Doxazosin Mesylate Drugs 0.000 description 1
- HKXBNHCUPKIYDM-CGMHZMFXSA-N Doxercalciferol Chemical compound C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)/C=C/[C@H](C)C(C)C)=C\C=C1\C[C@@H](O)C[C@H](O)C1=C HKXBNHCUPKIYDM-CGMHZMFXSA-N 0.000 description 1
- 229960004679 Doxorubicin Drugs 0.000 description 1
- 229960002918 Doxorubicin Hydrochloride Drugs 0.000 description 1
- 229960004434 Doxycycline Monohydrate Drugs 0.000 description 1
- CYQFCXCEBYINGO-DLBZAZTESA-N Dronabinol Natural products C1=C(C)CC[C@H]2C(C)(C)OC3=CC(CCCCC)=CC(O)=C3[C@H]21 CYQFCXCEBYINGO-DLBZAZTESA-N 0.000 description 1
- RMEDXOLNCUSCGS-UHFFFAOYSA-N Droperidol Chemical compound C1=CC(F)=CC=C1C(=O)CCCN1CC=C(N2C(NC3=CC=CC=C32)=O)CC1 RMEDXOLNCUSCGS-UHFFFAOYSA-N 0.000 description 1
- 229960000394 Droperidol Drugs 0.000 description 1
- 229940112141 Dry Powder Inhaler Drugs 0.000 description 1
- 241001269524 Dura Species 0.000 description 1
- 229940022766 EGTA Drugs 0.000 description 1
- 101700032127 ETX1 Proteins 0.000 description 1
- 101700029730 ETX2 Proteins 0.000 description 1
- 229960003645 Econazole Nitrate Drugs 0.000 description 1
- 229950008913 Edisilate Drugs 0.000 description 1
- 229960003748 Edrophonium Drugs 0.000 description 1
- VWLHWLSRQJQWRG-UHFFFAOYSA-O Edrophonum Chemical compound CC[N+](C)(C)C1=CC=CC(O)=C1 VWLHWLSRQJQWRG-UHFFFAOYSA-O 0.000 description 1
- XPOQHMRABVBWPR-ZDUSSCGKSA-N Efavirenz Chemical compound C([C@]1(C2=CC(Cl)=CC=C2NC(=O)O1)C(F)(F)F)#CC1CC1 XPOQHMRABVBWPR-ZDUSSCGKSA-N 0.000 description 1
- 229960000309 Enalapril Maleate Drugs 0.000 description 1
- LZFZMUMEGBBDTC-QEJZJMRPSA-N Enalaprilat Chemical compound C([C@H](N[C@@H](C)C(=O)N1[C@@H](CCC1)C(O)=O)C(O)=O)CC1=CC=CC=C1 LZFZMUMEGBBDTC-QEJZJMRPSA-N 0.000 description 1
- 108010066671 Enalaprilat Proteins 0.000 description 1
- 206010014599 Encephalitis Diseases 0.000 description 1
- 206010014665 Endocarditis Diseases 0.000 description 1
- 206010014698 Endocrine disease Diseases 0.000 description 1
- 108010042407 Endonucleases Proteins 0.000 description 1
- 210000002889 Endothelial Cells Anatomy 0.000 description 1
- 229960005153 Enoxaparin sodium Drugs 0.000 description 1
- 210000002409 Epiglottis Anatomy 0.000 description 1
- CXOFVDLJLONNDW-UHFFFAOYSA-N Epinat Chemical compound N1C(=O)NC(=O)C1(C=1C=CC=CC=1)C1=CC=CC=C1 CXOFVDLJLONNDW-UHFFFAOYSA-N 0.000 description 1
- 229960003265 Epirubicin Hydrochloride Drugs 0.000 description 1
- 229960000573 Eprosartan mesylate Drugs 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 229960002061 Ergocalciferol Drugs 0.000 description 1
- 229960001903 Ergotamine Tartrate Drugs 0.000 description 1
- 229960001015 Esmolol hydrochloride Drugs 0.000 description 1
- SUBDBMMJDZJVOS-UHFFFAOYSA-N Esomeprazole Chemical compound N=1C2=CC(OC)=CC=C2NC=1S(=O)CC1=NC=C(C)C(OC)=C1C SUBDBMMJDZJVOS-UHFFFAOYSA-N 0.000 description 1
- 229960002336 Estazolam Drugs 0.000 description 1
- CDCHDCWJMGXXRH-UHFFFAOYSA-N Estazolam Chemical compound C=1C(Cl)=CC=C(N2C=NN=C2CN=2)C=1C=2C1=CC=CC=C1 CDCHDCWJMGXXRH-UHFFFAOYSA-N 0.000 description 1
- RSEPBGGWRJCQGY-RBRWEJTLSA-N Estradiol valerate Chemical compound C1CC2=CC(O)=CC=C2[C@@H]2[C@@H]1[C@@H]1CC[C@H](OC(=O)CCCC)[C@@]1(C)CC2 RSEPBGGWRJCQGY-RBRWEJTLSA-N 0.000 description 1
- 229940011871 Estrogens Drugs 0.000 description 1
- 108010008165 Etanercept Proteins 0.000 description 1
- HAPOVYFOVVWLRS-UHFFFAOYSA-N Ethosuximide Chemical compound CCC1(C)CC(=O)NC1=O HAPOVYFOVVWLRS-UHFFFAOYSA-N 0.000 description 1
- 229960002767 Ethosuximide Drugs 0.000 description 1
- ONKUMRGIYFNPJW-KIEAKMPYSA-N Etynodiol diacetate Chemical compound C1C[C@]2(C)[C@@](C#C)(OC(C)=O)CC[C@H]2[C@@H]2CCC3=C[C@@H](OC(=O)C)CC[C@@H]3[C@H]21 ONKUMRGIYFNPJW-KIEAKMPYSA-N 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 208000010201 Exanthema Diseases 0.000 description 1
- 231100000776 Exotoxin Toxicity 0.000 description 1
- 229940066493 Expectorants Drugs 0.000 description 1
- 206010015832 Extrapyramidal disease Diseases 0.000 description 1
- 102100000368 F8 Human genes 0.000 description 1
- 101700070229 F8 Proteins 0.000 description 1
- 239000001263 FEMA 3042 Substances 0.000 description 1
- 230000035693 Fab Effects 0.000 description 1
- 108010076282 Factor IX Proteins 0.000 description 1
- XUFQPHANEAPEMJ-UHFFFAOYSA-N Famotidine Chemical compound NC(N)=NC1=NC(CSCCC(N)=NS(N)(=O)=O)=CS1 XUFQPHANEAPEMJ-UHFFFAOYSA-N 0.000 description 1
- 229960001596 Famotidine Drugs 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- RZTAMFZIAATZDJ-UHFFFAOYSA-N Felodipine Chemical compound CCOC(=O)C1=C(C)NC(C)=C(C(=O)OC)C1C1=CC=CC(Cl)=C1Cl RZTAMFZIAATZDJ-UHFFFAOYSA-N 0.000 description 1
- 229960003580 Felodipine Drugs 0.000 description 1
- YMTINGFKWWXKFG-UHFFFAOYSA-N Fenofibrate Chemical compound C1=CC(OC(C)(C)C(=O)OC(C)C)=CC=C1C(=O)C1=CC=C(Cl)C=C1 YMTINGFKWWXKFG-UHFFFAOYSA-N 0.000 description 1
- 229960002297 Fenofibrate Drugs 0.000 description 1
- TVURRHSHRRELCG-UHFFFAOYSA-N Fenoldopam Chemical compound C1=CC(O)=CC=C1C1C2=CC(O)=C(O)C(Cl)=C2CCNC1 TVURRHSHRRELCG-UHFFFAOYSA-N 0.000 description 1
- 229960004009 Fenoldopam Mesylate Drugs 0.000 description 1
- 229960002428 Fentanyl Drugs 0.000 description 1
- 229960004207 Fentanyl Citrate Drugs 0.000 description 1
- 229940089386 Fentanyl Transdermal System Drugs 0.000 description 1
- 210000003754 Fetus Anatomy 0.000 description 1
- RWTNPBWLLIMQHL-UHFFFAOYSA-N Fexofenadine Chemical compound C1=CC(C(C)(C(O)=O)C)=CC=C1C(O)CCCN1CCC(C(O)(C=2C=CC=CC=2)C=2C=CC=CC=2)CC1 RWTNPBWLLIMQHL-UHFFFAOYSA-N 0.000 description 1
- 229960000354 Fexofenadine hydrochloride Drugs 0.000 description 1
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N Floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 1
- 229960000961 Floxuridine Drugs 0.000 description 1
- RFHAOTPXVQNOHP-UHFFFAOYSA-N Fluconazole Chemical compound C1=NC=NN1CC(C=1C(=CC(F)=CC=1)F)(O)CN1C=NC=N1 RFHAOTPXVQNOHP-UHFFFAOYSA-N 0.000 description 1
- AAXVEMMRQDVLJB-BULBTXNYSA-N Fludrocortisone Chemical compound O=C1CC[C@]2(C)[C@@]3(F)[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 AAXVEMMRQDVLJB-BULBTXNYSA-N 0.000 description 1
- 229960002011 Fludrocortisone Drugs 0.000 description 1
- POPFMWWJOGLOIF-XWCQMRHXSA-N Fludroxycortide Chemical compound C1([C@@H](F)C2)=CC(=O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]2(C)C[C@@H]1O POPFMWWJOGLOIF-XWCQMRHXSA-N 0.000 description 1
- 229960001347 Fluocinolone Acetonide Drugs 0.000 description 1
- FEBLZLNTKCEFIT-VSXGLTOVSA-N Fluocinolone acetonide Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]2(C)C[C@@H]1O FEBLZLNTKCEFIT-VSXGLTOVSA-N 0.000 description 1
- WJOHZNCJWYWUJD-IUGZLZTKSA-N Fluocinonide Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)COC(=O)C)[C@@]2(C)C[C@@H]1O WJOHZNCJWYWUJD-IUGZLZTKSA-N 0.000 description 1
- FAOZLTXFLGPHNG-KNAQIMQKSA-N Fluorometholone Chemical compound C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@]2(F)[C@@H](O)C[C@]2(C)[C@@](O)(C(C)=O)CC[C@H]21 FAOZLTXFLGPHNG-KNAQIMQKSA-N 0.000 description 1
- 229960002949 Fluorouracil Drugs 0.000 description 1
- 229940013644 Flurandrenolide Drugs 0.000 description 1
- SAADBVWGJQAEFS-UHFFFAOYSA-N Flurazepam Chemical compound N=1CC(=O)N(CCN(CC)CC)C2=CC=C(Cl)C=C2C=1C1=CC=CC=C1F SAADBVWGJQAEFS-UHFFFAOYSA-N 0.000 description 1
- 229960003628 Flurazepam Hydrochloride Drugs 0.000 description 1
- 229960003898 Flurbiprofen sodium Drugs 0.000 description 1
- MGNNYOODZCAHBA-GQKYHHCASA-N Fluticasone Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@@H](C)[C@@](C(=O)SCF)(O)[C@@]2(C)C[C@@H]1O MGNNYOODZCAHBA-GQKYHHCASA-N 0.000 description 1
- WMWTYOKRWGGJOA-CENSZEJFSA-N Fluticasone propionate Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@@H](C)[C@@](C(=O)SCF)(OC(=O)CC)[C@@]2(C)C[C@@H]1O WMWTYOKRWGGJOA-CENSZEJFSA-N 0.000 description 1
- 229960000868 Fluvastatin sodium Drugs 0.000 description 1
- 229960002107 Fluvoxamine Maleate Drugs 0.000 description 1
- 229960000304 Folic Acid Drugs 0.000 description 1
- DLKYYJFLRUUGHJ-SSJCJZGYSA-A Fomivirsen sodium Chemical compound [Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](COP([O-])(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP([O-])(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP([O-])(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP([O-])(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP([O-])(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP([O-])(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP([O-])(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP([O-])(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP([O-])(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP([O-])(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP([O-])(=S)O[C@@H]2[C@H](O[C@H](C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP([O-])(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP([O-])(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP([O-])(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP([O-])(=S)O[C@@H]2[C@H](O[C@H](C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP([S-])(=O)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP([O-])(=S)O[C@@H]2[C@H](O[C@H](C2)N2C3=C(C(NC(N)=N3)=O)N=C2)CO)[C@@H](OP([O-])(=S)OC[C@@H]2[C@H](C[C@@H](O2)N2C3=C(C(NC(N)=N3)=O)N=C2)OP([O-])(=S)OC[C@@H]2[C@H](C[C@@H](O2)N2C(N=C(N)C=C2)=O)OP([O-])(=S)OC[C@@H]2[C@H](C[C@@H](O2)N2C3=C(C(NC(N)=N3)=O)N=C2)O)C1 DLKYYJFLRUUGHJ-SSJCJZGYSA-A 0.000 description 1
- 206010017374 Friedreich's ataxia Diseases 0.000 description 1
- 239000005715 Fructose Substances 0.000 description 1
- ZZUFCTLCJUWOSV-UHFFFAOYSA-N Furosemide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC(C(O)=O)=C1NCC1=CC=CO1 ZZUFCTLCJUWOSV-UHFFFAOYSA-N 0.000 description 1
- 229960003883 Furosemide Drugs 0.000 description 1
- 229960004580 GLIBENCLAMIDE Drugs 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 229960002963 Ganciclovir Drugs 0.000 description 1
- IRSCQMHQWWYFCW-UHFFFAOYSA-N Ganciclovir Chemical compound O=C1NC(N)=NC2=C1N=CN2COC(CO)CO IRSCQMHQWWYFCW-UHFFFAOYSA-N 0.000 description 1
- 208000008665 Gastrointestinal Disease Diseases 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- 108010072051 Glatiramer Acetate Proteins 0.000 description 1
- ZNNLBTZKUZBEKO-UHFFFAOYSA-N Glibenclamide Chemical compound COC1=CC=C(Cl)C=C1C(=O)NCCC1=CC=C(S(=O)(=O)NC(=O)NC2CCCCC2)C=C1 ZNNLBTZKUZBEKO-UHFFFAOYSA-N 0.000 description 1
- WIGIZIANZCJQQY-RUCARUNLSA-N Glimepiride Chemical compound O=C1C(CC)=C(C)CN1C(=O)NCCC1=CC=C(S(=O)(=O)NC(=O)N[C@@H]2CC[C@@H](C)CC2)C=C1 WIGIZIANZCJQQY-RUCARUNLSA-N 0.000 description 1
- ZJJXGWJIGJFDTL-UHFFFAOYSA-N Glipizide Chemical compound C1=NC(C)=CN=C1C(=O)NCCC1=CC=C(S(=O)(=O)NC(=O)NC2CCCCC2)C=C1 ZJJXGWJIGJFDTL-UHFFFAOYSA-N 0.000 description 1
- 229960001381 Glipizide Drugs 0.000 description 1
- FAEKWTJYAYMJKF-QHCPKHFHSA-N GlucoNorm Chemical compound C1=C(C(O)=O)C(OCC)=CC(CC(=O)N[C@@H](CC(C)C)C=2C(=CC=CC=2)N2CCCCC2)=C1 FAEKWTJYAYMJKF-QHCPKHFHSA-N 0.000 description 1
- 229960002989 Glutamic Acid Drugs 0.000 description 1
- 229940014653 Glyburide Drugs 0.000 description 1
- 229940015042 Glycopyrrolate Drugs 0.000 description 1
- VPNYRYCIDCJBOM-UHFFFAOYSA-M Glycopyrronium bromide Chemical compound [Br-].C1[N+](C)(C)CCC1OC(=O)C(O)(C=1C=CC=CC=1)C1CCCC1 VPNYRYCIDCJBOM-UHFFFAOYSA-M 0.000 description 1
- 102400000932 Gonadoliberin-1 Human genes 0.000 description 1
- 108010084340 Gonadotropin-Releasing Hormone Proteins 0.000 description 1
- 102000006771 Gonadotropins Human genes 0.000 description 1
- 108010086677 Gonadotropins Proteins 0.000 description 1
- 108010069236 Goserelin Proteins 0.000 description 1
- 229960002913 Goserelin Drugs 0.000 description 1
- HSRJKNPTNIJEKV-UHFFFAOYSA-N Guaifenesin Chemical compound COC1=CC=CC=C1OCC(O)CO HSRJKNPTNIJEKV-UHFFFAOYSA-N 0.000 description 1
- 229960002146 Guaifenesin Drugs 0.000 description 1
- WDZVGELJXXEGPV-YIXHJXPBSA-N Guanabenz Chemical compound NC(N)=N\N=C\C1=C(Cl)C=CC=C1Cl WDZVGELJXXEGPV-YIXHJXPBSA-N 0.000 description 1
- 229960003050 Guanabenz Acetate Drugs 0.000 description 1
- 229960004032 Guanadrel sulfate Drugs 0.000 description 1
- INJOMKTZOLKMBF-UHFFFAOYSA-N Guanfacine Chemical compound NC(=N)NC(=O)CC1=C(Cl)C=CC=C1Cl INJOMKTZOLKMBF-UHFFFAOYSA-N 0.000 description 1
- 229960004746 Guanfacine Hydrochloride Drugs 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- 241000989913 Gunnera petaloidea Species 0.000 description 1
- 229940093912 Gynecological Sulfonamides Drugs 0.000 description 1
- 208000005721 HIV Infections Diseases 0.000 description 1
- 101700071120 HSTN Proteins 0.000 description 1
- 101710015954 HVA1 Proteins 0.000 description 1
- 210000002216 Heart Anatomy 0.000 description 1
- 208000007890 Heart Neoplasms Diseases 0.000 description 1
- 206010019280 Heart failure Diseases 0.000 description 1
- 210000000777 Hematopoietic System Anatomy 0.000 description 1
- 229960001008 Heparin sodium Drugs 0.000 description 1
- 206010019663 Hepatic failure Diseases 0.000 description 1
- 208000006454 Hepatitis Diseases 0.000 description 1
- 208000005252 Hepatitis A Diseases 0.000 description 1
- 208000002672 Hepatitis B Diseases 0.000 description 1
- 206010073071 Hepatocellular carcinoma Diseases 0.000 description 1
- 208000007514 Herpes Zoster Diseases 0.000 description 1
- 229940027278 Hetastarch Drugs 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 1
- 206010020243 Hodgkin's disease Diseases 0.000 description 1
- 229960002106 Homatropine hydrobromide Drugs 0.000 description 1
- 108010000521 Human Growth Hormone Proteins 0.000 description 1
- 102000002265 Human Growth Hormone Human genes 0.000 description 1
- 239000000854 Human Growth Hormone Substances 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 1
- 229960005384 Hydralazine Hydrochloride Drugs 0.000 description 1
- AQLJVWUFPCUVLO-UHFFFAOYSA-N Hydrogen peroxide - urea Chemical compound OO.NC(N)=O AQLJVWUFPCUVLO-UHFFFAOYSA-N 0.000 description 1
- 229960001103 Hydroxocobalamin Drugs 0.000 description 1
- 229960004171 Hydroxychloroquine Drugs 0.000 description 1
- XXSMGPRMXLTPCZ-UHFFFAOYSA-N Hydroxychloroquine Chemical compound ClC1=CC=C2C(NC(C)CCCN(CCO)CC)=CC=NC2=C1 XXSMGPRMXLTPCZ-UHFFFAOYSA-N 0.000 description 1
- 229960002927 Hydroxychloroquine Sulfate Drugs 0.000 description 1
- 229920001612 Hydroxyethyl starch Polymers 0.000 description 1
- 229960003220 Hydroxyzine Hydrochloride Drugs 0.000 description 1
- RKUNBYITZUJHSG-FXUDXRNXSA-N Hyoscyamine Chemical compound C1([C@@H](CO)C(=O)O[C@H]2C[C@H]3CC[C@@H](C2)N3C)=CC=CC=C1 RKUNBYITZUJHSG-FXUDXRNXSA-N 0.000 description 1
- 229960001550 Hyoscyamine Sulfate Drugs 0.000 description 1
- 206010020584 Hypercalcaemia of malignancy Diseases 0.000 description 1
- 102100005044 IL11 Human genes 0.000 description 1
- 229960002182 IMIPENEM Drugs 0.000 description 1
- ZSKVGTPCRGIANV-ZXFLCMHBSA-N IMIPENEM Chemical compound C1C(SCC\N=C\N)=C(C(O)=O)N2C(=O)[C@H]([C@H](O)C)[C@H]21 ZSKVGTPCRGIANV-ZXFLCMHBSA-N 0.000 description 1
- 229960003444 IMMUNOSUPPRESSANTS Drugs 0.000 description 1
- 230000035809 INACTIVATION RATE Effects 0.000 description 1
- 229960004260 INDOMETHACIN SODIUM Drugs 0.000 description 1
- 101700086738 IORF Proteins 0.000 description 1
- HEFNNWSXXWATRW-UHFFFAOYSA-N Ibuprofen Chemical compound CC(C)CC1=CC=C(C(C)C(O)=O)C=C1 HEFNNWSXXWATRW-UHFFFAOYSA-N 0.000 description 1
- 229960001176 Idarubicin Hydrochloride Drugs 0.000 description 1
- 229960001101 Ifosfamide Drugs 0.000 description 1
- HOMGKSMUEGBAAB-UHFFFAOYSA-N Ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 1
- 229960002102 Imipramine Hydrochloride Drugs 0.000 description 1
- 108090000745 Immune Sera Proteins 0.000 description 1
- 210000004201 Immune Sera Anatomy 0.000 description 1
- 206010027665 Immune disorder Diseases 0.000 description 1
- 229940042743 Immune sera Drugs 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- NDDAHWYSQHTHNT-UHFFFAOYSA-N Indapamide Chemical compound CC1CC2=CC=CC=C2N1NC(=O)C1=CC=C(Cl)C(S(N)(=O)=O)=C1 NDDAHWYSQHTHNT-UHFFFAOYSA-N 0.000 description 1
- 229960004569 Indapamide Drugs 0.000 description 1
- 229960004243 Indinavir Sulfate Drugs 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 108010053490 Infliximab Proteins 0.000 description 1
- 229940102223 Injectable Solution Drugs 0.000 description 1
- 229940102213 Injectable Suspension Drugs 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N Intaxel Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- 229960003507 Interferon Alfa-2b Drugs 0.000 description 1
- 108010005716 Interferon beta-1a Proteins 0.000 description 1
- 229960004461 Interferon beta-1a Drugs 0.000 description 1
- 108010005714 Interferon beta-1b Proteins 0.000 description 1
- 229940028862 Interferon gamma-1b Drugs 0.000 description 1
- 102000000589 Interleukin-1 Human genes 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 102000003815 Interleukin-11 Human genes 0.000 description 1
- 108090000177 Interleukin-11 Proteins 0.000 description 1
- 108010082786 Interleukin-1alpha Proteins 0.000 description 1
- 102000004889 Interleukin-6 Human genes 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 108020004391 Introns Proteins 0.000 description 1
- 241000155250 Iole Species 0.000 description 1
- 229960001361 Ipratropium Bromide Drugs 0.000 description 1
- YCPOHTHPUREGFM-UHFFFAOYSA-N Irbesartan Chemical compound O=C1N(CC=2C=CC(=CC=2)C=2C(=CC=CC=2)C=2[N]N=NN=2)C(CCCC)=NC21CCCC2 YCPOHTHPUREGFM-UHFFFAOYSA-N 0.000 description 1
- 206010061255 Ischaemia Diseases 0.000 description 1
- 206010061256 Ischaemic stroke Diseases 0.000 description 1
- 229960000201 Isosorbide Dinitrate Drugs 0.000 description 1
- 229960003827 Isosorbide Mononitrate Drugs 0.000 description 1
- MOYKHGMNXAOIAT-JGWLITMVSA-N Isosorbide dinitrate Chemical compound [O-][N+](=O)O[C@H]1CO[C@@H]2[C@H](O[N+](=O)[O-])CO[C@@H]21 MOYKHGMNXAOIAT-JGWLITMVSA-N 0.000 description 1
- YWXYYJSYQOXTPL-SLPGGIOYSA-N Isosorbide mononitrate Chemical compound [O-][N+](=O)O[C@@H]1CO[C@@H]2[C@@H](O)CO[C@@H]21 YWXYYJSYQOXTPL-SLPGGIOYSA-N 0.000 description 1
- 241000710842 Japanese encephalitis virus Species 0.000 description 1
- 208000007766 Kaposi Sarcoma Diseases 0.000 description 1
- DKYWVDODHFEZIM-UHFFFAOYSA-N Ketoprofen Chemical compound OC(=O)C(C)C1=CC=CC(C(=O)C=2C=CC=CC=2)=C1 DKYWVDODHFEZIM-UHFFFAOYSA-N 0.000 description 1
- OZWKMVRBQXNZKK-UHFFFAOYSA-N Ketorolac Chemical compound OC(=O)C1CCN2C1=CC=C2C(=O)C1=CC=CC=C1 OZWKMVRBQXNZKK-UHFFFAOYSA-N 0.000 description 1
- 229960004384 Ketorolac Tromethamine Drugs 0.000 description 1
- 241000588748 Klebsiella Species 0.000 description 1
- PWKSKIMOESPYIA-BYPYZUCNSA-N L-N-acetyl-Cysteine Chemical compound CC(=O)N[C@@H](CS)C(O)=O PWKSKIMOESPYIA-BYPYZUCNSA-N 0.000 description 1
- SFLSHLFXELFNJZ-MRVPVSSYSA-N L-Noradrenaline Natural products NC[C@@H](O)C1=CC=C(O)C(O)=C1 SFLSHLFXELFNJZ-MRVPVSSYSA-N 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- 125000000415 L-cysteinyl group Chemical group O=C([*])[C@@](N([H])[H])([H])C([H])([H])S[H] 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- MTCFGRXMJLQNBG-REOHCLBHSA-N L-serine Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- 101700065814 LEA2 Proteins 0.000 description 1
- 101700021338 LEC Proteins 0.000 description 1
- 101700077545 LECC Proteins 0.000 description 1
- 101700028499 LECG Proteins 0.000 description 1
- 101700063913 LECT Proteins 0.000 description 1
- 102100005410 LINE-1 retrotransposable element ORF2 protein Human genes 0.000 description 1
- SGUAFYQXFOLMHL-UHFFFAOYSA-N Labetalol Chemical compound C=1C=C(O)C(C(N)=O)=CC=1C(O)CNC(C)CCC1=CC=CC=C1 SGUAFYQXFOLMHL-UHFFFAOYSA-N 0.000 description 1
- 229960003091 Labetalol hydrochloride Drugs 0.000 description 1
- 229960001627 Lamivudine Drugs 0.000 description 1
- 229940033984 Lamivudine / Zidovudine Drugs 0.000 description 1
- PYZRQGJRPPTADH-UHFFFAOYSA-N Lamotrigine Chemical compound NC1=NC(N)=NN=C1C1=CC=CC(Cl)=C1Cl PYZRQGJRPPTADH-UHFFFAOYSA-N 0.000 description 1
- 241000238866 Latrodectus mactans Species 0.000 description 1
- 101800001171 Leader peptide Proteins 0.000 description 1
- VHOGYURTWQBHIL-UHFFFAOYSA-N Leflunomide Chemical compound O1N=CC(C(=O)NC=2C=CC(=CC=2)C(F)(F)F)=C1C VHOGYURTWQBHIL-UHFFFAOYSA-N 0.000 description 1
- 241000589248 Legionella Species 0.000 description 1
- 208000007764 Legionnaires' Disease Diseases 0.000 description 1
- 208000004554 Leishmaniasis Diseases 0.000 description 1
- 229950007278 Lenercept Drugs 0.000 description 1
- 206010024229 Leprosy Diseases 0.000 description 1
- 229940008250 Leuprolide Drugs 0.000 description 1
- 108010000817 Leuprolide Proteins 0.000 description 1
- 229940089022 Leuprolide Acetate Drugs 0.000 description 1
- 229960004834 Levobunolol Hydrochloride Drugs 0.000 description 1
- HLFSDGLLUJUHTE-SNVBAGLBSA-N Levotetramisole Chemical compound C1([C@H]2CN3CCSC3=N2)=CC=CC=C1 HLFSDGLLUJUHTE-SNVBAGLBSA-N 0.000 description 1
- 229960003918 Levothyroxine Sodium Drugs 0.000 description 1
- 210000004558 Lewy Bodies Anatomy 0.000 description 1
- 201000002832 Lewy body dementia Diseases 0.000 description 1
- JLYXXMFPNIAWKQ-GNIYUCBRSA-N Lindane Chemical compound Cl[C@H]1[C@H](Cl)[C@@H](Cl)[C@@H](Cl)[C@H](Cl)[C@H]1Cl JLYXXMFPNIAWKQ-GNIYUCBRSA-N 0.000 description 1
- 206010024558 Lip oedema Diseases 0.000 description 1
- 208000007021 Lipedema Diseases 0.000 description 1
- 229960002394 Lisinopril Drugs 0.000 description 1
- 108010007859 Lisinopril Proteins 0.000 description 1
- 229940008015 Lithium Carbonate Drugs 0.000 description 1
- 229940073577 Lithium Chloride Drugs 0.000 description 1
- 208000007903 Liver Failure Diseases 0.000 description 1
- ZFMITUMMTDLWHR-UHFFFAOYSA-N Loniten Chemical compound NC1=[N+]([O-])C(N)=CC(N2CCCCC2)=N1 ZFMITUMMTDLWHR-UHFFFAOYSA-N 0.000 description 1
- RDOIQAHITMMDAJ-UHFFFAOYSA-N Loperamide Chemical compound C=1C=CC=CC=1C(C=1C=CC=CC=1)(C(=O)N(C)C)CCN(CC1)CCC1(O)C1=CC=C(Cl)C=C1 RDOIQAHITMMDAJ-UHFFFAOYSA-N 0.000 description 1
- 229960001571 Loperamide Drugs 0.000 description 1
- 229960003088 Loratadine Drugs 0.000 description 1
- JCCNYMKQOSZNPW-UHFFFAOYSA-N Loratadine Chemical compound C1CN(C(=O)OCC)CCC1=C1C2=NC=CC=C2CCC2=CC(Cl)=CC=C21 JCCNYMKQOSZNPW-UHFFFAOYSA-N 0.000 description 1
- DIWRORZWFLOCLC-UHFFFAOYSA-N Lorazepam Chemical compound C12=CC(Cl)=CC=C2NC(=O)C(O)N=C1C1=CC=CC=C1Cl DIWRORZWFLOCLC-UHFFFAOYSA-N 0.000 description 1
- 206010024855 Loss of consciousness Diseases 0.000 description 1
- PCZOHLXUXFIOCF-BXMDZJJMSA-N Lovastatin Chemical compound C([C@H]1[C@@H](C)C=CC2=C[C@H](C)C[C@@H]([C@H]12)OC(=O)[C@@H](C)CC)C[C@@H]1C[C@@H](O)CC(=O)O1 PCZOHLXUXFIOCF-BXMDZJJMSA-N 0.000 description 1
- XJGVXQDUIWGIRW-UHFFFAOYSA-N Loxapine Chemical compound C1CN(C)CCN1C1=NC2=CC=CC=C2OC2=CC=C(Cl)C=C12 XJGVXQDUIWGIRW-UHFFFAOYSA-N 0.000 description 1
- 229960000589 Loxapine Succinate Drugs 0.000 description 1
- 229960004990 Loxapine hydrochloride Drugs 0.000 description 1
- 229940070813 Lymphocyte immune globulin Drugs 0.000 description 1
- 101710029649 MDV043 Proteins 0.000 description 1
- MINDHVHHQZYEEK-HBBNESRFSA-N MUPIROCIN Chemical compound C[C@H](O)[C@H](C)[C@@H]1O[C@H]1C[C@@H]1[C@@H](O)[C@@H](O)[C@H](C\C(C)=C\C(=O)OCCCCCCCCC(O)=O)OC1 MINDHVHHQZYEEK-HBBNESRFSA-N 0.000 description 1
- 229940041033 Macrolides Drugs 0.000 description 1
- 229920002521 Macromolecule Polymers 0.000 description 1
- 229940072082 Magnesium Salicylate Drugs 0.000 description 1
- MQHWFIOJQSCFNM-UHFFFAOYSA-L Magnesium salicylate Chemical compound [Mg+2].OC1=CC=CC=C1C([O-])=O.OC1=CC=CC=C1C([O-])=O MQHWFIOJQSCFNM-UHFFFAOYSA-L 0.000 description 1
- FPYJFEHAWHCUMM-UHFFFAOYSA-N Maleic anhydride Chemical compound O=C1OC(=O)C=C1 FPYJFEHAWHCUMM-UHFFFAOYSA-N 0.000 description 1
- 206010025650 Malignant melanoma Diseases 0.000 description 1
- 229920002774 Maltodextrin Polymers 0.000 description 1
- 229920001776 Mature messenger RNA Polymers 0.000 description 1
- BAXLBXFAUKGCDY-UHFFFAOYSA-N Mebendazole Chemical compound [CH]1C2=NC(NC(=O)OC)=NC2=CC=C1C(=O)C1=CC=CC=C1 BAXLBXFAUKGCDY-UHFFFAOYSA-N 0.000 description 1
- 229960003439 Mebendazole Drugs 0.000 description 1
- 229940057917 Medium chain triglycerides Drugs 0.000 description 1
- FRQMUZJSZHZSGN-HBNHAYAOSA-N Medroxyprogesterone Chemical compound C([C@@]12C)CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2CC[C@]2(C)[C@@](O)(C(C)=O)CC[C@H]21 FRQMUZJSZHZSGN-HBNHAYAOSA-N 0.000 description 1
- 229960005329 Mefloquine Hydrochloride Drugs 0.000 description 1
- 210000003593 Megakaryocytes Anatomy 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N Melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 229960002514 Melphalan hydrochloride Drugs 0.000 description 1
- 229940051129 Meperidine Hydrochloride Drugs 0.000 description 1
- DMJNNHOOLUXYBV-PQTSNVLCSA-N Meropenem Chemical compound C=1([C@H](C)[C@@H]2[C@H](C(N2C=1C(O)=O)=O)[C@H](O)C)S[C@@H]1CN[C@H](C(=O)N(C)C)C1 DMJNNHOOLUXYBV-PQTSNVLCSA-N 0.000 description 1
- SLVMESMUVMCQIY-UHFFFAOYSA-N Mesoridazine Chemical compound CN1CCCCC1CCN1C2=CC(S(C)=O)=CC=C2SC2=CC=CC=C21 SLVMESMUVMCQIY-UHFFFAOYSA-N 0.000 description 1
- 229960000300 Mesoridazine Drugs 0.000 description 1
- 208000008466 Metabolic Disease Diseases 0.000 description 1
- 229960004329 Metformin hydrochloride Drugs 0.000 description 1
- 229960003058 Methotrexate Sodium Drugs 0.000 description 1
- CJCSPKMFHVPWAR-JTQLQIEISA-N Methyldopa Chemical compound OC(=O)[C@](N)(C)CC1=CC=C(O)C(O)=C1 CJCSPKMFHVPWAR-JTQLQIEISA-N 0.000 description 1
- 229960000615 Methyldopa Drugs 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N Methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- VHRSUDSXCMQTMA-PJHHCJLFSA-N Methylprednisolone Chemical compound C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2[C@@H](O)C[C@]2(C)[C@@](O)(C(=O)CO)CC[C@H]21 VHRSUDSXCMQTMA-PJHHCJLFSA-N 0.000 description 1
- 229960000334 Methylprednisolone Sodium Succinate Drugs 0.000 description 1
- 229960002237 Metoprolol Drugs 0.000 description 1
- IUBSYMUCCVWXPE-UHFFFAOYSA-N Metoprolol Chemical compound COCCC1=CC=C(OCC(O)CNC(C)C)C=C1 IUBSYMUCCVWXPE-UHFFFAOYSA-N 0.000 description 1
- 229960001300 Metoprolol Tartrate Drugs 0.000 description 1
- 229960000282 Metronidazole Drugs 0.000 description 1
- 229960005040 Miconazole Nitrate Drugs 0.000 description 1
- 241000272040 Micrurus fulvius Species 0.000 description 1
- DDLIGBOFAVUZHB-UHFFFAOYSA-N Midazolam Chemical compound C12=CC(Cl)=CC=C2N2C(C)=NC=C2CN=C1C1=CC=CC=C1F DDLIGBOFAVUZHB-UHFFFAOYSA-N 0.000 description 1
- 229960002853 Midazolam Hydrochloride Drugs 0.000 description 1
- IBAQFPQHRJAVAV-ULAWRXDQSA-N Miglitol Chemical compound OCCN1C[C@H](O)[C@@H](O)[C@H](O)[C@H]1CO IBAQFPQHRJAVAV-ULAWRXDQSA-N 0.000 description 1
- 206010027599 Migraine Diseases 0.000 description 1
- 208000008085 Migraine Disorders Diseases 0.000 description 1
- 206010027603 Migraine headache Diseases 0.000 description 1
- 210000004080 Milk Anatomy 0.000 description 1
- 229960003632 Minoxidil Drugs 0.000 description 1
- RONZAEMNMFQXRA-UHFFFAOYSA-N Mirtazapine Chemical compound C1C2=CC=CN=C2N2CCN(C)CC2C2=CC=CC=C21 RONZAEMNMFQXRA-UHFFFAOYSA-N 0.000 description 1
- 229960001785 Mirtazapine Drugs 0.000 description 1
- 229960001437 Mivacurium chloride Drugs 0.000 description 1
- YFGHCGITMMYXAQ-UHFFFAOYSA-N Modafinil Chemical compound C=1C=CC=CC=1C(S(=O)CC(=O)N)C1=CC=CC=C1 YFGHCGITMMYXAQ-UHFFFAOYSA-N 0.000 description 1
- 229920000881 Modified starch Polymers 0.000 description 1
- UWWDHYUMIORJTA-HSQYWUDLSA-N Moexipril Chemical compound C([C@@H](C(=O)OCC)N[C@@H](C)C(=O)N1[C@@H](CC2=CC(OC)=C(OC)C=C2C1)C(O)=O)CC1=CC=CC=C1 UWWDHYUMIORJTA-HSQYWUDLSA-N 0.000 description 1
- 229960004185 Moexipril hydrochloride Drugs 0.000 description 1
- 229960004684 Molindone Hydrochloride Drugs 0.000 description 1
- WOFMFGQZHJDGCX-ZULDAHANSA-N Mometasone furoate Chemical compound O([C@]1([C@@]2(C)C[C@H](O)[C@]3(Cl)[C@@]4(C)C=CC(=O)C=C4CC[C@H]3[C@@H]2C[C@H]1C)C(=O)CCl)C(=O)C1=CC=CO1 WOFMFGQZHJDGCX-ZULDAHANSA-N 0.000 description 1
- 102000013967 Monokines Human genes 0.000 description 1
- 108010050619 Monokines Proteins 0.000 description 1
- 229960002608 Moracizine Drugs 0.000 description 1
- 229940050868 Moricizine hydrochloride Drugs 0.000 description 1
- BQJCRHHNABKAKU-KBQPJGBKSA-N Morphine Chemical compound O([C@H]1[C@H](C=C[C@H]23)O)C4=C5[C@@]12CCN(C)[C@@H]3CC5=CC=C4O BQJCRHHNABKAKU-KBQPJGBKSA-N 0.000 description 1
- 229960004715 Morphine Sulfate Drugs 0.000 description 1
- 229960005195 Morphine hydrochloride Drugs 0.000 description 1
- 229940095293 Mumps Vaccine Drugs 0.000 description 1
- 229960003128 Mupirocin Drugs 0.000 description 1
- 229960003816 Muromonab-CD3 Drugs 0.000 description 1
- 108090000393 Muromonab-CD3 Proteins 0.000 description 1
- 210000002027 Muscle, Skeletal Anatomy 0.000 description 1
- 210000003205 Muscles Anatomy 0.000 description 1
- 206010048592 Musculoskeletal disease Diseases 0.000 description 1
- 208000003926 Myelitis Diseases 0.000 description 1
- IDBPHNDTYPBSNI-UHFFFAOYSA-N N-(1-(2-(4-Ethyl-5-oxo-2-tetrazolin-1-yl)ethyl)-4-(methoxymethyl)-4-piperidyl)propionanilide Chemical compound C1CN(CCN2C(N(CC)N=N2)=O)CCC1(COC)N(C(=O)CC)C1=CC=CC=C1 IDBPHNDTYPBSNI-UHFFFAOYSA-N 0.000 description 1
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 1
- 101700051754 NA11 Proteins 0.000 description 1
- 238000005481 NMR spectroscopy Methods 0.000 description 1
- 210000000282 Nails Anatomy 0.000 description 1
- 229960001513 Nalbuphine Hydrochloride Drugs 0.000 description 1
- 229960005250 Naloxone Hydrochloride Drugs 0.000 description 1
- CMWTZPSULFXXJA-VIFPVBQESA-N Naproxen Chemical compound C1=C([C@H](C)C(O)=O)C=CC2=CC(OC)=CC=C21 CMWTZPSULFXXJA-VIFPVBQESA-N 0.000 description 1
- 229960003940 Naproxen sodium Drugs 0.000 description 1
- 208000002454 Nasopharyngeal Carcinoma Diseases 0.000 description 1
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 1
- 229960002259 Nedocromil Sodium Drugs 0.000 description 1
- 229960002441 Nefazodone hydrochloride Drugs 0.000 description 1
- 229960005230 Nelfinavir Mesylate Drugs 0.000 description 1
- PGBHMTALBVVCIT-VCIWKGPPSA-N Neomycin Chemical compound N[C@@H]1[C@@H](O)[C@H](O)[C@H](CN)O[C@@H]1O[C@H]1[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](N)C[C@@H](N)[C@@H]2O)O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CN)O2)N)O[C@@H]1CO PGBHMTALBVVCIT-VCIWKGPPSA-N 0.000 description 1
- 229940053050 Neomycin Sulfate Drugs 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 229960002362 Neostigmine Drugs 0.000 description 1
- ALWKGYPQUAPLQC-UHFFFAOYSA-N Neostigmine Chemical compound CN(C)C(=O)OC1=CC=CC([N+](C)(C)C)=C1 ALWKGYPQUAPLQC-UHFFFAOYSA-N 0.000 description 1
- 206010053643 Neurodegenerative disease Diseases 0.000 description 1
- 206010029331 Neuropathy peripheral Diseases 0.000 description 1
- 229960000689 Nevirapine Drugs 0.000 description 1
- NQDJXKOVJZTUJA-UHFFFAOYSA-N Nevirapine Chemical compound C12=NC=CC=C2C(=O)NC=2C(C)=CC=NC=2N1C1CC1 NQDJXKOVJZTUJA-UHFFFAOYSA-N 0.000 description 1
- 229940053207 Niacin Drugs 0.000 description 1
- 229940053487 Niacinamide Drugs 0.000 description 1
- 229960000227 Nisoldipine Drugs 0.000 description 1
- 229940014995 Nitroglycerin Drugs 0.000 description 1
- 239000000006 Nitroglycerin Substances 0.000 description 1
- 206010029592 Non-Hodgkin's lymphomas Diseases 0.000 description 1
- 229960002748 Norepinephrine Drugs 0.000 description 1
- 229940053934 Norethindrone Drugs 0.000 description 1
- 229940053938 Norgestrel Drugs 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 229960003039 Nortriptyline Hydrochloride Drugs 0.000 description 1
- 210000001331 Nose Anatomy 0.000 description 1
- 108091005503 Nucleic proteins Proteins 0.000 description 1
- 210000004940 Nucleus Anatomy 0.000 description 1
- 229960001494 Octreotide Acetate Drugs 0.000 description 1
- KVWDHTXUZHCGIO-UHFFFAOYSA-N Olanzapine Chemical compound C1CN(C)CCN1C1=NC2=CC=CC=C2NC2=C1C=C(C)S2 KVWDHTXUZHCGIO-UHFFFAOYSA-N 0.000 description 1
- 239000005642 Oleic acid Substances 0.000 description 1
- 229920000272 Oligonucleotide Polymers 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 206010067621 Oral disease Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 101710034340 Os04g0173800 Proteins 0.000 description 1
- 229960002194 Oseltamivir phosphate Drugs 0.000 description 1
- 241000283898 Ovis Species 0.000 description 1
- 229960003994 Oxacillin Sodium Drugs 0.000 description 1
- OFPXSFXSNFPTHF-UHFFFAOYSA-N Oxaprozin Chemical compound O1C(CCC(=O)O)=NC(C=2C=CC=CC=2)=C1C1=CC=CC=C1 OFPXSFXSNFPTHF-UHFFFAOYSA-N 0.000 description 1
- ADIMAYPTOBDMTL-UHFFFAOYSA-N Oxazepam Chemical compound C12=CC(Cl)=CC=C2NC(=O)C(O)N=C1C1=CC=CC=C1 ADIMAYPTOBDMTL-UHFFFAOYSA-N 0.000 description 1
- 229960003617 Oxycodone Hydrochloride Drugs 0.000 description 1
- BRUQQQPBMZOVGD-XFKAJCMBSA-N Oxycontin Chemical compound O=C([C@@H]1O2)CC[C@@]3(O)[C@H]4CC5=CC=C(OC)C2=C5[C@@]13CCN4C BRUQQQPBMZOVGD-XFKAJCMBSA-N 0.000 description 1
- UQCNKQCJZOAFTQ-ISWURRPUSA-N Oxymorphone Chemical compound O([C@H]1C(CC[C@]23O)=O)C4=C5[C@@]12CCN(C)[C@@H]3CC5=CC=C4O UQCNKQCJZOAFTQ-ISWURRPUSA-N 0.000 description 1
- 229960005374 Oxymorphone Hydrochloride Drugs 0.000 description 1
- 101700061424 POLB Proteins 0.000 description 1
- 229960001592 Paclitaxel Drugs 0.000 description 1
- 108010019613 Palivizumab Proteins 0.000 description 1
- 208000008443 Pancreatic Carcinoma Diseases 0.000 description 1
- 229940045258 Pancrelipase Drugs 0.000 description 1
- 108010067035 Pancrelipase Proteins 0.000 description 1
- 229960003379 Pancuronium bromide Drugs 0.000 description 1
- 206010033799 Paralysis Diseases 0.000 description 1
- 206010067229 Paraneoplastic syndrome Diseases 0.000 description 1
- 206010061536 Parkinson's disease Diseases 0.000 description 1
- 229960005183 Paroxetine Hydrochloride Drugs 0.000 description 1
- NRNCYVBFPDDJNE-UHFFFAOYSA-N Pemoline Chemical compound O1C(N)=NC(=O)C1C1=CC=CC=C1 NRNCYVBFPDDJNE-UHFFFAOYSA-N 0.000 description 1
- 229960000761 Pemoline Drugs 0.000 description 1
- 229940090512 Penicillin G Potassium Drugs 0.000 description 1
- 229940083984 Penicillin G Sodium Drugs 0.000 description 1
- 239000004186 Penicillin G benzathine Substances 0.000 description 1
- 239000004105 Penicillin G potassium Substances 0.000 description 1
- 239000004185 Penicillin G procaine Substances 0.000 description 1
- 239000004107 Penicillin G sodium Substances 0.000 description 1
- 229940090663 Penicillin V Potassium Drugs 0.000 description 1
- XDRYMKDFEDOLFX-UHFFFAOYSA-N Pentamidine Chemical class C1=CC(C(=N)N)=CC=C1OCCCCCOC1=CC=C(C(N)=N)C=C1 XDRYMKDFEDOLFX-UHFFFAOYSA-N 0.000 description 1
- BYPFEZZEUUWMEJ-UHFFFAOYSA-N Pentoxifylline Chemical compound O=C1N(CCCCC(=O)C)C(=O)N(C)C2=C1N(C)C=N2 BYPFEZZEUUWMEJ-UHFFFAOYSA-N 0.000 description 1
- 229960001476 Pentoxifylline Drugs 0.000 description 1
- 108091005771 Peptidases Proteins 0.000 description 1
- 102000035443 Peptidases Human genes 0.000 description 1
- 229960001511 Pergolide Mesylate Drugs 0.000 description 1
- 206010034468 Pericardial disease Diseases 0.000 description 1
- 229960003929 Perindopril Erbumine Drugs 0.000 description 1
- 206010034636 Peripheral vascular disease Diseases 0.000 description 1
- 206010034674 Peritonitis Diseases 0.000 description 1
- 229960000490 Permethrin Drugs 0.000 description 1
- 229940066827 Pertussis Vaccine Drugs 0.000 description 1
- XADCESSVHJOZHK-UHFFFAOYSA-N Petidina Chemical compound C=1C=CC=CC=1C1(C(=O)OCC)CCN(C)CC1 XADCESSVHJOZHK-UHFFFAOYSA-N 0.000 description 1
- 229940066842 Petrolatum Drugs 0.000 description 1
- 239000004264 Petrolatum Substances 0.000 description 1
- 210000003800 Pharynx Anatomy 0.000 description 1
- 241000286209 Phasianidae Species 0.000 description 1
- 229960004790 Phenelzine Sulfate Drugs 0.000 description 1
- RXBKMJIPNDOHFR-UHFFFAOYSA-N Phenelzine sulfate Chemical compound OS(O)(=O)=O.NNCCC1=CC=CC=C1 RXBKMJIPNDOHFR-UHFFFAOYSA-N 0.000 description 1
- 229960005323 Phenoxyethanol Drugs 0.000 description 1
- QCDWFXQBSFUVSP-UHFFFAOYSA-N Phenoxyethanol Chemical compound OCCOC1=CC=CC=C1 QCDWFXQBSFUVSP-UHFFFAOYSA-N 0.000 description 1
- BPLBGHOLXOTWMN-MBNYWOFBSA-N Phenoxymethylpenicillin Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)COC1=CC=CC=C1 BPLBGHOLXOTWMN-MBNYWOFBSA-N 0.000 description 1
- 229960001277 Phentermine Hydrochloride Drugs 0.000 description 1
- 229960003056 Phentolamine Mesylate Drugs 0.000 description 1
- DLNKOYKMWOXYQA-CBAPKCEASA-N Phenylpropanolamine Chemical compound C[C@H](N)[C@H](O)C1=CC=CC=C1 DLNKOYKMWOXYQA-CBAPKCEASA-N 0.000 description 1
- 229960002036 Phenytoin Drugs 0.000 description 1
- 229960002790 Phenytoin sodium Drugs 0.000 description 1
- 102000011755 Phosphoglycerate kinases Human genes 0.000 description 1
- 108020004454 Phosphoglycerate kinases Proteins 0.000 description 1
- 229940067631 Phospholipids Drugs 0.000 description 1
- 229960001898 Phytomenadione Drugs 0.000 description 1
- 229960002139 Pilocarpine Hydrochloride Drugs 0.000 description 1
- 229960001963 Pilocarpine Nitrate Drugs 0.000 description 1
- YVUQSNJEYSNKRX-UHFFFAOYSA-N Pimozide Chemical compound C1=CC(F)=CC=C1C(C=1C=CC(F)=CC=1)CCCN1CCC(N2C(NC3=CC=CC=C32)=O)CC1 YVUQSNJEYSNKRX-UHFFFAOYSA-N 0.000 description 1
- PHUTUTUABXHXLW-UHFFFAOYSA-N Pindolol Chemical compound CC(C)NCC(O)COC1=CC=CC2=NC=C[C]12 PHUTUTUABXHXLW-UHFFFAOYSA-N 0.000 description 1
- HYAFETHFCAUJAY-UHFFFAOYSA-N Pioglitazone Chemical compound N1=CC(CC)=CC=C1CCOC(C=C1)=CC=C1CC1C(=O)NC(=O)S1 HYAFETHFCAUJAY-UHFFFAOYSA-N 0.000 description 1
- 229960002827 Pioglitazone hydrochloride Drugs 0.000 description 1
- 229960004460 Pipecuronium Bromide Drugs 0.000 description 1
- TXWBOBJCRVVBJF-YTGGZNJNSA-L Pipecuronium bromide Chemical compound [Br-].[Br-].N1([C@@H]2[C@@H](OC(C)=O)C[C@@H]3CC[C@H]4[C@@H]5C[C@@H]([C@@H]([C@]5(CC[C@@H]4[C@@]3(C)C2)C)OC(=O)C)N2CC[N+](C)(C)CC2)CC[N+](C)(C)CC1 TXWBOBJCRVVBJF-YTGGZNJNSA-L 0.000 description 1
- QYSPLQLAKJAUJT-UHFFFAOYSA-N Piroxicam Chemical compound OC=1C2=CC=CC=C2S(=O)(=O)N(C)C=1C(=O)NC1=CC=CC=N1 QYSPLQLAKJAUJT-UHFFFAOYSA-N 0.000 description 1
- 210000003635 Pituitary Gland Anatomy 0.000 description 1
- 102000006877 Pituitary Hormones Human genes 0.000 description 1
- 108010047386 Pituitary Hormones Proteins 0.000 description 1
- 240000000650 Plantago ovata Species 0.000 description 1
- 235000003421 Plantago ovata Nutrition 0.000 description 1
- 210000004011 Plasma Cells Anatomy 0.000 description 1
- 241000606999 Plesiomonas shigelloides Species 0.000 description 1
- 229960003171 Plicamycin Drugs 0.000 description 1
- 208000005384 Pneumocystis Pneumonia Diseases 0.000 description 1
- 206010073755 Pneumocystis jirovecii pneumonia Diseases 0.000 description 1
- 206010035664 Pneumonia Diseases 0.000 description 1
- 229940044519 Poloxamer 188 Drugs 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 108010020346 Polyglutamic Acid Proteins 0.000 description 1
- 229920001273 Polyhydroxy acid Polymers 0.000 description 1
- 229960003548 Polymyxin B Sulfate Drugs 0.000 description 1
- 229920001710 Polyorthoester Polymers 0.000 description 1
- 229920000265 Polyparaphenylene Polymers 0.000 description 1
- 229940078042 Polysaccharide iron complex Drugs 0.000 description 1
- 229920001214 Polysorbate 60 Polymers 0.000 description 1
- 229960004293 Porfimer Sodium Drugs 0.000 description 1
- TYJJADVDDVDEDZ-UHFFFAOYSA-M Potassium bicarbonate Chemical compound [K+].OC([O-])=O TYJJADVDDVDEDZ-UHFFFAOYSA-M 0.000 description 1
- HLCFGWHYROZGBI-JJKGCWMISA-M Potassium gluconate Chemical compound [K+].OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O HLCFGWHYROZGBI-JJKGCWMISA-M 0.000 description 1
- 229960002652 Pramipexole dihydrochloride Drugs 0.000 description 1
- IENZQIKPVFGBNW-UHFFFAOYSA-N Prazosin Chemical compound N=1C(N)=C2C=C(OC)C(OC)=CC2=NC=1N(CC1)CCN1C(=O)C1=CC=CO1 IENZQIKPVFGBNW-UHFFFAOYSA-N 0.000 description 1
- LRJOMUJRLNCICJ-JZYPGELDSA-N Prednisolone acetate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)COC(=O)C)(O)[C@@]1(C)C[C@@H]2O LRJOMUJRLNCICJ-JZYPGELDSA-N 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N Prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 206010036590 Premature baby Diseases 0.000 description 1
- WWYNJERNGUHSAO-XUDSTZEESA-N Previfem Chemical compound O=C1CC[C@@H]2[C@H]3CC[C@](CC)([C@](CC4)(O)C#C)[C@@H]4[C@@H]3CCC2=C1 WWYNJERNGUHSAO-XUDSTZEESA-N 0.000 description 1
- 229960005462 Primaquine Phosphate Drugs 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- DQMZLTXERSFNPB-UHFFFAOYSA-N Primidone Chemical compound C=1C=CC=CC=1C1(CC)C(=O)NCNC1=O DQMZLTXERSFNPB-UHFFFAOYSA-N 0.000 description 1
- 229960003253 Procainamide Hydrochloride Drugs 0.000 description 1
- 229960001586 Procarbazine Hydrochloride Drugs 0.000 description 1
- RJKFOVLPORLFTN-STHVQZNPSA-N Progesterone Natural products O=C(C)[C@@H]1[C@@]2(C)[C@H]([C@H]3[C@@H]([C@]4(C)C(=CC(=O)CC4)CC3)CC2)CC1 RJKFOVLPORLFTN-STHVQZNPSA-N 0.000 description 1
- 229960002443 Propafenone Hydrochloride Drugs 0.000 description 1
- 229960005439 Propantheline Bromide Drugs 0.000 description 1
- XLBIBBZXLMYSFF-UHFFFAOYSA-M Propantheline bromide Chemical compound [Br-].C1=CC=C2C(C(=O)OCC[N+](C)(C(C)C)C(C)C)C3=CC=CC=C3OC2=C1 XLBIBBZXLMYSFF-UHFFFAOYSA-M 0.000 description 1
- OLBCVFGFOZPWHH-UHFFFAOYSA-N Propofol Chemical compound CC(C)C1=CC=CC(C(C)C)=C1O OLBCVFGFOZPWHH-UHFFFAOYSA-N 0.000 description 1
- 229940065347 Propoxyphene Hydrochloride Drugs 0.000 description 1
- 229940024999 Proteolytic enzymes for treatment of wounds and ulcers Drugs 0.000 description 1
- 229960003447 Pseudoephedrine Hydrochloride Drugs 0.000 description 1
- 229960004159 Pseudoephedrine sulfate Drugs 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 206010037175 Psychiatric disease Diseases 0.000 description 1
- 229940070687 Psyllium Drugs 0.000 description 1
- 239000009223 Psyllium Substances 0.000 description 1
- 206010064911 Pulmonary arterial hypertension Diseases 0.000 description 1
- 206010037549 Purpura Diseases 0.000 description 1
- 241001672981 Purpura Species 0.000 description 1
- 229960000996 Pyrantel Pamoate Drugs 0.000 description 1
- AQXXZDYPVDOQEE-MXDQRGINSA-N Pyrantel pamoate Chemical compound CN1CCCN=C1\C=C\C1=CC=CS1.C1=CC=C2C(CC=3C4=CC=CC=C4C=C(C=3O)C(=O)O)=C(O)C(C(O)=O)=CC2=C1 AQXXZDYPVDOQEE-MXDQRGINSA-N 0.000 description 1
- 229940070846 Pyrethrins Drugs 0.000 description 1
- 229960002151 Pyridostigmine Bromide Drugs 0.000 description 1
- 229960004172 Pyridoxine Hydrochloride Drugs 0.000 description 1
- WKSAUQYGYAYLPV-UHFFFAOYSA-N Pyrimethamine Chemical compound CCC1=NC(N)=NC(N)=C1C1=CC=C(Cl)C=C1 WKSAUQYGYAYLPV-UHFFFAOYSA-N 0.000 description 1
- 229960003042 Quinapril hydrochloride Drugs 0.000 description 1
- 229960004482 Quinidine Sulfate Drugs 0.000 description 1
- 101700054624 RF1 Proteins 0.000 description 1
- ATEBXHFBFRCZMA-VXTBVIBXSA-N RIFABUTIN Chemical compound O([C@](C1=O)(C)O/C=C/[C@@H]([C@H]([C@@H](OC(C)=O)[C@H](C)[C@H](O)[C@H](C)[C@@H](O)[C@@H](C)\C=C\C=C(C)/C(=O)NC(=C2N3)C(=O)C=4C(O)=C5C)C)OC)C5=C1C=4C2=NC13CCN(CC(C)C)CC1 ATEBXHFBFRCZMA-VXTBVIBXSA-N 0.000 description 1
- JQXXHWHPUNPDRT-WLSIYKJHSA-N RIFAMPICIN Chemical compound O([C@](C1=O)(C)O/C=C/[C@@H]([C@H]([C@@H](OC(C)=O)[C@H](C)[C@H](O)[C@H](C)[C@@H](O)[C@@H](C)\C=C\C=C(C)/C(=O)NC=2C(O)=C3C([O-])=C4C)C)OC)C4=C1C3=C(O)C=2\C=N\N1CC[NH+](C)CC1 JQXXHWHPUNPDRT-WLSIYKJHSA-N 0.000 description 1
- 108020005067 RNA Splice Sites Proteins 0.000 description 1
- HDACQVRGBOVJII-JBDAPHQKSA-N Ramipril Chemical compound C([C@@H](C(=O)OCC)N[C@@H](C)C(=O)N1[C@@H](C[C@@H]2CCC[C@@H]21)C(O)=O)CC1=CC=CC=C1 HDACQVRGBOVJII-JBDAPHQKSA-N 0.000 description 1
- 229960003401 Ramipril Drugs 0.000 description 1
- LVQTUXZKLGXYIU-GWSNJHLMSA-M Rapacuronium Chemical compound [Br-].N1([C@@H]2[C@@H](OC(C)=O)C[C@@H]3CC[C@H]4[C@@H]5C[C@@H]([C@@H]([C@]5(CC[C@@H]4[C@@]3(C)C2)C)OC(=O)CC)[N+]2(CC=C)CCCCC2)CCCCC1 LVQTUXZKLGXYIU-GWSNJHLMSA-M 0.000 description 1
- 229960003335 Rapacuronium bromide Drugs 0.000 description 1
- 206010037844 Rash Diseases 0.000 description 1
- 208000003782 Raynaud Disease Diseases 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 102000018120 Recombinases Human genes 0.000 description 1
- 108010091086 Recombinases Proteins 0.000 description 1
- 208000005587 Refsum Disease Diseases 0.000 description 1
- 229960003011 Remifentanil hydrochloride Drugs 0.000 description 1
- 206010038428 Renal disease Diseases 0.000 description 1
- 206010038435 Renal failure Diseases 0.000 description 1
- 206010038444 Renal failure chronic Diseases 0.000 description 1
- 206010063837 Reperfusion injury Diseases 0.000 description 1
- GHMLBKRAJCXXBS-UHFFFAOYSA-N Resorcinol Natural products OC1=CC=CC(O)=C1 GHMLBKRAJCXXBS-UHFFFAOYSA-N 0.000 description 1
- 241000725643 Respiratory syncytial virus Species 0.000 description 1
- 229960002917 Reteplase Drugs 0.000 description 1
- 229960000329 Ribavirin Drugs 0.000 description 1
- IWUCXVSUMQZMFG-AFCXAGJDSA-N Ribavirin Chemical compound N1=C(C(=O)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 IWUCXVSUMQZMFG-AFCXAGJDSA-N 0.000 description 1
- AUNGANRZJHBGPY-SCRDCRAPSA-N Riboflavin Chemical compound OC[C@@H](O)[C@@H](O)[C@@H](O)CN1C=2C=C(C)C(C)=CC=2N=C2C1=NC(=O)NC2=O AUNGANRZJHBGPY-SCRDCRAPSA-N 0.000 description 1
- 229960002477 Riboflavin Drugs 0.000 description 1
- AUNGANRZJHBGPY-OUCADQQQSA-N Riboflavin Natural products OC[C@@H](O)[C@H](O)[C@@H](O)CN1C=2C=C(C)C(C)=CC=2N=C2C1=NC(=O)NC2=O AUNGANRZJHBGPY-OUCADQQQSA-N 0.000 description 1
- 241000724205 Rice stripe tenuivirus Species 0.000 description 1
- 235000004443 Ricinus communis Nutrition 0.000 description 1
- 229940081190 Rifampin Drugs 0.000 description 1
- WDZCUPBHRAEYDL-GZAUEHORSA-N Rifapentine Chemical compound O([C@](C1=O)(C)O/C=C/[C@@H]([C@H]([C@@H](OC(C)=O)[C@H](C)[C@H](O)[C@H](C)[C@@H](O)[C@@H](C)\C=C\C=C(C)/C(=O)NC=2C(O)=C3C(O)=C4C)C)OC)C4=C1C3=C(O)C=2\C=N\N(CC1)CCN1C1CCCC1 WDZCUPBHRAEYDL-GZAUEHORSA-N 0.000 description 1
- RAPZEAPATHNIPO-UHFFFAOYSA-N Risperidone Chemical compound FC1=CC=C2C(C3CCN(CC3)CCC=3C(=O)N4CCCCC4=NC=3C)=NOC2=C1 RAPZEAPATHNIPO-UHFFFAOYSA-N 0.000 description 1
- 229960001534 Risperidone Drugs 0.000 description 1
- NCDNCNXCDXHOMX-XGKFQTDJSA-N Ritonavir Chemical compound N([C@@H](C(C)C)C(=O)N[C@H](C[C@H](O)[C@H](CC=1C=CC=CC=1)NC(=O)OCC=1SC=NC=1)CC=1C=CC=CC=1)C(=O)N(C)CC1=CSC(C(C)C)=N1 NCDNCNXCDXHOMX-XGKFQTDJSA-N 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- RZJQGNCSTQAWON-UHFFFAOYSA-N Rofecoxib Chemical compound C1=CC(S(=O)(=O)C)=CC=C1C1=C(C=2C=CC=CC=2)C(=O)OC1 RZJQGNCSTQAWON-UHFFFAOYSA-N 0.000 description 1
- UHSKFQJFRQCDBE-UHFFFAOYSA-N Ropinirole Chemical compound CCCN(CCC)CCC1=CC=CC2=C1CC(=O)N2 UHSKFQJFRQCDBE-UHFFFAOYSA-N 0.000 description 1
- 229960003271 Rosiglitazone maleate Drugs 0.000 description 1
- 241000710799 Rubella virus Species 0.000 description 1
- 101710033747 S6 Proteins 0.000 description 1
- 229940030484 SEX HORMONES AND MODULATORS OF THE GENITAL SYSTEM ESTROGENS Drugs 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 241001354013 Salmonella enterica subsp. enterica serovar Enteritidis Species 0.000 description 1
- 241000293871 Salmonella enterica subsp. enterica serovar Typhi Species 0.000 description 1
- 206010039447 Salmonellosis Diseases 0.000 description 1
- 229960001852 Saquinavir Drugs 0.000 description 1
- QWAXKHKRTORLEM-UGJKXSETSA-N Saquinavir Chemical compound C([C@@H]([C@H](O)CN1C[C@H]2CCCC[C@H]2C[C@H]1C(=O)NC(C)(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)C=1N=C2C=CC=CC2=CC=1)C1=CC=CC=C1 QWAXKHKRTORLEM-UGJKXSETSA-N 0.000 description 1
- IRHXGOXEBNJUSN-YOXDLBRISA-N Saquinavir mesylate Chemical compound CS(O)(=O)=O.C([C@@H]([C@H](O)CN1C[C@H]2CCCC[C@H]2C[C@H]1C(=O)NC(C)(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)C=1N=C2C=CC=CC2=CC=1)C1=CC=CC=C1 IRHXGOXEBNJUSN-YOXDLBRISA-N 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 229920000972 Sense strand Polymers 0.000 description 1
- 229960003660 Sertraline Hydrochloride Drugs 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 108010079723 Shiga Toxin Proteins 0.000 description 1
- 241000607768 Shigella Species 0.000 description 1
- 241000607764 Shigella dysenteriae Species 0.000 description 1
- 229940007046 Shigella dysenteriae Drugs 0.000 description 1
- 241000607762 Shigella flexneri Species 0.000 description 1
- 241000607760 Shigella sonnei Species 0.000 description 1
- 229940115939 Shigella sonnei Drugs 0.000 description 1
- 229940083037 Simethicone Drugs 0.000 description 1
- CXQXSVUQTKDNFP-UHFFFAOYSA-N Simethicone Chemical compound C[Si](C)(C)O[Si](C)(C)O[Si](C)(C)C CXQXSVUQTKDNFP-UHFFFAOYSA-N 0.000 description 1
- 241000580858 Simian-Human immunodeficiency virus Species 0.000 description 1
- 108010070144 Single-Chain Antibodies Proteins 0.000 description 1
- 102000005632 Single-Chain Antibodies Human genes 0.000 description 1
- QFJCIRLUMZQUOT-HPLJOQBZSA-N Sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 1
- 229940083599 Sodium Iodide Drugs 0.000 description 1
- 229940005581 Sodium Lactate Drugs 0.000 description 1
- 229940083618 Sodium Nitroprusside Drugs 0.000 description 1
- 229940084026 Sodium Valproate Drugs 0.000 description 1
- UPMFZISCCZSDND-JJKGCWMISA-M Sodium gluconate Chemical compound [Na+].OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O UPMFZISCCZSDND-JJKGCWMISA-M 0.000 description 1
- 229940005574 Sodium gluconate Drugs 0.000 description 1
- NGSFWBMYFKHRBD-UHFFFAOYSA-M Sodium lactate Chemical compound [Na+].CC(O)C([O-])=O NGSFWBMYFKHRBD-UHFFFAOYSA-M 0.000 description 1
- FPWUWQVZUNFZQM-UHFFFAOYSA-N Sodium nitroprusside Chemical compound [Na+].[Na+].O=N[Fe-2](C#N)(C#N)(C#N)(C#N)C#N FPWUWQVZUNFZQM-UHFFFAOYSA-N 0.000 description 1
- 240000001016 Solanum tuberosum Species 0.000 description 1
- 235000002595 Solanum tuberosum Nutrition 0.000 description 1
- 229940075582 Sorbic Acid Drugs 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 229940083466 Soybean Lecithin Drugs 0.000 description 1
- 208000002320 Spinal Muscular Atrophy Diseases 0.000 description 1
- 208000010112 Spinocerebellar Degenerations Diseases 0.000 description 1
- LXMSZDCAJNLERA-ZHYRCANASA-N Spironolactone Chemical compound C([C@@H]1[C@]2(C)CC[C@@H]3[C@@]4(C)CCC(=O)C=C4C[C@H]([C@@H]13)SC(=O)C)C[C@@]21CCC(=O)O1 LXMSZDCAJNLERA-ZHYRCANASA-N 0.000 description 1
- 229940076185 Staphylococcus aureus Drugs 0.000 description 1
- 241000191967 Staphylococcus aureus Species 0.000 description 1
- 229960001203 Stavudine Drugs 0.000 description 1
- XNKLLVCARDGLGL-JGVFFNPUSA-N Stavudine Chemical compound O=C1NC(=O)C(C)=CN1[C@H]1C=C[C@@H](CO)O1 XNKLLVCARDGLGL-JGVFFNPUSA-N 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N Stearic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- 210000002784 Stomach Anatomy 0.000 description 1
- 241000193996 Streptococcus pyogenes Species 0.000 description 1
- 229960001052 Streptozocin Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N Streptozotocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 208000006011 Stroke Diseases 0.000 description 1
- 206010042297 Subacute sclerosing panencephalitis Diseases 0.000 description 1
- 229940120904 Succinylcholine Chloride Drugs 0.000 description 1
- 229960004673 Sulfadoxine Drugs 0.000 description 1
- MLKXDPUZXIRXEP-MFOYZWKCSA-N Sulindac Chemical compound CC1=C(CC(O)=O)C2=CC(F)=CC=C2\C1=C/C1=CC=C(S(C)=O)C=C1 MLKXDPUZXIRXEP-MFOYZWKCSA-N 0.000 description 1
- PJSFRIWCGOHTNF-UHFFFAOYSA-N Sulphormetoxin Chemical compound COC1=NC=NC(NS(=O)(=O)C=2C=CC(N)=CC=2)=C1OC PJSFRIWCGOHTNF-UHFFFAOYSA-N 0.000 description 1
- 206010042602 Supraventricular extrasystoles Diseases 0.000 description 1
- YOEWQQVKRJEPAE-UHFFFAOYSA-L Suxamethonium chloride Chemical compound [Cl-].[Cl-].C[N+](C)(C)CCOC(=O)CCC(=O)OCC[N+](C)(C)C YOEWQQVKRJEPAE-UHFFFAOYSA-L 0.000 description 1
- 206010042772 Syncope Diseases 0.000 description 1
- RJKFOVLPORLFTN-LEKSSAKUSA-N Syngestrets Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H](C(=O)C)[C@@]1(C)CC2 RJKFOVLPORLFTN-LEKSSAKUSA-N 0.000 description 1
- 210000001744 T-Lymphocytes Anatomy 0.000 description 1
- 108060008091 TBP Proteins 0.000 description 1
- WROMPOXWARCANT-UHFFFAOYSA-N TFA trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F.OC(=O)C(F)(F)F WROMPOXWARCANT-UHFFFAOYSA-N 0.000 description 1
- 101710038526 TNFRSF1A Proteins 0.000 description 1
- 101710037438 TST Proteins 0.000 description 1
- 101700055586 TXT1 Proteins 0.000 description 1
- 208000001871 Tachycardia Diseases 0.000 description 1
- YLJREFDVOIBQDA-UHFFFAOYSA-N Tacrine Chemical compound C1=CC=C2C(N)=C(CCCC3)C3=NC2=C1 YLJREFDVOIBQDA-UHFFFAOYSA-N 0.000 description 1
- 229960001685 Tacrine Drugs 0.000 description 1
- 229960001967 Tacrolimus Drugs 0.000 description 1
- QJJXYPPXXYFBGM-LFZNUXCKSA-N Tacrolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1\C=C(/C)[C@@H]1[C@H](C)[C@@H](O)CC(=O)[C@H](CC=C)/C=C(C)/C[C@H](C)C[C@H](OC)[C@H]([C@H](C[C@H]2C)OC)O[C@@]2(O)C(=O)C(=O)N2CCCC[C@H]2C(=O)O1 QJJXYPPXXYFBGM-LFZNUXCKSA-N 0.000 description 1
- VOKSWYLNZZRQPF-UHFFFAOYSA-N Talwin Chemical compound C1C2=CC=C(O)C=C2C2(C)C(C)C1N(CC=C(C)C)CC2 VOKSWYLNZZRQPF-UHFFFAOYSA-N 0.000 description 1
- 229940033123 Tannic Acid Drugs 0.000 description 1
- LRBQNJMCXXYXIU-NRMVVENXSA-N Tannic acid Chemical compound OC1=C(O)C(O)=CC(C(=O)OC=2C(=C(O)C=C(C=2)C(=O)OC[C@@H]2[C@H]([C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)O2)OC(=O)C=2C=C(OC(=O)C=3C=C(O)C(O)=C(O)C=3)C(O)=C(O)C=2)O)=C1 LRBQNJMCXXYXIU-NRMVVENXSA-N 0.000 description 1
- SEQDDYPDSLOBDC-UHFFFAOYSA-N Temazepam Chemical compound N=1C(O)C(=O)N(C)C2=CC=C(Cl)C=C2C=1C1=CC=CC=C1 SEQDDYPDSLOBDC-UHFFFAOYSA-N 0.000 description 1
- 229960003188 Temazepam Drugs 0.000 description 1
- DOMXUEMWDBAQBQ-WEVVVXLNSA-N Terbinafine Chemical compound C1=CC=C2C(CN(C\C=C\C#CC(C)(C)C)C)=CC=CC2=C1 DOMXUEMWDBAQBQ-WEVVVXLNSA-N 0.000 description 1
- 229960000699 Terbinafine hydrochloride Drugs 0.000 description 1
- BLSQLHNBWJLIBQ-OZXSUGGESA-N Terconazole Chemical compound C1CN(C(C)C)CCN1C(C=C1)=CC=C1OC[C@@H]1O[C@@](CN2N=CN=C2)(C=2C(=CC(Cl)=CC=2)Cl)OC1 BLSQLHNBWJLIBQ-OZXSUGGESA-N 0.000 description 1
- 229940088956 Testosterone Transdermal System Drugs 0.000 description 1
- 229940033529 Tetrahydrocannabinol Drugs 0.000 description 1
- 229960000278 Theophylline Drugs 0.000 description 1
- 229960005454 Thioguanine Drugs 0.000 description 1
- 229960004098 Thioridazine Hydrochloride Drugs 0.000 description 1
- GFBKORZTTCHDGY-UWVJOHFNSA-N Thiothixene Chemical compound C12=CC(S(=O)(=O)N(C)C)=CC=C2SC2=CC=CC=C2\C1=C\CCN1CCN(C)CC1 GFBKORZTTCHDGY-UWVJOHFNSA-N 0.000 description 1
- 229960000882 Thiothixene hydrochloride Drugs 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 206010043540 Thromboangiitis obliterans Diseases 0.000 description 1
- 229940036555 Thyroid hormones Drugs 0.000 description 1
- 229960002961 Ticlopidine Hydrochloride Drugs 0.000 description 1
- 229960005221 Timolol Maleate Drugs 0.000 description 1
- BUJAGSGYPOAWEI-UHFFFAOYSA-N Tocainide Chemical compound CC(N)C(=O)NC1=C(C)C=CC=C1C BUJAGSGYPOAWEI-UHFFFAOYSA-N 0.000 description 1
- 229960002872 Tocainide Drugs 0.000 description 1
- FUSNMLFNXJSCDI-UHFFFAOYSA-N Tolnaftate Chemical compound C=1C=C2C=CC=CC2=CC=1OC(=S)N(C)C1=CC=CC(C)=C1 FUSNMLFNXJSCDI-UHFFFAOYSA-N 0.000 description 1
- KJADKKWYZYXHBB-XBWDGYHZSA-N Topiramic acid Chemical compound C1O[C@@]2(COS(N)(=O)=O)OC(C)(C)O[C@H]2[C@@H]2OC(C)(C)O[C@@H]21 KJADKKWYZYXHBB-XBWDGYHZSA-N 0.000 description 1
- 229940100640 Transdermal System Drugs 0.000 description 1
- 229920001949 Transfer RNA Polymers 0.000 description 1
- 208000009174 Transverse Myelitis Diseases 0.000 description 1
- LWIHDJKSTIGBAC-UHFFFAOYSA-K Tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 1
- 229960001593 Triprolidine Hydrochloride Drugs 0.000 description 1
- GSEJCLTVZPLZKY-UHFFFAOYSA-N Tris Chemical compound OCCN(CCO)CCO GSEJCLTVZPLZKY-UHFFFAOYSA-N 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- GXPHKUHSUJUWKP-UHFFFAOYSA-N Troglitazone Chemical compound C1CC=2C(C)=C(O)C(C)=C(C)C=2OC1(C)COC(C=C1)=CC=C1CC1SC(=O)NC1=O GXPHKUHSUJUWKP-UHFFFAOYSA-N 0.000 description 1
- 229940035504 Tromethamine Drugs 0.000 description 1
- BGDKAVGWHJFAGW-UHFFFAOYSA-N Tropicamide Chemical compound C=1C=CC=CC=1C(CO)C(=O)N(CC)CC1=CC=NC=C1 BGDKAVGWHJFAGW-UHFFFAOYSA-N 0.000 description 1
- 208000003443 Unconsciousness Diseases 0.000 description 1
- 208000007814 Unstable Angina Diseases 0.000 description 1
- 210000002700 Urine Anatomy 0.000 description 1
- 229960005356 Urokinase Drugs 0.000 description 1
- 102000003990 Urokinase-type plasminogen activator Human genes 0.000 description 1
- 108090000435 Urokinase-type plasminogen activator Proteins 0.000 description 1
- RUDATBOHQWOJDD-UZVSRGJWSA-N Ursodeoxycholic acid Chemical compound C([C@H]1C[C@@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)CC1 RUDATBOHQWOJDD-UZVSRGJWSA-N 0.000 description 1
- 229960001661 Ursodiol Drugs 0.000 description 1
- MYPYJXKWCTUITO-LYRMYLQWSA-N VANCOMYCIN Chemical compound O([C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=C2C=C3C=C1OC1=CC=C(C=C1Cl)[C@@H](O)[C@H](C(N[C@@H](CC(N)=O)C(=O)N[C@H]3C(=O)N[C@H]1C(=O)N[C@H](C(N[C@@H](C3=CC(O)=CC(O)=C3C=3C(O)=CC=C1C=3)C(O)=O)=O)[C@H](O)C1=CC=C(C(=C1)Cl)O2)=O)NC(=O)[C@@H](CC(C)C)NC)[C@H]1C[C@](C)(N)[C@H](O)[C@H](C)O1 MYPYJXKWCTUITO-LYRMYLQWSA-N 0.000 description 1
- 229940029983 VITAMINS Drugs 0.000 description 1
- 101700039798 VKT1 Proteins 0.000 description 1
- HDOVUKNUBWVHOX-QMMMGPOBSA-N Valacyclover Chemical compound N1C(N)=NC(=O)C2=C1N(COCCOC(=O)[C@@H](N)C(C)C)C=N2 HDOVUKNUBWVHOX-QMMMGPOBSA-N 0.000 description 1
- ZOCKGBMQLCSHFP-KQRAQHLDSA-N Valrubicin Chemical compound O([C@H]1C[C@](CC2=C(O)C=3C(=O)C4=CC=CC(OC)=C4C(=O)C=3C(O)=C21)(O)C(=O)COC(=O)CCCC)[C@H]1C[C@H](NC(=O)C(F)(F)F)[C@H](O)[C@H](C)O1 ZOCKGBMQLCSHFP-KQRAQHLDSA-N 0.000 description 1
- 229960001572 Vancomycin Hydrochloride Drugs 0.000 description 1
- 206010046996 Varicose vein Diseases 0.000 description 1
- 229960004298 Vecuronium Bromide Drugs 0.000 description 1
- 229960002416 Venlafaxine hydrochloride Drugs 0.000 description 1
- 206010047249 Venous thrombosis Diseases 0.000 description 1
- 229940070384 Ventolin Drugs 0.000 description 1
- 208000003663 Ventricular Fibrillation Diseases 0.000 description 1
- 229960003636 Vidarabine Drugs 0.000 description 1
- 229960004982 Vinblastine Sulfate Drugs 0.000 description 1
- 206010047461 Viral infection Diseases 0.000 description 1
- 208000001756 Virus Disease Diseases 0.000 description 1
- 229940088594 Vitamin Drugs 0.000 description 1
- 229940045997 Vitamin A Drugs 0.000 description 1
- FPIPGXGPPPQFEQ-BOOMUCAASA-N Vitamin A Natural products OC/C=C(/C)\C=C\C=C(\C)/C=C/C1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-BOOMUCAASA-N 0.000 description 1
- 229940046008 Vitamin D Drugs 0.000 description 1
- 229930003316 Vitamin D Natural products 0.000 description 1
- QYSXJUFSXHHAJI-XFEUOLMDSA-N Vitamin D3 Natural products C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C/C=C1\C[C@@H](O)CCC1=C QYSXJUFSXHHAJI-XFEUOLMDSA-N 0.000 description 1
- 229940021016 Vitamin IV solution additives Drugs 0.000 description 1
- 229960002647 Warfarin Sodium Drugs 0.000 description 1
- 229960001095 Xylometazoline hydrochloride Drugs 0.000 description 1
- 208000003152 Yellow Fever Diseases 0.000 description 1
- 241000607479 Yersinia pestis Species 0.000 description 1
- YEEZWCHGZNKEEK-UHFFFAOYSA-N Zafirlukast Chemical compound COC1=CC(C(=O)NS(=O)(=O)C=2C(=CC=CC=2)C)=CC=C1CC(C1=C2)=CN(C)C1=CC=C2NC(=O)OC1CCCC1 YEEZWCHGZNKEEK-UHFFFAOYSA-N 0.000 description 1
- 229960004764 Zafirlukast Drugs 0.000 description 1
- HUNXMJYCHXQEGX-UHFFFAOYSA-N Zaleplon Chemical compound CCN(C(C)=O)C1=CC=CC(C=2N3N=CC(=C3N=CC=2)C#N)=C1 HUNXMJYCHXQEGX-UHFFFAOYSA-N 0.000 description 1
- 229960001028 Zanamivir Drugs 0.000 description 1
- HBOMLICNUCNMMY-XLPZGREQSA-N Zidovudine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](N=[N+]=[N-])C1 HBOMLICNUCNMMY-XLPZGREQSA-N 0.000 description 1
- 229960002555 Zidovudine Drugs 0.000 description 1
- ZAFYATHCZYHLPB-UHFFFAOYSA-N Zolpidem Chemical compound N1=C2C=CC(C)=CN2C(CC(=O)N(C)C)=C1C1=CC=C(C)C=C1 ZAFYATHCZYHLPB-UHFFFAOYSA-N 0.000 description 1
- RKUNBYITZUJHSG-PJPHBNEVSA-N [(1R,5S)-8-methyl-8-azabicyclo[3.2.1]octan-3-yl] 3-hydroxy-2-phenylpropanoate Chemical compound C([C@H]1CC[C@@H](C2)N1C)C2OC(=O)C(CO)C1=CC=CC=C1 RKUNBYITZUJHSG-PJPHBNEVSA-N 0.000 description 1
- OUUYBRCCFUEMLH-YDALLXLXSA-N [(1S)-2-[4-[bis(2-chloroethyl)amino]phenyl]-1-carboxyethyl]azanium;chloride Chemical compound Cl.OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 OUUYBRCCFUEMLH-YDALLXLXSA-N 0.000 description 1
- UFUVLHLTWXBHGZ-MGZQPHGTSA-N [(2R,3R,4S,5R,6R)-6-[(1S,2S)-2-chloro-1-[[(2S,4R)-1-methyl-4-propylpyrrolidine-2-carbonyl]amino]propyl]-4,5-dihydroxy-2-methylsulfanyloxan-3-yl] dihydrogen phosphate Chemical compound CN1C[C@H](CCC)C[C@H]1C(=O)N[C@H]([C@H](C)Cl)[C@@H]1[C@H](O)[C@H](O)[C@@H](OP(O)(O)=O)[C@@H](SC)O1 UFUVLHLTWXBHGZ-MGZQPHGTSA-N 0.000 description 1
- IWSWDOUXSCRCKW-UHFFFAOYSA-N [6,7-dimethoxy-2-[4-(oxolane-2-carbonyl)piperazin-1-yl]quinazolin-4-yl]azanium;chloride Chemical compound Cl.N=1C(N)=C2C=C(OC)C(OC)=CC2=NC=1N(CC1)CCN1C(=O)C1CCCO1 IWSWDOUXSCRCKW-UHFFFAOYSA-N 0.000 description 1
- CPGKMLVTFNUAHL-UHFFFAOYSA-N [Ca].[Ca] Chemical compound [Ca].[Ca] CPGKMLVTFNUAHL-UHFFFAOYSA-N 0.000 description 1
- ITDRVJXDQOONPC-UHFFFAOYSA-M [F-].NC(=O)N Chemical compound [F-].NC(=O)N ITDRVJXDQOONPC-UHFFFAOYSA-M 0.000 description 1
- 229960000531 abacavir sulfate Drugs 0.000 description 1
- WMHSRBZIJNQHKT-FFKFEZPRSA-N abacavir sulfate Chemical compound OS(O)(=O)=O.C=12N=CN([C@H]3C=C[C@@H](CO)C3)C2=NC(N)=NC=1NC1CC1.C=12N=CN([C@H]3C=C[C@@H](CO)C3)C2=NC(N)=NC=1NC1CC1 WMHSRBZIJNQHKT-FFKFEZPRSA-N 0.000 description 1
- 229960000446 abciximab Drugs 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 239000002250 absorbent Substances 0.000 description 1
- 230000002745 absorbent Effects 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 239000000205 acacia gum Substances 0.000 description 1
- 229960002632 acarbose Drugs 0.000 description 1
- KTUFKADDDORSSI-UHFFFAOYSA-N acebutolol hydrochloride Chemical compound Cl.CCCC(=O)NC1=CC=C(OCC(O)CNC(C)C)C(C(C)=O)=C1 KTUFKADDDORSSI-UHFFFAOYSA-N 0.000 description 1
- MRSXAJAOWWFZJJ-UHFFFAOYSA-M acetazolamide sodium Chemical compound [Na+].CC(=O)NC1=NN=C(S([NH-])(=O)=O)S1 MRSXAJAOWWFZJJ-UHFFFAOYSA-M 0.000 description 1
- FHEAIOHRHQGZPC-KIWGSFCNSA-N acetic acid;(2S)-2-amino-3-(4-hydroxyphenyl)propanoic acid;(2S)-2-aminopentanedioic acid;(2S)-2-aminopropanoic acid;(2S)-2,6-diaminohexanoic acid Chemical compound CC(O)=O.C[C@H](N)C(O)=O.NCCCC[C@H](N)C(O)=O.OC(=O)[C@@H](N)CCC(O)=O.OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 FHEAIOHRHQGZPC-KIWGSFCNSA-N 0.000 description 1
- JUGOREOARAHOCO-UHFFFAOYSA-M acetylcholine chloride Chemical compound [Cl-].CC(=O)OCC[N+](C)(C)C JUGOREOARAHOCO-UHFFFAOYSA-M 0.000 description 1
- 229960001138 acetylsalicylic acid Drugs 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 125000003647 acryloyl group Chemical group O=C([*])C([H])=C([H])[H] 0.000 description 1
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 1
- 125000002252 acyl group Chemical group 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 230000000240 adjuvant Effects 0.000 description 1
- 239000000674 adrenergic antagonist Substances 0.000 description 1
- 239000003463 adsorbent Substances 0.000 description 1
- 108010084841 afelimomab Proteins 0.000 description 1
- 229960003227 afelimomab Drugs 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 201000010000 agranulocytosis Diseases 0.000 description 1
- 150000001299 aldehydes Chemical group 0.000 description 1
- 229960005310 aldesleukin Drugs 0.000 description 1
- 229960005467 algeldrate Drugs 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 230000003113 alkalizing Effects 0.000 description 1
- FPIPGXGPPPQFEQ-OVSJKPMPSA-N all-trans-retinol Chemical compound OC\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-OVSJKPMPSA-N 0.000 description 1
- 230000000172 allergic Effects 0.000 description 1
- 230000000735 allogeneic Effects 0.000 description 1
- 229960004538 alprazolam Drugs 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminum Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- SXSTVPXRZQQBKQ-UHFFFAOYSA-M aluminum;magnesium;hydroxide;hydrate Chemical compound O.[OH-].[Mg].[Al] SXSTVPXRZQQBKQ-UHFFFAOYSA-M 0.000 description 1
- WOLHOYHSEKDWQH-UHFFFAOYSA-N amantadine hydrochloride Chemical compound [Cl-].C1C(C2)CC3CC2CC1([NH3+])C3 WOLHOYHSEKDWQH-UHFFFAOYSA-N 0.000 description 1
- FXKSEJFHKVNEFI-GCZBSULCSA-N amikacin disulfate Chemical compound [H+].[H+].[H+].[H+].[O-]S([O-])(=O)=O.[O-]S([O-])(=O)=O.O([C@@H]1[C@@H](N)C[C@H]([C@@H]([C@H]1O)O[C@@H]1[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O1)O)NC(=O)[C@@H](O)CCN)[C@H]1O[C@H](CN)[C@@H](O)[C@H](O)[C@H]1O FXKSEJFHKVNEFI-GCZBSULCSA-N 0.000 description 1
- ACHKKGDWZVCSNH-UHFFFAOYSA-N amiloride hydrochloride Chemical compound Cl.NC(N)=NC(=O)C1=NC(Cl)=C(N)N=C1N ACHKKGDWZVCSNH-UHFFFAOYSA-N 0.000 description 1
- ZPBWCRDSRKPIDG-UHFFFAOYSA-N amlodipine benzenesulfonate Chemical compound OS(=O)(=O)C1=CC=CC=C1.CCOC(=O)C1=C(COCCN)NC(C)=C(C(=O)OC)C1C1=CC=CC=C1Cl ZPBWCRDSRKPIDG-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 229960003942 amphotericin B Drugs 0.000 description 1
- 229960001830 amprenavir Drugs 0.000 description 1
- 201000000975 anemia of prematurity Diseases 0.000 description 1
- 150000008064 anhydrides Chemical class 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 230000000507 anthelmentic Effects 0.000 description 1
- 230000003257 anti-anginal Effects 0.000 description 1
- 230000000049 anti-anxiety Effects 0.000 description 1
- 230000001078 anti-cholinergic Effects 0.000 description 1
- 230000001773 anti-convulsant Effects 0.000 description 1
- 230000001887 anti-feedant Effects 0.000 description 1
- 230000003276 anti-hypertensive Effects 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 230000002141 anti-parasite Effects 0.000 description 1
- 230000001754 anti-pyretic Effects 0.000 description 1
- 230000001147 anti-toxic Effects 0.000 description 1
- 230000002365 anti-tubercular Effects 0.000 description 1
- 239000003472 antidiabetic agent Substances 0.000 description 1
- 239000003793 antidiarrheal agent Substances 0.000 description 1
- 230000000890 antigenic Effects 0.000 description 1
- 239000002220 antihypertensive agent Substances 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 229960000070 antineoplastic Monoclonal antibodies Drugs 0.000 description 1
- 239000003972 antineoplastic antibiotic Substances 0.000 description 1
- 239000002221 antipyretic Substances 0.000 description 1
- 239000003907 antipyretic analgesic agent Substances 0.000 description 1
- 239000003699 antiulcer agent Substances 0.000 description 1
- 229940121357 antivirals Drugs 0.000 description 1
- 238000003782 apoptosis assay Methods 0.000 description 1
- YZXBAPSDXZZRGB-DOFZRALJSA-M arachidonate Chemical compound CCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC([O-])=O YZXBAPSDXZZRGB-DOFZRALJSA-M 0.000 description 1
- 229940114078 arachidonate Drugs 0.000 description 1
- 229960001387 ardeparin sodium Drugs 0.000 description 1
- KBZOIRJILGZLEJ-LGYYRGKSSA-N argipressin Chemical compound C([C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CSSC[C@@H](C(N[C@@H](CC=2C=CC(O)=CC=2)C(=O)N1)=O)N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCN=C(N)N)C(=O)NCC(N)=O)C1=CC=CC=C1 KBZOIRJILGZLEJ-LGYYRGKSSA-N 0.000 description 1
- 201000008804 arthropathy Diseases 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 239000000605 aspartame Substances 0.000 description 1
- 235000010357 aspartame Nutrition 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- BSYNRYMUTXBXSQ-UHFFFAOYSA-N aspirin Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O BSYNRYMUTXBXSQ-UHFFFAOYSA-N 0.000 description 1
- 201000008937 atopic dermatitis Diseases 0.000 description 1
- 230000001746 atrial Effects 0.000 description 1
- 230000002238 attenuated Effects 0.000 description 1
- AUJRCFUBUPVWSZ-XTZHGVARSA-M auranofin Chemical compound CCP(CC)(CC)=[Au]S[C@@H]1O[C@H](COC(C)=O)[C@@H](OC(C)=O)[C@H](OC(C)=O)[C@H]1OC(C)=O AUJRCFUBUPVWSZ-XTZHGVARSA-M 0.000 description 1
- 229960001799 aurothioglucose Drugs 0.000 description 1
- 230000003305 autocrine Effects 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- ZXVOCOLRQJZVBW-UHFFFAOYSA-O azanium;ethanol Chemical compound [NH4+].CCO ZXVOCOLRQJZVBW-UHFFFAOYSA-O 0.000 description 1
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 1
- 229960002255 azelaic acid Drugs 0.000 description 1
- IVRMZWNICZWHMI-UHFFFAOYSA-N azide group Chemical group [N-]=[N+]=[N-] IVRMZWNICZWHMI-UHFFFAOYSA-N 0.000 description 1
- 229960004099 azithromycin Drugs 0.000 description 1
- CLKOFPXJLQSYAH-ABRJDSQDSA-N bacitracin A Chemical compound C1SC([C@@H](N)[C@@H](C)CC)=N[C@@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]1C(=O)N[C@H](CCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CC=2N=CNC=2)C(=O)N[C@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)NCCCC1 CLKOFPXJLQSYAH-ABRJDSQDSA-N 0.000 description 1
- 230000001580 bacterial Effects 0.000 description 1
- 239000000688 bacterial toxin Substances 0.000 description 1
- 229910052788 barium Inorganic materials 0.000 description 1
- DSAJWYNOEDNPEQ-UHFFFAOYSA-N barium(0) Chemical compound [Ba] DSAJWYNOEDNPEQ-UHFFFAOYSA-N 0.000 description 1
- 229960001081 benzatropine Drugs 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-M benzoate Chemical compound [O-]C(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-M 0.000 description 1
- WHRVRSCEWKLAHX-LQDWTQKMSA-N benzylpenicillin procaine Chemical compound [H+].CCN(CC)CCOC(=O)C1=CC=C(N)C=C1.N([C@H]1[C@H]2SC([C@@H](N2C1=O)C([O-])=O)(C)C)C(=O)CC1=CC=CC=C1 WHRVRSCEWKLAHX-LQDWTQKMSA-N 0.000 description 1
- 229960003237 betaine Drugs 0.000 description 1
- CHDPSNLJFOQTRK-UHFFFAOYSA-N betaxolol hydrochloride Chemical compound [Cl-].C1=CC(OCC(O)C[NH2+]C(C)C)=CC=C1CCOCC1CC1 CHDPSNLJFOQTRK-UHFFFAOYSA-N 0.000 description 1
- XXRMYXBSBOVVBH-UHFFFAOYSA-N bethanechol chloride Chemical compound [Cl-].C[N+](C)(C)CC(C)OC(N)=O XXRMYXBSBOVVBH-UHFFFAOYSA-N 0.000 description 1
- 102000024070 binding proteins Human genes 0.000 description 1
- 108091007650 binding proteins Proteins 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- RDNLAULGBSQZMP-UHFFFAOYSA-N biperiden hydrochloride Chemical compound [Cl-].C1C(C=C2)CC2C1C(C=1C=CC=CC=1)(O)CC[NH+]1CCCCC1 RDNLAULGBSQZMP-UHFFFAOYSA-N 0.000 description 1
- 229960003268 biperiden lactate Drugs 0.000 description 1
- WMSYWJSZGVOIJW-ONUALHDOSA-L bis[3-[(1R)-6,7-dimethoxy-2-methyl-1-[(3,4,5-trimethoxyphenyl)methyl]-3,4-dihydro-1H-isoquinolin-2-ium-2-yl]propyl] (E)-oct-4-enedioate;dichloride Chemical compound [Cl-].[Cl-].C([C@@H]1C2=CC(OC)=C(OC)C=C2CC[N+]1(C)CCCOC(=O)CC/C=C/CCC(=O)OCCC[N+]1(CCC=2C=C(C(=CC=2[C@H]1CC=1C=C(OC)C(OC)=C(OC)C=1)OC)OC)C)C1=CC(OC)=C(OC)C(OC)=C1 WMSYWJSZGVOIJW-ONUALHDOSA-L 0.000 description 1
- 229960000782 bismuth subsalicylate Drugs 0.000 description 1
- 229920001400 block copolymer Polymers 0.000 description 1
- 230000000903 blocking Effects 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 210000002798 bone marrow cell Anatomy 0.000 description 1
- 238000010322 bone marrow transplantation Methods 0.000 description 1
- 239000004327 boric acid Substances 0.000 description 1
- 229960002645 boric acid Drugs 0.000 description 1
- 108010006025 bovine growth hormone Proteins 0.000 description 1
- GDTBXPJZTBHREO-UHFFFAOYSA-N bromine Substances BrBr GDTBXPJZTBHREO-UHFFFAOYSA-N 0.000 description 1
- WKBOTKDWSSQWDR-UHFFFAOYSA-N bromine atom Chemical compound [Br] WKBOTKDWSSQWDR-UHFFFAOYSA-N 0.000 description 1
- NOJMTMIRQRDZMT-GSPXQYRGSA-N bromocriptine methanesulfonate Chemical compound CS(O)(=O)=O.C1=CC(C=2[C@H](N(C)C[C@@H](C=2)C(=O)N[C@]2(C(=O)N3[C@H](C(N4CCC[C@H]4[C@]3(O)O2)=O)CC(C)C)C(C)C)C2)=C3C2=C(Br)NC3=C1 NOJMTMIRQRDZMT-GSPXQYRGSA-N 0.000 description 1
- 239000000168 bronchodilator agent Substances 0.000 description 1
- 101710023118 btfP Proteins 0.000 description 1
- VOVIALXJUBGFJZ-KWVAZRHASA-N budesonide Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1C[C@H]3OC(CCC)O[C@@]3(C(=O)CO)[C@@]1(C)C[C@@H]2O VOVIALXJUBGFJZ-KWVAZRHASA-N 0.000 description 1
- 229960004064 bumetanide Drugs 0.000 description 1
- UAIXRPCCYXNJMQ-RZIPZOSSSA-N buprenorphine hydrochlorie Chemical compound [Cl-].C([C@]12[C@H]3OC=4C(O)=CC=C(C2=4)C[C@@H]2[C@]11CC[C@]3([C@H](C1)[C@](C)(O)C(C)(C)C)OC)C[NH+]2CC1CC1 UAIXRPCCYXNJMQ-RZIPZOSSSA-N 0.000 description 1
- 229960001768 buspirone hydrochloride Drugs 0.000 description 1
- RICLFGYGYQXUFH-UHFFFAOYSA-N buspirone hydrochloride Chemical compound [H+].[Cl-].C1C(=O)N(CCCCN2CCN(CC2)C=2N=CC=CN=2)C(=O)CC21CCCC2 RICLFGYGYQXUFH-UHFFFAOYSA-N 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L cacl2 Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- BDOSMKKIYDKNTQ-UHFFFAOYSA-N cadmium Chemical compound [Cd] BDOSMKKIYDKNTQ-UHFFFAOYSA-N 0.000 description 1
- 229910052793 cadmium Inorganic materials 0.000 description 1
- 229960001948 caffeine Drugs 0.000 description 1
- 229960004361 calcifediol Drugs 0.000 description 1
- 229960003773 calcitonin (salmon synthetic) Drugs 0.000 description 1
- 235000020964 calcitriol Nutrition 0.000 description 1
- 239000011612 calcitriol Substances 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 229960002713 calcium chloride Drugs 0.000 description 1
- 239000004227 calcium gluconate Substances 0.000 description 1
- 235000013927 calcium gluconate Nutrition 0.000 description 1
- 239000001527 calcium lactate Substances 0.000 description 1
- 235000011086 calcium lactate Nutrition 0.000 description 1
- 229960002401 calcium lactate Drugs 0.000 description 1
- VHUXSAWXWSTUOD-UHFFFAOYSA-L calcium;2-(3-phenoxyphenyl)propanoate Chemical compound [Ca+2].[O-]C(=O)C(C)C1=CC=CC(OC=2C=CC=CC=2)=C1.[O-]C(=O)C(C)C1=CC=CC(OC=2C=CC=CC=2)=C1 VHUXSAWXWSTUOD-UHFFFAOYSA-L 0.000 description 1
- 230000000711 cancerogenic Effects 0.000 description 1
- 229960004349 candesartan cilexetil Drugs 0.000 description 1
- GHVNFZFCNZKVNT-UHFFFAOYSA-M caprate Chemical compound CCCCCCCCCC([O-])=O GHVNFZFCNZKVNT-UHFFFAOYSA-M 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 229960000830 captopril Drugs 0.000 description 1
- 229960000623 carbamazepine Drugs 0.000 description 1
- 229940078916 carbamide peroxide Drugs 0.000 description 1
- 231100000315 carcinogenic Toxicity 0.000 description 1
- 230000000747 cardiac effect Effects 0.000 description 1
- 230000000271 cardiovascular Effects 0.000 description 1
- 239000002327 cardiovascular agent Substances 0.000 description 1
- 229960004195 carvedilol Drugs 0.000 description 1
- 239000004359 castor oil Substances 0.000 description 1
- 235000019438 castor oil Nutrition 0.000 description 1
- 238000005277 cation exchange chromatography Methods 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- QYIYFLOTGYLRGG-GPCCPHFNSA-N cefaclor Chemical compound C1([C@H](C(=O)N[C@@H]2C(N3C(=C(Cl)CS[C@@H]32)C(O)=O)=O)N)=CC=CC=C1 QYIYFLOTGYLRGG-GPCCPHFNSA-N 0.000 description 1
- BOEGTKLJZSQCCD-UEKVPHQBSA-N cefadroxil Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)C)C(O)=O)=CC=C(O)C=C1 BOEGTKLJZSQCCD-UEKVPHQBSA-N 0.000 description 1
- 229960003525 cefalexin Drugs 0.000 description 1
- FLKYBGKDCCEQQM-WYUVZMMLSA-M cefazolin sodium Chemical compound [Na+].S1C(C)=NN=C1SCC1=C(C([O-])=O)N2C(=O)[C@@H](NC(=O)CN3N=NN=C3)[C@H]2SC1 FLKYBGKDCCEQQM-WYUVZMMLSA-M 0.000 description 1
- 229960003719 cefdinir Drugs 0.000 description 1
- 229960002100 cefepime Drugs 0.000 description 1
- 229960005090 cefpodoxime Drugs 0.000 description 1
- 229960002580 cefprozil Drugs 0.000 description 1
- ADLFUPFRVXCDMO-LIGXYSTNSA-M ceftizoxime sodium Chemical compound [Na+].N([C@@H]1C(N2C(=CCS[C@@H]21)C([O-])=O)=O)C(=O)\C(=N/OC)C1=CSC(N)=N1 ADLFUPFRVXCDMO-LIGXYSTNSA-M 0.000 description 1
- 229960002620 cefuroxime axetil Drugs 0.000 description 1
- 229960000590 celecoxib Drugs 0.000 description 1
- 230000001413 cellular Effects 0.000 description 1
- 229940083181 centrally acting adntiadrenergic agents Methyldopa Drugs 0.000 description 1
- 229940084959 cephalexin hydrochloride Drugs 0.000 description 1
- AVGYWQBCYZHHPN-CYJZLJNKSA-N cephalexin monohydrate Chemical compound O.C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)C)C(O)=O)=CC=CC=C1 AVGYWQBCYZHHPN-CYJZLJNKSA-N 0.000 description 1
- 201000003861 cerebellar disease Diseases 0.000 description 1
- 230000000739 chaotic Effects 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 238000002144 chemical decomposition reaction Methods 0.000 description 1
- 238000001311 chemical methods and process Methods 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 230000003399 chemotactic Effects 0.000 description 1
- 210000000038 chest Anatomy 0.000 description 1
- DMLFJMQTNDSRFU-UHFFFAOYSA-N chlordiazepoxide hydrochloride Chemical compound Cl.O=N=1CC(NC)=NC2=CC=C(Cl)C=C2C=1C1=CC=CC=C1 DMLFJMQTNDSRFU-UHFFFAOYSA-N 0.000 description 1
- 239000000460 chlorine Substances 0.000 description 1
- 229910052801 chlorine Inorganic materials 0.000 description 1
- ZAMOUSCENKQFHK-UHFFFAOYSA-N chlorine atom Chemical compound [Cl] ZAMOUSCENKQFHK-UHFFFAOYSA-N 0.000 description 1
- 125000001309 chloro group Chemical group Cl* 0.000 description 1
- KYKAJFCTULSVSH-UHFFFAOYSA-N chloro(fluoro)methane Chemical compound F[C]Cl KYKAJFCTULSVSH-UHFFFAOYSA-N 0.000 description 1
- 229960003291 chlorphenamine Drugs 0.000 description 1
- 229960001523 chlortalidone Drugs 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- BHYOQNUELFTYRT-DPAQBDIFSA-N cholesterol sulfate Chemical compound C1C=C2C[C@@H](OS(O)(=O)=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 BHYOQNUELFTYRT-DPAQBDIFSA-N 0.000 description 1
- 229940080277 cholesteryl sulfate Drugs 0.000 description 1
- 229910052804 chromium Inorganic materials 0.000 description 1
- VYZAMTAEIAYCRO-UHFFFAOYSA-N chromium Chemical compound [Cr] VYZAMTAEIAYCRO-UHFFFAOYSA-N 0.000 description 1
- 239000011651 chromium Substances 0.000 description 1
- 201000000522 chronic kidney disease Diseases 0.000 description 1
- DIOIOSKKIYDRIQ-UHFFFAOYSA-N ciprofloxacin HCl Chemical compound Cl.C12=CC(N3CCNCC3)=C(F)C=C2C(=O)C(C(=O)O)=CN1C1CC1 DIOIOSKKIYDRIQ-UHFFFAOYSA-N 0.000 description 1
- 229960004106 citric acid Drugs 0.000 description 1
- 235000015165 citric acid Nutrition 0.000 description 1
- 229960002436 cladribine Drugs 0.000 description 1
- PMGQWSIVQFOFOQ-YKVZVUFRSA-N clemastine fumarate Chemical compound OC(=O)\C=C\C(O)=O.CN1CCC[C@@H]1CCO[C@@](C)(C=1C=CC(Cl)=CC=1)C1=CC=CC=C1 PMGQWSIVQFOFOQ-YKVZVUFRSA-N 0.000 description 1
- 229960002227 clindamycin Drugs 0.000 description 1
- 229960002291 clindamycin phosphate Drugs 0.000 description 1
- 229960004287 clofazimine Drugs 0.000 description 1
- 229960003120 clonazepam Drugs 0.000 description 1
- FDEODCTUSIWGLK-RSAXXLAASA-N clopidogrel sulfate Chemical compound [H+].OS([O-])(=O)=O.C1([C@H](N2CC=3C=CSC=3CC2)C(=O)OC)=CC=CC=C1Cl FDEODCTUSIWGLK-RSAXXLAASA-N 0.000 description 1
- 229960004362 clorazepate Drugs 0.000 description 1
- XDDJGVMJFWAHJX-UHFFFAOYSA-N clorazepic acid Chemical compound C12=CC(Cl)=CC=C2NC(=O)C(C(=O)O)N=C1C1=CC=CC=C1 XDDJGVMJFWAHJX-UHFFFAOYSA-N 0.000 description 1
- 229960004170 clozapine Drugs 0.000 description 1
- GUTLYIVDDKVIGB-UHFFFAOYSA-N cobalt Chemical compound [Co] GUTLYIVDDKVIGB-UHFFFAOYSA-N 0.000 description 1
- 229910052803 cobalt Inorganic materials 0.000 description 1
- 239000010941 cobalt Substances 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 229960004729 colecalciferol Drugs 0.000 description 1
- 238000010293 colony formation assay Methods 0.000 description 1
- 201000011231 colorectal cancer Diseases 0.000 description 1
- 201000010989 colorectal carcinoma Diseases 0.000 description 1
- 230000002860 competitive Effects 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- 201000004425 congenital hypoplastic anemia Diseases 0.000 description 1
- 201000006233 congestive heart failure Diseases 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 201000008739 coronary artery disease Diseases 0.000 description 1
- 230000001054 cortical Effects 0.000 description 1
- 230000002594 corticospinal Effects 0.000 description 1
- ALEXXDVDDISNDU-JZYPGELDSA-N cortisol 21-acetate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)COC(=O)C)(O)[C@@]1(C)C[C@@H]2O ALEXXDVDDISNDU-JZYPGELDSA-N 0.000 description 1
- BGSOJVFOEQLVMH-VWUMJDOOSA-N cortisol phosphate Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)COP(O)(O)=O)[C@@H]4[C@@H]3CCC2=C1 BGSOJVFOEQLVMH-VWUMJDOOSA-N 0.000 description 1
- 229960004544 cortisone Drugs 0.000 description 1
- ZOEFCCMDUURGSE-SQKVDDBVSA-N cosyntropin Chemical compound C([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(O)=O)NC(=O)[C@@H](N)CO)C1=CC=C(O)C=C1 ZOEFCCMDUURGSE-SQKVDDBVSA-N 0.000 description 1
- 230000001808 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 229960003338 crotamiton Drugs 0.000 description 1
- 238000002425 crystallisation Methods 0.000 description 1
- 230000005712 crystallization Effects 0.000 description 1
- 210000004748 cultured cells Anatomy 0.000 description 1
- 235000000639 cyanocobalamin Nutrition 0.000 description 1
- 239000011666 cyanocobalamin Substances 0.000 description 1
- 229960002104 cyanocobalamin Drugs 0.000 description 1
- 201000001546 cyclic hematopoiesis Diseases 0.000 description 1
- VXEAYBOGHINOKW-UHFFFAOYSA-N cyclobenzaprine hydrochloride Chemical compound Cl.C1=CC2=CC=CC=C2C(=CCCN(C)C)C2=CC=CC=C21 VXEAYBOGHINOKW-UHFFFAOYSA-N 0.000 description 1
- RHKZVMUBMXGOLL-UHFFFAOYSA-N cyclopentolate hydrochloride Chemical compound Cl.C1CCCC1(O)C(C(=O)OCCN(C)C)C1=CC=CC=C1 RHKZVMUBMXGOLL-UHFFFAOYSA-N 0.000 description 1
- 229960003077 cycloserine Drugs 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- 230000002354 daily Effects 0.000 description 1
- 229960000766 danazol Drugs 0.000 description 1
- WREGKURFCTUGRC-POYBYMJQSA-N ddC Chemical compound O=C1N=C(N)C=CN1[C@@H]1O[C@H](CO)CC1 WREGKURFCTUGRC-POYBYMJQSA-N 0.000 description 1
- BXZVVICBKDXVGW-NKWVEPMBSA-N ddIno Chemical compound O1[C@H](CO)CC[C@@H]1N1C(NC=NC2=O)=C2N=C1 BXZVVICBKDXVGW-NKWVEPMBSA-N 0.000 description 1
- 230000003247 decreasing Effects 0.000 description 1
- MEPNHSOMXMALDZ-UHFFFAOYSA-N delavirdine mesylate Chemical compound CS(O)(=O)=O.CC(C)NC1=CC=CN=C1N1CCN(C(=O)C=2NC3=CC=C(NS(C)(=O)=O)C=C3C=2)CC1 MEPNHSOMXMALDZ-UHFFFAOYSA-N 0.000 description 1
- CYQFCXCEBYINGO-IAGOWNOFSA-N delta1-THC Chemical compound C1=C(C)CC[C@H]2C(C)(C)OC3=CC(CCCCC)=CC(O)=C3[C@@H]21 CYQFCXCEBYINGO-IAGOWNOFSA-N 0.000 description 1
- GVSJQNRGSCOSNJ-KBHRXELFSA-N demeclocycline hydrochloride Chemical compound Cl.C1([C@@H](O)[C@H]2C3)=C(Cl)C=CC(O)=C1C(=O)C2=C(O)[C@@]1(O)[C@@H]3[C@H](N(C)C)C(O)=C(C(N)=O)C1=O GVSJQNRGSCOSNJ-KBHRXELFSA-N 0.000 description 1
- 230000003210 demyelinating Effects 0.000 description 1
- 201000002950 dengue hemorrhagic fever Diseases 0.000 description 1
- 238000000151 deposition Methods 0.000 description 1
- 239000000645 desinfectant Substances 0.000 description 1
- 230000000249 desinfective Effects 0.000 description 1
- XAEWZDYWZHIUCT-UHFFFAOYSA-N desipramine hydrochloride Chemical compound [H+].[Cl-].C1CC2=CC=CC=C2N(CCCNC)C2=CC=CC=C21 XAEWZDYWZHIUCT-UHFFFAOYSA-N 0.000 description 1
- 229960003657 dexamethasone acetate Drugs 0.000 description 1
- 229960000632 dexamfetamine Drugs 0.000 description 1
- PPQREHKVAOVYBT-UHFFFAOYSA-H dialuminum;tricarbonate Chemical compound [Al+3].[Al+3].[O-]C([O-])=O.[O-]C([O-])=O.[O-]C([O-])=O PPQREHKVAOVYBT-UHFFFAOYSA-H 0.000 description 1
- 229960004042 diazoxide Drugs 0.000 description 1
- 229940042935 dichlorodifluoromethane Drugs 0.000 description 1
- 235000019404 dichlorodifluoromethane Nutrition 0.000 description 1
- 229960001259 diclofenac Drugs 0.000 description 1
- DCOPUUMXTXDBNB-UHFFFAOYSA-N diclofenac Chemical compound OC(=O)CC1=CC=CC=C1NC1=C(Cl)C=CC=C1Cl DCOPUUMXTXDBNB-UHFFFAOYSA-N 0.000 description 1
- GUBNMFJOJGDCEL-UHFFFAOYSA-N dicyclomine hydrochloride Chemical compound [Cl-].C1CCCCC1C1(C(=O)OCC[NH+](CC)CC)CCCCC1 GUBNMFJOJGDCEL-UHFFFAOYSA-N 0.000 description 1
- 229960002656 didanosine Drugs 0.000 description 1
- 229960002124 diflorasone diacetate Drugs 0.000 description 1
- BOBLHFUVNSFZPJ-JOYXJVLSSA-N diflorasone diacetate Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@H](C)[C@@](C(=O)COC(C)=O)(OC(C)=O)[C@@]2(C)C[C@@H]1O BOBLHFUVNSFZPJ-JOYXJVLSSA-N 0.000 description 1
- 229960000616 diflunisal Drugs 0.000 description 1
- 229960005156 digoxin Drugs 0.000 description 1
- ADYPXRFPBQGGAH-UMYZUSPBSA-N dihydroergotamine mesylate Chemical compound CS(O)(=O)=O.C([C@H]1C(=O)N2CCC[C@H]2[C@]2(O)O[C@@](C(N21)=O)(C)NC(=O)[C@H]1CN([C@H]2[C@@H](C=3C=CC=C4NC=C(C=34)C2)C1)C)C1=CC=CC=C1 ADYPXRFPBQGGAH-UMYZUSPBSA-N 0.000 description 1
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 1
- 201000010046 dilated cardiomyopathy Diseases 0.000 description 1
- DKHVTDUUNTVKOW-UHFFFAOYSA-N dimenhydrinate Chemical compound O=C1N(C)C(=O)N(C)C2=C1[N-]C(Cl)=N2.C=1C=CC=CC=1C(OCC[NH+](C)C)C1=CC=CC=C1 DKHVTDUUNTVKOW-UHFFFAOYSA-N 0.000 description 1
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 1
- VKFAUCPBMAGVRG-UHFFFAOYSA-N dipivefrin hydrochloride Chemical compound [Cl-].C[NH2+]CC(O)C1=CC=C(OC(=O)C(C)(C)C)C(OC(=O)C(C)(C)C)=C1 VKFAUCPBMAGVRG-UHFFFAOYSA-N 0.000 description 1
- 229960000966 dipivefrine Drugs 0.000 description 1
- 210000001840 diploid cell Anatomy 0.000 description 1
- WLOHNSSYAXHWNR-DWIOZXRMSA-N dirithromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@@H]2O[C@H](COCCOC)N[C@H]([C@@H]2C)[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 WLOHNSSYAXHWNR-DWIOZXRMSA-N 0.000 description 1
- 229960004100 dirithromycin Drugs 0.000 description 1
- 229960001066 disopyramide Drugs 0.000 description 1
- CGDDQFMPGMYYQP-UHFFFAOYSA-N disopyramide phosphate Chemical compound OP(O)(O)=O.C=1C=CC=NC=1C(C(N)=O)(CCN(C(C)C)C(C)C)C1=CC=CC=C1 CGDDQFMPGMYYQP-UHFFFAOYSA-N 0.000 description 1
- 150000002019 disulfides Chemical class 0.000 description 1
- 230000001882 diuretic Effects 0.000 description 1
- BQKADKWNRWCIJL-UHFFFAOYSA-N dobutamine hydrochloride Chemical compound [Cl-].C=1C=C(O)C(O)=CC=1CC[NH2+]C(C)CCC1=CC=C(O)C=C1 BQKADKWNRWCIJL-UHFFFAOYSA-N 0.000 description 1
- 229960003218 dolasetron mesylate Drugs 0.000 description 1
- XWAIAVWHZJNZQQ-UHFFFAOYSA-N donepezil hydrochloride Chemical compound [H+].[Cl-].O=C1C=2C=C(OC)C(OC)=CC=2CC1CC(CC1)CCN1CC1=CC=CC=C1 XWAIAVWHZJNZQQ-UHFFFAOYSA-N 0.000 description 1
- OSRUSFPMRGDLAG-QMGYSKNISA-N dorzolamide hydrochloride Chemical compound [Cl-].CC[NH2+][C@H]1C[C@H](C)S(=O)(=O)C2=C1C=C(S(N)(=O)=O)S2 OSRUSFPMRGDLAG-QMGYSKNISA-N 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- VJECBOKJABCYMF-UHFFFAOYSA-N doxazosin mesylate Chemical compound [H+].CS([O-])(=O)=O.C1OC2=CC=CC=C2OC1C(=O)N(CC1)CCN1C1=NC(N)=C(C=C(C(OC)=C2)OC)C2=N1 VJECBOKJABCYMF-UHFFFAOYSA-N 0.000 description 1
- 229960000413 doxercalciferol Drugs 0.000 description 1
- HALQELOKLVRWRI-VDBOFHIQSA-N doxycycline hyclate Chemical compound O.[Cl-].[Cl-].CCO.O=C1C2=C(O)C=CC=C2[C@H](C)[C@@H]2C1=C(O)[C@]1(O)C(=O)C(C(N)=O)=C(O)[C@@H]([NH+](C)C)[C@@H]1[C@H]2O.O=C1C2=C(O)C=CC=C2[C@H](C)[C@@H]2C1=C(O)[C@]1(O)C(=O)C(C(N)=O)=C(O)[C@@H]([NH+](C)C)[C@@H]1[C@H]2O HALQELOKLVRWRI-VDBOFHIQSA-N 0.000 description 1
- 229960001172 doxycycline hyclate Drugs 0.000 description 1
- 229960004242 dronabinol Drugs 0.000 description 1
- 238000002651 drug therapy Methods 0.000 description 1
- 229960003804 efavirenz Drugs 0.000 description 1
- 229920001971 elastomer Polymers 0.000 description 1
- 238000002283 elective surgery Methods 0.000 description 1
- 239000008151 electrolyte solution Substances 0.000 description 1
- 230000003028 elevating Effects 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- OYFJQPXVCSSHAI-QFPUQLAESA-N enalapril maleate Chemical compound OC(=O)\C=C/C(O)=O.C([C@@H](C(=O)OCC)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(O)=O)CC1=CC=CC=C1 OYFJQPXVCSSHAI-QFPUQLAESA-N 0.000 description 1
- 229960002680 enalaprilat Drugs 0.000 description 1
- 229940046080 endocrine therapy drugs Estrogens Drugs 0.000 description 1
- 230000000688 enterotoxigenic Effects 0.000 description 1
- 239000002532 enzyme inhibitor Substances 0.000 description 1
- 229960000404 epinephryl borate Drugs 0.000 description 1
- 230000000925 erythroid Effects 0.000 description 1
- 229960004142 erythromycin stearate Drugs 0.000 description 1
- 230000000913 erythropoietic Effects 0.000 description 1
- GEKNCWBANDDJJL-UHFFFAOYSA-N esmolol hydrochloride Chemical compound [Cl-].COC(=O)CCC1=CC=C(OCC(O)C[NH2+]C(C)C)C=C1 GEKNCWBANDDJJL-UHFFFAOYSA-N 0.000 description 1
- 229960005416 estradiol cypionate Drugs 0.000 description 1
- 229960004766 estradiol valerate Drugs 0.000 description 1
- 239000002834 estrogen receptor modulator Substances 0.000 description 1
- 229960000403 etanercept Drugs 0.000 description 1
- DEFVIWRASFVYLL-UHFFFAOYSA-N ethylene glycol bis(2-aminoethyl)tetraacetic acid Chemical compound OC(=O)CN(CC(O)=O)CCOCCOCCN(CC(O)=O)CC(O)=O DEFVIWRASFVYLL-UHFFFAOYSA-N 0.000 description 1
- 229960000218 etynodiol Drugs 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 201000005884 exanthem Diseases 0.000 description 1
- 239000002095 exotoxin Substances 0.000 description 1
- 230000003419 expectorant Effects 0.000 description 1
- 239000003172 expectorant agent Substances 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 229940024790 factor IX complex Drugs 0.000 description 1
- 229960004396 famciclovir Drugs 0.000 description 1
- GGXKWVWZWMLJEH-UHFFFAOYSA-N famcyclovir Chemical compound N1=C(N)N=C2N(CCC(COC(=O)C)COC(C)=O)C=NC2=C1 GGXKWVWZWMLJEH-UHFFFAOYSA-N 0.000 description 1
- 235000019197 fats Nutrition 0.000 description 1
- 239000010685 fatty oil Substances 0.000 description 1
- IVLVTNPOHDFFCJ-UHFFFAOYSA-N fentanyl citrate Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O.C=1C=CC=CC=1N(C(=O)CC)C(CC1)CCN1CCC1=CC=CC=C1 IVLVTNPOHDFFCJ-UHFFFAOYSA-N 0.000 description 1
- 239000004222 ferrous gluconate Substances 0.000 description 1
- 235000013924 ferrous gluconate Nutrition 0.000 description 1
- 229960001645 ferrous gluconate Drugs 0.000 description 1
- 229960004884 fluconazole Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- 229960005304 fludarabine phosphate Drugs 0.000 description 1
- 229960004511 fludroxycortide Drugs 0.000 description 1
- 229960000785 fluocinonide Drugs 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- 239000011737 fluorine Substances 0.000 description 1
- YCKRFDGAMUMZLT-UHFFFAOYSA-N fluorine atom Chemical compound [F] YCKRFDGAMUMZLT-UHFFFAOYSA-N 0.000 description 1
- 229960001048 fluorometholone Drugs 0.000 description 1
- 229960005051 fluostigmine Drugs 0.000 description 1
- 229960002390 flurbiprofen Drugs 0.000 description 1
- 229960002714 fluticasone Drugs 0.000 description 1
- 229960000289 fluticasone propionate Drugs 0.000 description 1
- 235000019152 folic acid Nutrition 0.000 description 1
- 239000011724 folic acid Substances 0.000 description 1
- 229960005005 fomivirsen sodium Drugs 0.000 description 1
- 229960004279 formaldehyde Drugs 0.000 description 1
- 238000005755 formation reaction Methods 0.000 description 1
- 229960002490 fosinopril Drugs 0.000 description 1
- 229940050411 fumarate Drugs 0.000 description 1
- 238000002825 functional assay Methods 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 229960003794 ganirelix Drugs 0.000 description 1
- 201000000628 gas gangrene Diseases 0.000 description 1
- 201000002146 gastrointestinal system disease Diseases 0.000 description 1
- 229960003627 gemfibrozil Drugs 0.000 description 1
- 238000010358 genetic engineering technique Methods 0.000 description 1
- 229960002518 gentamicin Drugs 0.000 description 1
- 229960003776 glatiramer acetate Drugs 0.000 description 1
- 229960004346 glimepiride Drugs 0.000 description 1
- 239000000174 gluconic acid Substances 0.000 description 1
- 229950006191 gluconic acid Drugs 0.000 description 1
- 235000012208 gluconic acid Nutrition 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- 102000005396 glutamine synthetase family Human genes 0.000 description 1
- 108020002326 glutamine synthetase family Proteins 0.000 description 1
- 229960003711 glyceryl trinitrate Drugs 0.000 description 1
- 150000002334 glycols Chemical class 0.000 description 1
- 229960002462 glycopyrronium bromide Drugs 0.000 description 1
- 102000035362 glycosylated proteins Human genes 0.000 description 1
- 108091005600 glycosylated proteins Proteins 0.000 description 1
- 230000003899 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 229960001442 gonadorelin Drugs 0.000 description 1
- 239000002622 gonadotropin Substances 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 239000001963 growth media Substances 0.000 description 1
- RTEVGQJRTFFMLL-UHFFFAOYSA-N guanadrel sulfate Chemical compound OS(O)(=O)=O.O1C(CN=C(N)N)COC11CCCCC1.O1C(CN=C(N)N)COC11CCCCC1 RTEVGQJRTFFMLL-UHFFFAOYSA-N 0.000 description 1
- 238000001631 haemodialysis Methods 0.000 description 1
- 201000009277 hairy cell leukemia Diseases 0.000 description 1
- 125000005843 halogen group Chemical group 0.000 description 1
- 201000010238 heart disease Diseases 0.000 description 1
- 238000005534 hematocrit Methods 0.000 description 1
- 230000000322 hemodialysis Effects 0.000 description 1
- 201000001066 hemolytic-uremic syndrome Diseases 0.000 description 1
- 230000002440 hepatic Effects 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 150000004687 hexahydrates Chemical class 0.000 description 1
- FBPFZTCFMRRESA-UHFFFAOYSA-N hexane-1,2,3,4,5,6-hexol Chemical compound OCC(O)C(O)C(O)C(O)CO FBPFZTCFMRRESA-UHFFFAOYSA-N 0.000 description 1
- 201000001820 human immunodeficiency virus infectious disease Diseases 0.000 description 1
- 150000002430 hydrocarbons Chemical class 0.000 description 1
- 229960002003 hydrochlorothiazide Drugs 0.000 description 1
- 229960001067 hydrocortisone acetate Drugs 0.000 description 1
- 229950000785 hydrocortisone phosphate Drugs 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-N hydrogen bromide Chemical compound Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 235000004867 hydroxocobalamin Nutrition 0.000 description 1
- 239000011704 hydroxocobalamin Substances 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 229960001330 hydroxycarbamide Drugs 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-M hydroxyl anion Chemical compound [OH-] XLYOFNOQVPJJNP-UHFFFAOYSA-M 0.000 description 1
- 229910052588 hydroxylapatite Inorganic materials 0.000 description 1
- VSNHCAURESNICA-UHFFFAOYSA-N hydroxyurea Chemical compound NC(=O)NO VSNHCAURESNICA-UHFFFAOYSA-N 0.000 description 1
- 229940027318 hydroxyurea Drugs 0.000 description 1
- ANOMHKZSQFYSBR-UHFFFAOYSA-N hydroxyzine hydrochloride Chemical compound [H+].[H+].[Cl-].[Cl-].C1CN(CCOCCO)CCN1C(C=1C=CC(Cl)=CC=1)C1=CC=CC=C1 ANOMHKZSQFYSBR-UHFFFAOYSA-N 0.000 description 1
- 229960003210 hyoscyamine Drugs 0.000 description 1
- 229930005342 hyoscyamine Natural products 0.000 description 1
- 230000001660 hyperkinetic Effects 0.000 description 1
- 239000005554 hypnotics and sedatives Substances 0.000 description 1
- 230000003483 hypokinetic Effects 0.000 description 1
- 239000000960 hypophysis hormone Substances 0.000 description 1
- 229960001680 ibuprofen Drugs 0.000 description 1
- XZZXIYZZBJDEEP-UHFFFAOYSA-N imipramine hydrochloride Chemical compound [Cl-].C1CC2=CC=CC=C2N(CCC[NH+](C)C)C2=CC=CC=C21 XZZXIYZZBJDEEP-UHFFFAOYSA-N 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 239000000367 immunologic factor Substances 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 230000001506 immunosuppresive Effects 0.000 description 1
- NUBQKPWHXMGDLP-BDEHJDMKSA-N indinavir sulfate Chemical compound OS(O)(=O)=O.C([C@H](N(CC1)C[C@@H](O)C[C@@H](CC=2C=CC=CC=2)C(=O)N[C@H]2C3=CC=CC=C3C[C@H]2O)C(=O)NC(C)(C)C)N1CC1=CC=CN=C1 NUBQKPWHXMGDLP-BDEHJDMKSA-N 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000002757 inflammatory Effects 0.000 description 1
- 229960000598 infliximab Drugs 0.000 description 1
- 200000000003 influenza A Diseases 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 239000004026 insulin derivative Substances 0.000 description 1
- 229960003358 interferon alfacon-1 Drugs 0.000 description 1
- 108010010648 interferon alfacon-1 Proteins 0.000 description 1
- 229960003161 interferon beta-1b Drugs 0.000 description 1
- 108010042414 interferon gamma-1b Proteins 0.000 description 1
- 201000004332 intermediate coronary syndrome Diseases 0.000 description 1
- 229940079867 intestinal antiinfectives Sulfonamides Drugs 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000009114 investigational therapy Methods 0.000 description 1
- LHLMOSXCXGLMMN-VVQPYUEFSA-M ipratropium bromide Chemical compound [Br-].O([C@H]1C[C@H]2CC[C@@H](C1)[N@@+]2(C)C(C)C)C(=O)C(CO)C1=CC=CC=C1 LHLMOSXCXGLMMN-VVQPYUEFSA-M 0.000 description 1
- 229960002198 irbesartan Drugs 0.000 description 1
- UQSXHKLRYXJYBZ-UHFFFAOYSA-N iron oxide Chemical compound [Fe]=O UQSXHKLRYXJYBZ-UHFFFAOYSA-N 0.000 description 1
- 229910000460 iron oxide Inorganic materials 0.000 description 1
- HLBWMQJLOGMNBR-XRDLMGPZSA-N iron;(2R,3S,4R,5R)-2,3,4,5,6-pentahydroxyhexanoic acid;hydrate Chemical compound O.[Fe].OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)=O.OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)=O HLBWMQJLOGMNBR-XRDLMGPZSA-N 0.000 description 1
- MVZXTUSAYBWAAM-UHFFFAOYSA-N iron;sulfuric acid Chemical compound [Fe].OS(O)(=O)=O MVZXTUSAYBWAAM-UHFFFAOYSA-N 0.000 description 1
- 230000000302 ischemic Effects 0.000 description 1
- 229960003350 isoniazid Drugs 0.000 description 1
- 229960004427 isradipine Drugs 0.000 description 1
- 201000004815 juvenile spinal muscular atrophy Diseases 0.000 description 1
- BJHIKXHVCXFQLS-PYWDMBMJSA-N keto-D-sorbose Chemical compound OC[C@@H](O)[C@H](O)[C@@H](O)C(=O)CO BJHIKXHVCXFQLS-PYWDMBMJSA-N 0.000 description 1
- 229960000991 ketoprofen Drugs 0.000 description 1
- 229960004752 ketorolac Drugs 0.000 description 1
- BWHLPLXXIDYSNW-UHFFFAOYSA-N ketorolac tromethamine Chemical compound OCC(N)(CO)CO.OC(=O)C1CCN2C1=CC=C2C(=O)C1=CC=CC=C1 BWHLPLXXIDYSNW-UHFFFAOYSA-N 0.000 description 1
- 230000003907 kidney function Effects 0.000 description 1
- 229960001848 lamotrigine Drugs 0.000 description 1
- 229960003174 lansoprazole Drugs 0.000 description 1
- 201000010901 lateral sclerosis Diseases 0.000 description 1
- POULHZVOKOAJMA-UHFFFAOYSA-M laurate Chemical compound CCCCCCCCCCCC([O-])=O POULHZVOKOAJMA-UHFFFAOYSA-M 0.000 description 1
- 101700036391 lecA Proteins 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 229960000681 leflunomide Drugs 0.000 description 1
- 230000003902 lesions Effects 0.000 description 1
- GFIJNRVAKGFPGQ-LIJARHBVSA-N leuprolide Chemical compound CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 GFIJNRVAKGFPGQ-LIJARHBVSA-N 0.000 description 1
- 229960001614 levamisole Drugs 0.000 description 1
- DNTDOBSIBZKFCP-YDALLXLXSA-N levobunolol hydrochloride Chemical compound [Cl-].O=C1CCCC2=C1C=CC=C2OC[C@@H](O)C[NH2+]C(C)(C)C DNTDOBSIBZKFCP-YDALLXLXSA-N 0.000 description 1
- 229960004502 levodopa Drugs 0.000 description 1
- 229960004400 levonorgestrel Drugs 0.000 description 1
- YDTFRJLNMPSCFM-YDALLXLXSA-M levothyroxine sodium anhydrous Chemical compound [Na+].IC1=CC(C[C@H](N)C([O-])=O)=CC(I)=C1OC1=CC(I)=C(O)C(I)=C1 YDTFRJLNMPSCFM-YDALLXLXSA-M 0.000 description 1
- 101700063973 lgg-1 Proteins 0.000 description 1
- 101700079891 lgg-2 Proteins 0.000 description 1
- 229960002809 lindane Drugs 0.000 description 1
- SBXXSUDPJJJJLC-YDALLXLXSA-M liothyronine sodium Chemical compound [Na+].IC1=CC(C[C@H](N)C([O-])=O)=CC(I)=C1OC1=CC=C(O)C(I)=C1 SBXXSUDPJJJJLC-YDALLXLXSA-M 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- RLAWWYSOJDYHDC-BZSNNMDCSA-N lisinopril Chemical compound C([C@H](N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(O)=O)C(O)=O)CC1=CC=CC=C1 RLAWWYSOJDYHDC-BZSNNMDCSA-N 0.000 description 1
- XGZVUEUWXADBQD-UHFFFAOYSA-L lithium carbonate Chemical compound [Li+].[Li+].[O-]C([O-])=O XGZVUEUWXADBQD-UHFFFAOYSA-L 0.000 description 1
- 229910052808 lithium carbonate Inorganic materials 0.000 description 1
- 201000009673 liver disease Diseases 0.000 description 1
- 231100000835 liver failure Toxicity 0.000 description 1
- 229960001977 loracarbef Drugs 0.000 description 1
- 229960004391 lorazepam Drugs 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 229960004844 lovastatin Drugs 0.000 description 1
- YQZBAXDVDZTKEQ-UHFFFAOYSA-N loxapine succinate Chemical compound [H+].[H+].[O-]C(=O)CCC([O-])=O.C1CN(C)CCN1C1=NC2=CC=CC=C2OC2=CC=C(Cl)C=C12 YQZBAXDVDZTKEQ-UHFFFAOYSA-N 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- 108009000345 mRNA Processing Proteins 0.000 description 1
- 229960003640 mafenide Drugs 0.000 description 1
- 229960004018 magaldrate Drugs 0.000 description 1
- 235000002538 magnesium citrate Nutrition 0.000 description 1
- 239000004337 magnesium citrate Substances 0.000 description 1
- 229960005336 magnesium citrate Drugs 0.000 description 1
- 229960000816 magnesium hydroxide Drugs 0.000 description 1
- 239000000395 magnesium oxide Substances 0.000 description 1
- 229960000869 magnesium oxide Drugs 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 201000004792 malaria Diseases 0.000 description 1
- PEEHTFAAVSWFBL-UHFFFAOYSA-N maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 1
- 201000006812 malignant histiocytosis Diseases 0.000 description 1
- PWHULOQIROXLJO-UHFFFAOYSA-N manganese Chemical compound [Mn] PWHULOQIROXLJO-UHFFFAOYSA-N 0.000 description 1
- 229910052748 manganese Inorganic materials 0.000 description 1
- 239000011572 manganese Substances 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 101700001016 mbhA Proteins 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 229960004616 medroxyprogesterone Drugs 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- QWIZNVHXZXRPDR-WSCXOGSTSA-N melezitose Chemical compound O([C@@]1(O[C@@H]([C@H]([C@@H]1O[C@@H]1[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O1)O)O)CO)CO)[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O QWIZNVHXZXRPDR-WSCXOGSTSA-N 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- 201000009906 meningitis Diseases 0.000 description 1
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- 229960002260 meropenem Drugs 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- XZWYZXLIPXDOLR-UHFFFAOYSA-N metformin Chemical compound CN(C)C(=N)NC(N)=N XZWYZXLIPXDOLR-UHFFFAOYSA-N 0.000 description 1
- DASQOOZCTWOQPA-GXKRWWSZSA-L methotrexate disodium Chemical compound [Na+].[Na+].C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC([O-])=O)C([O-])=O)C=C1 DASQOOZCTWOQPA-GXKRWWSZSA-L 0.000 description 1
- VKQFCGNPDRICFG-UHFFFAOYSA-N methyl 2-methylpropyl 2,6-dimethyl-4-(2-nitrophenyl)-1,4-dihydropyridine-3,5-dicarboxylate Chemical compound COC(=O)C1=C(C)NC(C)=C(C(=O)OCC(C)C)C1C1=CC=CC=C1[N+]([O-])=O VKQFCGNPDRICFG-UHFFFAOYSA-N 0.000 description 1
- OJLOPKGSLYJEMD-URPKTTJQSA-N methyl 7-[(1R,2R,3R)-3-hydroxy-2-[(1E)-4-hydroxy-4-methyloct-1-en-1-yl]-5-oxocyclopentyl]heptanoate Chemical compound CCCCC(C)(O)C\C=C\[C@H]1[C@H](O)CC(=O)[C@@H]1CCCCCCC(=O)OC OJLOPKGSLYJEMD-URPKTTJQSA-N 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- 229960004584 methylprednisolone Drugs 0.000 description 1
- 229960001293 methylprednisolone acetate Drugs 0.000 description 1
- PLBHSZGDDKCEHR-LFYFAGGJSA-N methylprednisolone acetate Chemical compound C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2[C@@H](O)C[C@]2(C)[C@@](O)(C(=O)COC(C)=O)CC[C@H]21 PLBHSZGDDKCEHR-LFYFAGGJSA-N 0.000 description 1
- 229950009831 methylprednisolone succinate Drugs 0.000 description 1
- VAOCPAMSLUNLGC-UHFFFAOYSA-N metronidazole Chemical compound CC1=NC=C([N+]([O-])=O)N1CCO VAOCPAMSLUNLGC-UHFFFAOYSA-N 0.000 description 1
- 239000003094 microcapsule Substances 0.000 description 1
- MGCQZNBCJBRZDT-UHFFFAOYSA-N midodrine hydrochloride Chemical compound [H+].[Cl-].COC1=CC=C(OC)C(C(O)CNC(=O)CN)=C1 MGCQZNBCJBRZDT-UHFFFAOYSA-N 0.000 description 1
- 229960002728 midodrine hydrochloride Drugs 0.000 description 1
- 229960001110 miglitol Drugs 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 230000003547 miosis Effects 0.000 description 1
- 239000003604 miotic agent Substances 0.000 description 1
- 229960005249 misoprostol Drugs 0.000 description 1
- 230000002438 mitochondrial Effects 0.000 description 1
- 239000002829 mitogen activated protein kinase inhibitor Substances 0.000 description 1
- 230000002297 mitogenic Effects 0.000 description 1
- 239000011812 mixed powder Substances 0.000 description 1
- 229960001165 modafinil Drugs 0.000 description 1
- 239000003607 modifier Substances 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 229960002744 mometasone furoate Drugs 0.000 description 1
- 150000002763 monocarboxylic acids Chemical class 0.000 description 1
- 229960000060 monoclonal antibodies Drugs 0.000 description 1
- GAQAKFHSULJNAK-UHFFFAOYSA-N moricizine hydrochloride Chemical compound [Cl-].C12=CC(NC(=O)OCC)=CC=C2SC2=CC=CC=C2N1C(=O)CC[NH+]1CCOCC1 GAQAKFHSULJNAK-UHFFFAOYSA-N 0.000 description 1
- 229960005181 morphine Drugs 0.000 description 1
- 229930014694 morphine Natural products 0.000 description 1
- XCKKIKBIPZJUET-VYKNHSEDSA-N morphine hydrochloride Chemical compound Cl.O([C@H]1[C@H](C=C[C@H]23)O)C4=C5[C@@]12CCN(C)[C@@H]3CC5=CC=C4O XCKKIKBIPZJUET-VYKNHSEDSA-N 0.000 description 1
- USAHOPJHPJHUNS-IFCNUISUSA-N morphine sulfate Chemical compound OS(O)(=O)=O.O([C@H]1[C@H](C=C[C@H]23)O)C4=C5[C@@]12CCN(C)[C@@H]3CC5=CC=C4O.O([C@H]1[C@H](C=C[C@H]23)O)C4=C5[C@@]12CCN(C)[C@@H]3CC5=CC=C4O USAHOPJHPJHUNS-IFCNUISUSA-N 0.000 description 1
- 230000003232 mucoadhesive Effects 0.000 description 1
- 201000000585 muscular atrophy Diseases 0.000 description 1
- 230000002107 myocardial Effects 0.000 description 1
- 201000002481 myositis Diseases 0.000 description 1
- AYAPZOUDXCDGIF-FRFVDRIFSA-M nafcillin sodium Chemical compound [Na+].C1=CC=CC2=C(C(=O)N[C@@H]3C(N4[C@H](C(C)(C)S[C@@H]43)C([O-])=O)=O)C(OCC)=CC=C21 AYAPZOUDXCDGIF-FRFVDRIFSA-M 0.000 description 1
- 229960004313 naftifine Drugs 0.000 description 1
- OZGNYLLQHRPOBR-DHZHZOJOSA-N naftifine Chemical compound C=1C=CC2=CC=CC=C2C=1CN(C)C\C=C\C1=CC=CC=C1 OZGNYLLQHRPOBR-DHZHZOJOSA-N 0.000 description 1
- YZLZPSJXMWGIFH-BCXQGASESA-N nalbuphine hydrochloride Chemical compound [H+].[Cl-].C([C@]12[C@H]3OC=4C(O)=CC=C(C2=4)C[C@@H]2[C@]1(O)CC[C@@H]3O)CN2CC1CCC1 YZLZPSJXMWGIFH-BCXQGASESA-N 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 150000002790 naphthalenes Chemical class 0.000 description 1
- 229960002009 naproxen Drugs 0.000 description 1
- CDBRNDSHEYLDJV-FVGYRXGTSA-M naproxen sodium Chemical compound [Na+].C1=C([C@H](C)C([O-])=O)C=CC2=CC(OC)=CC=C21 CDBRNDSHEYLDJV-FVGYRXGTSA-M 0.000 description 1
- 239000004084 narcotic analgesic agent Substances 0.000 description 1
- 201000011216 nasopharynx carcinoma Diseases 0.000 description 1
- 229920005615 natural polymer Polymers 0.000 description 1
- JQEKDNLKIVGXAU-UHFFFAOYSA-L nedocromil sodium Chemical compound [Na+].[Na+].CCN1C(C([O-])=O)=CC(=O)C2=C1C(CCC)=C1OC(C([O-])=O)=CC(=O)C1=C2 JQEKDNLKIVGXAU-UHFFFAOYSA-L 0.000 description 1
- DYCKFEBIOUQECE-UHFFFAOYSA-N nefazodone hydrochloride Chemical compound [H+].[Cl-].O=C1N(CCOC=2C=CC=CC=2)C(CC)=NN1CCCN(CC1)CCN1C1=CC=CC(Cl)=C1 DYCKFEBIOUQECE-UHFFFAOYSA-N 0.000 description 1
- NQHXCOAXSHGTIA-SKXNDZRYSA-N nelfinavir mesylate Chemical compound CS(O)(=O)=O.CC1=C(O)C=CC=C1C(=O)N[C@H]([C@H](O)CN1[C@@H](C[C@@H]2CCCC[C@@H]2C1)C(=O)NC(C)(C)C)CSC1=CC=CC=C1 NQHXCOAXSHGTIA-SKXNDZRYSA-N 0.000 description 1
- 230000001272 neurogenic Effects 0.000 description 1
- 201000001119 neuropathy Diseases 0.000 description 1
- 229910052759 nickel Inorganic materials 0.000 description 1
- 229960003966 nicotinamide Drugs 0.000 description 1
- 235000005152 nicotinamide Nutrition 0.000 description 1
- 239000011570 nicotinamide Substances 0.000 description 1
- 229960003512 nicotinic acid Drugs 0.000 description 1
- 235000001968 nicotinic acid Nutrition 0.000 description 1
- 239000011664 nicotinic acid Substances 0.000 description 1
- IOVCWXUNBOPUCH-UHFFFAOYSA-M nitrite anion Chemical compound [O-]N=O IOVCWXUNBOPUCH-UHFFFAOYSA-M 0.000 description 1
- 229920001894 non-coding RNA Polymers 0.000 description 1
- 239000002687 nonaqueous vehicle Substances 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 229960000993 norethisterone Drugs 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 201000008875 nutrition disease Diseases 0.000 description 1
- 229940060184 oil ingredients Drugs 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 229960005017 olanzapine Drugs 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 229920001542 oligosaccharide Polymers 0.000 description 1
- 150000002482 oligosaccharides Polymers 0.000 description 1
- 229960000381 omeprazole Drugs 0.000 description 1
- 230000000771 oncological Effects 0.000 description 1
- 229940005943 ophthalmologic Antivirals Drugs 0.000 description 1
- 229940005931 ophthalmologic Fluoroquinolone antiinfectives Drugs 0.000 description 1
- 229940005938 ophthalmologic antiinfectives Sulfonamides Drugs 0.000 description 1
- 108010046821 oprelvekin Proteins 0.000 description 1
- 229960001840 oprelvekin Drugs 0.000 description 1
- 201000005737 orchitis Diseases 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 150000002892 organic cations Chemical class 0.000 description 1
- 229920000620 organic polymer Polymers 0.000 description 1
- PGZUMBJQJWIWGJ-ONAKXNSWSA-N oseltamivir phosphate Chemical compound OP(O)(O)=O.CCOC(=O)C1=C[C@@H](OC(CC)CC)[C@H](NC(C)=O)[C@@H](N)C1 PGZUMBJQJWIWGJ-ONAKXNSWSA-N 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- VDUVBBMAXXHEQP-SLINCCQESA-M oxacillin sodium Chemical compound [Na+].N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C([O-])=O)=O)C(=O)C1=C(C)ON=C1C1=CC=CC=C1 VDUVBBMAXXHEQP-SLINCCQESA-M 0.000 description 1
- 229960002739 oxaprozin Drugs 0.000 description 1
- 229960004535 oxazepam Drugs 0.000 description 1
- 239000007800 oxidant agent Substances 0.000 description 1
- 229960002085 oxycodone Drugs 0.000 description 1
- MUZQPDBAOYKNLO-RKXJKUSZSA-N oxycodone hydrochloride Chemical compound [H+].[Cl-].O=C([C@@H]1O2)CC[C@@]3(O)[C@H]4CC5=CC=C(OC)C2=C5[C@@]13CCN4C MUZQPDBAOYKNLO-RKXJKUSZSA-N 0.000 description 1
- RZVAJINKPMORJF-UHFFFAOYSA-N p-acetaminophenol Chemical compound CC(=O)NC1=CC=C(O)C=C1 RZVAJINKPMORJF-UHFFFAOYSA-N 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 229960000402 palivizumab Drugs 0.000 description 1
- NPIJXCQZLFKBMV-YTGGZNJNSA-L pancuronium bromide Chemical compound [Br-].[Br-].C[N+]1([C@@H]2[C@@H](OC(C)=O)C[C@@H]3CC[C@H]4[C@@H]5C[C@@H]([C@@H]([C@]5(CC[C@@H]4[C@@]3(C)C2)C)OC(=O)C)[N+]2(C)CCCCC2)CCCCC1 NPIJXCQZLFKBMV-YTGGZNJNSA-L 0.000 description 1
- 229960005489 paracetamol Drugs 0.000 description 1
- 230000003071 parasitic Effects 0.000 description 1
- 230000000849 parathyroid Effects 0.000 description 1
- 230000001314 paroxysmal Effects 0.000 description 1
- 229960001744 pegaspargase Drugs 0.000 description 1
- 108010001564 pegaspargase Proteins 0.000 description 1
- 201000006518 pelvic inflammatory disease Diseases 0.000 description 1
- 229940056365 penicillin G benzathine Drugs 0.000 description 1
- 235000019371 penicillin G benzathine Nutrition 0.000 description 1
- 235000019368 penicillin G potassium Nutrition 0.000 description 1
- 229940056362 penicillin G procaine Drugs 0.000 description 1
- 235000019370 penicillin G procaine Nutrition 0.000 description 1
- 235000019369 penicillin G sodium Nutrition 0.000 description 1
- 150000002960 penicillins Chemical class 0.000 description 1
- XYJRXVWERLGGKC-UHFFFAOYSA-D pentacalcium;hydroxide;triphosphate Chemical compound [OH-].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O XYJRXVWERLGGKC-UHFFFAOYSA-D 0.000 description 1
- 229960005301 pentazocine Drugs 0.000 description 1
- 239000002304 perfume Substances 0.000 description 1
- UWCVGPLTGZWHGS-ZORIOUSZSA-N pergolide mesylate Chemical compound CS(O)(=O)=O.C1=CC([C@H]2C[C@@H](CSC)CN([C@@H]2C2)CCC)=C3C2=CNC3=C1 UWCVGPLTGZWHGS-ZORIOUSZSA-N 0.000 description 1
- IYNMDWMQHSMDDE-MHXJNQAMSA-N perindopril erbumine Chemical compound CC(C)(C)N.C1CCC[C@@H]2N(C(=O)[C@H](C)N[C@@H](CCC)C(=O)OCC)[C@H](C(O)=O)C[C@@H]21 IYNMDWMQHSMDDE-MHXJNQAMSA-N 0.000 description 1
- 230000000737 periodic Effects 0.000 description 1
- 230000035699 permeability Effects 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 229960000482 pethidine Drugs 0.000 description 1
- 235000019271 petrolatum Nutrition 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 239000008180 pharmaceutical surfactant Substances 0.000 description 1
- 230000003285 pharmacodynamic Effects 0.000 description 1
- 229960004331 phenoxymethylpenicillin Drugs 0.000 description 1
- NCAIGTHBQTXTLR-UHFFFAOYSA-N phentermine hydrochloride Chemical compound [Cl-].CC(C)([NH3+])CC1=CC=CC=C1 NCAIGTHBQTXTLR-UHFFFAOYSA-N 0.000 description 1
- MRBDMNSDAVCSSF-UHFFFAOYSA-N phentolamine Chemical compound C1=CC(C)=CC=C1N(C=1C=C(O)C=CC=1)CC1=NCCN1 MRBDMNSDAVCSSF-UHFFFAOYSA-N 0.000 description 1
- 229940080469 phosphocellulose Drugs 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- PTMHPRAIXMAOOB-UHFFFAOYSA-L phosphoramidate Chemical compound NP([O-])([O-])=O PTMHPRAIXMAOOB-UHFFFAOYSA-L 0.000 description 1
- 125000002743 phosphorus functional group Chemical group 0.000 description 1
- 101710031800 phtx Proteins 0.000 description 1
- 235000019175 phylloquinone Nutrition 0.000 description 1
- 239000011772 phylloquinone Substances 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 230000035479 physiological effects, processes and functions Effects 0.000 description 1
- HZOTZTANVBDFOF-PBCQUBLHSA-N physostigmine salicylate Chemical compound OC(=O)C1=CC=CC=C1O.C12=CC(OC(=O)NC)=CC=C2N(C)[C@@H]2[C@@]1(C)CCN2C HZOTZTANVBDFOF-PBCQUBLHSA-N 0.000 description 1
- 229960002516 physostigmine salicylate Drugs 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 229960001416 pilocarpine Drugs 0.000 description 1
- 229960003634 pimozide Drugs 0.000 description 1
- 229960002508 pindolol Drugs 0.000 description 1
- 229960002702 piroxicam Drugs 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 201000000317 pneumocystosis Diseases 0.000 description 1
- 239000002574 poison Substances 0.000 description 1
- 231100000572 poisoning Toxicity 0.000 description 1
- 230000000607 poisoning Effects 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229940116406 poloxamer 184 Drugs 0.000 description 1
- 229920001993 poloxamer 188 Polymers 0.000 description 1
- 229920000724 poly(L-arginine) polymer Polymers 0.000 description 1
- 229920001308 poly(aminoacid) Polymers 0.000 description 1
- 229920002627 poly(phosphazenes) Polymers 0.000 description 1
- 108010011110 polyarginine Proteins 0.000 description 1
- 108010064470 polyaspartate Proteins 0.000 description 1
- 230000000581 polycythemic Effects 0.000 description 1
- 229920002643 polyglutamic acid Polymers 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229920002503 polyoxyethylene-polyoxypropylene Polymers 0.000 description 1
- 108010084828 polypeptide oleate condensate Proteins 0.000 description 1
- 150000007519 polyprotic acids Polymers 0.000 description 1
- 230000002980 postoperative Effects 0.000 description 1
- 239000011736 potassium bicarbonate Substances 0.000 description 1
- 235000015497 potassium bicarbonate Nutrition 0.000 description 1
- 229910000028 potassium bicarbonate Inorganic materials 0.000 description 1
- 229940094025 potassium bicarbonate Drugs 0.000 description 1
- 239000001103 potassium chloride Substances 0.000 description 1
- 235000011164 potassium chloride Nutrition 0.000 description 1
- 229960002816 potassium chloride Drugs 0.000 description 1
- 239000004224 potassium gluconate Substances 0.000 description 1
- 235000013926 potassium gluconate Nutrition 0.000 description 1
- 229960003189 potassium gluconate Drugs 0.000 description 1
- 230000036515 potency Effects 0.000 description 1
- QMNWXHSYPXQFSK-KLXURFKVSA-N pramipexole hydrochloride anhydrous Chemical compound Cl.Cl.C1[C@@H](NCCC)CCC2=C1SC(N)=N2 QMNWXHSYPXQFSK-KLXURFKVSA-N 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- OZAIFHULBGXAKX-UHFFFAOYSA-N precursor Substances N#CC(C)(C)N=NC(C)(C)C#N OZAIFHULBGXAKX-UHFFFAOYSA-N 0.000 description 1
- 229960002800 prednisolone acetate Drugs 0.000 description 1
- 229960004618 prednisone Drugs 0.000 description 1
- 230000002028 premature Effects 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 150000003141 primary amines Chemical class 0.000 description 1
- 201000008312 primary pulmonary hypertension Diseases 0.000 description 1
- 229960002393 primidone Drugs 0.000 description 1
- ABTXGJFUQRCPNH-UHFFFAOYSA-N procainamide hydrochloride Chemical compound [H+].[Cl-].CCN(CC)CCNC(=O)C1=CC=C(N)C=C1 ABTXGJFUQRCPNH-UHFFFAOYSA-N 0.000 description 1
- DERJYEZSLHIUKF-UHFFFAOYSA-N procarbazine hydrochloride Chemical compound Cl.CNNCC1=CC=C(C(=O)NC(C)C)C=C1 DERJYEZSLHIUKF-UHFFFAOYSA-N 0.000 description 1
- 229960003387 progesterone Drugs 0.000 description 1
- 239000000186 progesterone Substances 0.000 description 1
- 239000000583 progesterone congener Substances 0.000 description 1
- 230000005522 programmed cell death Effects 0.000 description 1
- 230000000750 progressive Effects 0.000 description 1
- 230000002035 prolonged Effects 0.000 description 1
- XWIHRGFIPXWGEF-UHFFFAOYSA-N propafenone hydrochloride Chemical compound Cl.CCCNCC(O)COC1=CC=CC=C1C(=O)CCC1=CC=CC=C1 XWIHRGFIPXWGEF-UHFFFAOYSA-N 0.000 description 1
- 229960004134 propofol Drugs 0.000 description 1
- 229940069959 propoxyphene napsylate Drugs 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- BALXUFOVQVENIU-KXNXZCPBSA-N pseudoephedrine hydrochloride Chemical compound [H+].[Cl-].CN[C@@H](C)[C@@H](O)C1=CC=CC=C1 BALXUFOVQVENIU-KXNXZCPBSA-N 0.000 description 1
- 239000012264 purified product Substances 0.000 description 1
- 239000003379 purinergic P1 receptor agonist Substances 0.000 description 1
- 239000002728 pyrethroid Substances 0.000 description 1
- ZUFQODAHGAHPFQ-UHFFFAOYSA-N pyridoxine hydrochloride Chemical compound Cl.CC1=NC=C(CO)C(CO)=C1O ZUFQODAHGAHPFQ-UHFFFAOYSA-N 0.000 description 1
- 235000019171 pyridoxine hydrochloride Nutrition 0.000 description 1
- 239000011764 pyridoxine hydrochloride Substances 0.000 description 1
- 229960000611 pyrimethamine Drugs 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- IBBLRJGOOANPTQ-JKVLGAQCSA-N quinapril hydrochloride Chemical compound Cl.C([C@@H](C(=O)OCC)N[C@@H](C)C(=O)N1[C@@H](CC2=CC=CC=C2C1)C(O)=O)CC1=CC=CC=C1 IBBLRJGOOANPTQ-JKVLGAQCSA-N 0.000 description 1
- 229960001404 quinidine Drugs 0.000 description 1
- XHKUDCCTVQUHJQ-LCYSNFERSA-N quinidine D-gluconate Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)=O.C([C@H]([C@H](C1)C=C)C2)C[N@@]1[C@H]2[C@@H](O)C1=CC=NC2=CC=C(OC)C=C21 XHKUDCCTVQUHJQ-LCYSNFERSA-N 0.000 description 1
- 229960002693 quinidine bisulfate Drugs 0.000 description 1
- 229960002454 quinidine gluconate Drugs 0.000 description 1
- 230000002285 radioactive Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- WFBMIPUMYUHANP-UHFFFAOYSA-N remifentanil hydrochloride Chemical compound [Cl-].C1C[NH+](CCC(=O)OC)CCC1(C(=O)OC)N(C(=O)CC)C1=CC=CC=C1 WFBMIPUMYUHANP-UHFFFAOYSA-N 0.000 description 1
- 230000000268 renotropic Effects 0.000 description 1
- 201000003099 renovascular hypertension Diseases 0.000 description 1
- 229960002354 repaglinide Drugs 0.000 description 1
- 230000035812 respiration Effects 0.000 description 1
- 230000029058 respiratory gaseous exchange Effects 0.000 description 1
- 108091007521 restriction endonucleases Proteins 0.000 description 1
- 108010051412 reteplase Proteins 0.000 description 1
- 229960003471 retinol Drugs 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 235000019192 riboflavin Nutrition 0.000 description 1
- 239000002151 riboflavin Substances 0.000 description 1
- 229960000885 rifabutin Drugs 0.000 description 1
- 229960001225 rifampicin Drugs 0.000 description 1
- 229960002599 rifapentine Drugs 0.000 description 1
- 229960000311 ritonavir Drugs 0.000 description 1
- 229960003682 rocuronium bromide Drugs 0.000 description 1
- OYTJKRAYGYRUJK-FMCCZJBLSA-M rocuronium bromide Chemical compound [Br-].N1([C@@H]2[C@@H](O)C[C@@H]3CC[C@H]4[C@@H]5C[C@@H]([C@@H]([C@]5(CC[C@@H]4[C@@]3(C)C2)C)OC(=O)C)[N+]2(CC=C)CCCC2)CCOCC1 OYTJKRAYGYRUJK-FMCCZJBLSA-M 0.000 description 1
- 229960000371 rofecoxib Drugs 0.000 description 1
- HJORMJIFDVBMOB-UHFFFAOYSA-N rolipram Chemical compound COC1=CC=C(C2CC(=O)NC2)C=C1OC1CCCC1 HJORMJIFDVBMOB-UHFFFAOYSA-N 0.000 description 1
- 229950005741 rolipram Drugs 0.000 description 1
- 229960001879 ropinirole Drugs 0.000 description 1
- SUFUKZSWUHZXAV-BTJKTKAUSA-N rosiglitazone maleate Chemical compound [H+].[H+].[O-]C(=O)\C=C/C([O-])=O.C=1C=CC=NC=1N(C)CCOC(C=C1)=CC=C1CC1SC(=O)NC1=O SUFUKZSWUHZXAV-BTJKTKAUSA-N 0.000 description 1
- 239000005060 rubber Substances 0.000 description 1
- 229960002052 salbutamol Drugs 0.000 description 1
- 238000003118 sandwich ELISA Methods 0.000 description 1
- 229960003542 saquinavir mesylate Drugs 0.000 description 1
- 230000003248 secreting Effects 0.000 description 1
- 230000004799 sedative–hypnotic effect Effects 0.000 description 1
- IYETZZCWLLUHIJ-UTONKHPSSA-N selegiline hydrochloride Chemical compound [Cl-].C#CC[NH+](C)[C@H](C)CC1=CC=CC=C1 IYETZZCWLLUHIJ-UTONKHPSSA-N 0.000 description 1
- 229960003678 selegiline hydrochloride Drugs 0.000 description 1
- BUGBHKTXTAQXES-UHFFFAOYSA-N selenium Chemical compound [Se] BUGBHKTXTAQXES-UHFFFAOYSA-N 0.000 description 1
- 229910052711 selenium Inorganic materials 0.000 description 1
- 239000011669 selenium Substances 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 201000001223 septic arthritis Diseases 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 229960002930 sirolimus Drugs 0.000 description 1
- 239000000176 sodium gluconate Substances 0.000 description 1
- 235000012207 sodium gluconate Nutrition 0.000 description 1
- 235000009518 sodium iodide Nutrition 0.000 description 1
- 239000001540 sodium lactate Substances 0.000 description 1
- 235000011088 sodium lactate Nutrition 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- GXOMMGAFBINOJY-SLINCCQESA-N sodium;(2S,5R,6R)-6-[[3-(2,6-dichlorophenyl)-5-methyl-1,2-oxazole-4-carbonyl]amino]-3,3-dimethyl-7-oxo-4-thia-1-azabicyclo[3.2.0]heptane-2-carboxylic acid Chemical compound [Na+].N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C1=C(C)ON=C1C1=C(Cl)C=CC=C1Cl GXOMMGAFBINOJY-SLINCCQESA-N 0.000 description 1
- SCLZRKVZRBKZCR-SLINCCQESA-N sodium;(2S,5R,6R)-6-[[3-(2-chlorophenyl)-5-methyl-1,2-oxazole-4-carbonyl]amino]-3,3-dimethyl-7-oxo-4-thia-1-azabicyclo[3.2.0]heptane-2-carboxylic acid Chemical compound [Na+].N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C1=C(C)ON=C1C1=CC=CC=C1Cl SCLZRKVZRBKZCR-SLINCCQESA-N 0.000 description 1
- YOBPSXOHCHDCMU-IXIFSOOLSA-M sodium;(6R,7R)-7-[[(2E)-2-(2-amino-1,3-thiazol-4-yl)-2-methoxyiminoacetyl]amino]-3-[(2-methyl-5,6-dioxo-1H-1,2,4-triazin-3-yl)sulfanylmethyl]-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylate Chemical compound [Na+].S([C@@H]1[C@@H](C(N1C=1C([O-])=O)=O)NC(=O)/C(=N/OC)C=2N=C(N)SC=2)CC=1CSC1=NC(=O)C(O)=NN1C YOBPSXOHCHDCMU-IXIFSOOLSA-M 0.000 description 1
- NCFTXMQPRQZFMZ-KHLPVGQYSA-M sodium;(6R,7R)-7-[[2-[(4-ethyl-2,3-dioxopiperazine-1-carbonyl)amino]-2-(4-hydroxyphenyl)acetyl]amino]-3-[(1-methyltetrazol-5-yl)sulfanylmethyl]-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylate Chemical compound [Na+].O=C1C(=O)N(CC)CCN1C(=O)NC(C=1C=CC(O)=CC=1)C(=O)N[C@@H]1C(=O)N2C(C([O-])=O)=C(CSC=3N(N=NN=3)C)CS[C@@H]21 NCFTXMQPRQZFMZ-KHLPVGQYSA-M 0.000 description 1
- UHYAQBLOGVNWNT-UHFFFAOYSA-M sodium;2-[1-(4-chlorobenzoyl)-5-methoxy-2-methylindol-3-yl]acetate;trihydrate Chemical compound O.O.O.[Na+].CC1=C(CC([O-])=O)C2=CC(OC)=CC=C2N1C(=O)C1=CC=C(Cl)C=C1 UHYAQBLOGVNWNT-UHFFFAOYSA-M 0.000 description 1
- FJPYVLNWWICYDW-UHFFFAOYSA-M sodium;5,5-diphenylimidazolidin-1-ide-2,4-dione Chemical compound [Na+].O=C1[N-]C(=O)NC1(C=1C=CC=CC=1)C1=CC=CC=C1 FJPYVLNWWICYDW-UHFFFAOYSA-M 0.000 description 1
- 229960003259 somatrem Drugs 0.000 description 1
- 229960004532 somatropin Drugs 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- WSWCOQWTEOXDQX-UHFFFAOYSA-N sorbic acid Chemical compound CC=CC=CC(O)=O WSWCOQWTEOXDQX-UHFFFAOYSA-N 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 229960002920 sorbitol Drugs 0.000 description 1
- 229960000887 spectinomycin hydrochloride Drugs 0.000 description 1
- DCHJOVNPPSBWHK-UXXUFHFZSA-N spectinomycin hydrochloride hydrate Chemical compound O.O.O.O.O.Cl.Cl.O([C@@H]1[C@@H](NC)[C@@H](O)[C@H]([C@@H]([C@H]1O1)O)NC)[C@]2(O)[C@H]1O[C@H](C)CC2=O DCHJOVNPPSBWHK-UXXUFHFZSA-N 0.000 description 1
- 229960002256 spironolactone Drugs 0.000 description 1
- 238000001694 spray drying Methods 0.000 description 1
- 239000008174 sterile solution Substances 0.000 description 1
- 230000004936 stimulating Effects 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 239000001384 succinic acid Substances 0.000 description 1
- 229960005404 sulfamethoxazole Drugs 0.000 description 1
- 150000003456 sulfonamides Chemical class 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 239000011593 sulfur Substances 0.000 description 1
- JLKIGFTWXXRPMT-UHFFFAOYSA-N sulphamethoxazole Chemical compound O1C(C)=CC(NS(=O)(=O)C=2C=CC(N)=CC=2)=N1 JLKIGFTWXXRPMT-UHFFFAOYSA-N 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 229960001531 suxamethonium Drugs 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 229920001059 synthetic polymer Polymers 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 229940041075 systemic Fluoroquinolone antibacterials Drugs 0.000 description 1
- 229920002258 tannic acid Polymers 0.000 description 1
- 235000015523 tannic acid Nutrition 0.000 description 1
- 229920001864 tannin Polymers 0.000 description 1
- 239000001648 tannin Substances 0.000 description 1
- 235000018553 tannin Nutrition 0.000 description 1
- 229930003347 taxol Natural products 0.000 description 1
- 229960001909 terazosin hydrochloride Drugs 0.000 description 1
- 229960000580 terconazole Drugs 0.000 description 1
- JDMUZPCDCYZTJA-UHFFFAOYSA-N tert-butyl 2,2-diaminoheptanoate Chemical compound CCCCCC(N)(N)C(=O)OC(C)(C)C JDMUZPCDCYZTJA-UHFFFAOYSA-N 0.000 description 1
- AOCSUUGBCMTKJH-UHFFFAOYSA-N tert-butyl N-(2-aminoethyl)carbamate Chemical compound CC(C)(C)OC(=O)NCCN AOCSUUGBCMTKJH-UHFFFAOYSA-N 0.000 description 1
- 125000005931 tert-butyloxycarbonyl group Chemical group [H]C([H])([H])C(OC(*)=O)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 229960000921 testosterone cypionate Drugs 0.000 description 1
- HPFVBGJFAYZEBE-ZLQWOROUSA-N testosterone cypionate Chemical compound O([C@H]1CC[C@H]2[C@H]3[C@@H]([C@]4(CCC(=O)C=C4CC3)C)CC[C@@]21C)C(=O)CCC1CCCC1 HPFVBGJFAYZEBE-ZLQWOROUSA-N 0.000 description 1
- 229960001423 tetracosactide Drugs 0.000 description 1
- 229960004989 tetracycline hydrochloride Drugs 0.000 description 1
- UWHCKJMYHZGTIT-UHFFFAOYSA-N tetraethylene glycol Chemical compound OCCOCCOCCOCCO UWHCKJMYHZGTIT-UHFFFAOYSA-N 0.000 description 1
- 150000004044 tetrasaccharides Chemical class 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- RVBRTNPNFYFDMZ-SPIKMXEPSA-N thiethylperazine maleate Chemical compound [H+].[H+].[H+].[H+].[O-]C(=O)\C=C/C([O-])=O.[O-]C(=O)\C=C/C([O-])=O.C12=CC(SCC)=CC=C2SC2=CC=CC=C2N1CCCN1CCN(C)CC1 RVBRTNPNFYFDMZ-SPIKMXEPSA-N 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- NZFNXWQNBYZDAQ-UHFFFAOYSA-N thioridazine hydrochloride Chemical compound Cl.C12=CC(SC)=CC=C2SC2=CC=CC=C2N1CCC1CCCCN1C NZFNXWQNBYZDAQ-UHFFFAOYSA-N 0.000 description 1
- MTKNGOHFNXIVOS-UHFFFAOYSA-N ticlopidine hydrochloride Chemical compound [H+].[Cl-].ClC1=CC=CC=C1CN1CC(C=CS2)=C2CC1 MTKNGOHFNXIVOS-UHFFFAOYSA-N 0.000 description 1
- 229960004880 tolnaftate Drugs 0.000 description 1
- 229940026754 topical Antivirals Drugs 0.000 description 1
- 229940026752 topical Sulfonamides Drugs 0.000 description 1
- 229960004394 topiramate Drugs 0.000 description 1
- 125000005490 tosylate group Chemical group 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 230000002103 transcriptional Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 230000001052 transient Effects 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 229940086542 triethylamine Drugs 0.000 description 1
- CUZMOIXUFHOLLN-UMVVUDSKSA-N triprolidine hydrochloride monohydrate Chemical compound O.Cl.C1=CC(C)=CC=C1C(\C=1N=CC=CC=1)=C/CN1CCCC1 CUZMOIXUFHOLLN-UMVVUDSKSA-N 0.000 description 1
- 150000004043 trisaccharides Chemical class 0.000 description 1
- 229960001641 troglitazone Drugs 0.000 description 1
- 229960000281 trometamol Drugs 0.000 description 1
- 229960004791 tropicamide Drugs 0.000 description 1
- 239000002753 trypsin inhibitor Substances 0.000 description 1
- 201000008827 tuberculosis Diseases 0.000 description 1
- 229910052721 tungsten Inorganic materials 0.000 description 1
- 238000002604 ultrasonography Methods 0.000 description 1
- 229960000653 valrubicin Drugs 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 239000005526 vasoconstrictor agent Substances 0.000 description 1
- 229960003726 vasopressin Drugs 0.000 description 1
- VEPSYABRBFXYIB-PWXDFCLTSA-M vecuronium bromide Chemical compound [Br-].N1([C@@H]2[C@@H](OC(C)=O)C[C@@H]3CC[C@H]4[C@@H]5C[C@@H]([C@@H]([C@]5(CC[C@@H]4[C@@]3(C)C2)C)OC(=O)C)[N+]2(C)CCCCC2)CCCCC1 VEPSYABRBFXYIB-PWXDFCLTSA-M 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- QYRYFNHXARDNFZ-UHFFFAOYSA-N venlafaxine hydrochloride Chemical compound [H+].[Cl-].C1=CC(OC)=CC=C1C(CN(C)C)C1(O)CCCCC1 QYRYFNHXARDNFZ-UHFFFAOYSA-N 0.000 description 1
- ZTHWFVSEMLMLKT-CAMOTBBTSA-N vidarabine monohydrate Chemical compound O.C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1O ZTHWFVSEMLMLKT-CAMOTBBTSA-N 0.000 description 1
- KDQAABAKXDWYSZ-JKDPCDLQSA-N vincaleukoblastine sulfate Chemical compound OS(O)(=O)=O.C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 KDQAABAKXDWYSZ-JKDPCDLQSA-N 0.000 description 1
- GBABOYUKABKIAF-IELIFDKJSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-IELIFDKJSA-N 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- 230000003612 virological Effects 0.000 description 1
- 235000019155 vitamin A Nutrition 0.000 description 1
- 239000011719 vitamin A Substances 0.000 description 1
- 235000019166 vitamin D Nutrition 0.000 description 1
- 239000011710 vitamin D Substances 0.000 description 1
- 150000003710 vitamin D derivatives Chemical class 0.000 description 1
- 235000001892 vitamin D2 Nutrition 0.000 description 1
- 239000011653 vitamin D2 Substances 0.000 description 1
- 235000005282 vitamin D3 Nutrition 0.000 description 1
- 239000011647 vitamin D3 Substances 0.000 description 1
- QYSXJUFSXHHAJI-YRZJJWOYSA-N vitamin D3 Chemical compound C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C\C=C1\C[C@@H](O)CCC1=C QYSXJUFSXHHAJI-YRZJJWOYSA-N 0.000 description 1
- 150000003722 vitamin derivatives Chemical class 0.000 description 1
- 239000002023 wood Substances 0.000 description 1
- 229910052727 yttrium Inorganic materials 0.000 description 1
- 229960000523 zalcitabine Drugs 0.000 description 1
- 229960004010 zaleplon Drugs 0.000 description 1
- 229960001475 zolpidem Drugs 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N α-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
Abstract
The present invention relates to at least one novel human EPO mimetic hinge core mimetibody or specified portion or variant, including isolated nucleic acids that encode at least one EPO mimetic hinge core mimetibody or specified portion or variant, EPO mimetic hinge core mimetibody or specified portion or variants, vectors, host cells, transgenic animals or plants, and methods of making and using thereof, including therapeutic compositions, methods and devices.
Description
CENTRAL HUMAN MIMETICUERPOSES OF THE HIPPER REGION, MIMETICS OF ERYTHROPOYETINE, COMPOSITIONS. METHODS AND USES
FIELD OF THE INVENTION
The present invention relates to central mimetibodies of the hinge region, mammalian EPO mimetics, specific portions and specific variants for biologically active proteins, fragments or ligands, nucleic acids encoding and complementary to a central mimetibody of the hinge region. , EPO mimetic, host cells and methods for making and using same, including, formulations, administration and therapeutic devices.
BACKGROUND OF THE INVENTION
Recombinant proteins are an emerging class of therapeutic agents. Such recombinant therapeutic agents have produced advances in the chemical formulation and modification of proteins. Such modifications can potentially improve the therapeutic utility of therapeutic proteins, such as increasing half-lives (for example, by blocking their exposure to proteolytic enzymes), improving biological activity or reducing unwanted side effects. A
Such modification is the use of immunoglobulin fragments fused to receptor proteins, such as an enterocept. Therapeutic proteins have also been constructed using the Fc domain to try to provide a longer half-life or to incorporate functions such as Fc receptor binding, protein A binding and complement fixation. A specific and vital role of the mammalian hematopoietic system is the production of erythrocytes or red blood cells, which transport oxygen to the various tissues of the animal's body. The procedure to produce erythrocytes ("erythropoiesis") occurs continuously during the life of the animal to counteract the destruction of erythrocytes. The typical red blood cell has a relatively short life, usually 100 to 120 days. Erythropoiesis is a precisely controlled physiological mechanism by which sufficient numbers of erythrocytes are produced to allow adequate tissue oxygenation, but not so much to impede circulation. It is now known that erythropoiesis is mainly controlled by polypeptide erythropoietin (EPO), an acid glycoprotein. Erythropoietin occurs as the result of the expression of a gene from a single copy located on a chromosome of a mammal. The amino acid sequence for recombinant human EPO ("rHuEPO") is substantially identical to the amino acid sequence for EPO obtained from human urinary sources. However, the glycosylation of rHuEPO differs from that of urinary EPO and human serum EPO.
In a healthy mammal EPO is present in blood plasma at very low concentrations, since the tissues are sufficiently oxygenated by the number of circulating erythrocytes. The present EPO stimulates the production of new erythrocytes to replace those lost due to the aging process. In addition, EPO production is stimulated under hypoxic conditions, where the oxygen supply to body tissues is reduced below normal physiological levels despite adequate perfusion of the tissue by the blood. Hypoxia can be caused by hemorrhage, radiation-induced destruction of erythrocytes, various anemias, high altitude, or long periods of unconsciousness. In contrast, if the number of red blood cells in circulation exceeds that needed for normal tissue oxygenation, the production of EPO is reduced. However, certain disease states involve abnormal erythropoiesis. Recombinant human EPO (rHuEPO) is being used therapeutically in several countries. In the United States, the United States Food and Drug Administration (FDA) has approved the use of rHuEPO to treat anemia associated with end-stage renal disease. Patients who undergo hemodialysis to treat this disorder typically suffer from severe anemia caused by rupture and premature death of erythrocytes as a result of dialysis treatment. EPO is also useful in the treatment of other types of anemia. For example, anemia induced by chemotherapy,
anemia associated with myelodysplasia, those associated with several congenital disorders, anemia related to AIDS and anemia associated with prematurity, can be treated with EPO. In addition, EPO may play a role in other areas, such as helping to re-establish a normal hematocrit more quickly in patients with bone marrow transplantation, in patients preparing for autologous blood transfusions, and in patients suffering from overload disorders of iron. Erythropoietin (EPO) is a glycoprotein hormone composed of 165 amino acids and four carbohydrate chains that functions as the main regulator of erythropoiesis, binding to a specific receptor on the surface of erythrocyte precursor cells. This union indicates its proliferation and differentiation into mature red blood cells. The erythropoietin receptor is a 484 amino acid glycoprotein with high affinity for erythropoietin. For the erythropoietin receptor, the homodimerization induced by the ligand may be one of the key events that govern activation. Erythropoietin has a relatively short half-life. Erythropoietin administered intravenously is eliminated at a rate consistent with first-order kinetics with a circulating half-life ranging from approximately 3 to 4 hours in patients with CRF. Within the range of the therapeutic dose, the detectable levels of erythropoietin in the plasma are maintained for at least 24 hours. After subcutaneous administration of erythropoietin, maximum levels in serum
they are reached in the course of 5-24 hours and decline slowly after this. The small erythropoietin peptidomimetics were identified by several groups through the screening of random libraries of peptides showing the phage for affinity of the erythropoietin receptor. These sequences have no homology with erythropoietin.
In the functional assays, several of these peptides showed activity, but only 1 / 100,000 of that of the recombinant erythropoietin.
Although several attempts have been made to increase the potency of these peptides by preparing covalent dimers or multimers of the peptidomimetics, these compounds are still 1, 000-10,000 times less active than erythropoietin on a molar basis, and have very short half-lives, which has made them unsuitable for use as therapeutic agents. Accordingly, there is a need to provide improved and / or modified versions of therapeutic EPO proteins, which overcome one or more of these and other problems known in the art.
BRIEF DESCRIPTION OF THE INVENTION
The present invention provides central human mimetibodies of the hinge region, EPO mimetics, including modified immunoglobulins, cleavage products and other specified portions and variants thereof, as well as compositions of central mimetibodies of the hinge region, mimetics. of EPO, encoding or complementary nucleic acids, vectors, host cells, compositions, formulations, devices, transgenic animals, transgenic plants and methods for making and using same, as described and / or enabled herein, in combination with which is known in the art. The present invention also provides at least one isolated central mimetibody of the hinge region, EPO mimetic or a specified portion or variant as described herein and / or as is known in the art. The central mimetibody of the EPO mimetic hinge region may optionally comprise at least one CH3 region directly linked to at least one CH2 region directly linked to at least a portion of at least one hinge region or a fragment thereof ( H), directly linked to an optional linker sequence (L), directly linked to at least one EPO (P) mimetic therapeutic peptide, optionally, directly further linked to at least a portion of at least one variable antibody sequence ( V). In a preferred embodiment, a pair of CH3-CH2-
hinge-linker-therapeutic peptide region with an N-terminal antibody sequence, the pair is optionally linked by the association or a covalent bond, such as, but not exclusively, at least one Cys-Cys disulfide bond or at least one CH4 or another immunoglobulin sequence. In one embodiment, a central mimetibody of the hinge region, mimic of EPO, comprises formula (I):
((V (m) -P (n) -L (o) -H (p) -CH2 (q) -CH3 (r)) (s),
wherein V is at least a portion of an N term of an immunoglobulin variable region, P is at least a bioactive EPO mimic polypeptide, L is at least a linking sequence, H is at least a portion of a variable region of the immunoglobulin, CH2 is at least a portion of a CH2 constant region of the immunoglobulin, CH3 is at least a portion of an immunoglobulin CH3 constant region, m, n, op, q, rys can be, independently, an integer between 0, 1 or 2 and 10, which mimic different types of immunoglobulin molecules, for example, non-exclusively, IgG1, IgG2, IgG3, IgG4, IgA1, IgA2, IgM, IgD, IgE or any subclass thereof and the similar, or any combination thereof. Thus, a central mimetibody of the hinge region, mimetic of the EPO of the present invention, mimics at least a portion of an antibody or an immunoglobulin structure or function, with its
inherent properties and functions, while providing a therapeutic peptide and its properties or activities inherent or acquired in vitro, in vivo or in situ. The various portions of the antibody and the therapeutic peptide portions of at least one central mimetic of the hinge region, mimetic of the EPO of the present invention, may vary as described herein in combination with what is known in the art. . The present invention provides, in one aspect, isolated nucleic acid molecules which comprise, are complementary, have a significant identity or hybridize to specific mimetibodies encoding the polynucleotide or specified portions or variants thereof, comprising at least one sequence, domain, portion or specified variant thereof. The present invention further provides recombinant vectors comprising at least one of the nucleic acid molecules of the central isolated mimetibody of the hinge region, mimetic of EPO, host cells containing such nucleic acids and / or recombinant vectors, as well as methods for making and / or using such nucleic acids of the central mimetibody of the hinge region, EPO mimetic, vectors and / or host cells. At least one central mimetibody of the hinge region, mimic of the EPO or a specified portion or variant of the invention, mimics the binding of the P portion of the mimetibody to at least one ligand, or has at least one biological activity of at least one a protein, subunit, fragment, portion or any combination thereof.
The present invention also provides at least one central isolated mimetibody of the hinge region, mimetic of EPO or a portion or variant specified as described herein and / or as is known in the art, wherein the central mimetic of the hinge region, mimic of the EPO or a specified portion or variant has at least one activity, such as, but not exclusively, the known biological activities of at least one bioactive peptide or polypeptide corresponding to the P portion of Formula I Therefore, a central mimetic body of the hinge region, EPO mimetic can be screened for the corresponding activity according to known methods, such as at least one neutralizing activity towards a protein or fragment thereof. The present invention also provides at least one composition comprising (a) at least one central isolated mimetibody of the hinge region, EPO mimic or a specified portion or variant encoding a nucleic acid and / or a central mimetic of the region of hinge, mimic of EPO as described herein; and (b) a suitable carrier or diluent. The carrier or diluent can optionally be pharmaceutically acceptable, according to known methods. The composition may optionally further comprise at least one compound, protein or additional composition. The present invention also provides at least one method for expressing at least one central mimetibody of the hinge region,
EPO mimic or a specified portion or variant in a host cell, comprising culturing a host cell as described herein and / or as is known in the art, under conditions wherein at least one central mimetic of the host region hinge, mimetic of the EPO or a specified portion or variant, is expressed in detectable and / or recoverable amounts. The present invention further provides at least one central mimetic of the hinge region, mimetic of EPO, a specified portion or variant in a method or composition, when administered in a therapeutically effective amount for modulation, to treat or reduce the symptoms of at least one bone and joint disorder, a cardiovascular disorder, a dental or oral disorder, a dermatological disorder, an ear, nose or throat disorder, an endocrine or metabolic disorder, a gastrointestinal disorder, a gynecological disorder, a disorder hepatic or biliary, an obstetric disorder, a hematological disorder, an immunological or allergic disorder, an infectious disease, a musculoskeletal disorder, an oncological disorder, a neurological disorder, a nutritional disorder, an ophthalmological disorder, a pediatric disorder, a poisoning disorder , a psychiatric disorder, a kidney disorder, an after pulmonary lathe or any other known disorder. (See, for example, The Merck Manual, 17th ed., Merck Research Laboratories, Merck and Co., Whitehouse Station, NJ (1999), fully incorporated herein by reference), as needed in many different conditions, such as
as non-exclusive, before, after, or during a related disease or treatment condition, as is known in the art. The present invention further provides at least one central mimetic of the hinge region, EPO mimic, a portion or variant specified in a method or composition, when administered in a therapeutically effective amount, for modulation, to treat or reduce the symptoms of at least one immune, cardiovascular, infectious, malignant and / or neurological disease in a cell, tissue, organ, animal or patient and / or, as needed in many different conditions, such as, in a non-exclusive manner, prior to , subsequent to, or during a related disease or treatment condition, as is known in the art and / or as described herein. The present invention also provides at least one composition, device and / or method for delivering a therapeutically or prophylactically effective amount of at least one central mimetibody of the hinge region, EPO mimetic or a specified portion or variant, in accordance with present invention. The present invention further provides at least one anti-idiotype antibody to at least one central mimetic of the hinge, mimetic region of the EPO of the present invention. The anti-idiotype antibody includes any protein or peptide that contains a molecule that comprises at least a portion of an immunoglobulin molecule,
such as, non-exclusively, at least one complementary determining region (CDR) of a heavy or light chain or a ligand-binding portion thereof, a variable region of heavy chain or light chain, a constant chain region heavy or light chain, a region of the framework or any portion thereof, which binds competitively to a region that binds to the EPO receptor of at least one central mimetibody of the hinge region, mimic of the EPO of the present invention. Such idiotype antibodies of the invention may include or be derived from any mammal, such as, but not limited to, a human, a mouse, a rabbit, a rat, a rodent, a primate and the like. The present invention also provides at least one isolated nucleic acid molecule comprising, complementing or hybridizing to a polynucleotide encoding at least one anti-idiotype antibody of a central mimetic of the hinge region, EPO mimic, comprising at least one sequence, domain, portion or specified variant thereof. The present invention further provides recombinant vectors comprising the nucleic acid molecules encoding the anti-idiotype antibody of the central mimetibody of the hinge region, mimic of EPO, host cells containing such nucleic acids and / or recombinant vectors, as well as methods for making and / or using such nucleic acids of the anti-idiotype antibody, vectors and / or host cells. The present invention also provides at least one method for expressing at least one central mimetibody of the hinge region,
mimetic of EPO, or an anti-idiotype antibody of the central mimetibody of the hinge region, mimic of EPO, in a host cell, comprising culturing a host cell as described herein, under conditions wherein at least one central mimetibody of the hinge region, mimetic of EPO or an anti-idiotype antibody is expressed in detectable and / or recoverable amounts. The present invention also provides at least one composition comprising (a) a nucleic acid encoding an isolated central mimetibody of the hinge region, mimic of EPO and / or a central mimetibody of the hinge region, mimic of EPO, as described herein; and (b) a suitable carrier or diluent. The carrier or diluent can optionally be pharmaceutically acceptable, according to the known carriers or diluents. The composition may optionally further comprise at least one compound, protein or additional composition. The present invention further provides at least one method or composition of a central mimetic of the hinge region, mimic of EPO, for administering a therapeutically effective amount to modulate or treat at least one condition related to the protein in a cell, tissue, organ, animal or patient and / or, before, of, subsequent to, or during a related condition, as is known in the art and / or as described herein.
The present invention also provides at least one composition, device and / or method for delivering a therapeutically or prophylactically effective amount of at least one central mimetibody of the hinge region, EPO mimetic, according to the present invention. The present invention further provides at least one method or composition of a central mimetibody of the hinge region, EPO mimetic, for diagnosing at least one condition related to EPO in a cell, tissue, organ, animal or patient and / or , before, after, or during a related condition, as is known in the art and / or as described herein. The present invention also provides at least one composition, device and / or method for providing the diagnosis of at least one central mimetibody of the hinge region, EPO mimetic, according to the present invention. In one aspect, the present invention provides at least one centrally isolated human mimetibody of the hinge region, EPO mimetic, comprising at least one P (n) region, comprising at least a portion of at least one of the SEQ ID NOS: 1-30, for example, as presented in Table 1 below, or optionally with one or more substitutions, deletions or insertions as described herein or as is known in the art. In another aspect, the present invention provides at least one centrally isolated human mimetibody of the hinge region, EPO mimetic, wherein the central mimetibody of the region of
hinge, EPO mimetic specifically binds to at least one epitope comprising at least 1-3 of at least one ligand or binding region, ligand which binds to at least a portion of at least one of SEQ ID NOS : 1-30 as presented in Table 1 below, or optionally with one or more substitutions, deletions or insertions, as described herein or as is known in the art. The at least one central mimetibody of the hinge region, EPO mimetic, can optionally further perform at least one of: binding to the protein with an affinity of at least one selected of at least 10"9 M, at least 10"10 M, at least 10" 11 M or at least 10"12 M; substantially neutralize at least one activity of at least one protein or portion thereof. Also provided is an isolated nucleic acid encoding at least one centrally isolated human mimetibody of the hinge region, EPO mimetic; an isolated nucleic acid vector comprising the isolated nucleic acid and / or a prokaryotic or eukaryotic host cell comprising the isolated nucleic acid. The host cell can optionally, be at least one selected from COS-1, COS-7, HEK293, BHK21, CHO, BSC-1, Hep G2, 653, SP2 / 0, 293, HeLa, myeloma or lymphoma cells, or any derived cells, immortalized or transformed from them. A method is also provided for producing at least one central mimetibody of the hinge region, EPO mimetic, which comprises translating the nucleic acid encoding the central mimetibody of the hinge region, low EPO mimetic.
conditions in vitro, in vivo or in situ, so that the central mimetibody of the hinge region, EPO mimic, is expressed in detectable or recoverable amounts. Also provided is a composition comprising at least one centrally isolated human mimetibody of the hinge region, EPO mimetic and at least one pharmaceutically acceptable carrier or diluent. The composition may optionally further comprise an effective amount of at least one compound or protein selected from at least one of a detectable label or reporter, an anti-infective drug, a drug for the cardiovascular system (CV), a drug for the central nervous system. (CNS), a drug for autonomic nervous system (ANS), a drug for the respiratory tract, a drug to the gastrointestinal (Gl), a hormonal drug, a drug for fluid balance or electrolyte, a hematologic drug , an anticancer drug, a drug for immunomodulation, nasal ophthalmic drug, otic or a topical drug, a nutritional drug, an antagonist drug TNF, antirheumatic, a muscle relaxant, narcotic, nonsteroidal anti-inflammatory (nthe), an analgesic, an anesthetic, a sedative, a local anesthetic, a neuromuscular blocker, an antimicrobial, an antisoriático, a corticosteroid, a eroide anabolic, an erythropoietin, an immunization, an immunoglobulin, an immunosuppressive, a growth hormone, a drug for hormone replacement, a radiopharmaceutical, an antidepressant, an antipsychotic, a stimulant, a medication for asthma, an agonist
beta, an inhaled steroid, an epinephrine or analogue, a cytokine or a cytokine antagonist. The present invention further provides an antibody or anti-idiotype fragment that specifically binds to at least one central mimetibody of the hinge region, mimetic of the EPO of the present invention. A method is also provided for diagnosing or treating a disease condition in a cell, tissue, organ or animal, comprising (a) contacting or administering a composition comprising an effective amount of at least one isolated human mimetibody central to the hinge region, mimic of the EPO of the invention with the cell, tissue, organ or animal. The method may further optionally comprise using an effective amount of 0.001-50 mg / kilogram of the cells, tissue, organ or animal. The method may further comprise optionally use the contact or administration by at least one mode selected from parenteral, subcutaneous, intramuscular, intravenous, intraarticular, intrabronchial, intraabdominal, intracapsular, intracartilaginous, intracavitary, intracelial, intracelebelar, intracerebroventricular, intracolic, intracervical, intragastric , ntrahepático, intramyocardial, intraósteo, intrapelvic, intrapericardiac, intraperitoneal, intrapleural, intraprostatic, intrapulmonary, intrarectal, intrarenal, ntrarretinal, intraspinal, intrasynovial, intrathoracic, intrauterine, intravesical, bolus, vaginal, rectal, buccal, sublingual,
intranasal or transdermal. The method may further optionally comprise administering before, concurrently or after (a) contacting or administering at least one composition comprising an effective amount of at least one compound or protein selected from at least one of a detectable brand or reporter. , an anti-infective drug, a drug for the cardiovascular system (CV), a drug for the central nervous system (CNS), a drug for the autonomic nervous system (ANS), a drug for the respiratory tract, a drug for the gastrointestinal tract (Gl), a hormonal drug, a drug for fluid balance or electrolyte, a hematologic drug, an antineoplastic drug, a drug for immunomodulation, nasal ophthalmic drug, otic or a topical drug, a nutritional drug, a TNF antagonist drug, antirheumatic, muscle relaxant, narcotic, nonsteroidal anti-inflammatory (NSAID), an analgesic, an anesthetic, a sedative, a local anesthetic, a neuromuscular blocker, an antimicrobial, an antisoriático, a corticosteroid, an anabolic steroid, an erythropoietin, an immunization , an immunoglobulin, an immunosuppressant, a growth hormone, a hormone replacement drug, a radiopharmaceutical, an antidepressant, an antipsychotic, a stimulant, a medication for asthma, a beta agonist, an inhaled steroid, an epinephrine or the like, a cytokine or a cytokine antagonist. Also provided is a medical device, comprising at least one isolated central human mimetibody of the hinge region,
mimetic of the EPO of the invention, wherein the device is suitable for contacting or administering the at least one central mimetibody of the hinge, EPO mimetic region by at least one selected parenteral, subcutaneous, intramuscular mode, intravenous, intraarticular, intrabronchial, intraabdominal, intracapsular, intracartilaginous, intracavity, intracellular, intracelebellar, intracerebroventricular, intracolic, intracervical, intragastric, intrahepatic, intrahepatic, intramyocardial, intradose, intrapelvic, intrapericardial, intraperitoneal, intrapleural, intraprostatic, intrapulmonary, intrarectal, intrarenal, intraretinal , intraspinal, intrasynovial, intrathoracic, intrauterine, intravesical, bolus, vaginal, rectal, buccal, sublingual, intranasal or transdermal. Also provided is an article of manufacture for pharmaceutical or diagnostic use in humans, comprising a packaging material and a container comprising a solution or a lyophilized form of at least one isolated human mimetibody central to the hinge region, mimetic of the EPO of the present invention. The article of manufacture may optionally comprise having the container as a component of a parenteral, subcutaneous, intramuscular, intravenous, intraarticular, intrabronchial, intraabdominal, intracapsular, intracartilage, intracavity, intracelial, intracelebelar, intracerebroventricular, intracolic, intracervical, delivery or delivery system or device. intragastric, intrahepatic, intramyocardial, intratracheal, intrapelvic, intrapericardial, intraperitoneal, intrapleural, intraprostatic, intrapulmonary, intrarectal, intrarenal, intraretinal,
Intraspinal, intrasynovial, intrathoracic, intrauterine, intravesical, bolus, vaginal, rectal, buccal, sublingual, intranasal or transdermal. A method is also provided for producing at least one centrally isolated human mimetibody of the hinge region, mimic of the EPO of the present invention, which comprises providing a host cell or a transgenic animal or a transgenic plant or a plant cell capable of express in recoverable quantities, the central mimetibody of the hinge region, EPO mimic. In the present invention, there is further provided at least one central mimetibody of the hinge region, mimic of the EPO produced by the above method. The present invention also provides at least one method for expressing at least one central mimetibody of the hinge region, EPO mimic, or an anti-idiotype antibody, in a host cell, which comprises culturing a host cell as described herein under conditions wherein at least one central mimetibody of the hinge region, EPO mimic is expressed in detectable and / or recoverable amounts. The present invention further provides any invention described herein.
DETAILED DESCRIPTION OF THE INVENTION
The present invention provides mimetibodies or recombinant and / or synthetic specified portions or variants, as well as coding nucleic acid compositions and molecules comprising at least one polynucleotide encoding at least one central mimetic of the hinge region, mimic of EPO. Such mimetibodies or specified portions or variants of the present invention comprise specific sequences of central mimetibodies of the hinge region, EPO mimetics, domains, fragments and variants thereof, and methods for making and using nucleic acids and mimetibodies. or specified portions or variants, including compositions, methods and therapeutic devices. The present invention also provides at least one isolated central mimetibody of the hinge region, EPO mimetic or a specified portion or variant as described herein and / or as is known in the art. The central mimetibody of the hinge region, EPO mimetic may optionally comprise at least one CH3 region directly linked to at least one CH2 region directly linked to at least one hinge region or fragment thereof (H), directly linked to an optional linker sequence (L), directly linked to at least one therapeutic peptide (P), linked
directly in addition optionally with at least a portion of at least one variable sequence of antibody (V). In a preferred embodiment, a central mimetibody of the hinge region, mimic of EPO, comprises formula (I):
((V (m) -P (n) -L (o) -H (p) -CH2 (q) -CH3 (r)) (s), wherein V is at least a portion of a N-terminus of a immunoglobulin variable region, P is at least one bioactive peptide, L is a polypeptide that provides structural flexibility, allowing the mimetibody to have alternating binding orientations and properties, H is at least a portion of a variable immunoglobulin hinge region, CH2 is at least a portion of an immunoglobulin CH2 constant region, CH3 is at least a portion of an immunoglobulin CH3 constant region, m, n, o, p, q, r and s can independently be an integer between 0, 1 or 2 and 10, which mimic different types of immunoglobulin molecules, for example, non-exclusively, IgG1, IgG2, IgG3, IgG4, IgA, IgM, IgD, IgE and the like, or combinations thereof. where m = 1, can be linked to other monomers by covalent bonding or association, such as, but not limited to, a disulfide bond Cys-Cys or another immunoglobulin sequence. The central mimetibody of the hinge, mimetic region of the EPO of the present invention mimics an antibody structure with its inherent properties and functions, while providing a therapeutic peptide and its
properties or activities inherent or acquired in vitro, live or in situ. The various portions of the antibody and the therapeutic peptide portions of at least one central mimetibody of the hinge region, mimetic of the EPO of the present invention, may vary as described herein in combination with what is known in the art. As used herein, a "central mimetibody of the hinge region, EPO mimetic," "a central mimetibody portion of the hinge region, EPO mimetic," or "central mimetic antibody fragment of the region." of hinge, EPO mimic "and / or" variant of the central mimetibody of the hinge region, mimic of EPO "and the like, mimics, has or simulates at least one ligand binding or at least one biological activity of at least a protein, such as binding or activity of the ligand in vitro, in situ and / or preferably in vivo, such as, but not limited to, at least one of SEQ ID NOS: 1-30. For example, a central mimetibody of the hinge region, suitable EPO mimic, a specified portion or variant of the present invention, can be attached to at least one protein ligand and includes at least one protein ligand, a receptor, receptor soluble and similar. A central mimetibody of the hinge region, mimetic of the appropriate EPO, specified portion or variant can also modulate, increase, modify, activate at least one protein receptor or signaling or other measurable or detectable activity. The mimetibodies useful in the methods and compositions of the present invention are characterized by a suitable binding affinity.
to the ligands or receptors of the protein and optionally and preferably have low toxicity. In particular, a central mimetibody of the hinge region, EPO mimetic, wherein the individual components, such as the portion of the variable region, the constant region (without a CH1 portion) and the framework, or any portion of the (for example, a portion of the J, D or V regions of the heavy or light variable chain, at least a portion of at least one hinge region, the constant heavy or light chain chain and the like), so Individual and / or collective, optionally and preferably possesses low immunogenicity, is useful in the present invention. The mimetibodies that can be used in the invention are optionally characterized by their ability to treat patients for extended periods with relief of symptoms from good to excellent and low toxicity. Low immunogenicity and / or high affinity, as well as other undefined properties, can contribute to the therapeutic results achieved. "Low immunogenicity" is defined herein as elevating significant HAMA, HACA or HAHA responses by less than about 75%, or preferably by less than about 50, 45, 40, 35, 30, 35, 20, 15, 10, 9, 8, 7, 6, 5, 4, 3, 2 and / or 1% of the treated patients and / or raising the low titres in the treated patient (less than about 300, preferably less than about 100 , measured with an enzyme immunoassay with double antigen) (see, for example, Elliott et al., Lancef 344: 1125-1127 (1994)).
Utility The isolated nucleic acids of the present invention can be used for the production of at least one central mimetic of the hinge region, EPO mimetic, fragment or specified variant thereof, which can be used to effect in a cell, tissue, organ or animal (including mammals and humans), to modulate, treat, alleviate, help prevent the occurrence of or reduce the symptoms of, at least one condition related to a protein, selected, non-exclusively, from at least one of an immune disorder or disease, cardiovascular disorder or disease, an infectious, malignant and / or neurological disorder or disease, an anemia; an immune / autoimmune condition; and / or carcinogenic / infectious, as well as other known or specified protein-related conditions. Such a method may comprise administering an effective amount of a composition or a pharmaceutical composition comprising at least one central mimetic of the hinge region, EPO mimetic or a specified portion or variant to a cell, tissue, organ, animal or patient in need for such modulation, treatment, relief, prevention or reduction in symptoms, effects or mechanisms. The effective amount may comprise an amount of about 0.0001 to 500 mg / kg per single or multiple administration, or to achieve a serum concentration of 0.0001-5000 μg / ml of serum concentration per single or multiple administration, or any range or value effective in it, how it is done and
determined using known methods, as described herein or known in the relevant arts.
Appointments All publications and patents cited herein are incorporated herein by reference in their entirety, since they show the state of the art at the time of the present invention and / or provide a description and enablement of the present invention. The publications refer to any scientific or patent publication, or any other information available in any media format, including all registered, electronic or printed formats. The following references are hereby incorporated by reference in their entirety: Ausubel, et al., Ed., Current Protocols in Molecular Biology, John Wiley & Sons, Inc., NY, NY (1987-2003); Sambrook, et al., Molecular Cloning: A Laboratory Manual, 2nd Edition, Cold Spring Harbor, NY (1989); Harlow and Lane, Antibodies, a Laboratory Manual, Cold Spring Harbor, NY (1989); Colligan, et al., Eds., Current Protocols in Immunology, John Wiley & Sons, Inc., NY (1994-2003); Colligan et al., Current Protocols in Protein Science, John Wiley & Sons, NY, NY, (1997-2003).
Mimetibodies of the present invention The central mimetibody of the hinge, mimetic region of EPO may optionally comprise at least one linked CH3 region
directly with at least one CH2 region directly linked to at least a portion of at least one fragment of the hinge region (H), such that it comprises at least one region of central hinge, directly linked to an optional linker sequence (L) , directly linked to at least one therapeutic peptide (P), optionally further linked, directly to at least a portion of at least one variable antibody sequence (V). In a preferred embodiment, a pair of CH3-CH2-H-L-V, the pair linked by association or the covalent bond. Thus, a central mimetibody of the hinge region, mimetic of the EPO of the present invention, mites an antibody structure with its inherent properties and functions, while providing a therapeutic peptide and its inherent or acquired properties or activities in vitro, n live or in situ. The various portions of the antibody and the therapeutic peptide portions of at least one central mimetibody of the hinge region, mimetic of the EPO of the present invention, may vary as described herein in combination with what is known in the art. The mimetibodies of the present invention thus provide at least one suitable property compared to known proteins, such as, non-exclusively, at least one of increased half-life, increased activity, more specific activity, increased strength, increased or decreased inactivation rate, a selected activity or a more suitable subset of activities,
less immunogenicity, quality or increased duration of at least one desired therapeutic effect, less side effects and the like. Fragments of the mimetibodies according to Formula (I), can be produced by enzymatic cleavage, synthetic or recombinant techniques, as is known in the art and / or as described herein. The mimetibodies can also be produced in a variety of truncated forms using antibody genes in which one or more stop codons have been introduced upstream of the natural stop site. The various portions of the mimetibodies can be chemically linked by conventional techniques, or they can be prepared as a contiguous protein using genetic engineering techniques. For example, a nucleic acid encoding at least one of the constant regions of a human antibody chain can be expressed to produce a contiguous chain for use in the mimetibodies of the present invention. See, for example, Ladner et al., U.S. Patent. No. 4,946,778 and Bird, R. E. et al., Science, 242: 423-426 (1988), with respect to single chain antibodies. As used herein, the term "human mimetibody" refers to an antibody in which substantially every part of the protein is expected (eg, EPO mimetic peptide, framework, CL, CH domains (e.g. , CH2, CH3), hinge (VL, VH)), is substantially non-immunogenic in humans, with only minor changes or variations in the sequence. Such changes or variations
optionally, and preferably, retain or reduce immunogenicity in humans relative to unmodified human antibodies, or mimetibodies of the present invention. Thus, a human antibody and the central mimetibody of the hinge region, mimetic of the corresponding EPO of the present invention, is distinct from a chimeric or humanized antibody. It is noted that a human antibody and a central mimetibody of the hinge region, mimic of EPO, can be produced by an animal or non-human cell that is capable of expressing the genes of human immunoglobulins (e.g., heavy chain and / or chain). light). Human mimetibodies that are specific for at least one ligand or protein receptor thereof, can be designed against an appropriate ligand, such as a receptor or ligand isolated from the protein and / or EPO or a portion thereof (including molecules synthetic, such as synthetic peptides). The preparation of such mimetibodies is performed using known techniques to identify and characterize the ligand binding regions or sequences of at least one protein or portion thereof. In a preferred embodiment, at least one central mimetibody of the hinge region, EPO mimetic or a specified portion or variant of the present invention, is produced by at least one cell line, a mixed cell line, an immortalized cell or a clonal population of immortalized and / or cultured cells. The immortalized cells
that produce a protein, can be produced using appropriate methods. Preferably, the at least one central mimetic of the hinge region, mimic of the EPO or a specified portion or variant, is generated by providing nucleic acids or vectors comprising derived DNA having a sequence substantially similar to at least one site of the invention. human immunoglobulin which is functionally rearranged, or which can undergo a functional rearrangement, and which further comprises a mimetibody structure as described herein, for example, non-exclusively, Formula (I), wherein the portions of the variable regions C and N terminals can be used for V, the hinge regions for H, CH2 for CH2 and CH3 for CH3, as is known in the art. The term "functionally rearranged", as used herein, refers to a segment of a nucleic acid from an immunoglobulin site that has undergone V (D) J recombination., thereby producing an immunoglobulin gene encoding an immunoglobulin chain (e.g., heavy chain), or any portion thereof. A functionally rearranged immunoglobulin gene can be identified directly or indirectly using suitable methods, such as, for example, nucleotide sequencing, hybridization (e.g., Southern blotting, Northern blotting), using probes that can anneal to the coding junctions between the segments of the gene or enzymatic amplification of immunoglobulin genes (eg, polymerase chain reaction) with primers that can anneal to
the coding junctions between the segments of the gene. If a cell produces a central mimetibody of the hinge region, EPO mimic or a portion or variant comprising a particular variable region or a variable region comprising a particular sequence (eg, at least one P sequence), it can also Determine using appropriate methods. The mimetibodies, portions and variants specified in the present invention, can also be prepared using at least one nucleic acid encoding a central mimetibody of the hinge region, EPO mimic or a specified portion or variant, to provide transgenic animals or mammals. , such as goats, cows, horses, sheep and the like, that produce such mimetibodies or specified portions or variants in their milk. Such animals can be provided using known methods as applied for the sequences encoding the antibody. See, for example, non-exclusively, US Patents. Nos. 5,827,690; 5,849,992; 4,873,316; 5,849,992; 5,994,616; 5,565,362; 5,304,489, and the like, each of which is fully incorporated herein by reference. The mimetibodies, portions and variants specified herein, can be further prepared using at least one nucleic acid encoding a central mimetibody of the hinge region, mimetic of EPO or a specified portion or variant, to provide transgenic plants and cells of cultivated plants (for example, non-exclusively, tobacco and corn) that produce such mimetibodies, portions or
variants specified in the parts of the plant or in the cultivated cells thereof. As a non-limiting example, transgenic tobacco leaves expressing recombinant proteins have been used successfully to provide large amounts of recombinant proteins, for example, using an inducible promoter. See, for example, Cramer et al., Curr. Top. Microbol. Immunol. 240: 95-118 (1999) and the references cited therein. Also, transgenic corn has been used to express mammalian proteins at levels of commercial production, with biological activities equivalent to those produced in other recombinant systems or purified from natural sources. See, for example, Hood et al., Adv. Exp. Med. Biol. 464: 127-147 (1999) and the references cited therein. Antibodies in large quantities have also been produced from seeds of transgenic plants, including antibody fragments, such as single chain mimetibodies (scFv), including tobacco seeds and potato tubers. See, for example, Conrad et al., Plant Mol. Biol. 38: 101-109 (1998) and the references cited therein. Thus, the mimetibodies, portions and variants specified of the present invention, can also be produced using transgenic plants, according to known methods. See also, for example, Fischer et al., Biotechnol. Appl. Biochem. 30: 99-108 (October, 1999), Ma et al., Trends Biotechnol. 13: 522-7 (1995); Ma et al., Plant Physio. 109: 341-6 (1995); Whitelam et al., Biochem. Soc. Trans. 22: 940-944 (1994); and the references cited in the
same. The above references are incorporated herein by reference in their entirety. The mimetibodies of the invention can bind ligands of human protein with a wide variety of affinities (KD). In a preferred embodiment, at least one central human mimetibody of the hinge region, mimetic of the EPO of the present invention can optionally be linked to at least one protein ligand with high affinity. For example, at least one central mimetic of the hinge, mimetic region of the EPO of the present invention can be linked to at least one protein ligand with a KD equal to or less than about 10 ~ 7 M or, more preferably, with a KD equal to or less than approximately 0.1-9.9 (or any interval or value therein) X 10"7, 10 ~ 8, 10"9, 10" 10, 10"11, 10" 12 or 10"13 M, or any interval or value therein The affinity or strength of a central mimetibody of the hinge region, mimic EPO for at least one protein ligand can be determined experimentally using any suitable method, for example, as used to determine the affinity or binding strength of the antibody-antigen (See, for example, Berzofsky, et al., "Antibody-Antigen Interactions", In Fundamental Immunology, Paul, WE, Ed., Raven Press: New York, NY (1984); Kuby, Janis Immunology, W. H. Freeman and Company: New York, NY (1992); and methods described therein). The measured affinity of a particular central mimetibody interaction of the hinge region, mimic of the EPO-ligand, may vary if measured under
different conditions (for example, salt concentration, pH). Thus, affinity measurements and other ligand binding parameters (e.g., KD, Ka, K), are preferably made with standardized solutions of the central mimetibody of the hinge region, mimic of EPO and the ligand, and a standardized shock absorber, such as the shock absorber described herein.
Nucleic Acid Molecules Using the information provided herein, such as nucleotide sequences encoding at least 90-100% of the contiguous amino acids of at least one of SEQ ID NOS: 1-30, as well as at least a portion of an antibody, wherein the above sequences are inserted as the sequence P of Formula (I) to provide a central mimetic of the hinge region, mimetic of the EPO of the present invention, which further comprises fragments, specified variants or sequences of consensus thereof, or a deposited vector comprising at least one of these sequences, a nucleic acid molecule of the present invention encoding at least one central mimetibody of the hinge region, EPO mimetic or a specified portion or variant, it can be obtained using the methods described herein or as are known in the art. The nucleic acid molecules of the present invention can be in the form of RNA, such as mRNA, ARNhn, tRNA or any
another form, or in the form of DNA, including, but not limited to, cDNA and genomic DNA obtained by cloning or synthetically produced, or any combination thereof. The DNA can be triple-stranded, double-stranded or single-stranded, or any combination thereof. A portion of at least one strand of DNA or RNA can be a coding strand, also known as the sense strand or it can be the non-coding strand, also referred to as the antisense strand. The isolated nucleic acid molecules of the present invention may include nucleic acid molecules comprising an open reading frame (ORF), optionally with one or more introns, nucleic acid molecules comprising the coding sequence for a central mimetic of the hinge region, mimic of EPO or a specified portion or variant; and nucleic acid molecules comprising a nucleotide sequence substantially different from those described above, but which, due to the degeneracy of the genetic code, still encode at least one central mimetibody of the hinge region, EPO mimetic as described in US Pat. present and / or as is known in the art. Of course, the genetic code is well known in the art. Thus, it would be routine for someone skilled in the art to generate such degenerate variants of nucleic acids encoding the central specific mimetibody of the hinge region, EPO mimetic or a specified portion or variant of the present invention. See,
for example, Ausubel, et al., supra, and such nucleic acid variants are included in the present invention. As indicated herein, the nucleic acid molecules of the present invention comprising a nucleic acid encoding a central mimetibody of the hinge region, EPO mimetic or a specified portion or variant may include, but are not limited to, , those encoding the amino acid sequence of a central mimetibody fragment of the hinge region, EPO mimetic, by itself; the coding sequence for all the central mimetibody of the hinge region, mimic of the EPO or a portion thereof; the coding sequence for a central mimetibody of the hinge region, mimic of EPO, fragment or portion, as well as additional sequences, such as the coding sequence for at least one signal or fusion leader peptide, with or without the sequences additional encoders mentioned above, such as an intron, together with additional non-coding sequences, including, but not limited to, the non-coding 5 'and 3' sequences, such as transcribed, untranslated sequences that play a role in transcription, mRNA processing, including splicing and polyadenylation signals (e.g., ribosome binding and mRNA stability); and additional coding sequences that encode additional amino acids, such as those that provide additional functionalities. Thus, the sequence encoding a central mimetibody of the hinge region, EPO mimic or a specified portion or variant,
can be fused to a marker sequence, such as a peptide-encoding sequence that facilitates the purification of the central fused mimetibody of the hinge region, EPO mimetic or a specified portion or variant, comprising a fragment or moiety of the core mimetic the hinge region, EPO mimic.
Polynucleotides that selectively hybridize to a polynucleotide as described herein. The present invention provides isolated nucleic acids that hybridize under conditions of selective hybridization to a polynucleotide described herein, or others described herein, including variants or specified portions of the same. Thus, the polynucleotides of this embodiment can be used to isolate, detect and / or quantify the nucleic acids comprising such polynucleotides. Hybridization conditions of low or moderate stringency are typically, but not exclusively, employed with sequences that have a reduced sequence identity relative to the complementary sequences. The conditions of moderate and high rigor can be used optionally for sequences of greater identity. Low stringency conditions allow for selective hybridization of sequences that have approximately 40-99% sequence identity and can be used to identify orthologous or paralogical sequences.
Optionally, the polynucleotides of this invention will encode at least a portion of a central mimetibody of the hinge region, EPO mimetic or a specified portion or variant encoded by the polynucleotides described herein. The polynucleotides of this invention encompass nucleic acid sequences that can be employed for selective hybridization to a polynucleotide encoding a central mimetic of the hinge region, EPO mimetic or a specified portion or variant of the present invention. See, for example, Ausubel, supra; Colligan, supra, each one fully incorporated in the present as reference.
Construction of Nucleic Acids The isolated nucleic acids of the present invention can be made using (a) recombinant methods, (b) synthetic techniques, (c) purification techniques or combinations thereof, as is well known in the art. The nucleic acids may conveniently comprise sequences in addition to a polynucleotide of the present invention. For example, a multiple cloning site comprising one or more restriction sites of the endonuclease can be inserted into the nucleic acid to aid in the isolation of the polynucleotide. Also, translatable sequences can be inserted to assist in the isolation of the translated polynucleotide of the present invention. For example, a sequence
marker with hexahistidine, provides a convenient means to purify the proteins of the present invention. The nucleic acid of the present invention, excluding the coding sequence, is optionally a vector, adapter or a linker for cloning and / or for the expression of a polynucleotide of the present invention. Additional sequences may be added to such cloning and / or expression sequences to optimize their function in cloning and / or expression, to aid in the isolation of the polynucleotide or to improve the introduction of the polynucleotide into a cell. The use of cloning vectors, expression vectors, adapters and linkers is well known in the art. See, for example, Ausubel, supra; or Sambrook, supra.
Recombinant methods for constructing nucleic acids Nucleic acid compositions isolated from this
The invention, such as RNA, cDNA, genomic DNA or any combination thereof, can be obtained from biological sources using any of several cloning methodologies known to those skilled in the art. In some embodiments, oligonucleotide probes that hybridize selectively, under conditions of adequate stringency to the polynucleotides of the present invention, are used to identify the desired sequence in a cDNA or genomic DNA library. Isolation of RNA and construction of cDNA libraries and
genomic, is well known to those with ordinary experience in the art. (See, for example, Ausubel, supra; or Sambrook, supra).
Synthetic Methods for Building Nucleic Acids The isolated nucleic acids of the present invention can also be prepared by direct chemical synthesis by known methods (see, for example, Ausubel, et al., Supra). Chemical synthesis generally produces a single-stranded oligonucleotide, which can be converted to double-stranded DNA by hybridization with a complementary sequence, by polymerization with a DNA polymerase using the single strand as a template. One skilled in the art will recognize that although chemical synthesis of DNA can be limited to sequences of approximately 100 or more bases, longer sequences can be obtained by linking shorter sequences.
Recombinant expression cassettes The present invention also provides recombinant expression cassettes comprising a nucleic acid of the present invention. A nucleic acid sequence of the present invention, for example, a cDNA or genomic sequence, which encodes a central mimetibody of the hinge region, EPO mimetic or a specified portion or variant of the present invention, may be used for build a cassette of recombinant expression that can be introduced into at least one cell
desired host. A recombinant expression cassette will typically comprise a polynucleotide of the present invention operably linked to transcriptional initiation regulatory sequences that will direct transcription of the polynucleotide in the intended host cell. Heterologous and non-heterologous (i.e., endogenous) promoters can be employed to direct the expression of the nucleic acids of the present invention. In some embodiments, the isolated nucleic acids serving as a promoter, enhancer or other elements can be introduced in the appropriate position (upstream, downstream or in an intron) of a non-heterologous form of a polynucleotide of the present invention, to overregulate or deregulate the expression of a polynucleotide of the present invention. For example, endogenous promoters can be altered in vivo or in vitro by mutation, deletion and / or substitution, as is known in the art. A polynucleotide of the present invention can be expressed in any sense or antisense orientation as desired. It will be appreciated that control of gene expression in the sense or antisense orientation can have a direct impact on the observable characteristics. Another method of suppression is sense suppression. The introduction of a nucleic acid configured in the sense orientation, has not been shown to be an effective means by which to block the transcription of the target genes.
Vectors and Host Cells The present invention also relates to vectors that include isolated nucleic acid molecules of the present invention, host cells that are genetically engineered with recombinant vectors, and the production of at least one central mimetic of the hinge region. , mimetic of EPO or a portion or variant specified by recombinant techniques, as is well known in the art. See, for example, Sambrook, et al., Supra; Ausubel, et al., Supra, each fully incorporated herein by reference. The polynucleotides can optionally be linked to a vector containing a selectable marker for propagation in a host. Generally, a plasmid vector is introduced into the cell using suitable known methods, such as electroporation and the like, other known methods include the use of the vector as a precipitate, such as a calcium phosphate precipitate, or in a complex with a charged lipid. If the vector is a virus, it can be packaged in vitro using an appropriate packaging cell line and then transduced into the host cells. The DNA insert must be operatively linked to an appropriate promoter. The expression constructs will additionally contain sites optionally for at least one of the start of transcription, termination and in the transcribed region, a ribosome binding site for translation. The coding portion of the mature transcripts expressed by the
constructs, will preferably include a translation starting at the beginning and a terminating Colon (eg, UAA, UGA or UAG) appropriately placed at the end of the mRNA to be translated, with preferred UAA and UAG for cell expression of mammal or eukaryotes. The expression vectors, preferably, but optionally, will include at least one selectable marker. Such labels include, for example, non-exclusively, resistance to methotrexate (MTX), dihydrofolate reductase (DHFR, U.S. Patent Nos. 4,399,216; 4,634,665; 4,656,134; 4,956,288; 5,149,636; 5,179,017; ampicillin; neomycin (G418); mycophenolic acid; or glutamine synthetase (GS, U.S. Patent Nos. 5,122,464; 5,770,359; 5,827,739), for the culture of eukaryotic cells and genes for resistance to tetracycline or ampicillin for cultures in E. coli and other bacteria or prokaryotes (the above patents are fully incorporated herein by reference.) The culture media and appropriate conditions for the host cells described above are well known in the art, and suitable vectors will be readily apparent to the skilled artisan. a host cell can be made by transfection with calcium phosphate, transfection mediated by DEAE-dextran, transfection dyed by a cationic lipid, electroporation, transduction, infection or other known methods. Such methods are described in the art, such as Sambrook, supra, Chapters 1-4 and 16-18; Ausubel, supra, Chapters 1, 9, 13, 15, 16.
At least one central mimetibody of the hinge region, mimetic of the EPO or a specified portion or variant of the present invention, may be expressed in a modified form, such as a fusion protein, and may include not only secretory signals, but also additional heterologous functional regions. For example, a region of additional amino acids, particularly charged amino acids, may be added to the N terminus of a central mimetibody of the hinge region, EPO mimetic or a specified portion or variant, to improve stability and persistence in the host cell, during purification or during subsequent handling and storage. Also, peptide portions can be added to a central mimetibody of the hinge region, mimetic of the EPO or a specified portion or variant of the present invention to facilitate purification. Such regions can be removed prior to the final preparation of a central mimetibody of the hinge region, EPO mimetic or at least one fragment thereof. Such methods are described in many standard laboratory manuals, such as Sambrook, supra, Chapters 17.29-17.42 and 18.1-18.74; Ausubel, supra, Chapters 16, 17 and 18. Those of ordinary skill in the art are aware of numerous expression systems available for the expression of a nucleic acid encoding a protein of the present invention. Illustrative cell cultures useful for the production of the mimetibodies, specified portions or variants thereof, are the
mammalian cells. Mammalian cell systems are often in the form of monolayers of cells, although suspensions or bi-reactors of mammalian cells can also be used. Several suitable host cell lines capable of expressing intact glycosylated proteins have been developed in the art, and include cell lines COS-1 (eg, ATCC CRL 1650), COS-7 (eg, ATCC CRL-1651), HEK293, BHK21 (e.g., ATCC CRL-10), CHO (e.g., ATCC CRL 1610, DG-44) and BSC-1 (e.g., ATCC CRL-26), hepG2 cells, P3X63Ag8.653 cells, SP2 / 0- Ag14, 293, HeLa cells and the like, which are readily available from, for example, the American Type Culture Collection, Manassas, Va. Preferred host cells include cells of lymphoid origin, such as myeloma and lymphoma cells. Particularly preferred host cells are P3X63Ag8.653 cells (Accession number of ATCC CRL-1580) and SP2 / 0-Ag14 cells (Accession number of ATCC CRL-1851). Expression vectors for these cells can include one or more of the following expression control sequences, such as, but not limited to, an origin of replication; a promoter (e.g., SV40 late or early promoters, the CMV promoter (e.g., U.S. Patent Nos. 5,168,062; 5,385,839), a tk HSV promoter, a pgk (phosphoglycerate kinase) promoter, an EF-1 alpha promoter ( for example, U.S. Patent No. 5,266,491), at least one human immunoglobulin promoter, an enhancer and / or processing information sites, such as
ribosome binding sites, RNA splice sites, polyadenylation sites (e.g., a large poly A T Ag addition site of SV40), and transcription termination sequences. See, for example, Ausubel et al., Supra; Sambrook, et al., Supra. Other cells useful for the production of the nucleic acids or proteins of the present invention are known and / or available, for example, from the Catalog of Cell Lines and Hybridomas of the American Type Culture Collection (www.atcc.org) or others well-known or commercial sources. When eukaryotic host cells are employed, the polyadenylation termination or transcription sequences are typically incorporated into the vector. An example of a terminator sequence is the polyadenylation sequence of the bovine growth hormone gene. The sequences for the exact splicing of the transcript can also be included. An example of a splicing sequence is the VP1 intron SV40 (Sprague, et al., J. Virol. 45: 773-781 (1983)). Additionally, gene sequences for controlling replication in the host cell, as is known in the art, can be incorporated into the vector.
Purification of a central mimetibody of the hinge region, EPO mimetic or a specified portion or variant thereof A central mimetibody of the hinge region, mimetic of the EPO or a specified portion or variant, can be recovered and purified from recombinant cell cultures by well-known methods,
including, but not limited to, protein A purification, ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and chromatography with lectin. High performance liquid chromatography ("HPLC") can also be used for purification. See, e.g., Colligan, Current Protocols in Immunology, or Current Protocols in Protein Science, John Wiley & Sons, NY, NY, (1997-2003), for example, Chapters 1, 4, 6, 8, 9, 10, each fully incorporated herein by reference. The mimetibodies or the specified portions or variants of the present invention include naturally purified products, synthetic chemical process products and products produced by recombinant techniques from a eukaryotic host, including, for example, yeast cells, from higher plants, of insect and mammals. Depending on the host employed in a recombinant production process, the central mimetibody of the hinge region, EPO mimetic or a specified portion or variant of the present invention, may be glycosylated or non-glycosylated, with glycosylated being preferred. Such methods are described in many standard laboratory manuals, such as Sambrook, supra, Sections 17.37-17.42; Ausubel, supra, Chapters 10, 12, 13, 16, 18 and 20, Colligan, Protein Science, supra,
Chapters 12-14, all fully incorporated herein by reference.
Mimetibodies, fragments v / or variants specified The isolated mimetibodies of the present invention comprise a central mimetibody of the hinge region, mimic of the EPO or a specified portion or variant encoded by any of the polynucleotides of the present invention, as discussed with more detail herein, or any central mimetibody of the hinge region, mimetic of EPO isolated or prepared or a specified portion or variant thereof. Preferably, the central mimetic of the hinge region, mimetic of the EPO or the portion or variant that binds to the ligand, binds to at least one ligand or receptor of the EPO protein and, therefore, provides at least one biological activity of the EPO of the corresponding protein or a fragment thereof. Different therapeutic or diagnostically significant proteins, are well known in the art and suitable assays or biological activities of such proteins are well known in the art. Non-limiting examples of the EPO mimetic peptides suitable for this invention appear in Table 1 below. These peptides can be prepared by the methods described and / or known in the art. A single-letter amino acid abbreviations are used in the
most of the cases. The X in these sequences (and through this specification, unless otherwise specified in a particular case), means that any of the 20 natural or known amino acid residues or known derivatives thereof may be present, or any known modified amino acid thereof. Any of these peptides may be linked in series (ie, sequentially), with or without linkers, and a few examples linked in series are provided in the Table. The binders are listed as "?", And can be any of the binders described herein. The series repeats and the binders are shown separately by dotted lines for clarity. Any peptide that contains a cysteinyl residue can be optionally cross-linked with another Cys-containing peptide, either or both of which can be linked to a carrier. A few cross-linked examples are provided in the Table. Any peptide having more than one Cys residue can form an intrapeptide disulfide bond, too; see, for example, the EPO mimetic peptides in Table 1. A few examples of intrapeptide disulfide-linked peptides are specified in the Table. Any of these peptides can be derived as described herein, and a few derivative examples are provided in the Table. For derivatives in which the carboxyl terminus can be crowned with an amino group, the coronation amino group is shown as -NH2. For derivatives in which the amino acid residues are replaced by different portions
to amino acid residues, substitutions are denoted by a d, which means any of the portions known in the art, for example, as described in Bhatnagar et al. (1996), J. Med. Chem. 39: 3814-9 and Cuthbertson et al. (1997), J. Med. Chem. 40: 2876-82, which are fully incorporated by reference. The substituent J and the substituents Z (Z5, Z6, ... Z40), are defined in the patents of E.U.A. Nos. 5,608,035, 5,786,331 and 5,880,096, which are hereby incorporated by reference in their entirety. For the EPO mimetic sequences (Table 1), the substituents X2 to Xn and the integer "n" are as defined in WO 96/40772, which is incorporated fully as a reference. The residues appearing in bold are amino acids D, but they may optionally be amino acids L. All peptides are linked via peptide bonds unless otherwise indicated. The abbreviations are listed at the end of this specification. In the column "SEQ ID NO", "NR", it means that sequence listing is not required for the given sequence.
TABLE 1
Peptide mimetic sequences of EPO
Sequence / structure SEQ ID NO:
YXCXXGPXTWXCXP 1
YXCXXGPXTWXCXP-YXCXXGPXTWXCXP 1
YXCXXGPXTWXCXP -? - YXCXXGPXTWXCXP 1
YXCXXGPXTWXCXP -? - (1
YXCXXGPXTWXCXP -? - (a-amine) 1
GGTYSCHFGPLTWVCKPQGG 2
GGDYHCRMGPLTWVCKPLGG 3 GGVYACRMGPITWVCSPLGG 4
VGNY CHFGPITWVCRPGGG 5
GGLYLCRFGPVTWDCGYKGG 6
GGTYSCHFGPLTWVCKPQGG 7
GGTYSCHFGPLTWVCKPQGG-GGTYSCHFGPLTWVCKPQGG 7
GGTYSCHFGPLTWVCKPQGG -? - GGTYSCHFGPLTWVCKPQGG 7
GGTYSCHFGPLTWVCKPQGGSSK 8
GGTYSCHFGPLTWVCKPQGGSSK-GGTYSCHFGPLTWVCKPQGGSSK 8
GGTYSCHFGPLTWVCKPQGGSSK -? - GGTYSCHFGPLTWVCKPQGGSSK 8
GGTYSCHFGPLTWVCKPQGGSS (e-amine)
K / ßA / GGTYSCHFGPLTWVCKPQGGSS (a-amine) 8
GGTYSCHFGPLTWVCKPQGGSSK (-? - biotin) 8
CX4X5GPX6TWX7C 9
GGTYSCHGPLTWVCKPQGG 10
VGNYMAHMGPITWVCRPGG 11
GGPHHVYACRMGPLTWIC 12
GGTYSCHFGPLTWVCKPQ 13
GGLYACHMGPMTWVCQPLRG 14
TIAQYICYMGPETWECRPSPKA 15
YSCHFGPLTWVCK 16
YCHFGPLTWVC 17
YX2X3 X4X5G PX 6TWX7X8 19
X-? YX2X3X4X5GPX6X7X8X9X? OX ?? twenty
X1YX2CX4X5GPX6TWX7CX9X10X ?? twenty-one
GGLYLCRFGPVTWDCGYKGG 22
'GGTYSCHFGPLTWVCKPQGG 23
VGNYMCHFGPITWVCRPGGG 24
GGVYACRMGPITWVCSPLGG 25
TIAQYICYMGPETWECRPSPKA 26
YSCHFGPLTWVCK 27
YCHFGPLTWVC 28
SCHFGPLTWVCK 29
(AX2) nX3X4X5GPX6TWX7X8 30
The biological activities of EPO are well known in the art. See, for example, Anagnostou A et al. Erythropoietin has a mitogenic and positive chemotactic effect on endothelial cells. Proceedings of the National Academy of Science (USA) 87: 5978-82 (1990); Fandrey J and Jelkman WE Interleukin 1 and tumor necrosis factor-alpha inhibit erythropoietin production in vitro. Annals of the New York Academy of Science 628: 250-5 (1991); Geissler K et al., Recombinant human erythropoietin: A multipotential
hemopoietic growth factor in vivo and in vitro. Contrib. Nephrol. 87: 1-10 (1990); Gregory CJ Erythropoietin sensitivity as a differentiation marker in the hemopoietic system. Studies of three erythropoietic colony responses ¡n culture. Journal of Cellular Physiology 89: 289-301 (1976); Jelkman W et al Monokines inhibiting erythropoietin production in human hepatoma cultures and in isolated perfused rat kidneys. Life Sci. 50: 301-8 (1992); Kimata H et al Human recombinant erythropoietin directly stimulates B cell immunoglobulin production and proliferation in serum-free medium. Clinical and Experimental Immunology 85: 151-6 (1991); Kimata H et al Erythropoietin enhances immunoglobulin production and proliferation by human plasma cells in a serum-free medium. Clin. Immunology Immunopathol. 59: 495-501 (1991); Kimata H et al. Effect of recombinant human erythropoietin on human IgE production in vitro Clinical and Experimental Immunology 83: 483-7 (1991); Koury MJ and Bondurant MC Erythropoietin retards DNA breakdown and prevent programmed cell death in erythroid progenitor cells. Science 248: 378-81 (1990); Lim VS et al Effect of recombinant human erythropoietin on renal function in humans. Kidney International 37: 131-6 (1990); Mitjavila MT et al Autocrine stimulation by erythropoietin and autonomous growth of human erythroid leukemic cells in vitro. Journal of Clinical Investigation 88: 789-97 (1991); Andre M et al Performance of an immunoradiometric assay of erythropoietin and results for specimens from anemic and polycythemic patients. Clinical Chemistry 38: 758-63 (1992); Hankins WD et al. Erythropoietin-dependent and erythropoietin-producing cell lines. Implications
for research and for leukemia therapy. Annals of the New York Academy of Science 554: 21-8 (1989); Kendall RGT et al Storage and preparation of samples for erythropoietin radioimmunoassay. Clin. Lab. Haematology 13: 189-96 (1991); Krumvieh D et al Comparison of relevant biological assays for the determination of biological active erythropoietin. Dev. Biol. Stand. 69: 15-22 (1988); Ma DD et al Assessment of an EIA for measuring human serum erythropoietin as compared with RIA and an in-vitro bioassay. British Journal of Haematology 80: 431-6 (1992); Noe G et al A sensitive sandwich ELISA for measuring erythropoietin in human serum British Journal of Haematology 80: 285-92 (1992); Pauly JU et al. Highly specific and highly sensitive enzyme immunoassays for antibodies to human interleukin 3 (IL3) and human erythropoietin (EPO) in serum. Behring Institui Mitteilungen 90: 112-25 (1991); Sakata S and Enoki Y Improved microbioassay for plasma erythropoietin based on CFU-E colony formation. Ann. Hematology 64: 224-30 (1992); Sanengen T et al Immunoreactive erythropoietin and erythropoiesis stimulating factor (s) in plasma from hypertransfused neonatal and adult mice. Studies with a radioimmunoassay and a cell culture assay for erythropoietin. Acta Physio. Scand. 135: 11-6 (1989); Widness JA et al A sensitive and specific erythropoietin immunoprecipitation assay: application to pharmacokinetic studies. Journal of Lab. Clin. Med. 119: 285-94 (1992); for an additional information, see also the individual cell lines used in the individual bioassays. Each of the above references is incorporated herein by reference in its entirety. The
EPO can be tested using cell lines such as HCD57, NFS-60, TF-1 and UT-7, that respond to the factor. The activity of EPO can also be assessed in a colony formation assay, by determining the number of CFU-E of bone marrow cells. A different method of defection and complete differentiation is the quantification by RT-PCR of cytokines. A central mimetibody of the hinge region, EPO mimetic, or a specified portion or variant thereof, which partially or substantially preferably provides at least one biological activity of at least one protein or fragment, can be bound to the protein or ligand of the fragment and thus provide at least one activity that is mediated in a manner other than by binding the proiein to at least one ligand or receptacle of the propheine or from other dependent or pro-mediated mechanisms. As used in the present, the term "aclivity of the mimic body of the hinge region, mimic of the EPO", refers to a central mime-body of the hinge region, mimicking the EPO that may modulate or cause minus a protein dependent activity by about 20-10,000%, preferably by at least about 60, 70, 80, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 110 , 120, 130, 140, 150, 160, 170, 180, 190, 200, 250, 300, 350, 400, 450, 500, 550, 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000 , 6000, 7000, 8000, 9000% or more, depending on the trial.
The ability of a mimei-body of the hinge region, mimic of the EPO or a portion or variant specified to provide at least one protein-dependent activity, is preferably assessed by at least one biological assay of the appropriate protein, such as is described herein and / or as is known in the art. A central human mimetibody of the hinge region, EPO mimetic or a specified portion or variant of the invention, may be similar to any class (IgG, IgA, IgM, etc.) or isotype and may comprise at least a portion of a light chain kappa or lambda. In one embodiment, the central human mimetibody of the hinge region, EPO mimetic or a specified portion or variant, comprises a fragment or variable of the heavy chain of IgG, a hinge region, CH2 and CH3, for example, minus one of the isotypes, lgG1, lgG2, lgG3 or lgG4. At least one central mimetic of the hinge region, mimic of the EPO or a specified portion or variant of the invention, binds to at least one specified ligand, specific to at least one proiein, subunit, fragment, portion or any combination thereof. the same. The at least one mimic peptide of the EPO of at least one central mimei-body of the hinge region, EPO mimetic, a specified portion or variant of the present invention, may optionally be linked to at least one specified ligand epitope of the ligand. The binding epitope can comprise any combination of at least one amino acid sequence of at least 1-3 amino acids to the entire specified portion
of the coníiguous amino acids of the sequences selected from the group consisting of a protein ligand, as an EPO receptor or a portion thereof. Such antibodies can be prepared by linking several portions of Formula (1) of the mimetic body of the hinge, EPO mimetic region using known techniques, preparing and expressing at least one (i.e., one or more) nucleic acid molecules encoding the mimeiibody of the hinge region, mimic of EPO, using known techniques of recombinant DNA technology or using any other suitable method as chemical syn- thesis. The mimelibodies that bind to the ligands or receptors of human EPO and that comprise at least a portion that defines a variable region of heavy or light chain, can be prepared using suitable methods, such as the phage display (Kaísube, Y., et al., Int J Mol. Med, 1 (5): 863-868 (1998)) or methods employing transgenic animals, as is known in the art and / or as described in the present. The central mimei-body of the hinge region, EPO mimetic, a specified portion or variant, can be expressed using the coding nucleic acid or portion thereof in a suitable host cell. Preferably, such mimetibodies or fragments that bind to the ligand thereof, can bind to the ligands or receptors of human EPO with high affinity (eg, KD less than or equal to
approximately 10"7 M) The amino acid sequences that are substantially the same as the sequences described herein, include sequences that comprise conservative amino acid substitutions, as well as deletions and / or amino acid insertions. to the replacement of a first amino acid by a second amino acid that has chemical and / or physical properties (eg, charge, sphericity, polarity, hydrophobicity / hydrophilicity), which are similar to those of the first amino acid.Conservative substitutions include the replacement of a amino acid for another within the following groups: lysine (K), arginine (R) and hisidine (H), aspartate (D) and gluíamaío (E); asparagine (N), gluíamina (Q), serina (S), threonine (T), tyrosine (Y), K, R, H, D and E, alanine (A), valine (V), leucine (L), isoleucine (I), proline (P), phenylalanine (F), tryptophan (W), methionine (M), cisiein (C) and glycine (G); F, W and Y; C, S and T.
Amino Acid Codes The amino acids that constitute the mimetibodies or the specified portions or variants of the present invention are often abbreviated. The designations of the amino acids can be indicated by the designation of the amino acid by its one-letter code, its code of other words, name, or nucleoid codons, as is well understood in the art (see, Alberts, B., et al. ., Molecular Biology of The
Cell, Third Ed., Garland Publishing, Inc., New York, 1994), as presented in the Table.
TABLE 2
A central mimetibody of the hinge region, mimetic of the EPO or a specified portion or variant of the present invention, may
include one or more substitutions, deletions or additions of amino acids, either from naïve mutations or human manipulation, as specified herein. Such sequences or others that may be used in the present invention, include, but are not limited to, the following sequences presented in Table 3, as further described in Figures 1-42 of the provisional application of E.U.A. 60 / 507,349, filed on 09/30/2003, fully incorporated by reference herein, corresponding to Figures 1-41 of PCT Application No. US04 / 19783, filed on June 17, 2004, incorporated complete herewith as reference, with the corresponding SEQ ID NOS: 31-72. These Referred Figures 1-42 (SEQ ID NOS: 31-72), or Figures 1-41 of PCT US04 / 19783, show examples of heavy / light chain variable / heavy region sequences, armbands / subdomains and their subscripts. , portions of which may be used in the Ig-derived proteins of the present invention, as taught herein.
TABLE 3
Of course, the number of amino acid substitutions that an expert would make depends on many factors, including those described above. Generally speaking, the number of amino acid substitutions, insertions or deletions for at least one of a central mimetibody of the hinge region, EPO mimic, will not be greater than 40, 30, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1 amino acids, such as 1-30 or any range or value therein, as specified in I presented.
The following description of the components of a central mimetibody of the hinge region of the EPO of the present invention is based on the use of formula I of the present invention,
((V (m) -P (n) -L (o) -H (p) -CH2 (q) -CH3 (r)) (s),
wherein V is at least a portion of an N term of an immunoglobulin variable region, P is at least one bioactive peptide, L is at least one binding polypeptide, H is at least a portion of at least one hinge region of the Immunoglobulin, CH2 is at least a portion of a CH2 constant region of immunoglobulin, CH3 is at least a portion of an immunoglobulin CH3 constant region, m, n, o, p, q, rys are independently an integer enire 0 , 1 or 2 and 10, which mimic different types of immunoglobulin molecules, for example, non-exclusively IgG1, IgG2, IgG3, IgG4, IgA, IgM, IgD, IgE and the like, or any subclass thereof, or any combination thereof. In the central mimetibodies of the hinge region of the present invention, the optional VN terminal portion may comprise 1-20 amino acids of at least one heavy chain variable framework region 1 (FR1), for example, as presented in the Figures 1-9 (SEQ ID NOS: 31-39), or at least one LC variable region, for example, as presented in Figures 10-31 (SEQ ID NOS: 40-61), of the US provisional application 60 / 507,349, filed on 09/30/2003, fully incorporated as
reference herein, corresponding to Figures 1-41 of PCT Application No. US04 / 19783, filed on June 17, 2004, hereby incorporated herein by reference., including substitutions, deletions or insertions as shown in these Figures, with those of the preferred Figures 5, 6 and 8. Also preferred are the variable sequences comprising the sequence Q-X-Q. Portion P may comprise at least any epidermal peptide as known in the art or as described herein, and as non-exclusive, those shown in Table 1, SEQ ID NOS: 1-30, or as known in the art, or any combination or consensus sequence thereof, or any fusion protein thereof. The optional linker sequence can be any peptide linker as is known in the art. The preferred sequence includes any combination of G and S, for example, XrX2-X3-X4-Xn, where X may be G or S, and n may be 5-30. Non-limiting examples include, GS, GGGS, GSGGGS, GSGGGSGG, and the like. In the present invention, the CH1 portion is not used and a variable number of amino acids of the N-terminus of the hinge region is deleted, for example, as referred to in Figures 1-42 of the provisional application of E.U.A. 60 / 507,349, presented on 09/30/2003, fully incorporated by reference herein, corresponding to Figures 1-41 of PCT Application No. US04 / 19783, filed in June
17, 2004, incorporated herein by reference in its entirety, and Table 3. The variable number of amino acids used for the central portion of the hinge region of a mimetibody of the present invention includes, but is not limited to, deletion. of any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 , 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49 , 50, 51, 52, 53, 54, 55, 56, 57 or 1-3, 2-5, 2-7, 2-8, 3-9, 4-10, 5-9, 5-10, 5 -15, 10-20, 2-30, 20-40, 10-50, or any range or value therein, of the N-terminal amino acids of at least one hinge region, for example, as presented in the Figures 32-40 of the provisional US application 60 / 507,349, filed on 09/30/2003, fully incorporated by reference herein, corresponding to Figures 1-41 of PCT Application No. US04 / 19783, filed on June 17, 2004, incorporated completely herein as reference, or Table 3 above, for example, non-exclusively, the deletion of any or all of amino acids 99-101 to 105-157 of amino acids 99-105, 99-108, 99- 111, 99-112, 99-113, 99-114, 99-115, 99-119, 99-125, 99-128, 99-134, 99-140, 99-143, 99-149, 99-155 and 99-158 of Figures 32-40 of the US provisional application 60 / 507,349, filed on 09/30/2003, fully incorporated by reference herein, corresponding to Figures 1-41 of PCT Application No. US04 / 19783, filed on June 17, 2004, incorporated completely herein as reference, which correspond to SEQ ID NOS: 62-70, including the susfituciones,
insertions or deletions described in Figures 32-40 of the provisional application of E.U.A. 60 / 507,349, filed on 09/30/2003, fully incorporated by reference herein, corresponding to Figures 1-41 of PCT Application No. US04 / 19783, filed on June 17, 2004, incorporated in full in the present as a reference. In the preferred embodiments, a hinge region of the present invention includes a deletion of the N term from the hinge region to provide a hinge region that includes an hasfa deletion, but not including a Cys or hasfa residue, but not including a Cys-Pro-Xaa-Cys sequence. In a further preferred embodiment, each center sequence of the hinge region used in a central body of the hinge region of the present invention includes amino acids 109-113 or 112-113 of Figure 36 (SEQ ID NO: 66). (IgG1); 105-110 or 109-110 of Figure 37 (SEQ ID NO: 67) (IgG2); 111-160, 114-160, 120-160, 126-160, 129-160, 135-160, 141-160, 144-160, 150-160, 156-160 and 159-160 of Figure 38 (SEQ ID. NO: 68) (IgG3); or 106-110 or 109-110 of Figure 39 (SEQ ID NO: 69) (IgG4). The sequences CH2, CH3 and optional CH4 can be any human sequence suitable or comparable to human, for example, as presented in Figures 1-42 of the provisional application of E.U.A. 60 / 507,349, filed on 09/30/2003, filed as a reference herein, corresponding to Figures 1-41 of the PCT Application No. US04 / 19783, filed on June 17, 2004,
fully incorporated herein by reference, and Table 3, or as is known in the art, or any combination or consensus sequence thereof, or any fusion thereof. The amino acids in a mimic member of the hinge region, mimic of the EPO or a specified portion or variant of the present invention, which are essential for function, can be identified by methods known in the art, such as silio-directed mugegenesis. or the alanine scanning mufagenesis (eg, Ausubel, supra, Chapters 8, 15; Cunningham and Wells, Science 244: 1081-1085 (1989)). The last procedure introduces unique alanine mulations in each residue in the molecule. The resulting mutant molecules are then tested for biological activity, such as, non-exclusively, at least one activity related to the protein, as specified in the present or as is known in the art. Those sites that are critical to the central region of the hinge region, mimic of EPO, or a specified portion or variant that binds, may also be identified by structural analyzes, such as crystallization, nuclear magnetic resonance, or photoaffinity-labeled (Smlth, et al., J. Mol. Biol. 224: 899-904 (1992) and de Vos, et al., Science 255: 306-312 (1992)). The mimetibodies or specified portions or variants of the present invention may comprise, as the portion P of Formula (I), non-exclusively, at least one portion, sequence or combination selected from 3 to all of at least one of SEQ ID NOS: 1-30. The
Non-limiting variants that can improve or maintain at least one of the activities listed above include, but are not limited to, any of the above polypeptides, which further comprise at least one mutation corresponding to at least one substitution, insertion or deletion that does not affect Significantly, the appropriate biological activities or functions of the central mimetibody of the hinge region mimic EPO. A central mimetibody of the hinge region, EPO mimetic or a specified portion or variant may optionally comprise, at least a functional portion of at least one polypeptide such as the P portion of Formula (I), at least one of 90-100 % of SEQ ID NOS: 1-30. A central mimetibody of the hinge, mimetic region of the EPO may optionally further comprise an amino acid sequence for the P portion of Formula (I), selected from one or more of SEQ ID NOS: 1-30. In one embodiment, the amino acid sequence P or a portion thereof, has approximately 90-100% identity (i.e., 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or any interval or value therein) with the corresponding amino acid sequence of the corresponding portion of at least one of SEQ ID NOS: 1-30. Preferably, 90-100% identity of the amino acid sequence (i.e., 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or any range or value therein) , it is determined by using an appropriate computer algorithm, as is known in the art.
The mimetibodies or specified portions or variants of the present invention may comprise any number of contiguous amino acid residues of a central mimetibody of the hinge region, EPO mimetic or a specified portion or variant of the present invention, wherein the number is selects from the group of integers consisting of 10-100% of the number of contiguous residues in a central mimetibody of the hinge region, EPO mimic. Optionally, this subsequence of conical amino acids is at least about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190 , 200, 210, 220, 230, 240, 250 or more amino acids of longitude, or any value or value therein. In addition, the number of sub-sequences may be any integer selected from the group consisting of 1 to 20, such as at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 , 15, 16, 17, 18, 19, 20, or more. As those with experience will appreciate, the invention includes at least one mimei-body of the hinge region, mimic of the biologically active EPO or a specified portion or variant of the present invention. The mimeiibodies or biologically active specified portions or variants have a specific activity of at least 20%, 30% or 40%, and preferably at least 50%, 60% or 70%, and most preferably at least 80% , 90% or 95% -1000% of that of naphiva (nonsyneffective), endogenous or related prolein and protein inserted or fused
known or specified portions or variants. The methods for testing and quantifying which measure enzymatic activity and specificity by substraction are well known to those skilled in the art. In another aspect, the invention relates to human mimeinibodies and fragments that bind to the ligand as described herein, which are modified by the covalent binding of an organic portion. Such modification can produce a central mimic body of the hinge region, mimic of EPO or a fragment that binds to the ligand with improved pharmacokinetic properties (e.g., increased serum half-life in vivo). The organic portion can be a linear or branched hydrophilic polymeric group, a fatty acid group or a fatty acid ester group. In the particular modalities, the hydrophilic polymeric group can have a molecular weight of about 800 to about 120,000 Dalfons, and can be a polyalkane glycol (e.g., polyethylene glycol (PEG), polypropylene glycol (PPG)), a carbohydrate polymer, an amino acid polymer or a polyvinyl pyrrolidone, and the fatty acid group or the fatty acid ester may comprise from about eight to about forty carbon atoms. The modified mimetibodies and fragments that bind to the ligand of the invention may comprise one or more organic portions that are covalently linked, directly or indirectly to the central mimetibody of the hinge region, mimetic of the EPO or to a specified portion or variant. Each organic portion that binds to a central mimetibody of
the hinge region, EPO mimetic or a fragment that binds to the ligand of the invention, can be independently a hydrophilic polymeric group, a fatty acid group or a fatty acid ester group. As used herein, the term "fatty acid" embraces monocarboxylic acids and dicarboxylic acids. A "hydrophilic polymer group," as used herein, refers to an organic polymer that is more soluble in water than in octane. For example, polylysine is more soluble in water than in octane. Thus, a central mimetibody of the hinge, mimetic region of EPO modified by the covalent attachment of polylysine is encompassed by the invention. Hydrophilic polymers suitable for modifying the antibodies of the invention may be linear or branched and include, for example, polyalkane glycols (eg, PEG, monomethoxy-polyethylene glycol (mPEG), PPG and the like), carbohydrates (eg, dextran, cellulose, ollgosaccharides, polysaccharides and the like), polymers of hydrophilic amino acids (for example, polylysine, polyarginine, polyaspartate and the like), polyalkane oxides (for example, polyethylene oxide, polypropylene oxide and the like) and polyvinyl pyrrolidone. Preferably, the hydrophilic polymer that modifies the central mimetibody of the hinge, mimetic region of the EPO of the invention has a molecular weight of about 800 to about 150,000 Daltons as a separate molecular enume. For example, PEG250o, PEG5000, PEG750o, PEG9000, PEGioooo, PEG? 2500, PEG? 500o and PEG20ooo can be used, where the subscript is the average molecular weight of the polymer in Dalíons.
The hydrophilic polymeric group may be substituted with one to about six fatty acid alkyl or fatty acid ester groups. Hydrophilic polymers which are substituted with a fatty acid or fatty acid ester group can be prepared using suitable methods. For example, a polymer comprising an amine group can be coupled to a carboxylate of the fatty acid or fatty acid ester, and an activated carboxylate (eg, activated with N, N-carbonyl diimidazole) in a fatty acid or an ester of The fatty acid can be coupled to a hydroxyl group in a polymer. Fatty acids and fatty acid esters suitable for modifying the mimetibodies of the invention may be saturated or may contain one or more units of unsaturation. Fatty acids which are suitable for modifying the mimetibodies of the invention include, for example, n-dodecanoate (C-2, lauraio), n-ioradecanoaio (C 4, myriadio), n-octadecanoate (Cie, esilario). ), n-eicosanoaio (C2o, araquidato), n-docosanoato (C22, behenato), n-triacontanoato (C30), n-tetracontanoaío (C4o), cis-? 9-ocíadecanoado (Cis, oleato), all cis-? 5,8,11, 14-eicosatetraenoate (C20, arachidonate), octandioic acid, tetradecandioic acid, ociacdecandioic acid, docosandioic acid and the like. Suitable fatty acid esters include monoesters of dicarboxylic acids comprising a linear or branched lower alkyl group. The lower alkyl group may comprise from one to about twelve, preferably one to about six, carbon atoms.
The modified human molecules and fragments that bind to the ligand can be prepared by using suitable methods, such as by means of a reaction with a nail or more modifying agents. A "modifying agent" as used herein, refers to a suitable organic group (e.g., hydrophilic polymer, a fatty acid, a fatty acid ester) that comprises an activating group. An "activating group" is a chemical moiety or a functional group that can, under suitable conditions, react with a second chemical group thereby forming a covalent bond between the modifying agent and the second chemical group. For example, reactive groups with amine include lamellar electrophilic groups such as tosylate, mesylate, halo (chlorine, bromine, fluorine, iodine), esters of N-hydroxysuccinimidyl (NHS) and the like. Activating groups which can react with the thiols include, for example, maleimide, iodoacetyl, acryloyl, pyridyl disulfides, 5-phiol-2-nitrobenzoic acid (TNB-thiol) and the like. An aldehyde functional group can be coupled to molecules containing amine or hydrazide, and an azide group can react with a trivalent phosphorus group to form phosphoramidate or phosphorimide bonds. Suitable methods for producing acyivant groups in molecules are known in the art (see, for example, Hermanson, G. T., Bioconjugate Techniques, Academic Press: San Diego, CA (1996)). An activating group can be linked directly to the organic group (for example, hydrophilic polymer, fatty acid, fatty acid ester), or through a linking portion, for example, a C1-C12 group
divalenfe, wherein one or more carbon atoms can be replaced by a hetero-atom such as oxygen, nitrogen or sulfur. Suitable linker moieties include, for example, tetra-ethylene glycol, - (CH2) 3-, -NH- (CH2) 6-NH-, - (CH2) 2-NH- and -CH2-0-CH2-CH2-0-CH2 -CH2-0-CH-NH-. Modifying agents comprising a linking moiety, can be produced, for example, by reacting a mono-Boc-alkyldiamine (eg, mono-Boc-ethylenediamine, mono-Boc-diaminohexane) with a fatty acid in the presence of 1-amino acid. -3- (3-dimethylaminopropyl) carbodimide (EDC), to form an amide bond between the free amine and the carboxylaph of the fatty acid. The Boc group can be removed from the production by the trifluoroacetic acid (TFA) irradiation to expose a primary amine which can be coupled to the carboxyl group as described, or it can be reacted with maleic anhydride and the product resulfanized to cyclize to produce an acyl derivative derivative. maleimido of fatty acid. (See, for example, Thompson, et al., WO 92/16221, the teachings of which are incorporated herein by reference). The modified mimeiibodies of the invention can be produced by reacting a human mimei-body downstream of the hinge region, mimic of EPO or a fragment that binds to the ligand with a modifying organism. For example, the organic moieties can be attached to the mimeiibody of the hinge, mimic region of the EPO in a nonspecific manner using a modifying agent that reacts with an amine, for example, a NHS ester of PEG. The mimeficuerpos
modified humans or ligand-binding fragments can also be prepared by reducing disulfide bonds (eg, in-chain disulfide bonds) of a mimic body of the hinge region, mimic of EPO, or a fragment that binds to the ligand. The central mimetibody of the hinge region, mimetic of the reduced EPO or a fragment that binds to the ligand can then be reacted with a modifying agent that reacts with an iole, to produce the central mimei-body of the hinge region, mimetic of the EPO modified of the invention. Modified human mimefibodies and ligand-binding fragments comprising an organic portion that binds to specific sites of a miter-body member of the hinge region, EPO mimetic or a specified portion or variant of the present invention can be prepared using suitable methods, such as reverse proieolysis (Fisch et al., Bioconjugate Chem., 3: 147-153 (1992), Werlen et al., Bioconjugate Chem., 5: 411-417 (1994); Kumaran et al., Protein Sci. 6 (10): 2233-2241 (1997); Itoh et al., Bioorg. Chem., 2, 4 (1): 59-68 (1996); Capellas et al., Biotechnol. Bioeng., 56 (4): 456-463 (1997)), and the methods described in Hermanson, GT, Bioconjugate Techniques, Academic Press: San Diego, CA (1996).
Compositions of Centeral Mammary Moieties of the Hinge Region, EPO mimics The present invention also provides at least one composition of a central mimetic of the hinge region, mimetic of
EPO or a specified portion or variant comprising at least one, at least two, at least three, at least four, at least five, at least six or more mimefibodies or specified portions or variants thereof, as described in present and / or as is known in the art, which are provided in a composition, mixture or non-natural form. Such percentages of the composition are by weight, volume, concentration, molarity or molality as solutions, mixtures, suspensions, emulsions or liquid or dry colloids, as is known in the art or as described herein. Such compositions may comprise 0.00001-99.9999 percent by weight, volume, molarity concentration or molality as liquid, gas or dry solutions, mixtures, suspension, emulsions or colloids, as is known in the art or as described herein, at any interval or value therein, as, non-exclusively 0.00001, 0.00003, 0.00005, 0.00009, 0.0001, 0.0003, 0.0005, 0.0009, 0.001, 0.003, 0.005, 0.009, 0.01, 0.02, 0.03, 0.05, 0.09 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.3, 4.5, 4.6, 4.7, 4.8, 4.9, 5, 6, 7, 8 , 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81 , 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 99.1, 99.2, 99.3, 99.4, 99.5, 99.6, 99.7 , 99.8, 99.9%. Such compositions of the present invention include, but are not limited to, 0.00001-100 mg / ml and / or 0.00001-100 mg / g.
The composition may optionally further comprise an effective amount of at least one compound or protein selected from at least one of an amphetamine drug, a cardiovascular system drug (CV), a drug for the central nervous system (CNS), a drug for the autonomic nervous system (ANS), a drug for the respiratory tract, a drug for the gastrointestinal tract (Gl), a hormonal drug, a drug for the balance of fluids or electrolyte, a hematological drug, an antineoplastic drug, a drug for immunomodulation, an ophthalmic, otic or nasal drug, a topical drug, a nutritive drug or the like. Such drugs are well known in the art, including formulations, indications, dosage and administration for each presented herein (see, eg, Nursing 2001 Handbook of Drugs, 21st edition, Springhouse Corp., Springhouse, PA, 2001; Health Professional's Drug Guide 2001, ed., Shannon, Wilson, Stang, Prenfice-Hall, Inc, Upper Saddie River, NJ, PharmcoIherapy Handbook, Wells ef al., Ed., Appleton &Lange, Slamford, CT, each! Completed in the presence as reference). The antineoplastic drug may be at least one selected from amoebicides or at least one of antiprozozoa, anthelmintic, amphi- mycic, antimalarial, antimicrobial or at least one anilio- prolic, aminoglycosides, penicillins, cephalosporins, tel- cyclines, sulfonamides, fluoroquinolones, antivirals, amphi- infectious macrolides, anti-infectives. miscellaneous The drug for the CV may be at least one selected from
Noiropic, antiarrhyme, antianginal, antihypertensive, anti-lipemic, miscellaneous cardiovascular drugs. The drug for the CNS may be at least one selected from non-narcotic analgesics or at least one selected from antipyretics, nonsteroidal anti-inflammatory drugs, narcotic drugs or at least one opioid analgesic, sedative hypnotics, anticonvulsants, antidepressants, antianxiety drugs, animimicos, sphimulanis. central nervous system, antiparkinsonians, miscellaneous drugs for the central nervous system. The drug for ANS may be at least one selected from cholinergic (parasympathomimetic) blockers, anticholinergic, adrenergic (simpalomiméíicos), adrenergic (sympatholytic), relaxants of the skeleíico muscle, neuromuscular blockers. The drug for the respiratory tract may be at least one selected from antihisphamines, bronchodilators, expectorants or at least one antifeedant, miscellaneous respiratory drugs. The drug for the Ig Gl can be at least one selected from amino acids or at least one of absorbents or at least one of amphiphillenol, digestive enzymes or at least one solubilizer of gallstones, antidiarrheals, laxatives, antiemetics, antiulcer drugs. The hormone drug may be at least one selected from corticosteroids, androgens or at least one anabolic spheroid, esogenous or at least one progesina, gonadotropin, antidiabetic drugs or at least one glucagon, thyroid hormones, thyroid hormone antagonists, pituitary hormones , drugs similar to the paraíiroides. The drug for balance
Fluids and electrolytes can be at least one selected from diuretics, electrolytes or at least one replacement solution, acidifying or at least one alkalinizing. The hematological drug can be at least one selected from hemaynics, anicocoagulans, blood derivatives, thrombolytic enzymes. The antineoplastic agents may be at least one selected from alkylating agents, antimicrobial agents, antineoplastic agents, antineoplastic agents that alter the hormonal balance, miscellaneous antineoplastic agents. The drug for immunomodulation can be at least one selected from immunosuppressants, vaccines or at least one dioxoid, antioxyxin, or at least one amino acid, immune sera, biological response modifiers. Ophthalmic drugs, otic and nasal can be at least one selected from ophthalmic antiinfectives, ophthalmic antiinflammatories, miotics, midriáíicos, ophthalmic vasoconslrictores miscellaneous otic, nasal drugs. The topical drug may be at least one selected from local anti-infectives, scabicides or at least one pediculicide, topical corticosteroids. The nutritive drug can be at least one selected from vitamins, minerals or calories. See, for example, the content of the Nursing 2001 Drug Handbook, supra. The at least one amoebicide or antiprozozoate may be at least one selected from aiovaquone, chloroquine hydrochloride, chloroquine phosphate, meironidazole, meironidazole hydrochloride, pentamidine derivative. The at least one anylhelminic can be at least one selected from mebendazole, pyrantel pamoate, isobendazole. The least
an antimicrobial can be at least one selected from amphocyeric B, amphoprotein B cholesteryl sulfate complex, lipid anfolericin B complex, liposomal amphotericin B, fluconazole, flucyosin, micro-size griseofulvin, ultramicro-sized griseofulvin, iiraconazole, quenoconazole, nisiaine, hydrochloride íerbinafina. The at least one antimalarial can be at least one selected from chloroquine hydrochloride, chloroquine phosphate, doxycycline, hydroxychloroquine sulfate, mefloquine hydrochloride, primaquine phosphate, pyrimethamine, pyrimethylamine with sulfadoxine. The at least one antituberculous or anilileproic acid can be at least one selected from clofazimine, cycloserine, dapsone, ethylbacillin hydrochloride, isoniazid, prazrazinemide, rifabutin, rifampin, rifapentine, streptomycin sulfate. The at least one aminoglycoside can be at least one selected from amikacin sulfate, geniamycin sulfate, neomycin sulfate, streptomycin sulfate, and бbramycin sulfate. The at least one penicillin can be at least one selected from amoxcillin / pofasium clavulanna, amoxicillin hydrolyzate, ampicillin, ampicillin sodium, ampicillin hydrolyzate, sodium ampicillin / sodium sulbacid, cloxacillin sodium, dicloxacillin sodium, sodium mezlocillin, sodium nafcillin, oxacillin sodium, penicillin G benzathine, penicillin G potassium, penicillin G procaine, penicillin G sodium, penicillin V potassium, piperacillin sodium, piperacillin sodium / iozobaciram sodium, disodium ticarcillin, disodium ticarcillin / polasium davulanate. The at least one cephalosporin can be at least one selected from at least one of cefaclor, cefadroxil, cefazolin sodium, cefdinir, hydrochloride of cefepime, cefixime,
sodium cefmelazole, cefonic acid sodium, cefoperazone sodium, cefoximax sodium, cefotein disodium, cefoxycin sodium, cefpodoxime proxeil, cefprozil, ceftazidime, ceftibuiene, ceftizoxime sodium, ceftriaxone sodium, cefuroxime axetil, cefuroxime sodium, cephalexin hydrochloride, cephalexin monohydrate, cephradine, loracarbef . The at least one tetracycline may be at least one selected from demeclocycline hydrochloride, calcium doxycycline, doxycycline hyclate, doxycycline hydrochloride, doxycycline monohydrate, minocidine hydrochloride, teracycline hydrochloride. The at least one sulfonamide can be at least one selected from cotrimoxazole, sulfadiazine, sulfamethoxazole, sulfisoxazole, sulfisoxazole acelyl. The at least one fluoroquinolone can be at least one selected from alacrofloxacin mesylate, ciprofloxacin, enoxacin, levofloxacin, lomefloxacin hydrochloride, nalidixic acid, norfloxacin, ofloxacin, sparfloxacin, trovafloxacin mesylate. The at least one fluoroquinolone can be at least one selected from mesylation of alacrofloxacin, ciprofloxacin, enoxacin, levofloxacin, lomefloxacin hydrochloride, nalidixic acid, norfloxacin, ofloxacin, sparfloxacin, trovafloxacin mesylate. The at least one antiviral can be at least one selected from abacavir sulfate, acyclovir sodium, amanidead hydrochloride, amprenavir, cidofovir, delavirdine mesylate, didanosine, efavirenz, famciclovir, fomivirsen sodium, foscamef sodium, ganciclovir, indinavir sulfate, lamivudine , lamivudine / zidovudine, nelfinavir mesylate, nevirapine, oseltamivir phosphate, ribavirin, rimanadine hydrochloride, ritonavir, saquinavir,
saquinavir mesylate, stavudine, valaciclovir hydrochloride, zalcitabine, zanamivir, zidovudine. The at least one macrolide anti-infective can be at least one selected from azithromycin, clarifromycin, dirithromycin, basic erythromycin, erythromycin esylaromycin, erifromycin eyilsuccinate, erythromycin labyrinthion, erythromycin stearate. The at least one miscellaneous additive may be at least one selected from aztreonam, bacifracin, sodium chloramphenicol succinal, clindamycin hydrochloride, clindamycin palm hydrochloride., dindamicine phosphate, imipenem and sodium cilastaine, meropenem, niírofuraníoína microcrisíales, niírofuraníoína microcrisíales, quinuprisíina / dalfoprisíina, spectinomycin hydrochloride, Irimefoprima, vancomycin hydrochloride. (See, for example, pp. 24-214 of Nursing 2001 Drug Handbook). The at least one inohropic can be at least one selected from the amnio- na, digoxin, milicone lacium. The at least one amino acid may be at least one selected from adenosine, amiodarone hydrochloride, atropine sulfate, bretyl tosilafo, diltiazem hydrochloride, disopyramide, disopyramide phosphate, esmolol hydrochloride, flecalnide acetamide, ibufillda fumarate, hydrochloride lldocaine, mexilefin hydrochloride, moricizine hydrochloride, phenoxine, phenoxynine sodium, procainamide hydrochloride, propafenone hydrochloride, propranolol hydrochloride, quinidine bisulfate, quinidine gluconate, quinidine polygalacyuronide, quinidine sulfate, soiolol, tocainide hydrochloride, hydrochloride of verapamil. The at least one antiangina can be at least one selected from besilado de
Amlodipidine, amylum amyloid, bepridyl hydrochloride, diltiazem hydrochloride, isosorbide dinitrate, isosorbide mononitrate, nadolol, nicardipine hydrochloride, nifedipine, nitroglycerin, propranolol hydrochloride, verapamil, verapamil hydrochloride. The at least one antihypertensive agent may be at least one selected from acebutolol hydrochloride, amlodipine besylate, atenolol, benazepril hydrochloride, betaxolol hydrochloride, bisoprolol fumarate, candesartan cilexetil, captopril, carteolol hydrochloride, carvedilol, clonidine, clonidine hydrochloride. , diazoxide, diliiazem hydrochloride, doxazosin mesylate, enalaprilat, enalapril maleate, eprosartan mesylate, felodipine, fenoldopam mesylate, sodium fosinopril, guanabenz acetate, guanadrel sulfate, guanfacine hydrochloride, hydralazine hydrochloride, irbesartan, isradipine, labetalol hydrochloride, lisinopril, losarían of potassium, methyldopa, methyldopa hydrochloride, succinate of metoprolol, metoprolol tartrate, minoxidil, moexipril hydrochloride, nadolol, nicardipine hydrochloride, nifedipine, nisoldipine, sodium nitroprusside, penbuiolol sulfate, perindopril erbumine, phentolamine mesylate, pindolol, hydrochloride of prazo sina, propanoic hydrochloride, quinapril hydrochloride, ramipril, felmisartan, terazosin hydrochloride, imolol maleate, irarlapril, valsaran, verapamil hydrochloride. The at least one antilipemic can be at least one selected from calcium atorvasfatin, sodium cerivastain, cholesyramine, cholesipyl hydrochloride, fenofibrate (micronized), fluvastatin sodium, gemfibrozil, lovastatin, nlacin, pravasaline sodium, simvasiaine. The at least one miscellaneous drug for the CV may be at least one
selected from abciximab, alprosadil, arbutamine hydrochloride, cilosiazole, clopidogrel bisulfate, dipyridamole, eptifibalide, midodrine hydrochloride, pentoxifylline, ticlopidine hydrochloride, and irofiban hydrochloride. (See, for example, pp. 215-336 of Nursing 2001 Drug Handbook). The at least one non-narcotic or antipyretic analgesic can be at least one selected from acetaminophen, aspirin, magnesium choline irrisalicylate, diflunisal, magnesium salicylate. The at least one non-spheroidal anti-inflammatory drug may be at least one selected from celecoxib, diclofenac, sodium diclofenac, eiolaco, calcium fenoprofen, flurbiprofen, ibuprofen, indomeiacin, indomethacin sodium hydrochloride, ketoprofen, ketorolac tromethamine, nabumeine, naproxen , naproxen sodium, oxaprozin, piroxicam, rofecoxib, sulindaco. The at least one narcotic or opioid analgesic can be at least one selected from alfentanil hydrochloride, buprenorphine hydrochloride, butorphanol hydroxide, codeine phosphate, codeine sulfate, fentanyl citrate, fentanyl transdermal system, transmucosal fentanyl, hydromorphone hydrochloride , meperidine hydrochloride, meladone hydrochloride, morphine hydrochloride, morphine sulfate, morphine urea, nalbuphine hydrochloride, oxycodone hydrochloride, oxycodone pecillin, oxymorphone hydrochloride, pentazocine hydrochloride, pentazocine hydrochloride and naloxone hydrochloride, lactate of pentazocine, propoxyphene hydrochloride, propoxyphene napsylate, remifentanil hydrochloride, sufenanilic acid, framadol hydrochloride. The at least hypnotic sedative can be at least one selected from doral hydrate,
estazolam, flurazepam hydrochloride, pentobarbital, sodium pentobarbital, sodium phenobarbital, secobarbiil sodium, temazepam, iozozolam, zaleplon, zolpidem tartraio. The at least one aniliconvulsant can be at least one selected from acetazolamide sodium, carbamazepine, clonazepam, dorazepaie deipotassium, diazepam, divalproex sodium, ethosuximide, fosfenitoin sodium, gabapenlin, lamotrigine, magnesium sulfate, phenobarbifal, sodium phenobarbital, phenytoin, phenytoin sodium, Sodium phenophin (extended, primidone, iagabine hydrochloride, topiramate, sodium valproate, valprolco acid. The at least one antidepressant may be at least one selected from amyrylpyridine hydrochloride, amitripylline pamoate, amoxapine, bupropion hydrochloride, cyAalopram hydrobromide, clomipramine hydrochloride, desipramine hydrochloride, doxepin hydrochloride, fluoxelline hydrochloride, imipramine hydrochloride, mipramine pamoate, mirtazapine, nefazodone hydrochloride, nortriptyline hydrochloride, paroxetine hydrochloride, phenelzine sulfate, sertraline hydrochloride, sulpharyl of iarylcypromine, maleate of viripramine, venlafaxine hydrochloride. The at least one antianxiety drug can be at least one selected from alprazolam, buspirone hydrochloride, chlordiazepoxide, chlordiazepoxide hydrochloride, dipolamic clorazepate, diazepam, doxepin hydrochloride, hydroxycin hydroquinone, hydroxyzine hydrochloride, hydroxycin pamoate, lorazepam, mephrobamate, Midazolam hydrochloride, oxazepam. The at least one animocyclic drug can be at least one selected from chlorpromazine hydrochloride, clozapine, flufenacin decanoate, enaninate from
fluefenacin, flufenacin hydrochloride, haloperidol, haloperidol decanoa, haloperidol alocap, loxapine hydrochloride, loxapine succinate, mesoridazine besilaine, molindone hydrochloride, olanzapine, perphenazine, pimozide, prochlorperazine, queiapia fumarate, risperidone, thioridazine hydrochloride, thiofixene, thiothixene hydrochloride, hydrochloride of urea fluoride. The at least one central nervous system stimulus can be at least one selected from amphetamine sulfate, caffeine, dextroamphetamine sulfate, doxapram hydrochloride, mefanfetamine hydrochloride, mephiphenidaflor hydrochloride, modafinil, pemoline, phentermine hydrochloride. The at least one antiparkinsonian may be at least one selected from amantadine hydrochloride, mesylation of benztropine, biperiden hydrochloride, biperiden's lactate, bromocriptine mesylate, carbidopa-levodopa, eniacapone, levodopa, pergolide mesylate, pramipexole dihydrochloride, ropinirole, selegiline hydrochloride, iocapona, hydrochloride of iohexyphenylidyl. The at least one miscellaneous drug of the central nervous system can be at least one selected from bupropion hydrochloride, donepezil hydrochloride, droperidol, fluvoxamine maleate, lithium carbonate, lithium chloride, narayriphenium hydrochloride, polacrilex nicoin, nicoinic transdermal system , propofol, benzoate of rizaíipiphen, hydrochloride of the monohydramide of sibuiramine, succinaio of sumafripía, hydrochloride of lacrine, zolmiíipipía. (See, for example, pp. 337-530 of Nursing 2001 Drug Handbook). The at least one cholinergic (for example, parasympathomimetic) may be at least one selected from bethanechol chloride,
edrophonium, neosigmine bromide, neostigmine melilsulfalo, physostigmine salicylate, pyridostigmine bromide. The at least one anticolinergist can be at least one selected from sulfate of atropine, dicyclomine hydrochloride, glycopyrrolate, hyoscyamine, hyoscyamine sulfate, propantheline bromide, scopolamine, scopolamine builyl bromide, scopolamine hydrobromide. The at least one adrenergic (sympathomimetic) may be at least one selected from dobutamine hydrochloride, dopamine hydrochloride, meraminol bitartraph, norepinephrine biomarrow, phenylephrine hydrochloride, pseudoephedrine hydrochloride, pseudoephedrine sulfate. The at least one adrenergic blocker (sympatholytic) can be at least one selected from dihydroergotamine mesylate, ergotamine tartrate, meiiséridle maleate, propranolol hydrochloride. The at least one skeletal muscle relaxant may be at least one selected from baclofen, carisoprodol, chlorzoxazone, cyclobenzaprine hydrochloride, sodium danirolene, meiocarbamol, Iizanidine hydrochloride. The at least one neuromuscular blocker can be at least one selected from airacurium besylate, besylate of cisairacurium, doxacurium chloride, mivacurium chloride, pancuronium bromide, pipecuronium bromide, rapacuronium bromide, rocuronium bromide, succinylcholine chloride, chloride of fubocurarine, vecuronium bromide. (See, for example, pp. 531-84 of Nursing 2001 Drug Handbook). The at least one anisophislamine can be at least one selected from brompheramine maleate, cetiricin hydrochloride, maleate
of chlorpheniramine, clemastine fumarate, ciprohepidead hydrochloride, diphenhydramine hydrochloride, fexofenadine hydrochloride, loratadine, promethazine hydrochloride, promethacillus pheoclonide, triprolidine hydrochloride. The at least one bronchodilator may be at least one selected from albuterol, albufferol sulfate, aminophylline, afropin sulfate, ephedrine sulfate, epinephrine, epinephine bitartrate, epinephrine hydrochloride, ipratropium bromide, soproferenol, isoprorenol hydrochloride, sulfa of isoproierenol, levalbuireol hydrochloride, metaprorenol sulfate, oxyfilin, acetamide of pirbuferol, xinafoalo of salmeferol, sulfuric acid, iophylline. The at least one specimen or anililusive can be at least one selected from benzonatoate, codeine phosphate, codeine sulfate, dexframethraphan bromhydrate, diphenhydramine hydrochloride, guaifenesin, hydromorphone hydrochloride. The at least one respiratory miscellaneous drug can be at least one selected from acetylcysteine, beclomethasone dipropionate, beractan, budesonide, calfacium, cromolyn sodium, dornase alfa, sodium epoprosenol, flunisolide, fluticasone propionate, sodium moniluck, nedocromil sodium, palivizumab, aceionide of triamcinolone, zafirlukast, zileuíona. (See, for example, pp. 585-642 of Nursing 2001 Drug Handbook). The at least one anhydride, adsorbent or anilifluoride can be at least one selected from aluminum carbonate, aluminum hydroxide, calcium carbonate, magaldrate, magnesium hydroxide, magnesium oxide, simethicone, sodium bicarbonate. The at least one digestive enzyme or
The solubility of gallstones can be at least one selected from pancreafina, pancrelipase, ursodiol. The at least one antidiarrhoeic can be at least one selected from atapulgyl, bismuth subsalicylate, polycarbophil sodium, diphenoxylachloride hydrochloride or atropine sulfate, loperamide, octreotide acetate, opium tincture, opium tincture (canforated). The at least one laxative can be at least one selected from bisocodyl, polycarbophil sodium, cascara sagrada (Rhamnus purshiana), aromatic liquid liquid of cascara sagrada, liquid extract of cascara sagrada, castor oil, docusaio cam, docusato sodium, glycerin, lacíulosa, magnesium citrate, magnesium hydroxide, magnesium sulfate, methylcellulose, mineral oil, polyethylene glycol or electrolyte solution, psyllium, senna, sodium phosphates. The at least one antieméfic may be at least one selected from chlorpromazine hydrochloride, dimenhydrinate, dolasetron mesylate, dronabinol, graniseiron hydrochloride, medicine chlorhydrate, metocloproamide hydrochloride, ondanseíron hydrochloride, perphenazine, prochlorperazine, prochlorperazine edisilate, maleate prochlorperazine, promethazine hydrochloride, scopolamine, tietylperazine maleate, trimeiobenzamide hydrochloride. The at least one aniliucera drug may be at least one selected from cimetidine, cimefidine hydrochloride, famotidine, lansoprazole, misoprostol, nizaidin, omeprazole, rabeprozol sodium, bismuth ranifidine citrate, raniidin hydrochloride, sucralpha. (See, for example, pp. 643-95 of the Nursing 2001 Drug Handbook). The at least one corticosteroid may be at least one selected from beiameiason, acetylase from beiamephase or
sodium phosphamide of beíamefasona, sodium phosphatase of betamefasona, aceíaío of cortisone, dexamethasone, dexamethasone acetate, dexamethasone sodium, phosphate, fludrocortisone acetamide, hydrocortisone, hydrocortisone acetyl, hydrocortisone cipiona, sodium hydrocortisone phosphate, succinate of hydrocortisone sodium, methylprednisolone , methylprednisolone acetate, methylprednisolone sodium succinate, prednisolone, prednisolone acetate, prednisolone sodium phosphate, prednisolone tebutapho, prednisone, riamcinolone, friamcinolone aceylonide, friamcinolone diacephia. The at least one androgen or anabolic spheroid can be at least one selected from danazol, fluoximesyerone, meyiliesioserone, decanoafo from nandrolone, fenpropionalo from nandrolone, isoserone, testosterone cypionate, isosiaerone enanaria, isosterone propionate, testosterone transdermal system. The at least one estrogen or progestin can be at least one selected from esterified estrogens, estradiol, estradiol cypionate, estradiol / fransdermic system from noreindrone acellum, estradiol valerate, esogenous (conjugates), esipropylate, eicinyl sphradiol, eylinyl sphradiol and desogestrel Ethyl estradiol and diacephalion of efinodiol, ethynyl sphradiol and desogestrel, ethinyl estradiol and diacetate of ethinodiol, ethinyl estradiol and levonorgesfrel, ethinyl estradiol and noreindrone, ethynyl sphradiol and acetic acid noreindrone, ethynyl estradiol and norgestimaph, ethynyl estradiol and norgesphrel, ethynyl estradiol and norelindrone and acetyl and ferrous fumarate, levonorgesyral, acelaide of medroxyprogesterone, mesyranol and noreindrone, norelindrone, norethindrone acetyl, norgestrel, progesterone. The least
a gonadropropin may be at least one selected from ganirelix acetyl, gonadorelin acetyl, hisyrelin acellum, menopropins. The at least one amino acid or glucagon can be at least one selected from acarbose, chlorpropamide, glimepiride, glipizide, glucagon, glyburide, insulins, metformin hydrochloride, miglitol, pioglitazone hydrochloride, repaglinide, rosiglitazone maleate, troglitazone. The at least one thyroid hormone can be at least one selected from levothyroxine sodium, sodium liothyronine, lyotrix, thyroid. The at least one antagonist of the uroid hormone can be at least one selected from meimazole, pofasium iodide, poisonous iodide (saurated solution), propyl-trifouracil, radioactive iodine (sodium iodide I311), strong iodine solution. The at least one hormone of the pituitary gland may be at least one selected from corticotropin, cosyntropin, desmofresin acetyl, leuprolide acetate, repository corticotropin, somatrem, somatropin, vasopressin. The at least one drug similar to the parathyroid, may be at least one selected from calcifediol, calcitonin
(human), calcitonin (salmon), calcitriol, dihydrotaquiserol, disodium eidronaio. (See, for example, pp. 696-796 of Nursing 2001 Drug Handbook). The at least one diuretic can be at least one selected from acezozolamide, sodium acezozolamide, amiloride hydrochloride, bumetanide, chlorthalidone, sodium ethacrylate, eiacrine acid, furosemide, hydrochlorothiazide, indapamide, manifol, mepholazone, spironolactone, ororsesemida,,, riamriamíeíeíereno,,,, urea. The at least one electrolyte or replacement solution can be at least one selected from calcium oil,
calcium carbonate, calcium chloride, calcium calcium, calcium glutionale, calcium glucerate, calcium gluconate, calcium lactate, calcium phosphate (dibasic), calcium phosphate (tribasic), dextran (high molecular weight), dextran (low molecular weight), hetastarch, magnesium chloride, magnesium sulfate, potassium acetaium, potassium bicarbonate, potassium chloride, potassium gluconate, Ringer's injection, Ringer's injection (lactate), sodium chloride. The at least one acidifying or alkalizing agent can be at least one selected from sodium bicarbonate, sodium lactate, tromethamine. (See, for example, pp. 797-833 of Nursing 2001 Drug Handbook). The at least one hemaynic can be at least one selected from ferrous fumarate, ferrous gluconate, ferrous sulfate, ferrous sulfate (dry), iron dextran, iron sorbitol, polysaccharide-iron complex, sodium-gluconate complex. The at least one anticoagulant may be at least one selected from ardeparin sodium, dalteparin sodium, danaparoid sodium, enoxaparin sodium, calcium heparin, heparin sodium, warfarin sodium. The at least one blood derivative can be at least one selected from 5% albumin, 25% albumin, antihemophilic factor, anti-inhibitor-coagulanfe complex, anlifrombine III (human), facifor IX (human), factor IX complex, fractions of plasma protein. The at least one thrombolytic enzyme can be at least one selected from allylase, anistreplase, reteplase (recombinase), stryptokinase, urokinase. (See, for example, pp. 834-66 of Nursing 2001 Drug Handbook).
The at least one alkylating agent can be at least one selected from busulfan, carboplafin, carmusin, chlorambucil, cisplaine, cyclophosphamide, ifosfamide, lomusin, mechlorefamine hydrochloride, melphalan, melphalan hydrochloride, streptozocin, iomozolomide, iolepa. The at least one animethabolite may be at least one selected from capecitabine, cladribine, cytarabine, floxuridine, fludarabine phosphate, fluorouracil, hydroxyurea, mercaptopurine, methorexafo, methotrexate sodium, thioguanine. The at least one antineoplastic antibiotic can be at least one selected from bleomycin sulfate, dactinomycin, daunorubicin liposomal citrate, daunorubicin hydrochloride, doxorubicin hydrochloride, doxorubicin liposomal hydrochloride, epirubicin hydrochloride, idarubicin hydrochloride, miyomycin, penllosyatin, plicamycin , valrubicin. The at least one antineoplastic that alters the hormonal equilibrium can be at least one selected from anasyrozole, bicaluumamide, sodium pyramusine phosphate, exemesin, fluamide, goserelin acetyl, leirozole, leuprolide acetyl, megesyral acetyl, nilulamide, lamoxyphene, tesfolacyone, foremifen coli. The at least one miscellaneous anineoplastic may be at least one selected from asparaginase, Calmette-Guerin bacilli (BCG) (live intravesical), dacarbazine, doceiaxel, eyoposide, eosophoside phosphate, gemcyanabine hydrochloride, irinoic acid hydrochloride, mihoranium, hydrochloride mifoxanilone, paclitaxel, pegaspargase, porfimer sodium, procarbazine hydrochloride, riomarximab, nitroside, fopoiecane hydrochloride, irasyuzumab,
Finoinoin, vinblastine sulfate, vincrisine sulfate, tartraio vinorelbine. (See, for example, pp. 867-963 of Nursing 2001 Drug Handbook). The at least one immunosuppressant can be at least one selected from azafioprine, basiliximab, cyclosporine, daclizumab, lymphocyte immune globulin, muromonab-CD3, mycophenolate mofopyloyl, mycophenolate hydrochloride mofopil, sirolimus, tacrolimus. The at least one vaccine or toxoid may be at least one selected from the BCG vaccine, cholera vaccine, diphtheria and telanic toxoldes (adsorbed), diphtheria and telanic loxoids and adsorbed acellular pertussis vaccine, diphtheria and telanic toxoids and vaccine for complete cell iosin ferina, Haemophilius b conjugate vaccines, A (inactivated) hepatitis A vaccine, B (recombinant) hepatic vaccines, trivalent influenza virus vaccine 1999-2000 of types A and B (purified surface antigen), vaccine for trivalent influenza virus 1999-2000 of types A and B (subvirion or purified subvirion), vaccine for trivalent influenza virus 1999-2000 types A and B (complete viron), vaccine for Japanese encephalitis virus (inactivated), vaccine for Lyme disease (recombinant OspA), measles and mumps and rubella virus vaccine (live), measles and measles virus vaccine and measles (live), vaccine for measles virus (live vaccine), polysaccharide vaccine for meningococcus, vaccine for mumps virus (live), vaccine for pest, vaccine for pneumococci (polyvalent), vaccine for the poliovirus (uncluttered), poliovirus vaccine (live, oral, ivalent), vaccine
for rabies (adsorbed), rabies vaccine (human diploid cells), rubella and mumps virus vaccine (live), rubella virus vaccine (live, attenuated), leiinic toxoid (adsorbed), foxoid íeíánico (fluid), vaccine for typhoid (oral), vaccine for typhoid (parenteral), polysaccharide vaccine for typhoid Vi, vaccine for varicella virus, vaccine for yellow fever. The at least one antitoxin or antivenom may be at least one selected from the antivenom of the black widow spider, in antivenom for Cróíalos (polyvalent), diphtheria antitoxin (equine), anlivenene Micrurus fulvius). The at least one Immune serum can be at least one selected from the immune globulin immune to cytomegalovirus (inlyvenous), the immune globulin of hepatitis B (human), intramuscular immune globulin, immune globulin iniravenous, immune globulin of rabies (human), Invasive globulin immune to respiratory syncytial virus (human), immune globulin Rh0 (D) (human), intravenous globulin immune to Rh0 (D) (human), globulin immune to tetenes (human), globulin immune to varicella zoster. The at least one biological response modifier can be at least one selected from aldesleukin, epoetin alfa, filgrasim, glatiramer acetate for injection, interferon alfacon-1, inferferon alfa-2a (recombinanie), interferon alfa-2b (recombinanie) , interferon beta-1a, interferon beta-1 b (recombinant), interferon gamma-1b, hydrochloride of levamisole, oprelvekin, sargramosfim. (See, for example, pp. 964-1040 of Nursing 2001 Drug Handbook).
The at least one ophthalmic agent can be selected from bacitracin, chloramphenicol, ciprofloxacin hydrochloride, erythromycin, geniamycin sulfa, 0.3% ofloxacin, polymyxin B sulfate, 10% sodium sulfacefamide, 15% sodium sulfacetamide, 30% sodium sulfacetamide. , бbramycin, vidarabine. The at least one ophthalmic agent may be at least one selected from dexamethasone, dexamethasone sodium phosphate, 0.1% sodium diclofenac, fluorometholone, flurbiprofen sodium, ketorolac, arnomethamine, prednisolone acetamide (suspension), prednisolone sodium phosphate (solution). The at least one mlotic can be at least one selected from acetylcholine chloride, carbachol (intraocular), carbachol (topical), ecoiodofuran iodide, pilocarpine, pilocarpine hydrochloride, pilocarpine nitrate. The at least one mydriatic can be at least one selected from atropine sulfate, cyclopentolate hydrochloride, epinephrine hydrochloride, epinephryl borate, homatropine hydrobromide, phenylephrine hydrochloride, scopolamine hydrobromide, tropicamide. The at least one ophthalmic vasoconstrictor can be at least one selected from naphazoline hydrochloride, oximeiazoline hydrochloride, hydroxyurea hydrochloride. The at least one miscellaneous ophthalmic can be at least one selected from aphidlonidine hydrochloride, bexololol hydrochloride, brimonidine tartrate, carteolol hydrochloride, dipivefrin hydrochloride, dorzolamide hydrochloride, emedasin difumarate, sodium fluorescein, queioiifen fumarate, laianoprosi, levobunolol hydrochloride, melipranolol hydrochloride, sodium chloride (hypertonic), timolol maleate. The at least one Óíico can be at least
a selected one of boric acid, carbamide peroxide, chloramphenicol, triethylamine polypeptide oleate condensate. The at least one nasal drug can be at least one selected from beclomethasone dipropionate, budesonide, ephedrine sulfate, epinephrine hydrochloride, flunisolide, fluficasone propionate, naphazoline hydrochloride, oximeiazoline hydrochloride, phenylephrine hydrochloride, fetrahydrozoline hydrochloride, acephonido of triamcinolone, xylometazoline hydrochloride. (See, for example, pp. 1041-97 of Nursing 2001 Drug Handbook). The at least one local anti-infective may be at least one selected from acyclovir, amphotericin B, azelaic acid cream, bacifracin, bumaconazole niitara, clindamycin phosphate, clofrimazole, econazole nitrate, erythromycin, gentamicin sulfate, quenoconazole, mafenide acetyl, metronidazole (topical), miconazole nitrate, mupirocin, hydrochloride naftifine, neomycin sulfa, nilrofurazone, nisiafine, piala sulfadiazine, terbinafine hydrochloride, terconazole, tetracycline hydrochloride, thioconazole, tolnaftate. The at least one scabicide or pediculicide may be at least one selected from crotamiton, lindane, permethrin, pyrethrins. The at least one topical corticosteroid may be at least one selected from beimameonasone dipropionase, belameiasone valerate, clobefasol propionate, desonido, desoximeiasone, dexamethasone, sodium dexamethasone phosphate, diflorasone diacetate, fluocinolone acetonide, fluocinonide, flurandrenolide, propionate, fluticasone, halcionide, hydrocortisone, hydrocortisone acetate, hydrocortisone buíirate, valerate
of hydrocortisone, mometasone furoate, friamcinolone acetonide. (See, for example, pp. 1098-1136 of Nursing 2001 Drug Handbook). The at least one vitamin or mineral can be at least one selected from vitamin A, complex of vine B, cyanocobalamin, folic acid, hydroxocobalamin, calcium leucovorin, niacin, niacinamide, pyridoxine hydrochloride, riboflavin, iamin hydrochloride, vifamin C, vilamine D, cholecalciferol, ergocalciferol, analog of vitamin D, doxercalciferol, paricalciol, violin E, analogue of vine K, phytonadione, sodium fluoride, sodium fluoride (topical), elements in chromium, copper, iodine, manganese , selenium, zinc. The at least one caloric can be at least one selected from infusions of amino acids (chrysphalins), infusions of amino acids in dexrose, infusions of amino acids with electrolytes, infusions of amino acids with electrolytes in dexfrosa, infusions of amino acids for hepatic failure, infusions of amino acids for alia meiabolic tension, infusions of amino acids for renal failure, dextrose, fat emulsions, medium chain triglycerides. (See, for example, pp. 1137-63 of the Nursing 2001 Drug Handbook). The antibody or polypeptide compositions of the mimetic, central region of the hinge region of the EPO of the present invention may further comprise at least any suitable and / or effective amount of a composition or pharmaceutical composition comprising at least one proiein or antibody of the invention. mimeiibody of the hinge region, mimic of EPO to a cell, tissue, organ, animal or patient in
the need for such modulation, tracing or therapy, optionally further comprising at least one selected from at least one TNF aniagonist (eg, non-exclusively, a chemical antagonist of the TNF protein, an antibody or monoclonal or polyclonal fragment of TNF) , a soluble TNF receptor (e.g., p55, p70 or p85) or a fragment, fusion polypeptides thereof, or a small molecule TNF antagonist, e.g., protein I or II that binds to TNF (TBP -1 or TBP-II nerelimonmab, infliximab, enterocept, CDP-571, CDP-870, afelimomab, lenercept and the like), an antirheumatic drug (for example, methotrexate, auranofin, aurothioglucose, azathioprine, etanercept, sodium gold, sulfate) of hydroxychloroquine, leflunomide, sulfasalcin), a muscle relaxant, a narcotic, a nonsteroidal inflammatory drug (NSAID), an analgesic, an anesthetic, a sedative, a local anesthetic, a neuromuscular blocker, an antimicrobial ( for example, aminoglycoside, an antimicrobial, an antiparasitic, an aniviviral, a carbapenem, a cephalosporin, a flurorquinolone, a macrolide, a penicillin, a sulfonamide, a tetracycline, animicrobial oíros), an amphisoria, a corticosteroid, an anabolic steroid, an agent related to diabetes, a mineral, a nutrient, a thyroid agent, a vilamine, a calcium-related hormone, an amphiarrheal, an anti-inflammatory, an anti-emetic, an anti-ulcer, a laxanie, an anticoagulant, an erythropoietin (eg, epoxyelin) alpha), a filgrasim (for example, G-CSF, Neupogen), a sargramostim (GM-CSF, Leucine), an immunization, an immunoglobulin, an immunosuppressant (for example, basiliximab, cyclosporine, daclizumab), a
growth hormone, a hormone replacement drug, an estrogen receptor modulator, a mydriatic, a cycloplegic, an alkylating agent, an anti-metabolite, a mitotic inhibitor, a radiopharmaceutical, an antidepressant, an antimaniac agent, an antisychic, an anxiolytic , a hypnotic, a sympathomimetic, a stimulant, donepezil, tacrine, a medication for asthma, a befa agony, an inhaled spheroid, a leucoiriene inhibitor, a methylxanine, a cromolyn, an epinephrine or the like, dornase alfa (Pulmozyme), a cytokine or an anphonygosis of the cifocin. Non-limiting examples of such cytokines include, nonexclusively, any of IL-1 to IL-23. Suitable dosages are well known in the art. See, for example, Wells et al., Eds., Pharmacotherapy Handbook, 2nd Edition, Applefon and Lange, Stamford, CT (2000); PDR Pharmacopoeia, Tarascon Pocket Pharmacopoeia 2000, Deluxe Edition, Tarascon Publishing, Loma Linda, CA (2000), each of the references is incorporated completely in the present as reference. Such compositions may also include ioxin molecules that are linked, joined, co-formulated or coadministered with at least one antibody or polypeptide of the present invention. The toxin may optionally act to selectively destroy the cell or pathological tissue. The pathological cell can be a cancer cell or another cell. Such toxins can be, in a non-exclusive manner, a purified or recombinant toxin or a fragment of toxin comprising at least one functional cytotoxic domain of the toxin, for example, selected from at least one of castor,
diphtheria toxin, poison toxin, or a bacterial toxin. The term toxin also includes endoioxins such as exotoxins produced by any mutant or natural recombinant bacteria or viruses, which can cause any pathological condition in humans and other mammals, including toxin shock, which can result in death. Such toxins may include, but are not limited to, enterotoxin labile with the heat of enterotoxigenic E. coli (LT), heat-stable enterotoxin (ST), Shigella cytotoxin, Aeromonas enterotoxins, toxin 1 of toxic shock syndrome ( TSST-1), staphylococcal enterotoxin A (SEA), B (SEB) or C (SEC), eneroeroxins of Esfrepiococos and the like. Such bacteria include, but are not limited to, strains of enteroioxygenic E. coli species (ETEC), sickle-hemorrhagic E. coli (e.g., serotype strains 0157: H7), species of Esiophylococcus (e.g., Staphylococcus aureus, Staphylococcus pyogenes). , Shigella species (eg, Shigella dysenteriae, Shigella flexneri, Sliigella boydii, and Shigella sonnei), Salmonella species (eg, Salmonella typhi, Salmonella cholera-suis, Salmonella enteritidis), Clostridium species (eg, Clostridium perfringens) , Clostridium difficile, Clostridium botulinum), Camphlobacter species (eg, Camphlobacter jejuni, Camphlobacter fetus), Heliobacter species (eg, Hellobacter pylori), Aeromonas species (eg, Aeromonas sobria, Aeromonas hydrophila, Aeromonas caviae), Pleisomonas shigelloides, Yersina enterocolitica, Vibrios species (for example, Vibrios cholerae, Vibrios parahenaolyticus), Klebsiella species, Pseudomonas a eruginous and
Streptococci See, for example, Slein, ed., INTERNAL MEDICINE, 3rd ed., Pp. 1-13, Liííle, Brown and Co., Boston, (1990); Evans et al., Eds., Bacterial Infections of Humans: Epidemiology and Control, 2a. Ed., Pp 239-254, Plenum Medical Book Co., New York (1991); Mandell et al, Principies and Practice of Infectious Diseases, 3a. Ed., Churchill Livingstone, New York (1990); Berkow et al., Eds., The Merck Manual, 16th edition, Merck and Co., Rahway, N.J., 1992; Wood et al, FEMS Microbiology Immunology, 76: 121-134 (1991); Marrack et al., Science, 248: 705-711 (1990), the content of the references is fully incorporated herein by reference. The compositions of the central mimetibody of the hinge region, EPO mimetic or a specified portion or variant of the present invention, may further comprise at least one of any suitable auxiliary, such as, but not limited to, a diluent, binder, siabilizanie, shock absorbers, salts, lipophilic solvents, preservatives, helpers or similar. Pharmaceutically acceptable auxiliaries are preferred. Non-limiting examples of, and methods for preparing such sterile solutions are well known in the art, such as, non-exclusively, Gennaro, Ed., Remington's Pharmaceutical Sciences, 18th Edition, Mack Publishing Co. (Easton, PA) 1990. Pharmaceutically acceptable carriers can be routinely selected that are suitable for the mode of administration, solubility and / or stability of the composition of the central mimetibody of the region of
hinge, mimic of the EPO, as is well known in the art or as described herein. The excipients and pharmaceutical additives useful in the present composition include, but are not limited to, proteins, peptides, amino acids, lipids and carbohydrates (for example, sugars, including monosaccharides, di, tri, tetra and oligosaccharides; sugar derivatives, such as aldiioles, aldonic acids, spherified sugars and the like, and polysaccharides or sugar polymers), which may be present singly or in combination, comprising alone or in combination 1-99.99% by weight or volume. Exemplary protein excipients include serum albumin such as human serum albumin (HSA), recombinant human albumin (rHA), gelatin, casein and the like. The representative amino acid / mimetic components of the hinge region, mimic of EPO or a specified portion or variant, which also function in a buffer capacity, include alanine, glycine, arginine, betaine, histidine, glutamic acid, aspartic acid , cysteine, lysine, leucine, isoleucine, valine, methionine, phenylalanine, aspartame and the like. Another favorite amino acid is glycine. Carbohydrate excipients suitable for use in the invention include, for example, monosaccharides such as fructose, maltose, galactose, glucose, D-mannose, sorbose and the like.; disaccharides, such as lactose, sucrose, trehalose, cellobiose and the like; polysaccharides, such as raffinose, melezitose, maltodextrins, dextrans, starches and the like; Y
aldiols, such as mannitol, xylitol, maltiol, lacfilol, xylitol sorbitol (glucitol), myoinosilol and the like. Preferred carbohydrate excipients for use in the present invention are mannitol, trehalose and raffinose. The mimetic compositions of the hinge, mimic region of the EPO may also include a buffer or an agent that adjusts the pH; Typically, the buffer is a salt prepared from an acid or organic base. Representative buffers include organic acid salts such as citric acid, ascorbic acid, gluconic acid, carbonic acid, tartaric acid, succinic acid, acetic acid or phylic acid salts; Tris, hydrochloride of bromethamine or phosphate buffers. Preferred buffers to be used in the present compositions are organic acid salts as a salt. Additionally, compositions of the mimeiibody of the hinge region, EPO mimetic region or a specified portion or variant of the invention, may include polymeric excipients / additives such as polyvinylpyrrolidones, phycole (a polymeric sugar), dextray (e.g. cyclodextrins, such as 2-hydroxypropyl-β-cyclodexyrin), polyethylene glycols, flavoring agents, antimicrobial agents, sweeteners, antioxidants, antialiasing agents, insensitivity agents (for example, polysorbabies such as "TWEEN 20" and "TWEEN 80"), lipids (eg example, phospholipids, fatty acids,), spheroids (e.g., cholesterol), and chelating agents (e.g., EDTA).
These and the additional known excipients and / or pharmaceutical additives suitable for use in the central mimetic compositions of the hinge region, EPO mimetic according to the invention, are known in the art, for example, as listed in " Remington: The Science &Practice of Pharmacy ", 19th ed., Williams & Williams, (1995), and in "Physician's Desk Reference," 52nd ed., Medical Economics, Montvale, NJ (1998), the descriptions of which are fully incorporated herein by reference. Preferred carrier or excipient materials are carbohydrates (e.g., saccharides and aldiioles) and buffers (e.g., chloro) or polymeric agents.
Formulations As indicated above, the invention provides stable formulations, which, preferably, include a suitable buffer with physiological saline or a salt chosen, as well as optional preserved solutions and formulations, containing a preservative, as well as conserved formulations for multiple suitable uses for pharmaceutical or veterinary use, comprising at least one central mimetibody of the hinge region, EPO mimetic or a specified portion or variant in a pharmaceutically acceptable formulation. The preserved formulations contain at least one known preservative or optionally selected from the group consisting of at least one phenol, m-cresol, p-cresol, o-cresol, chlorocresol, alcohol
benzyl, phenylmercuric nitrite, phenoxyethanol, formaldehyde, chlorobutanol, magnesium chloride (eg, hexahydrate), alkyl paraben (methyl, ethyl, propyl, butyl and the like), benzalkonium chloride, benzethonium chloride, sodium dehydroacetate and thimerosal, or mixtures thereof in an aqueous diluent. Any suitable concentration can be used as known in the art, such as 0.001-5%, or any value or value therein, such as, not exclusively 0.001, 0.003, 0.005, 0.009, 0.01, 0.02, 0.03, 0.05 0.09, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4 , 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.3, 4.5, 4.6, 4.7, 4.8, 4.9 or any interval or value in the same. Non-limiting examples include, without conservator, 0.1-2% m-cresol (e.g., 0.2, 0.3, 0.4, 0.5, 0.9, 1.0%), 0.1-3% benzyl alcohol (eg, 0.5, 0.9, 1.1, 1.5, 1.9, 2.0, 2.5%), 0.001-0.5% thimerosal (eg, 0.005, 0.01), 0.001-2.0 % phenol (eg, 0.05, 0.25, 0.28, 0.5, 0.9, 1.0%), 0.0005-1.0% alkylparabens (eg, 0.00075, 0.0009, 0.001, 0.002, 0.005, 0.0075, 0.009, 0.01, 0.02, 0.05 , 0.075, 0.09, 0.1, 0.2, 0.3, 0.5, 0.75, 0.9, 1.0%) and the similar. As indicated above, the invention provides an article of manufacture, which comprises packing a material and at least one vial comprising a solution of at least one less a core mimetibody of the hinge region, EPO mimetic or a portion or variant. specified, with prescribed shock absorbers and / or preservatives,
optionally in an aqueous diluent, wherein the packaging material comprises a label indicating that the solution can be maintained for a period of 1, 2, 3, 4, 5, 6, 9, 12, 18, 20, and 24, 30 , 36, 40, 48, 54, 60, 66, 72 hours or greater. The invention further comprises an article of manufacture, comprising a packaging material, a first vial comprising at least one mimei-body of the hinge region, mimetic of lyophilized EPO or a specified portion or variant, and a second vial that it comprises an aqueous diluent of a prescribed buffer or preservative, wherein the packaging material comprises a label which indicates to the patient to reconstruct the at least one mimetic body of the hinge region, mimic of the EPO or a specified portion or variant in the diluent aqueous, to form a solution that can be maintained for a period of twenty-four hours or more. The at least one central mimetibody of the hinge region, mimic of the EPO or a specified portion or variant used in accordance with the present invention, may be produced by recombinant means, including preparations of mammalian or transgenic cells, or may be purified from other biological sources, as described herein or as known in the art. The identification of the amounts of at least one central mimei-body of the hinge region, EPO mimetic or a portion or variant specified in the product of the present invention, includes amounts that provide after reconstitution, whether it is a wet / dry system ,
concentrations of about 1.0 μg / ml to about 1000 mg / ml, although lower and higher concentrations are operable and are dependent on the intended delivery vehicle, for example, solution formulations will differ from the transdermal, pulmonary, and transmucosal patch methods or osmotic or micropump. Preferably, the aqueous diluent optionally further comprises a pharmaceutically acceptable preservative. Preferred preservatives include those selected from the group consisting of phenol, m-cresol, p-cresol, o-cresol, chlorocresol, benzyl alcohol, alkyl paraben (meilyl, ethyl, propyl, builyl and the like), benzalkonium chloride, Benzeoniium, sodium dehydroacetate and thimerosal, or mixtures thereof. The concentration of the preservative used in the formulation is a sufficient concentration to provide an antimicrobial effect. Such concentrations are dependent on the selected conservative and are easily determined by the expert. Other excipients, for example, agents for isofonicity, buffers, amphodoxies, preservative improvers, may optionally be added and preferably diluted. An agent for isohonicity, such as glycerin, is commonly used at known concentrations. A physiologically tolerated buffer is preferably added to provide improved pH control. The formulations can cover a wide pH range, such as from about pH 4 to about pH 10, and the preferred one ranges from about pH 5 to
about pH 9, and a more preferred one ranges from about 6.0 to about 8.0. Preferably, the formulations of the present invention have a pH of about 6.8 and about 7.8. Preferred buffers include phosphate buffers, more preferably, sodium phosphate, particularly phosphate buffered saline (PBS). Other additives, such as pharmaceutically acceptable solubilizers such as Tween 20 (polyoxyethylene (20) sorbifan monolaurate), Tween 40 (polyoxyethylene (20) sorbifan monopalmitate), Tween 80 (polyoxyethylene (20) sorbitan monooleate), Pluronic F68 (copolymers of polyoxyethylene-polyoxypropylene block), and PEG (polyphenylene glycol) or non-ionic surfactants such as polysorbate 20 or 80 or poloxamer 184 or 188, Pluronic® polyols, other block copolymers, and ionic binders such as EDTA and EGTA can optionally be added to the formulations or compositions to reduce aggregation. These additives are particularly useful if a pump or a plastic container is used to administer the formulation. The presence of a pharmaceutically acceptable surfactant mimics the propensity to aggregate from the proiein. The formulations of the present invention can be prepared by a process comprising mixing at least one central mimetibody of the hinge region, EPO mimetic or a specified portion or variant and a conservative selected from the group consisting of phenol, m-cresol, p-cresol, o-cresol, chlorocresol, benzyl alcohol,
alkyl paraben (methyl, ethyl, propyl, butyl and the like), banzalkonium chloride, benzethonium chloride, sodium dehydroacety and thimerosal or mixtures thereof in an aqueous diluent. The mixing of at least one central mimetibody of the hinge region, mimetic of the EPO or a specified portion or variant and a preservative in an aqueous diluent is carried out using conventional dissolution and mixing procedures. To prepare a suitable formulation, for example, a measured amount of at least one central mimetibody of the hinge region, EPO mimetic or a specified portion or variant in a buffered solution, is combined with the desired preservative in a buffered solution in sufficient quantities to provide the proiein and the preservative at the desired concentrations. Variations of this procedure will be recognized by one of ordinary skill in the art. For example, the order in which the components are added, if additional additives are used, the temperature and the pH at which the formulation is prepared, are all factors that can be optimized for the concentration and the means of administration used. The claimed formulations can be provided to the patients as clear solutions or as double vials comprising a vial of at least one central mimetic of the hinge region, mimetic of lyophilized EPO or a specified portion or variant that is reconstituted with a second vial that contains water, a preservative and / or excipients, preferably a phosphate and / or serum buffer
physiological and a salt chosen, in an aqueous diluent. A single vial with the solution or a dual vial that requires reconstitution can be re-hybridized multiple times and may be sufficient for a single cycle or for multiple cycles of patient irradiation, and may thus provide a more convenient treatment regimen than those currently available. . The claimed manufactured articles of manufacture are useful for administration for a period of immediately to twenty-four hours or more. Accordingly, the claimed manufacturing articles present, offer significant advantages to the patient. The formulations of the invention can optionally and safely be stored at ambient temperatures at about 2 to about 40 ° C and maintain their biological activity of the protein for extended periods of time, thus allowing a label on the package to indicate that the The solution can be maintained and / or used for a period of 6, 12, 18, 24, 36, 48, 72 or 96 hours or more. If the conserved diluent is used, the product may include use at least one of 1-12 months, half a year, one and a half and / or two years. The solutions of at least one central mimetibody of the hinge region, EPO mimetic or a portion or variant specified in the invention, can be prepared by a process comprising mixing at least one central mimetibody of the hinge region, mimetic of the EPO or a specified portion or variant in an aqueous diluent. The mixing is carried out using conventional methods of
dissolution and mixing. To prepare a suitable diluent, for example, a measured amount of at least one central mimetibody of the hinge region, EPO mimetic or a specified portion or variant in water or buffer, is combined in sufficient amounts to provide the protein and optionally a preservative or buffer at the desired concentrations. Variations of this procedure will be recognized by someone with ordinary skill in the art. For example, the order in which the components are added, if additional additives are used, the temperature and the pH at which the formulation is prepared, are all factors that can be optimized for the concentration and the means of administration used. The claimed products can be provided to the patients as transradrenal solutions or as double vials comprising a vial of at least one half metal body of the hinge region., mimetic of lyophilized EPO or a specified portion or variant that is reconstituted with a second vial containing the aqueous diluent. A single vial with the solution or a dual vial requiring reconstitution may be re-used multiple times and may be sufficient for a single cycle or for multiple cycles of the patient's schedule, and may thus provide a more convenient regimen than the currently available ones. . The claimed products can be provided indirectly to patients by providing pharmacies, clinics or other such institutions and facilities, transparent solutions or double vials
which comprise at least one central mimetibody of the hinge region, mimetic of lyophilized EPO or a specified portion or variant that is reconstiuted with a second vial containing the aqueous diluent. The translucent solution in this case can be up to one liter or even larger in size, providing a large deposit from which smaller portions of the solution of the at least one central mimetibody of the hinge, mimetic region of the EPO or a portion or variant specified, one or multiple times, to transfer them to smaller vials and be provided by the pharmacy or clinic to their clients and / or patients. Recognized devices comprising these single-vial systems include those pen injector devices for the delivery of a solution, such as Humajecí®, NovoPen®, B-D®Pen, AuíoPen® and Opíimen®. Recognized devices comprising a dual system include those pen injector systems for reconstituting a lyophilized drug in a cartridge for delivery of the reconstituted solution, such as HumairoPen®. The products claimed present include a packaging material. The packaging material shall provide, in addition to the information required by the regulatory agencies, the conditions under which the product may be used. The packaging material of the present invention provides instructions to the patient to reconstruct the at least one mimei-body of the hinge region, mimic of the EPO or a specified portion or variant in the aqueous diluent to form a
solution and use the solution for a period of 2-24 hours or longer for the product of two vials, wet / dry. For a single vial, the product in solution, the label indicates that such a solution can be used for a period of 2-24 hours or more. The claimed products present are useful for pharmaceutical use of the product in humans. The formulations of the present invention can be prepared by a process comprising mixing at least one mimetic body of the hinge region, mimic of the EPO or a specified portion or variant and a selected buffer, preferably a phosphate buffer containing serum physiological or a salt chosen. The mixing of at least one mimetic body of the hinge region, mimicking the EPO or a specified portion or variant and the buffer in aqueous diluent, is carried out using conventional dissolution and mixing procedures. To prepare a suitable formulation, for example, a measured amount of at least one mimic body of the hinge region, mimetic of EPO or a specified portion or variant in water or buffer, is combined with the desired buffer in water, in sufficient amounts to provide the protein and buffer in the desired concentrations. Variations of this procedure will be recognized by one of ordinary skill in the art. For example, the order in which the components are added, if additional additives are used, the temperature and the pH at which the
formulation, are all factors that can be optimized for the concentration and the means of diversification used. The claimed spiked or preserved formulations can be provided to patients as clear solutions or as double vials comprising a vial of at least one central mimetibody of the hinge region, lyophilized EPO mimic or a specified portion or variant that is reconstituted with a second vial containing a preservative or buffer and excipients in an aqueous diluent. A single vial with the solution or a dual vial that requires reconstitution can be re-used multiple times and may be sufficient for a single cycle or for multiple cycles of the patient's treatment, and may thus provide a more convenient regimen than the currently available ones. . At least one central mimetibody of the hinge region, mimetic of the EPO or a portion or variant specified in the stable or preserved formulations or solutions described herein, may be administered to a patient according to the present invention, via a variety of delivery methods, including SC or IM injection; transdermal, pulmonary, transmucosal, implant, osmotic pump, cartridge, micropump or other means appreciated by the expert, well known in the art.
Therapeutic Applications The present invention for antibodies also provides a method for modulating or irradiating anemia, in a cell, tissue, organ, animal or patient, including, but not limited to, at least one of any anemia, anemia related to the anemia. for cancer, anemia related to radiotherapy or chemotherapy, anemia related to the rash of a viral or bacterial infection, renal anemia, anemia of prematurity, anemia associated with pediatric and / or adult cancer, anemia associated with lymphoma, myeloma , multiple myeloma, anemia associated with AIDS, concomitant traisation for patients with or without donation of aufologo blood waiting for an elective surgery, preoperative and postoperative for surgery, donation or blood transfusion auíóloga, perioperaíorio handling, cyclic neutropenia or Kosímann syndrome (agranulocytosis congenital), end-stage renal disease, anemia associated Dialysis, chronic renal failure, primary hemopoietic diseases, such as congenital hypoplastic anemia, major falasemia, sickle cell disease, vasoocclusive complications of sickle cell disease. Furman et al., Pediatrics 1992; 90: 716-728, Goldberg Science. 1988; 242: 1412-1415; Paul et al., Exp Hematol. 1984; 12: 825-830; Erslev et al., Arch Infern Med. 1968; 122: 230-235; Ersley et al., Ann Clin Lab Sci. 1980; 10: 250-257; Jacobs ei al., Nafure. 1985; 313: 806-810; Lin ei al., Proc Nati Acad Sci USA. 1985; 82: 7580-7584; Law al., Proc Naíl Acad Sci USA. 1986; 83: 6920-6924; Goldwasser ef al., J Biol Chem. 1974;
249: 4202-4206; Eaves eí al., Blood. 1978; 52: 1196-1210; Sawyer went to., Blood. 1989; 74: 103-109; Winearls et al., Lancet. 1986; 2: 1175-1178; Eschbach et al., N Engl J Med. 1987; 316: 73-78; Eschbach et al., Ann Intern Med. 1989; 111: 992-1000, each reference is fully incorporated herein by reference. The antibodies of the present invention can also be used for non-renal forms of induced anemia, for example, by chronic infections, inflammatory processes, radiation therapy and cytosylactic drug therapy, and aleniative results have been reported in patients with non-renal anemia. . See, for example, Abis Rl and Rudnick SA Erythropoietin: evolving clinical applications. Experimental Hemaíology 19: 842-50 (1991); Graber SE and Kraníz SB Erythropoietin: biology and clinical use. Hemafology / Oncol. Clin. North Amer. 3: 369-400 (1989); Jelkman W and Gross AJ (eds) Eryíhropoietin. Springer, Berlin 1989; Koury MJ and Bondurant MC The molecular mechanism of erythropoietin action. European Journal of Biochemistry 210: 649-63 (1992); Krantz SB Eryíhropoietin. Blood 77: 419-34 (1991); Tabbara IA Eryíhropoietin. Biology and clinical applications. Archives of Infernal Medicine 153: 298-304 (1993), each fully incorporated herein by reference. The present invention also provides a method for modulating or irradiating an anemia or condition related to blood cells, in a cell, tissue, organ, animal or patient, wherein the anemia or condition related to the blood cell is associated with
at least one, including, but not limited to, at least one related immune disease, cardiovascular disease, infectious, malignant and / or neurological disease. Such a method may optionally comprise administering an effective amount of at least one composition or pharmaceutical composition comprising at least one central mimei-body of the hinge region, EPO mimetic or a specified portion or variant to a cell, protein, organ, animal. or patient in need of modulation, therapy or therapy. The present invention also provides a method for modulating or bringing the cancer / infectious disease into a cell, organ, animal, or patient, including, but not limited to, at least one of an acute or chronic bacterial infection., acute and chronic parasitic or infectious processes, including bacterial, viral and mycotic infections, HIV infection / neuropathy due to HIV, meningitis, hepatitis, septic arthritis, peritonitis, pneumonia, epiglottis, e. coli 0157: h7, haemolytic uraemic syndrome / myxobolic purpura frombociíopénica, malaria, dengue haemorrhagic fever, leishmaniasis, leprosy, toxic shock syndrome, streptococcal myositis, gas gangrene, mycobacterial tuberculosis, intracellular avium mycobacteria, pneumocystis carinii pneumonia, disease pelvic inflammatory disease, orchitis / epididymiis, legionella, lyme disease, influenza A, epsi-barr virus, vital associated hemaphagocytic syndrome, aseptic encephalitis / meningifis and the like; (ii) leukemia, acute leukemia, acute lymphoblastic leukemia (ALL), ALL of B lymphocytes, T lymphocytes or
FAB, acute myeloid leukemia (AML), chronic myelocytic leukemia (CML), chronic lymphocytic leukemia (CLL), hairy cell leukemia, myelodysplastic syndrome (MDS), lymphoma, Hodgkin's disease, malignant lymphoma, non-hodgkin's lymphoma , Burkitt's lymphoma, multiple myeloma, Kaposi's sarcoma, colorectal carcinoma, pancreatic carcinoma, nasopharyngeal carcinoma, malignant histiocytosis, paraneoplastic syndrome / hypercalcemia of malignancy, solid tumors, adenocarcinomas, sarcomas, malignant melanoma, and the like; or (iii) neurodegenerative diseases, multiple sclerosis, migraine headache, complex dementia due to AIDS, disease-causing diseases, such as multiple sclerosis and acute transverse myelitis; extrapyramidal and cerebellar disorders such as lesions of the corticospinal system; írasíomos of the basal ganglia or cerebelar írastornos; hyperkinetic motion frasíomos such as Huntingfon's Korea and senile korea; movement frasures induced by drugs, such as those induced by drugs that block CNS dopamine receptors; hypokinetic disorders of the movement, such as Parkinson's disease; Progressive Paralysis of the supranucleus; cerebellar esírucfurales injuries; spinocerebellar degenerations, such as spinal ataxia, Friedreich's ataxia, cerebellar cortical degenerations, degenerations of multiple systems (Mencel, Dejerine-Thomas, Shi-Drager and Machado-Joseph); sysiemic írasíornos (Refsum's disease, abeíalipoproíemia, ataxia, íelangiecíasia and mitochondrial írastomo of multiple systems); disorders of the demyelinating nucleus, such as multiple sclerosis, myelitis
acute transverse; and motor unit disorders such as neurogenic muscular atrophies (degeneration of the anterior horn cell, such as amyloid lateral sclerosis, infanilic spinal muscular atrophy, and juvenile spinal muscular atrophy); Alzheimer disease; Down syndrome in middle age; diffuse disease of the Lewy body; Senile dementia of the Lewy body type; Wemicke-Korsakoff syndrome; chronic alcoholism; Creutzfeldí-Jakob disease; subacute sclerosing panencephalitis, Hallerrorden-Spaíz disease and pugilistic dementia and the like. Such a method may optionally comprise administering an effective amount of a composition or pharmaceutical composition comprising at least one antibody to the TNF or a specified portion or variant to a cell, tissue, organ, animal or patient in need of such modulation, treatment or therapy. See, for example, the Merck Manual, 16th Edition, Merck & Company, Rahway, NJ (1992). Such a method may optionally comprise administering an effective amount of at least one composition or pharmaceutical composition comprising at least one mimetic body of the hinge region, mimic of EPO or a specified portion or variant to a cell, tissue, organ, animal. or patient in need of such modulation, treatment or therapy. The present invention also provides a method for modulating or treating at least one cardiovascular disease in a cell, tissue, organ, animal or patient, including, but not limited to,
less one of a cardiac shock syndrome, myocardial infarction, congestive heart failure, stroke, ischemic stroke, haemorrhage, arteriosclerosis, aerosol, diabetic aetiosclerotic disease, hypertension, arterial hypertension, renovascular hypertension, syncope, cardiovascular syphilis, heart failure, pulmonary heart, primary pulmonary hypertension, cardiac arrhythmias, ectopic atrial beats, atrial agitation, atrial fibrillation (sustained or paroxysmal), chaotic or multifocal atrial tachycardia, QRS tachycardia, regular arrhythmias, specific arrhythmias, ventricular fibrillation, His bundle arrhythmias, atrioventricular block, branched beam block, myocardial ischemic disorders, coronary artery disease, chest angina, myocardial infarction, cardiomyopathy, dilated congestive cardiomyopathy, resuscitative cardiomyopathy, vascular heart disease, endocarditis, pericardial disease, cardiac tumors, aortic and peripheral aneurysms, aortic dissection, inflammation of the aorta, occlusion of the abdominal aorta and its branches, peripheral vascular disorders, occlusive arterial disorders, peripheral aà © cersclerotic disease, Buerger's disease, functional disorders of the peripheral artery, Raynaud's phenomenon and disease, acrocyanosis, erymromelalgia, venous diseases, venous thrombosis, varicose veins, arteriovenous fistula, linfederma, lipedema , unstable angina, reperfusion injury, posibomba syndrome, reperfusion ischemia injury and the like. Such a method may optionally comprise administering an effective amount of a pharmaceutical composition or composition comprising at least one
mimetic body of the hinge region, EPO mimic or a specified portion or variant to a cell, tissue, organ, animal or patient in need of modulation, therapy or therapy. Any method of the present invention may comprise administering an effective amount of a composition or pharmaceutical composition comprising at least one mimic body of the hinge region, EPO mimic or a specified portion or variant to a cell, protein, organ, animal. or patient in need of modulation, treatment or therapy. Such a method may further comprise, optionally, coadministration or combination therapy to bring about immune diseases, wherein the administration of at least one central mimetibody of the hinge region, EPO mimetic, a specified portion or variant thereof, comprises also administer, before, concurrently and / or afterwards, at least one selected from at least one TNF antagonist (eg, non-exclusively, an antibody or fragment of TNF, a soluble receptor or fragments of TNF, proteins of fusion, or a small-molecule TNF antagonist), an antirheumatic drug, a muscle relaxant, a narcotic, a nonsteroidal anti-inflammatory drug (NSAID), an analgesic, an anesthetic, a sedative, a local anesthetic, a neuromuscular blocker, an antimicrobial (for example, aminoglycoside, an antimicrobial agent, an antiparasitic agent, an antiviral agent, a carbapenem, cephalosporin, a flurorquinolone, a macrolide, a penicillin, a sulfonamide, an iron oxide, an antimicrobial agent), an anisoaraic, a corticosteroid, a
anabolic steroid, a diabetes-related organism, a mineral, a nutrient, a thyroid agent, a vine, a calcium-related hormone, an antidiarrheal, an antiemetic, an anti-emetic, an antiulcer, a laxanie, an anicoagulanle, an erythropoietin (e.g., epoetin alfa), a filgrasfim (e.g., G-CSF, Neupogen), a sargramostim (GM-CSF, Leucine), an immunization, an immunoglobulin, an immunosuppressant (e.g., basiliximab, cyclosporin, daclizumab), a growth hormone, a drug for hormone replacement, a modulator of the esophageal receptor, a mydriatic, a cycloplegic, an alkylating agent, an animemiabolite, a mitotic inhibitor, a radiopharmaceutical, an antidepressant, an antimaniaco agent, an antisychic, a Anxiolytic, a hypnotic, a sympathomimetic, a stimulant, donepezil, an iacrine, a medication for asthma, a beta agonist, an inhaled spheroid, a leukophrenic inhibitor, a methylxanoline, a cromolyn, an epinephrine or analog, dornase alfa (Pulmozyme), a cifocin or a cycloocin antagonist. Suitable dosages are well known in the art. See, for example, Wells et al., Eds., Pharmacotherapy Handbook, 2nd Edition, Appleton and Lange, Stamford, CT (2000); PDR Pharmacopoeia, Tarascon Pocket Pharmacopoeia 2000, Deluxe Edition, Tarascon Publishing, Loma Linda, CA (2000), each of the references are fully incorporated herein by reference. The mimetibodies can also be used ex vivo, such as in an anilic marrow culture. Briefly, the bone marrow is removed from a patient before chemotherapy and treated with TPO and / or EPO, optionally
in combination with mimetibodies, optionally in combination with one or more additional cytokines. The treated marrow is then returned to the patient after chemotherapy to accelerate marrow recovery. In addition, TPO, alone or in combination with the EPO and / or EPO mimetibodies, can be used for the ex vivo expansion of the marrow in the peripheral blood progenitor cells (PBPC) of the marrow. Before the chemotherapy treatment, the marrow can be stimulated with the germ cell factor (SCF) or G-CSF to release the initial progenitor cells in the bloodstream. These parents are optionally collected and concentrated from the peripheral blood and then treated in culture with TPO and mimetibodies.optionally in combination with one or more other cytokines, including, but not limited to, SCF, G-CSF, IL-3, GM-CSF, IL-6 or IL-11, to differentiate and proliferate in high megakaryocyte cultures. density, which optionally, is then returned to the patient after high-dose chemotherapy. The doses of TPO for ex vivo bone marrow treatment will be in the inervator from 100 pg / ml to 10 ng / ml, preferably 500 pg / ml to 3 ng / ml. The doses of the mimetibodies will be equivalent in acidity to EPO which can be used from 0.1 units / ml to 20 units / ml, preferably from 0.5 units / ml to 2 units / ml, or any value or value therein. TNF antagonists suitable for the compositions, combination therapy, co-administration, devices and / or methods of the present invention (further comprising at least one antibody,
specified portion or variant thereof, of the present invention), include, but are not limited to, anti-TNF antibodies, ligand-binding fragments thereof, and receptor molecules that specifically bind to TNF; compounds which prevent and / or inhibit the synthesis of TNF, the release of TNF or its action on target cells, such as ialidomide, iodide, phosphodiesierase inhibitors (eg, penioxyfilline and rolipram), adenosine receptor agonists A2b and adenosine A2b receptor enhancers; compounds that prevent and / or inhibit TNF receptor signaling, such as inhibitors of mitogen-activated protein kinase (MAP); compounds that block and / or inhibit the excision of TNF from the membrane, such as inhibitors of meyaloproininase; compounds that block and / or inhibit the activity of TNF, such as inhibitors of the enzyme that converts angiotensin (ACE) (eg, capíopril); and compounds that block and / or inhibit the production and / or synthesis of TNF, such as MAP kinase inhibitors. As used in the present, an "antibody to tumor necrosis factor", "TNF antibody", "TNFα antibody" or fragment and the like, decreases, blocks, inhibits, cancels or interferes with the activity of TNFα. viir, in silu and / or preferably in vivo. For example, a suitable human TNF antibody of the present invention can bind to TNFa and include amph-TNF antibodies, fragments that bind to the antigen thereof, and specified mutants or domains thereof that specifically bind to TNFa. An antibody or fragment of the appropriate TNF
it can also decrease, block, annul, interfere, prevent and / or inhibit RNA, TNF-DNA, or protein synthesis, TNF release, TNF receptor signaling, TNF cleavage from the membrane, activity of TNF, the production and / or synthesis of TNF. The chimeric cA2 antibody consists of a variable region that binds to the antigen of the high-affinity, neutralizing mouse anti-human IgG1 antibody to the IgG1 antibody, designated as A2, and the constant regions of human IgG1, immunoglobulin kappa. The Fc region of human IgG1 improves the effector function of the allogeneic antibody, increases the half-life in circulating serum and decreases the immunogenicity of the antibody. The strength and specificity of the chimeric cA2 antibody epitope are derived from the variable region of the murine A2 antibody. In a particular embodiment, a preferred source for the nucleic acids encoding the variable region of murine antibody A2 is the hybridoma A2 cell line. Chimeric A2 (cA2) neutralizes the cyto-toxic effect of natural and recombinant human TNFα in a dose-dependent manner. Of the binding assays of the chimeric cA2 antibody and the recombinant human TNFα, the affinity constant of the chimeric cA2 antibody was calculated to be 1.04 × 10 10 M "1. Preferred methods for determining the specificity and affinity of the monoclonal antibody by inhibition Competitive, can be found in Harlow, et al., Antibodies: A Laboraory Manual, Cold Spring Harbor Laboraory Press, Cold Spring Harbor, New York, 1988; Colligan et al., eds., Currení Protocols in Immunology,
Greene Publishing Assoc. and Wiley Inícscience, New York, (1992-2003); Kozbor went to., Immunol. Today, 4: 72-79 (1983); Ausubel et al., Eds. Currení Profocols in Molecular Biology, Wiley Interscience, New York (1987-2003); and Muller, Meth. Enzymol., 92: 589-601 (1983), references which are fully incorporated in the present reference. In a particular embodiment, the murine monoclonal antibody A2 is produced by a cell line designated c134A. The chimeric antibody cA2 is produced by a cell line designated c168A. Additional examples of anti-TNF monoclonal antibodies that can be used in the present invention are described in the art (see, for example, U.S. Patent No. 5,231, 024).; Moller, A. et al., Cytokine 2 (3): 162-169 (1990); Application of E.U.A. No. 07 / 943,852 (filed on September 11, 1992); Rathjen e al., International Publication No. WO 91/02078 (published February 21, 1991); Rubin et al., EPO Patent Publication No. 0 218 868 (published April 22, 1987); Yone et al., EPO Patent Publication No. 0 288 088 (October 26, 1988); Llang, et al., Biochem. Biophys. Res. Comm. 137: 847-854 (1986); Meager, et al., Hybridoma 6: 305-311 (1987); Fendly et al., Hybridoma 6: 359-369 (1987); Bringman, et al., Hybridoma 6: 489-507 (1987); and Hirai, et al., J. Immunol. Meth. 96: 57-62 (1987), references which are incorporated herein by reference in their entirety).
TNF Receptor Molecules The preferred TNF receptor molecules useful in the present invention are those that bind to alpha affinity to TNFα (see, for example, Feldmann et al., International Publication No. WO 92/07076 (published in April 30, 1992), Schall et al., Cell 61: 361-370 (1990), and Loetscher et al., Cell 61: 351-359 (1990), references which are incorporated herein by reference in full) and optionally have low immunogenicity. In particular, cell surface receptors of 55 kDa (p55 TNF-R) and 75 kDa (p75 TNF-R) TNF are useful in the present invention. Truncated forms of these receptors, comprising the extracellular domains (ECD) of the receptors or the functional portions thereof (see, for example, Corcoran et al., Eur. J. Biochem. 223: 831-840 (1994) ), are also useful in the present invention. Truncated forms of TNF receptors, comprising the ECD, have been detected in urine and serum as 30 kDa and 40 kDa TNFa inhibitory binding proteins (Engelmann, H. et al., J. Biol. Chem. 265: 1531-1536 (1990)). The multimeric molecules of the TNF receptor and the TNF immunoreceptor fusion molecules and the derivatives or fragments or portions thereof, are additional examples of the TNF receptor molecules that are useful in the methods and compositions of the present invention. . The TNF receptor molecules that can be used in the invention are characterized by their ability to treat patients for extended periods with a relief of
symptoms of good to excellent and low toxicity. Low immunogenicity and / or affinity, as well as undefined properties, may contribute to the therapeutic results achieved. The TNF receptor multimeric molecules useful in the present invention comprise all or a functional portion of the ECD of two or more TNF receptors linked via one or more polypeptide linkers or other non-peptide linkers, such as polyethylene glycol (PEG). The multimeric molecules may further comprise a signal peptide of a secreted protein to direct the expression of the multimeric molecule. These multimeric molecules and the methods for their production have been described in the application of E.U.A. No. 08 / 437,533 (filed on May 9, 1995), the content of which is hereby incorporated herein by reference. The TNF immunoreceptor fusion molecules useful in the methods and compositions of the present invention comprise at least a portion of one or more immunoglobulin molecules and all or a functional portion of one or more TNF receptors. These immunoreceptor fusion molecules can be assembled as monomers or hetero or homomultimers. The immunoreceptor fusion molecules can also be monovalent or multivalent. An example of such TNF immunoreceptor fusion molecules is the TNF receptor / IgG fusion protein. TNF immunoreceptor fusion molecules and methods for their production have been described in the art (Lesslauer et al., Eur. J.
Immunol. 21: 2883-2886 (19911; Ashkenazi et al., Proc. Nati, Acad. Sci. USA 88: 10535-10539 (1991); Peppel et al., J. Exp. Med. 174: 1483-1489 (1991); Kolls et al., Proc. Nati, Acad. Sci. USA 91: 215-219 (1994); Buíler et al., Cytokine 6 (6): 616-623 (1994); Baker et al., Eur. J Immunol., 24: 2040-2048 (1994), Beutler et al., U.S. Patent No. 5,447,851, and U.S. Application No. 08 / 442,133 (filed on May 16, 1995), each of the references is incorporated completely in the present as a reference). Methods for producing immunoreceptor fusion molecules can also be found in Capon et al., U.S. Pat. No. 5,116,964; Capón eí al., Patent of E.U.A. No. 5,225,538; and Capon et al., Nature 337: 525-531 (1989), references which are incorporated herein by reference in their entirety. An equivalentderivative, fragment or functional region of the TNF receptor molecule refers to the portion of the TNF receptor molecule, or the portion of the sequence of the TNF receptor molecule that encodes the TNF receptor molecule, which it is of sufficient size and the sequences to functionally resemble the TNF receptor molecules that can be used in the present invention (for example, it binds to TNFa with alias affinity and possesses low immunogenicity). A functional equivalent of the TNF receptor molecule also includes modified TNF receptor molecules, which functionally resemble the TNF receptor molecules that can be used in the present invention (e.g., binds to TNFa with high affinity and has low
immunogenicity). For example, a functional equivalent of the TNF receptor molecule may contain a "SILENT" codon or one or more substitutions, deletions or additions of amino acids (for example, the substitution of an acidic amino acid for another acidic amino acid, or the substitution of a codon encoding the same hydrophobic amino acid or a different one by another codon encoding a hydrophobic amino acid). See, Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Assoc. and Wiley-Interscience, New York (1987-2003). Cytokines include, but are not limited to, all known cytokines. See, for example, CopewifhCyfokines.com. Cytokine antagonists include, but are not limited to, any antibody, fragment or mimetic, any soluble receptor, fragment or mimetic, any small molecule antagonist or any combination thereof. Any method of the present invention may comprise a method for bringing a protein-mediated enzyme, which comprises administering an effective amount of a pharmaceutical composition or composition comprising at least one minor moiety of the hinge region, mimic of the EPO or a portion or variance specified to a cell, tissue, organ, animal or patient in need of modulation, irradiation or therapy. Such a method may optionally further comprise coadministration or combination therapy to irradiate immune diseases, wherein the administration of at least one half-body of
the hinge region, mimic of the EPO, a specified portion or variant thereof, further comprises administering, simultaneously and / or concurrently, at least one selected from at least one of the other cytokines such as IL-3, -6 and -11; facíor germ cells; G-CSF and GM-CSF. Typically, the treatment of pathological conditions is effected by administering an effective amount or dosage of at least one central mimetic composition of the hinge region, EPO mimetic which totals, on average, a range of at least about 0.01 to 500 milligrams. of at least one mimeiibody of the hinge region, mimic of the EPO or a specified portion or variant / kilogram of patient per dose, and preferably at least about 0.1 to 100 milligrams of the central mimeiibody of the hinge region, mimic of the EPO or a specified portion or variant / kilogram of patient per single or multiple administration, depending on the specific activity contained in the composition. All in all, the effective serum concentration may comprise 0.1-5000 μg / ml of serum concentration by single or multiple administration. Suitable dosages are known to the medical practitioners and will, of course, depend on the particular disease state, the specific disease of the composition being administered and the particular patient being subjected to the treatment. In some cases, to achieve the desired therapeutic amount, it may be necessary to provide repeated administration, ie, repeated individual administrations of a particular dose verified or measured, wherein
Individual administrations are repeated until the desired daily dose or effect is achieved. Preferred doses may optionally include 0.01, 0.02, 0.03, 0.04, 0.05. 0.06, 0.07, 0.08, 009, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 and / or 30 mg / kg / administration or any range, value or fraction of same, or to reach a serum concentration of 0.1, 0.5, 0.9, 1.0, 1.1, 1.2, 1.5, 1.9, 2.0, 2.5, 2.9, 3.0, 3.5, 3.9, 4.0, 4.5, 4.9, 5.0, 5.5, 5.9, 6.0, 6.5, 6.9, 7.0, 7.5, 7.9, 8.0, 8.5, 8.9, 9.0, 9.5, 9.9, 10, 10.5, 10.9, 11, 11.5, 11.9, 20, 12.5, 12.9, 13.0, 13.5, 13.9, 14.0, 14.5, 4.9, 5.0, 5.5, 5.9, 6.0, 6.5, 6.9, 7.0, 7.5, 7.9, 8.0, 8.5, 8.9, 9.0, 9.5, 9.9, 10, 10.5, 10.9, 11, 11.5, 11.9, 12, 12.5, 12.9, 13.0 , 13.5, 13.9, 14, 14.5, 15, 15.5, 15.9, 16, 16.5, 16.9, 17, 17.5, 17.9, 18, 18.5, 18.9, 19, 19.5, 19.9, 20, 20.5, 20.9, 21, 22, 23 , 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 96, 100, 200, 300, 400, 500 , 600, 700, 800, 900, 1000, 1500, 2000, 2500, 3000, 3500, 4000, 4500 and / or 5000 / ml of serum concentration by single or multiple administration, or any range, value or fraction thereof. Alternatively, the dosage administered may vary depending on known factors, such as the pharmacodynamic characteristics of the particular agent and its mode and route of administration.; age, health and weight of the recipient; nature and extent of symptoms, kind of concurrent treatment frequency of the event and the desired effect. Usually, a dosage of the active ingredient can be
approximately 0.1 to 100 milligrams per kilogram of body weight. Ordinarily, 0.1 to 50, and preferably 0.1 to 10 milligrams per kilogram per administration or in a sustained release form, are effective to achieve the desired results. As a non-limiting example, the tracing of humans or animals may be provided as a one-time or periodic dosage of at least one core mimetic of the hinge region, EPO mimetic or a specified portion or variant of the present invention, 0.01 to 100 mg / kg, such as 0.5, 0.9, 1.0, 1.1, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17 , 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 40, 45, 50, 60, 70, 80, 90 or 100 mg / kg, per day, in at least one of the day 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 , 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40, or alternatively, at least one of week 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20, or any combination thereof, using single doses, infusion or repeated. Dosage forms (composition) suitable for internal administration generally contain from about 0.0001 milligrams to about 500 milligrams of the active ingredient per unit or container. In these pharmaceutical compositions, the active ingredient will ordinarily be present in a quantity of about 0.5-95% by weight based on the total weight of the composition.
For parenteral administration, the central membrane of the hinge region, mimic of the EPO or a specified portion or variant, can be formulated as a solution, suspension, emulsion or lyophilized powder in association or separately provided, with a parenteral parenteral vehicle. acceptable. Examples of such vehicles are water, physiological saline, Ringer's solution, dextrose solution and 5% human serum albumin. Liposomes and non-aqueous vehicles, such as fixed oils, can also be used. The vehicle or freeze-dried powder may contain additives that maintain isotonicity (e.g., sodium chloride, mannitol) and chemical stability (e.g., buffers and preservatives). The formulation is sterilized by known or suitable techniques. Suitable pharmaceutical carriers are described in the most recent edition of Remington's Pharmaceutical Sciences, A. Osol, a standard reference standard in this field.
Therapeutic Administration Many known and developed modes can be used in accordance with the present invention to administer effec- tively therapeutically effective amounts of at least one central mimefibody of the hinge region, EPO mimetic or a specified portion or variant according to the present invention. While pulmonary administration
is used in the following description, other modes of administration may be used in accordance with the present invention with suitable results. A central mimetibody of the hinge, mimetic region of the EPO of the present invention may be supplied in a carrier, as a solution, emulsion, colloid or suspension or as a powder, using any of a variety of devices and methods owed for administration. by inhalation or other modes described in the present invention or known in the art.
Parenteral Formulations and Administration Formulations for parenteral administration may contain as common carriers water or sterile physiological saline, polyalkylene glycols, such as polyethylene glycol, oils of vegetable origin, hydrogenated naphthalenes and the like. Aqueous or oily suspensions for injection can be prepared using an appropriate emulsifier or humidifier and a suspending agent, according to known methods. The agents for injection may be a non-toxic, non-orally administrable diluting agent, such as an aqueous solution or a sterile injectable solution or suspension in a solvent. As the vehicle or useful solvent, water, Ringer's solution, isotonic saline, etc., are allowed, such as ordinary solvency or suspension solvent, sterile non-volatile oil can be used. For these purposes, any kind of oil and non-volatile fatty acid can be used, including fatty oils or fatty acids
naíurales or siníéíicos or semisiníéíicos; mono or di or naíural or synthetic or semisynthetic oligoglycerides. Parenteral administration is known in the art and includes, but is not limited to, conventional means of injections, a needle-free injection device pressurized with gas, as described in U.S. Pat. No. 5,851, 198, and a laser perforating device as described in the U.S. Patent. No. 5,839,446, fully incorporated herein by reference.
Alternate Delivery The invention is further related to the administration of at least one mimetic body of the hinge region, mimic of EPO or a portion or variant specified by parenteral, subcutaneous, intramuscular, intravenous, bolus, vaginal, rectal, buccal, sublingual, intranasal, or transdermal. The compositions of the protein, mimic body of the hinge region, EPO mimetic or a specified portion or variant, can be prepared for parenteral administration (subcutaneous, intramuscular or intravenous), particularly in the form of liquid solutions or suspensions.; for use in vaginal or rectal administration, particularly semi-solid forms such as creams and suppositories; for buccal or sublingual administration, particularly in the form of tablets or capsules; or intranasally, particularly in the form of powders, nasal drops or aerosols or certain agents; or transdermally, in particular in the form of a gel, ointment, lotion, suspension or delivery system.
patch with chemical enhancers such as dimethyl sulfoxide to modify the structure of the skin or to increase the concentration of the drug in the transdermal patch (Junginger, et al., in "Drug Permeation Enhancement"; Hsieh, DS, Eds., p. 59-90 (Marcel Dekker, Inc. New York 1994, fully incorporated herein by reference), or with oxidizing agents that allow the application of formulations containing proteins and peptides in the skin (WO 98/53847), or application of electric fields to create transient irradiation such as electroporation, or to increase the mobility of drugs charged through the skin, such as iontophoresis, or ultrasound application such as sonophoresis (U.S. Patent Nos. 4,309,989 and 4,767,402). prior publications and patents are hereby incorporated by reference in their entirety).
Lung / Nasal Administration For pulmonary administration, preferably, at least one central mimetic composition of the hinge region, EPO mimetic or a specified portion or variant, is supplied in an effective particle size to reach the airways inferiors of the lung or sinuses. According to the invention, at least one central mimetic of the hinge region, EPO mimetic or a specified portion or variant can be delivered by any of a variety of inhalation or nasal devices known in the art for the administration of a
therapeutic agent by inhalation. These devices are capable of depositing aerosolized formulations in the cavity of the sinuses or the alveoli of a patient, including metered dose inhalers, nebulizers, dry powder generators, sprinklers and the like. Other suitable devices for directing the pulmonary or nasal administration of the mimetic body of the hinge region, mimic of the EPO or a specified portion or variant, are also known in the art. Such devices may use formulations suitable for administration to distribute the central mimetibody of the hinge region, EPO mimetic or a specified portion or variant in an aerosol. Such aerosols may comprise solutions (aqueous or non-aqueous tannins) or solid particles. Metered-dose inhalers, such as the Ventolin® metered-dose inhaler, typically use a propellant gas and require activation during inspiration (see, for example, WO 94/16970, WO 98/35888). Dry powder inhalers such as Turbuhaler ™ (Asirá), Rofahaler® (Glaxo), Diskus® (Glaxo), Spiros ™ inhaler (Dura), devices marketed by Inhale Therapeuíics, and the Spinhaler® powder inhaler (Fisons), use the respiration of a mixed powder (US 4668218 Assira, EP 237507 Assira, WO 97/25086 Glaxo, WO 94/08552 Dura, US 5458135 Inhale, WO 94/06498 Fisons, incorporated herein by reference in its entirety). Nebulizers such as AERx ™ Aradigm, the Ultravent® nebulizer (Mallinckrodt), and the Acom II® nebulizer (Marquest Medical Products) (US 5404871 Aradigm, WO 97/22376), references above
they are fully incorporated herein by reference, produce aerosols of solutions, while metered dose inhalers, dry powder inhalers, etc., generate small particle aerosols. These specific examples of commercially available inhalation devices are intended to be representative of specific devices suitable for the practice of this invention, and are not intended to limit the scope of the invention. Preferably, a composition comprising at least one central mimic body of the hinge region, EPO mimetic or a specified portion or variant is delivered by a dry powder inhaler or a spray. There are several desirable characteristics of an inhalation device for the administration of at least one central membranum of the hinge region, EPO mimetic or a specified portion or variant of the present invention. For example, the delivery by the inhalation device is, in an advantageous, reliable, reproducible and accurate manner. The inhalation device can optionally supply small dry particles, for example, less than about 10 μm, preferably about 1-5 μm, for good breathability.
Administration of compositions of the central mimei-body of the hinge region, EPO mimetic or a portion or variant specified as a spray A spray comprising a composition of a central mimetibody of the hinge region, mimic of the EPO or a portion or specified variant, may be produced by passing a suspension or solution of at least one mimei-body of the hinge region, EPO mimetic or a specified portion or variant through a nozzle under pressure. The size and configuration of the nozzle, the applied pressure and the speed of the liquid feed can be chosen to achieve the desired output and particle size. An electro-vacuum may be produced, for example, by an electric field in connection with a capillary or nozzle feed. Advantageously, the particles of at least one protein of a composition of the central mimetibody of the hinge region, mimic of the EPO or a specified portion or variant, delivered by a sprayer, have a particle size of less than about 10 μm, preferably in the range of about 1 μm to about 5 μm, and more preferably about 2 μm to about 3 μm. Formulations of at least one protein of a composition of a central mimetibody of the hinge region, mimic of EPO or a specified portion or variant suitable for use with a sprayer, typically includes a protein of a composition of a mimetibody.
central of the hinge region, mimetic of the EPO or a specified portion or variant in an aqueous solution at a concentration of about 1 mg to about 20 mg of at least one prolein of a composition of a mimei-body of the hinge region, EPO mimic or a portion or variance specified per ml of solution. The formulation may include agents such as an excipient, a buffer, an agent for isotonicity, a preservative, a surfactant and, preferably, zinc. The formulation may also include an excipient or agent for the stabilization of the protein of the mimei-body composition of the hinge region, EPO mimetic or a specified portion or variant, such as a buffer, a reducing agent, a protein bulk or a carbohydrate. Bulk proteins useful in the formulation of the composition proteins of the central mimetibody of the hinge region, EPO mimetic or a specified portion or variant include albumin, protamine or the like. Typical carbohydrates useful in the formulation of proteins of the composition of the central mimetibody of the hinge region, mimetic of EPO or a specified portion or variant include sucrose, mannitol, lactose, trehalose, glucose or the like. The protein formulation of the mimeiibody composition of the hinge region, mimic of the EPO or a specified portion or variant may also include a pentioscintive, which may reduce or prevent protein-induced surface aggregation of the protein. composition of the mimeiibody of the hinge region, mimic of the EPO or a
portion or specified variant, caused by the atomization of the solution when forming an aerosol. Various conventional surfactants can be employed, such as esters of chicken polyethylene fatty acids and alcohols and esters of polyoxyethylene sorbitol fatty acid. The amounts will generally vary between 0.001 and 14% by weight of the formulation. Especially preferred surfactants for the purposes of this invention are the polyoxyethylene sorbitan monooleate, polysorbate 80, polysorbate 20, or the like. Additional agents known in the art for the formulation of a prolein such as the mimeiibodies, or specified portions or variants, may also be included in the formulation.
Administration of the compositions of the central mimetibody of the hinge region, mimetic of the EPO or a portion or variant specified by means of a nebulizer The proiein of the composition of the mimeiibody of the hinge region, mimetic of the EPO or a specified portion or variant it can be administered by a nebulizer, such as a jet nebulizer or an ulysonic nebulizer. Typically, in a jet nebulizer, a source of compressed air is used to create a jet of air at a velocity through a hole. As the gas expands beyond the nozzle, a low pressure region is created, which exfers a solution of a protein from the composition of the central mimetibody of the hinge region, EPO mimetic or a specified portion or variant. through
a capillary tube connected to a liquid reservoir. The liquid stream of the capillary tube is cut into unstable filaments and gofas as it leaves the tube, creating the aerosol. A range of configurations, flow rates and types of baffles can be used to achieve the desired performance characteristics for a given jet nebulizer. In an ulysonic nebulizer, the electric energy of alias frequency is used to create vibrational, mechanical energy, typically using a piezoelectric transducer. This energy is transferred to the protein formulation of the central mimetibody composition of the hinge region, EPO mimetic or a specified portion or variant either directly or through a coupling fluid creating an aerosol that includes the the composition of the mimic body of the hinge region, mimetic of the EPO or a specified portion or variant. Advantageously, the particles of the composition of the core composition of the hinge region, mimic of the EPO or a specified portion or variant, supplied by the nebulizer, have a particle size of less than about 10 μm, so preferred, in the range of about 1 μm to about 5 μm, and more preferably about 2 μm to about 3 μm. The formulations of at least one mimic body of the hinge region, EPO mimetic or a specified portion or variant suitable for use with a nebulizer, either jet or ulfrasonic, include, typically, a composition of the composition of the central nervous system.
of the hinge region, mimic of the EPO or a specified portion or variant in an aqueous solution at a concentration of about 1 mg to about 20 mg of at least one proiein of the central mimei-body of the hinge region, EPO mimetic or a portion or variant specified per ml of solution. The formulation may include ionic agents such as an excipient, a buffer, an agent for isoyonicity, a preservative, an surfactant and, preferably, zinc. The formulation may also include an excipient or agent for the stabilization of at least one protein of the mimetic composition of the hinge region, mimic of the EPO or a specified portion or variant, as a buffer, a reducing agent., a bulk protein or a carbohydrate. Bulk proteins useful in the formulation of at least one protein of the composition of the central mimetibody of the hinge region, mimetic of EPO or a specified portion or variant include albumin, protamine or the like. Undifferent lipid carbohydrates in the formulation of at least one central membranum of the hinge region, EPO mimic, or a specified portion or variant include sucrose, mannitol, lactose, carbohydrate, glucose, or the like. The at least one central mimetic formulation of the hinge region, EPO mimetic or a specified portion or variant also may include a surfactant, which may reduce or prevent the surface-induced aggregation of at least one central mimetic. of the hinge region, mimetic of EPO or a specified portion or variant, caused by the atomization of the solution to the
form an aerosol. Various conventional agents may be employed, such as esters of polyoxyethylene fatty acid and alcohols, and polyoxyethylene sorbital fatty acid esters. The amounts will generally vary between 0.001 and 4% by weight of the formulation. Preferred oxides especially for the purposes of this invention are monooleate polyoxyethylene sorbitan, polysorbafo 80, polysorba 20, or the like. Additional agents known in the art for the formulation of the falic protein as at least one protein of the central mimetibody of the hinge region, EPO mimetic or a specified portion or variant may also be included in the formulation.
Administration of the mimei-body compositions of the hinge region, EPO mimetic or a specified portion or variant by a metered-dose inhaler In a metered-dose inhaler (MDI), a propellant, at least one central mimetic of the region Hinge, mimic of the EPO or a specified portion or variant, and any excipient or other additive, are contained in a box as a mixture including a compressed or liquefied gas. The actuation of the dosing valve releases the mixture as an aerosol, preferably, containing particles in the size range of less than about 10 μm, preferably about 1 μm to about 5 μm, and most preferably about 2 μm to about 3 μm. The desired size of the
The aerosol particle can be obtained by employing a formulation of a protein of the composition of the central mimetibody of the hinge region, EPO mimetic or a specified portion or variant, produced by various methods known to those skilled in the art, including jet, spray drying, condensation of the critical point or similar. Preferred metered dose inhalers include those manufactured by 3M or Glaxo and employ a hydrofluorocarbon propellant. Formulations of at least one central mimetibody of the hinge region, EPO mimetic or a portion or variant specified for use with a metered dose inhaler device, will generally include a finely divided powder that contains at least one central mimetic of the region. of hinge, mimetic of the EPO or a portion or variant specified as a suspension in a non-aqueous medium, for example, suspended in a propellant with the aid of an surfactant. The propellant may be any conventional material used for this purpose, such as chlorofluorocarbon, a hydrochlorofluorocarbon, a hydrofluorocarbon or a hydrocarbon, including ichlorofluoromethane, dichlorodifluoromethane, dichloroethylfluoroemphenol and 1,1,1- tefrafluoroelan, HFA-134a (hydrofluoroalkane-134a) , HFA-227 (hydrofluoroalkane-227), or similar. Preferably, the propellant is a hydrofluorocarbon. The surfactant can be chosen to stabilize at least one central mimetibody of the hinge region, EPO mimetic or a portion or variant specified as
a suspension in the propellant, to protect the active agent from chemical degradation and the like. Suitable lens surfactants include sorbitaniumiumium, soybean lecithin, oleic acid or the like. In some cases, aerosols in solution that use solid solvents such as eneol are preferred. Additional agents known in the art for the formulation of a protein such as a protein can also be included in the formulation. One of ordinary skill in the art will recognize that the methods of the current invention can be achieved by pulmonary administration of at least one composition of a mimic body of the hinge region, mimic of EPO or a portion or variant specified via devices not described. at the moment.
Mucous formulations and administration For the absorption of mucosal surfaces, the compositions and methods for administering at least one central mimetibody of the hinge region, EPO mimetic or a specified portion or variant, include an emulsion comprising a plurality of submicromeriral particles, a mucoadhesive macromolecule, a bioacid peptide and a phase aqueous coníinua, which promoted the absorption of the mucous surfaces through the mucoadhesion of the particles of the emulsion (U.S. Patent No. 5,514,670). The mucosal surfaces suitable for the application of the emulsions of the present invention
they can include routes of administration cornea, conjunctiva, buccal, sublingual, nasal, vaginal, pulmonary, stomach, intestinal and rectal. Formulations for vaginal or rectal administration, for example, suppositories, may contain as excipients, for example, polyalkylene glycols, petrolatum, cocoa butter and the like. Formulations for inanal administration can be solid and contain as excipients, for example, lactose or they can be aqueous or oily solutions of nasal drops. For oral administration, excipients include sugars, calcium esery, magnesium stearate, pregelatinized starch, and the like (U.S. Patent No. 5,849,695).
Oral formulations and administration Formulations for oral administration are based on the co-administration of adjuvants (for example, resorcinols and non-ionic agents, such as polyoxyethylene oleyl ether and n-hexadecyl polyethylene ether), to artificially increase the permeability of intestinal walls. , as well as the co-administration of enzyme inhibitors (eg, pancreatic trypsin inhibitors, diisopropyl fluorophosphate (DFF) and trasilol), to inhibit enzymatic degradation. The active compound of the dosage form of the solid type for oral administration can be mixed with at least one additive, including sucrose, lactose, cellulose, mannitol, euphalosa, raffinose, mallyoyl, dextran, starches, agar, arginases, chitins, chitosan. , pecíinas, gomaragañío rubber,
gum arabic, gelatin, collagen, casein, albumin, synthetic or semisynthetic polymer, and glyceride. Such dosage forms may also contain other types of additives, for example, an inactive diluent, natural lubricants such as magnesium, paraben, preservatives such as sorbic acid, ascorbic acid, alpha-Icopherol, antioxidants such as cysteine, disinfectants, binders, thickeners, buffer agents, sweeteners, flavoring agents, perfuming agents, etc. Tablets and pills can also be processed in enteric coated preparations. Liquid preparations for oral administration include emulsion, syrup, elixir, suspension and solution preparations, which allow medical use. These preparations may contain inactive diluent agents commonly used in the field, for example, water. Liposomes have also been described as drug delivery systems for insulin and heparin (U.S. Patent No. 4,239,754). More recently, artificial polymer microspheres of mixed amino acids (proteinoids) have been used to deliver the pharmaceuticals (Patenie de E.U.A. No. 4,925,673). In addition, the carrier compounds described in the U.S. Pat. No. 5,879,681 and the U.S. Patent. No. 5,5,871, 753, are used to supply biologically active agents, orally, as is known in the art.
Transdermal Formulations and Administration For transdermal administration, the at least one central mimetibody of the hinge region, EPO mimetic or a specified portion or variant is encapsulated in delivery devices such as liposome or polymer nanoparticles, microcapsule microparticles or microspheres ( collectively referred to as microparticles, unless otherwise indicated). Various suitable devices are known, including microparticles made of synthetic polymers such as polyhydroxy acids such as polylactic acid, polyglycolic acid and copolymers thereof, polyorthoesters, polyanhydrides and polyphosphazenes, and natural polymers such as collagen, polyamino acids, albumin and orads proteins, alginate and other polysaccharides and combinations thereof
(U.S. Patent No. 5,814,599).
Prolonged administration and formulations It may sometimes be desirable to deliver the compounds of the present invention to the subject for extended periods of time, for example, for periods of one week to one year from a single administration. Several dosage forms of release, deposit, or implant can be used. For example, a dosage form may contain a pharmaceutically acceptable non-toxic salt of the compound that has a low degree of solubility in body fluids, for example, (a) an acid addition salt with a polybasic acid such as phosphoric acid, acid
sulfuric acid, cylric acid, tartaric acid, tannic acid, pamoic acid, alginic acid, polyglutamic acid, mono- or disulfonic naphthalenic acid, polygalacryuronic acid and the like; (b) a salt with a polyvalent meifial cation, such as zinc, calcium, bismuth, barium, magnesium, aluminum, copper, cobalt, nickel, cadmium and the like, or with an organic cation formed of for example, N, N ' - dibenzyl-ethylenediamine or eilendiamine; or (c) combinations of (a) and (b), for example, a zinc salt of zinc. Additionally, the compounds of the present invention or, preferably, a relatively insoluble salt such as those just described, can be formulated in a gel, for example, an aluminum monostearate gel with, for example, sesame oil, Suitable for Injection. Particularly preferred salts are zinc salts, zinc salts of zinc, salts of pamoane and the like. Another type of slow release depot formulation for injection would contain the compound or dispersed salt to be encapsulated in a non-toxic, non-antigenic degradation polymer, such as a polylactic acid / polyglycolic acid polymer, for example, as described in the US Patent No. 3,773,919. The compounds or, preferably, the relatively insoluble salts, such as those described above, can also be formulated in cholesterol-matrix syllable granules, particularly for use in animals. In addition, additional slow release, depot or implant formulations, for example, gaseous or liquid liposomes are known in the literature (Pateníe de E.U.A. No.
,770,222 and "Systems of Delivery of Sustained and Concerned Release Drug", J. R. Robinson ed., Marcel Dekker, Inc., N. Y., 1978). Having generally described the invention, it will be more readily understood with reference to the following examples, which are provided by way of illusion and are not intended to be limiting.
EXAMPLE 1 Cloning and expression of a central mimetibody of the hinge region, mimic of EPO in mammalian cells
An ichipic mammalian expression vector contains at least one promoter element, which mediates the initiation of transcription of the mRNA, the coding sequence of the mimeiibody of the hinge region, mimetic of EPO or a specified portion or variant, and signals required for the termination of transcription and polyadenylation of the transcript. Additional elements include enhancers, Kozak sequences and nlervinial sequences flanked by donor and acceptor sites for RNA splicing. A highly efficient transcription can be achieved with the early and late promoters for SV40, the long terminal repeats (LTRS) of Reirovirus, for example, RSV, HTLVI, HIVI and the cytomegalovirus early promoter (CMV). However, cell elements can also be used (for example, promoter of human acyin). Expression vectors suitable for use in the
practice of the present invention include, for example, vector vectors such as pIRESIneo, pReero-Off, pRetro-On, PLXSN or pLNCX (Clonetech Labs, Palo Alto, CA), pADNc3.1 (+/-), pADNc / Zeo (+ / -) or pADNc3.1 / Hygro (+/-) (Invitrogen), PSVL and PMSG (Pharmacia, Uppsala, Sweden), pRSVcat (ATCC 37152), pSV2dhfr (ATCC 37146) and pBC12MI (ATCC 67109). Mammalian host cells that can be used include Hela 293, H9 and Jurkaf human cells, mouse NIH3T3 and C127 cells, Cos 1 cells, Cos 7 and CV 1, quail QC1-3 cells, mouse and ovarian L cells. of Chinese hamster (CHO). Alternatively, the gene can be expressed in stable cell lines that contain the gene integrated into a chromosome. Co-transfection with a selectable marker such as dhfr, gpf, neomycin or hygromycin, allows the identification and isolation of the transfected cells. The transfected gene can also be amplified to express large amounts of the mimetic core of the hinge region, mimic of the encoded EPO or a specified portion or variant. The DHFR marker (dihydrofolate reductase) is useful for developing cell lines that carry several hundred or even several thousand copies of the gene of interest. Another useful selection marker is the enzyme glutamine synase (GS) (Murphy, et al., Biochem J. 227: 277-279 (1991)).; Bebbingíon, et al., Bio / Technology 10: 169-175 (1992)). Using these markers, the mammalian cells are cultured in a selective medium and the cells with the highest resistance are selected. These cell lines contain the amplified genes integrated in a
chromosome. Chinese hamster ovary (CHO) and NSO cells are frequently used for the production of the central mimetibodies of the hinge region, EPO mimetic or a specified portion or variant. The expression vectors pC1 and pC4 contain the strong promoter (LTR) of the Rous Sarcoma Virus (Cullen, et al., Molec. Cell, Biol. 5: 438-447 (1985)), plus a fragment of the CMV enhancer. (Boshart, et al., Cell 41: 521-530 (1985)). Multiple cloning sites, for example, with the excision sites of the BamHI resynchronization enzyme, Xbal and Asp718, facilitate the cloning of the gene of interest. The vectors also contain the 3 'infron, the polyadenylation and termination signal of the rabies preproinsulin gene.
Cloning and expression in CHO cells The vector pC4 is used for the expression of the central mimetibody of the hinge region, mimetic of EPO or a specified portion or variant. Plasmid pC4 is a derivative of plasmid pSV2-dhfr (Accession No. ATCC 37146). The plasmid contains the mouse DHFR gene under the conirol of the SV40 early promoter. Chinese hamster ovary cells or cells that lack the activity of dihydrofolate that are transfected with these plasmids can be selected by culturing the cells in a selective medium (eg, alpha minus MEM, Life Technologies, Gaithersburg, MD), supplemented with the meioírexaío quimioferapéuíico agent. The amplification of DHFR genes in methotrexate-resistant (MTX) cells has been well documented (see, for example, F. W. All,
al., J. Biol. Chem. 253: 1357-1370 (1978); J. L. Hamlin and C. Ma, Biochem. et Biophys. Acta 1097: 107-143 (1990); and M. J. Page and M. A. Sydenham, Biotechnology 9: 64-68 (1991)). Cells that are grown in concentrations that are increased by MTX develop resistance to the drug by overproducing the target enzyme, DHFR, as a result of the amplification of the DHFR gene. If a second gene binds to the DHFR gene, it is usually co-amplified and overexpressed. It is known in the art that this procedure can be used to develop cell lines that carry more than 1,000 copies of the amplified genes. Subsequently, when the meiofrexa is exhaled, cell lines containing the amplified gene integrated in one or more chromosomes of the host cell are obtained. The plasmid pC4 coniiene to express the gene of interest, the strong promoter of the long terminal repeat (LTR) of the Rous Sarcoma Virus (Cullen, et al., Molec.Cell. Biol. 5: 438-447 (1985) ), plus an isolated fragment of the human cytomegalovirus (CMV) immediate early gene enhancer (Boshart, et al., Cell 41: 521-530 (1985)). Downstream of the promoter is BamHI, Xbal and Asp718, the cleavage sites of the restriction enzyme that allow the integration of genes. Defras of these cloning sites, the plasmid contains the 3 'iniron and the polyadenylation site of the rabies preproinsulin gene. Other promoters of alpha efficiency can also be used for the expression, for example, the human β-actin promoter, the SV40 early or late promoters or the long terminal repeats of other reirovirus, for example, HIV and
HTLVI. The expression systems of the Cloneech Tet-Off and Tet-On gene and similar systems can be used to express EPO in a regulated manner in mammalian cells (M. Gossen, and H. Bujard, Proc. Nati. Acad. Sci. USA 89: 5547-5551 (1992)). For the polyadenylation of the mRNA, other signals can also be used, for example, of the human growth hormone or globin genes. Stable cell lines carrying a gene of interest integrated into the chromosomes can also be selected for confraction with selectable markers such as gp1, G418 or hygromycin. It is advantageous to use more than one selectable marker at the start, for example, G418 plus methotrexate. Plasmid pC4 is digested with restriction enzymes and then dephosphorylated using calf intestinal phosphatase by methods known in the art. The vector is then isolated from a 1% agarose gel. The DNA sequence encoding the central mimeinibody of the hinge regionEPO mimic or a specified portion or variant is used, which corresponds to the HC and LC variable regions of a central mimetibody of the hinge region, EPO mimic of the present invention, in accordance with the steps of the method known. The isolated nucleic acid encoding a suitable human conserved region (ie, the HC and LC regions) is also used in this construct. The isolated variable and constant region encoding the DNA and the dephosphorylated vector are then ligated with T4 DNA ligase. The cells
of E. coli HB101 or XL-1 Blue are then transformed and the bacteria are identified as containing the fragment inserted in the plasmid pC4 using, for example, analysis of the restriction enzymes. Chinese hamster ovary (CHO) cells lacking an active DHFR gene are used for transfection. 5 μg of the expression plasmid pC4 is contrasted with 0.5 μg of the plasmid pSV2-neo using lipofectin. Plasmid pSV2neo contains a dominant selectable marker, the neo gene of Tn5 that encodes an enzyme that confers resistance to a group of antibiotics, including G418. The cells are seeded in alpha minus MEM supplemented with 1 μg / ml of G418. After 2 days, the cells are fripinized and seeded in hybridoma cloning plates (Greiner, Germany) in alpha minus MEM supplemented with 10, 25 or 50 ng / ml of methotrexate plus 1 μg / ml of G418. After about 10-14 days, the single clones are triptinized and seeded in 6-well Petri dishes or in 10-ml dishes using different methorexame concentrations (50 nM, 100 nM, 200 nM, 400 nM, 800 nM) . The clones that grow at the concentrations more aliquots of meihotrexate are transfered to new plates of 6 wells that condense even greater concentrations of mephoraxate (1 mM, 2 mM, 5 mM, 10 mM, 20 mM). The same procedure was repeated until clones were obtained that grew at a concentration of 100-200 mM. The expression of the prodrug of the desired gene is analyzed, for example, by SDS-PAGE and Western blot or by reverse phase HPLC analysis.
EXAMPLE 2 Non-limiting example of a central mimetibody of the hinge region, mimic of the EPO of the invention
Aniecedeníes The EMP-1 (peptide miméíico of the EPO-1) is a peptide of 20 amino acids without homology with the sequence of the human erifropoyeíina (HuEPO), but with the capacity (like a dimer) of acíivar the receiver of the EPO ( Wrighton et al, 1996, Science, vol 273,458-463). However, its relatively low activity (10,000 to 100,000 times less than HuEPO) and its short half-life (ex-vivo half-life of 8 hours in 50% serum, unknown live half-life), compromises its usefulness as a therapeutic agent. Therefore, a way is needed to give the penis a longer half-life, without disturbing, and possibly improving its potency. For this purpose, several attempts have been made to increase the activity of EMP-1 by stabilizing the dimerization of the peptide or by incorporating the peptide into larger structures to increase the half-life. Wrighlen I went to. (1997, Nature Biotechnology, vol.15,1261-65) EMP-1 labeled with biotin combined with streptavidin to isolate dimerization. They observed a 100-fold increase in activity in a cell proliferation assay in vitro. They also used amphi-bioin antibody to stabilize the peptide dimer, however, only a 10-fold increase in activity was observed. The same authors prepared a definite dimeric form
chemically of the EMP-1. In this case, a 100-fold increase in in vivo activity was observed. Another group sought to improve the activity of EMP-1 through a covalent bond to polyethylene glycol (PEG) (Johnson et al., 1997, Chem. &Bio., Vol 4 (12), 939-50). They reported an increase in potency up to 1000 times, however, the construct was found to be immunogenic in mice (the antibodies were directed to the peptide) (Dana Johnson, Personal Communications). Kuai I went to. (2000, J. Pepfide Res., Vol 56.59-62) inserted the peptide EMP-1 into the sequence of the plasminogen activator inhibitor-1 (PAI-1). It was thought that the insertion of EMP-1 in this process would make the dimerization and increase the half-life. In an in vivo test, it was observed that the potency of this consfrucio was significantly higher, such as more than 2500 times greater than the EMP-1 alone. It should be noted that different in vilro assays and in vivo models were used in these studies, and the reported potencies may not be comparable with each result or other results presented here.
Central Mimetibody of the Hinge Region, EPO Mimetic of the Present Invention A specific, non-limiting example of this invention is the central EMP-mimic construct of the hinge region, where V is the first of several amino acids N -terminals of a naive HC or LC antibody, P is a single copy of the bioacidive EMP-1 peptide and L is a cascade repeat of the flexible linker Gly-Ser or Gly-Gly-Gly-Ser, H is a region
hinge and CH2 and CH3 are the subclasses of the IgG1 or IgG4 isozyme. It is thought that this structure will resist the peptide EMP-1, but will allow sufficient flexibility so that the dimerization of the peptides as part of the assembled homodimer is stabilized. To support this, the EMP-mimetibody activity of the hinge region in an in vitro cell proliferation assay is more than 500 times greater than that of the EMP-1 peptide and only substantially similar to the recombinant HuEPO (rHuEPO). In addition, it is expected that the half-life of this construct will be many times that of the rHuEPO or peptide EMP-1 alone and similar to that of an IgG. Consistently, normal mice treated with the EMP-central mimetibody of the hinge region achieve a maximum hemarocyte significantly more than the mice tested with rHuEPO, when there are units of biological activity, and the elevated levels are maintained. last a longer period. This construct is efficiently secreted from the cells and appears to be folded properly; overcoming the problems associated with the 1st generation mimetibodies. In addition to the basic structure described above, variants with potentially favorable biological characteristics are described. These include those who may have a decreased tendency to self-associate, reduced immune effector functions, or decreased immunogenicity. You will hear modifications that confer the desired characteristics such as the conformation of the biologically active peptide, and the
transfer through the blood-brain barrier, they are also considered. The proposed variants and modifications may be combined in any way to provide constructs with the desired activities. Using the recombinant DNA methods, the EMP-1 peptide was inserted into an intermediate vector between an immunoglobulin signal peptide and a human J sequence. This was done using the synthetic oligonucleotides complementary to exíre comparables with the resins of the vector present in the vector. These oligonucleotides comprise coding sequences for the consensus site of the signal peptidase (QIQ), the peptide EMP-1 (SEQ ID NO: 2), and a flexible linker composed of GS or GGGS. A restriction fragment containing the functional elements mentioned above was then transferred to an expression neighbor. This vector contained an ani-CD4 immunoglobulin promoter and enhancer, and the coding sequence for a central sequence of the hinge region of human IgG1, and a portion of a hinge region of IgG1, CPPCP (109- 113 of SEQ ID NO: 66, as shown in Figure 36C), a constant region HC 2 (CH 2) and a consynt region 3 (CH 3), as well as the necessary elements for the replication of the plasmid and the selection in the bacteria and the selection of stable expresores in mammalian cells. This plasmid was linearized and infroduced in the mouse NLE cell melanoma cell line via electroporation. The resistant cells were selected and the high expresores of EMP-mimetibody cenfral of the
hinge region, were identified by ELISA assay of culture supernatants. The purification of the cell culture supernatant construct was achieved by affinity chromazography of the standard protein A. The passage of the purified product through polylacrylamide gels containing SDS under denaturation and reduction conditions, confirmed the expected size of the purified product. The identity of the purified protein was further confirmed by mass spectrometry and N terminal sequence. The amino acid sequences of EMP-central amino groups of the hinge region are shown below. Functional domains are indicated above the sequence encoding the peptide. The peptide consensus sequence of the amino acid signal corresponds to the first fresh amino acids of a natural immunoglobulin. It is thought that these amino acids contribute to the efficient removal of the peptide from the signal by the peptidase of the signal in the endoplasmic reticulum. This sequence is immediately followed by the sequence encoding EMP-1. The two C-terminal e-amino acids of the EMP-1 sequence combined with the following six amino acids form a flexible binder characterized by the Gly-Gly-Gly-Ser repeat. A sequence of the human junction region (J) follows later. It is thought that the J sequence will provide even more flexibility to allow the EMP-1 dimer to adopt the proper conformation, and allows the dimer to protrude from the globular structure of the immunoglobulin and penetrate the gap between the two
EPO receivers. The hinge region HC is also included in the construct immediately after the region J. There are three cysteines in the hinge region of lgG1 (highlighted). The former would normally mate with the light chain (LC) of the immunoglobulin and the latter two would participate in interchain links between two HCs. The rest of the sequence is composed of the CH2 and CH3 regions, which constitute the volume of the proiein. One of the reasons why immunoglobulins are thought to have a long serum half-life is their ability to bind to FcRn that extends the serum half-life, returning the pinocytosed immunoglobulin back to the ex-cellular space. This FcRn binding site overlaps the junction of the CH2 and CH3 regions (Sheilds et al, 2001, J. Biol. Chem., Vol 276 (9), 6591-6604). The peptide sequence of central EMP-mimetibody of the hinge region shows important functional domains.
V Peptide EMP-1 Hinge Enlanzate lgG1 CH2 1 QIQGGTYSCHFGPLTWVCKPQGG GS CPPCP APELLGGP lgG1 CH2 61SVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS lgG1 CH3
122TYRWSVLTVLHQDWLNGKEYKCKVSNKALPAP1EKTISKAKGQPREPQVYTLPPSRDEL lgG1 CH3 183TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ lgG1 CH3 241 QGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 82)
V Peptide EMP-1 Hinge Enlanzate lgG1 CH2 1 QIQGGTYSCHFGPLTWVCKPQGG GGGS CPPCP APELLGGP lgG1 CH2 61 SVFLFPPKPKDTL ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS lgG1 CH3
122TYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL lgG1 CH3 183TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ lgG1 CH3 241 QGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 83)
V Peptide EMP-1 Hinge Engage lgG1 CH2 1 QIQGGTYSCHFGPLTWVCKPQGG GSGGGS CPPCP APELLGGP lgG1 CH2 61SVFLFPPKPKDTLMISRTPEVTCWVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS lgG1 CH3
122TYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL lgG1 CH3 183TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ lgG1 CH3 241 QGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 84)
V Peptide EMP-1 Hinge Engage lgG1 CH2 1 QIQGGTYSCHFGPLTWVCKPQGG GS CPPCP APEAAGGP lgG1 CH2 61SVFLFPPKPKDTLMISRTPEVTCWVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS [gG1 CH3
122TYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL IgG1 IgG1 CH3 CH3 241 QGNVFSCSVMHEALHNHYTQKSLSLSPGK 183TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ (SEQ ID NO: 85) V EMP-1 Peptide Hinge IgG1 CH2 1 QIQGGTYSCHFGPLTWVCKPQGG Enlanzate GGGS CPPCP APEAAGGP IgG1 CH2 61 SVFLFPP KPKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS | 9g1 CH3
122TYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL lgG1 CH3 183TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ lgG1 CH3 241 QGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 86)
V Peptide EMP-1 Hinge Engage lgG4 CH2 1 QIQGGTYSCHFGPLTWVCKPQGG GS CPPCP APEFLGGP lgG4 CH2 61 SVFLFPPKPKDTLMISRTPEVTCVWDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNS lgG4 CH3
121 TYRWSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEM lgG4 CH3 83 TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQ lgG4 CH3 241 EGNVFSCSVMHEALHNHYTQKSLSLSLGK (SEQ ID NO: 87)
V Peptide EMP-1 Hinge Enlanzate lgG4 CH2
1 QIQGGTYSCHFGPLTWVCKPQGG GS CPPCP APEAAGGP IgG 4 CH2 61 SVFLFPPKPKDTLMISRTPEVTCWVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNS - | gG4 CH3 121 TYRWSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEM
lgG4 CH3 183 TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQ lgG4 CH3 241 EGNVFSCSVMHEALHNHYTQKSLSLSLGK (SEQ ID NO: 88)
V Peptide EMP-1 Hinge Enlanzate lgG4 CH2 1 QIQGGTYSCHFGPLTWVCKPQGG GGGS CPPCP APEAAGGP lgG1 CH2 61 SVFLFPPKPKDTLMISRTPEVTCVWDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNS lgG4 CH3
121 TYRWSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEM lgG4 CH3 183 TKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQ lgG4 CH3 241 EGNVFSCSVMHEALHNHYTQKSLSLSLGK (SEQ ID NO: 89)
It is well known that two heavy chains of IgG are assembled during cellular processing via disulfide bonds between the cysteines located in the hinge region to form a homodimer. This is also expected to occur among the modified peptides to form the assembled construct of EMP-central mimetibody of the hinge region.
In addition, the infra-chain disulfide bond between the two cysteines in the EMP-1 peptide is also expected to be formed. The expected EMP-1 em- emymetry of the hinge region contains two EMP-1 peptides. The spatial arrangement of the N-terminus peptides together with the flexibility of the binding sequences should allow the peptides to form a bioactive dimer. The activity of the EMP mimic-body in the region of the hinge was first tested in an in vitro bioactivity assay. For this test, the EPO-dependent cell line UT-7 / EPO derived from a patient with acute megakaryoblastic leukemia (Komatsu et al., 1993, Blood, vol 82 (2), 456-464) was used. These cells undergo programmed cell death 48 to 72 hours after extraction of the medium supplemented with rHuEPO. Cells that have been incubated in the absence of rHuEPO for 24 hours can be saved if they were brought with rHuEPO or an EPO agonist. The central EMP-mimetibody of the hinge region was added to the cells without food without rHuEPO and the cell viability was determined 48 hours after the treatment using the tetrazolium compound MTS (CelITiter 96 Aque0us One Solution, Promega) which is metabolized by the living cells to provide a production with an absorbance that can be measured. The results of a typical assay showed that the potency of a central EMP-mimetibody of the hinge region on a molar basis is 500 times greater than that of peptide EMP-1 and 5 times less than that of rHuEPO. In addition, these same cells were stimulated with EMP-
The central region of the hinge region and the tyrosine phosphorylation pads were visualized by running the cell lysate through a polyacrylamide gel. The pattern exhibited by EMP-mimetic body of the hinge region was similar to that of the rHuEPO, indicating that the mechanism by which the central EMP-mimetibody of the hinge region acts on these cells, is similar to that of the rHuEPO. The in vivo studies were done in normal mice to compare the half-life of the EMP-mimetibody cenfral of the region of the hinge with that of the rHuEPO and to compare its effecíos in the eriíropoyesis. When the mice were dosed equally, the EMP-mimetibody central region of the hinge gave a higher maximum response and the response was prolonged, compared to the rHuEPO. The serum concentrations of the rHuEPO and the central EMP-mimetibody of the hinge region were measured by ELISA. The approximate half-life of the EMP-mlmetic of the hinge region was at least several times that of the rHuEPO. It has been shown that the mutation of two lysine residues (L), L234 and L235, in the lower hinge region of IgG1 to alanine (A), will nullify the immunoglobulin's ability to mediate complement-dependent cyclo-toxicity (CDC) and antibody-dependent cellular toxicity (ADCC) (Hezereh et al., 2001, J. Virol., vol 75 (24), 12161-68). Preliminary stages have shown that the central EMP-mimeiibody of the hinge region does not mediate the complement lysis of the cells expressing the
Receiver of the EPO. This may be due to the low number of receptors found in erythroid progenitor cells. In addition, the live expansion of the erythroid progenitors as evidenced by the significant increases in hemaputation supports the possible functional irrelevance of the functions of the immune effector. However, although effects associated with the function of the effector have not been observed, there remains an interest in introducing mutations as a precautionary step. Another modification that would result in a decrease in the mediation of immune effector functions is the elimination of the glycosylation binding site. This can be achieved by the mutation of asparagine at position 297 (N297) to glutamine (Q). Additional changes may optionally include threonine (T) with an alternating amino acid to reduce or modify O-glycosylation, for example, T34 or T47 with Aglucosylated versions of subglass lgG1 known to be poor mediators of effector function immune (Jefferis et al., 1998, Immol., Rev., 163, 50-76).
Advantages The novel construct, EMP-mimetibody central region of the hinge described above offers an alternate way to show the bioactive peptide EMP-1. The activity of this construct is in the range of the rHuEPO and the average life is similar to that of an IgG.
In addition, it is expected that the proposed modifications, in combination and with
the addition to the novel characteristics of the EMP-mimetibody cenfral of the hinge region, improve the uty of the construct of EMP-central mimetibody of the region of the hinge. It is clear that the invention can be practiced in a manner as described particularly in the description and the examples above. Numerous modifications and variations of the present invention are possible, in light of the foregoing teachings and, as a result, are beyond the scope of the present invention.
Claims (40)
1. A nucleic acid of a mimic body of the hinge region, mimic of EPO, comprising at least one polynucleotide encoding at least one amino acid sequence of SEQ ID NOS: 82 and 84, or a complementary polynucleotide thereof.
2. A nucleic acid of a central mimetibody of the hinge region, mimic of EPO, comprising at least one polynucleotide encoding at least one amino acid sequence of SEQ ID NOS: 83 and 85-89, or a polynucleotide complementary to it.
3. A nucleic acid of a central mimetibody of the hinge region, mimic of EPO, comprising at least one polynucleotide encoding at least one amino acid sequence of SEQ ID NOS: 1-30, or a polynucleotide complementary to the same.
4. A nucleic acid of a central mimetibody of the hinge region, mimic of EPO, comprising at least one polynucleotide encoding a polypeptide according to Formula (I): ((V (m) -P (n ) -L (o) -H (p) -CH2 (q) -CH3 (r)) (s), wherein V is at least a portion of an N term of an immunoglobulin variable region, P is at least one mimetic mimic of bioactive EPO, L is a linking sequence, H is at least a portion of a central variable region of the immunoglobulin hinge, CH2 is at least a portion of an immunoglobulin CH2 constant region, CH3 is at least a portion of an immunoglobulin CH3 constant region, m, n, o, p, q, rys can independently be an integer 0, 1 or 2 and 10.
5. A polypeptide of a central mimetibody of the hinge region, mimic of EPO, comprising at least all contiguous amino acids of at least one of SEQ ID NO: 82 and 84.
6.- A polypeptide of a central mimetibody of the hinge region, EPO mimetic, comprising at least all of the contiguous amino acids of at least one of SEQ ID NO: 83 and 85-89.
7. A polypeptide of a central mimetibody of the hinge region, mimic of EPO, comprising at least all contiguous amino acids of at least one of SEQ ID NOS: 1-30.
8. A polypeptide of a central mimetibody of the hinge region, mimic of EPO, comprising a polypeptide according to Formula (I): ((V (m) -P (n) -L (o) - H (p) -CH2 (q) -CH3 (r)) (s), wherein V is QIQ, P is at least one bioactive peptide selected from SEQ ID NOS: 1-30, L comprises GS, GGGS (SEQ ID NO: 73) or GSGGGS (SEQ ID NO: 74), H is CPPCP (SEQ ID NO: 75), CH2 is APELLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK TISKAK (SEQ ID NO: 76), CH3 is GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK (SEQ ID NO: 78), and m, n, o, p, q, r, s are independently an integer between 0, 1 or 2 and 10.
9.- A polypeptide of a central mimei-body of the region hinge, EPO mimetic, comprising a polypeptide according to Formula (I): ((V (m) -P (n) -L (o) -H (p) -CH2 (q) -CH3 ( r)) (s), wherein V is QIQ, P is at least one bioactive peptide selected from SEQ ID NOS: 1-30, L comprises GS, GGGS (SEQ ID NO: 73) or GSGGGS (SEQ ID NO: 74), H is CPPCP (SEQ ID NO: 75), CH2 is APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAK (SEQ ID NO: 77), CH3 is GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK (SEQ ID NO: 78), and m, n, o, p, q, r, s are independently an integer between 0, 1 or 2 and 10.
10.- A polypeptide of a central mimetibody of the hinge region, mimic of EPO, comprising a polypeptide according to Formula (I): ((V (m) -P (n) -L (o) -H (p) -CH2 (q) -CH3 (r)) (s), wherein V is QIQ, P is at least one bioactive peptide selected from SEQ ID NOS: 1-30, L comprises GS, GGGS (SEQ ID NO: 73) or GSGGGS (SEQ ID NO. : 74), H is CPPCP (SEQ ID NO: 75), CH2 is APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSQEDPEVQFNWYVDG EVHNAKTKPREEQFNSTYRWSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEK TISKAK (SEQ ID NO: 79), CH3 is GQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLS LSLGK (SEQ ID NO: 81), and m, n, o, p, q, r, s are independently an integer between 0, 1 or 2 and 10.
11.- A polypeptide of a mimeiibody central to the hinge region, mimic of EPO, comprising a polypeptide according to Formula (I): ((V (m) -P (n) -L (o) -H (p) -CH2 (q) -CH3 (r)) (s), wherein V is QIQ, P is at least one bioactive peptide selected from SEQ ID NOS: 1-30, L comprises GS, GGGS (SEQ ID NO: 73) or GSGGGS (SEQ ID NO. : 74), H is CPPCP (SEQ ID NO: 75), CH2 is APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSQEDPEVQFNWYVDG VEVHNAKTKPREEQFNSTYRWSVLTVLHQDWLNGKEYKCKVSNKGLPSSIE KTISKAK (SEQ ID NO: 80), CH3 is GQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLS LSLGK (SEQ ID NO: 81), and m, n, o, p, q, r, s are independently an integer between 0, 1 or 2 and 10.
12.- A polypeptide of a central mimetibody of the hinge region, mimic of EPO, comprising a polypeptide according to Formula (I): ((V (m) -P (n) -L (o) -H (p) -CH2 (q) -CH3 (r)) (s), wherein V is a N-terminal portion of a human variable region, P is at least one peptide bioacid selected from SEQ ID NOS: 1-30, L is a binding polypeptide, H is at least a portion of a variable region of the immunoglobulin hinge, CH2 is APELLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK TISKAK (SEQ ID NO: 76), CH3 is GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK (SEQ ID NO: 78), and m, n, o, p, q, r, s are independently an integer between 0, 1 or 2 and 10.
13.- A polypeptide of a mimetic body of the hinge region, mimic of EPO, comprising a polypeptide according to Formula (I): ((V (m) -P (n) -L (o) -H (p) -CH2 (q) -CH3 (r)) (s), wherein V is a N-terminal portion of a human variable region, P is at least one bioactive peptide selected from SEQ ID NOS: 1-30, L is a linker polypeptide, H is at least a portion of a central variable region of the immunoglobulin hinge, CH2 is APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAK (SEQ ID NO: 77), CH3 is GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK (SEQ ID NO: 78), and m, n, o, p, q, r, s are independently an integer between 0, 1 or 2 and 10.
14. A polypeptide of a mimeiibody of the region of hinge, mimic of EPO, comprising a polypeptide according to Formula (I): ((V (m) -P (n) -L (o) -H (p) -CH2 (q) -CH3 (r) )) (s), wherein V is a N-terminal portion of a human variable region, P is at least one bioactive peptide selected from SEQ ID NOS: 1-30, L is a linker polypeptide, H is at least one portion of a central variable region of the immunoglobulin hinge, CH2 s APEFLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSQEDPEVQFNWYVDG VEVHNAKTKPREEQFNSTYRWSVLTVLHQDWLNGKEYKCKVSNKGLPSSIE KTISKAK (SEQ ID NO: 79), CH3 is GQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLS LSLGK (SEQ ID NO: 81), and m, n, o, p, q, r, s are independently an integer between 0, 1 or 2 and 10.
15.- A polypeptide of a central mimetibody of the hinge region, mimic of EPO, comprising a polypeptide according to Formula (I): ((V (m) -P (n) -L (o) -H (p) -CH2 (q) -CH3 (r)) (s), wherein V is a N-terminal portion of a human variable region, P is at least one bioactive peptide selected from SEQ ID NOS: 1-30, L is a linker polypeptide, H is at least a portion of a central variable region of the immunoglobulin hinge, CH2 is APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSQEDPEVQFNWYVDG VEVHNAKTKPREEQFNSTYRWSVLTVLHQDWLNGKEYKCKVSNKGLPSSIE KTISKAK (SEQ ID NO: 80), CH3 is GQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLS LSLGK (SEQ ID NO: 81), and m, n, o, p, q, r, s are independently an integer between 0, 1 or 2 and 10.
16.- A polypeptide of a central mimetibody of the hinge region, mimic of EPO, comprising a polypeptide according to Formula (I): ((V (m) -P (n) -L (o) -H (p) -CH2 (q) -CH3 (r)) (s), wherein V is QIQ, P is at least one bioacid peptide selected from SEQ ID NOS: 1-30, L is a linker polypeptide, H is at least a portion of a central variable region of the immunoglobulin hinge, CH2 is at least a portion of a CH2 immunoglobulin constant region, CH3 is at least a portion of a CH3 immunoglobulin constant region, and m, n, o, p, q, r, s are independently an integer between 0, or 2 and 10.
17. A polypeptide of a central mimetibody of the hinge region, mimic of EPO, comprising an acupressure polypeptide. with the Formula (I): ((V (m) -P (n) -L (o) -H (p) -CH2 (q) -CH3 (r)) (s), wherein V is at least a portion of a N term of a variable immunoglobulin region, P is at least a bioactive EPO mimic peptide, L comprises GS, GGGS (SEQ ID NO: 73) or GSGGGS (SEQ ID NO: 74), H is at least a portion of a variable region of the immunoglobulin hinge, CH2 is at minus one portion of a region consists of CH2 of immunoglobulin, CH3 is at least a portion of a CH3 constant region of immunoglobulin, and m, n, o, p, q, r, s are independently an integer between 0, 1 or 2 and 10.
18. A polypeptide of a central mimetibody of the hinge region, mimic of EPO, comprising a polypeptide according to Formula (I): ((V (m) -P (n) -L (o) -H (p) -CH2 (q) -CH3 (r)) (s), wherein V is at least a portion of an N terminus of an immunoglobulin variable region, P is at least one peptide mimetic of Bioacid EPO, L is a binding polypeptide, H is at least a portion of a variable region of the immunoglobulin hinge, CH2 is at least a portion of an immunoglobulin CH2 constant region, CH3 is at least a portion of a CH3 region of immunoglobulin, and m, n, o, p, q, r, s are independently an integer enire 0, 1 or 2 and 10.
19.- A polypeptide of a central mimetibody l of the hinge region, mimic of EPO, comprising a polypeptide according to Formula (I): ((V (m) -P (n) -L (o) -H (p) -CH2 (q ) -CH3 (r)) (s), wherein V is at least a portion of an N terminus of a variable immunoglobulin region, P is at least a bioactive EPO mimic peptide, L is a binding polypeptide, H is CPPCP (SEQ ID NO: 75), CH2 is at least a portion of a region consisting of CH2 of immunoglobulin, CH3 is at least a portion of a CH3 constant region of immunoglobulin, and m, n, o, p, q, r, s are independently an integer between 0, 1 or 2 and 10.
20. A polypeptide of a central mimetibody of the hinge region, mimic of EPO, comprising a polypeptide according to Formula (I): ((V (m) -P (n) -L (o) -H ( p) -CH2 (q) -CH3 (r)) (s), wherein V is at least a portion of an N term of an immunoglobulin variable region, P is at least one bioactive peptide selected from SEQ ID NOS: 1-30, L is a binding polypeptide, H is at least a portion of a central variable region of the immunoglobulin hinge, CH2 is at least a portion of a CH2 immunoglobulin constant region, CH3 is at least a portion of a region consisting of immunoglobulin CH3, and m, n, o, p, q, r, s are independently an integer enire 0, 1 or 2 and 10.
21.- A nucleic acid of a central mimetibody of the hinge region, mimic of EPO or a polypeptide of a central mimetibody of the hinge region, EPO mimic, according to at least one of claims 1-20, wherein the polypeptide Eptide has at least one activity of at least one P polypeptide.
22. A monoclonal or polyclonal anti-idiotype antibody, fusion protein or fragment thereof, which specifically binds to at least one polypeptide of a central mimetibody of the hinge region. , EPO mimetic, according to at least one of claims 5-20.
23. A nucleic acid of a central mimetibody of the hinge region, mimic of EPO, which encodes at least one polypeptide of a mimic body of the hinge region, mimic of EPO or a antibody of a central mimetibody of the hinge region, mimic of EPO, according to any of claims 1-20.
24. A vector of a mimeiibody of the hinge region, mimic of EPO, comprising at least one isolated nucleic acid according to claim 23.
25.- A host cell of a mimic body of the hinge region , EPO mimic, comprising an isolated nucleic acid according to claim 23.
26.- The host cell of a central mimetibody of the hinge region, mimic of the EPO, according to claim 23, further characterized because the host cell is at least one selected from COS-1, COS-7, HEK293, BHK21, CHO, BSC-1, Hep G2, 653, SP2 / 0, 293, NSO, DG44 CHO, CHO K1, HeLa, of myeloma or lymphoma, or any cell derived, immortalized or transformed from them.
27. A method for producing at least one polypeptide of a central mimetibody of the hinge region, mimetic of EPO or an antibody of a mimetic body of the hinge region, mimic of EPO, which comprises translating a nucleic acid of according to claim 23 under in vitro conditions, either in vivo or in situ, so that the central mimetibody of the hinge region, mimetic of the EPO or the antibody is expressed in detectable or recoverable amounts.
28. A composition comprising at least one nucleic acid of a central mimetibody of the hinge region, mimic of EPO, a polypeptide of a mimei-body of the hinge region, mimetic of EPO, or an antibody of a central antibody mimic. the hinge region, mimic of EPO, according to at least one of claims 1-20.
29. The composition according to claim 28, further characterized in that the composition further comprises at least one pharmaceutically acceptable carrier or diluent.
30. The composition according to claim 28, further characterized in that it comprises at least one composition comprising a therapeutically effective amount of at least one compound, composition or polypeptide selected from at least one of a deicible brand or reporter, an antagonist of the TNF, an anti-infective drug, a drug for the cardiovascular system (CV), a drug for the central nervous system (CNS), a drug for the autonomic nervous system (ANS), a drug for the respiratory tract, a drug for the tract Gastrointestinal (Gl), a hormonal drug, a fluid or electrolyte balance drug, a hematologic drug, an antineoplastic, an immunomodulation drug, an ophthalmic, otic or nasal drug, a topical drug, a nutritional drug, a cytokine or a cytokine antagonist.
31. The composition according to claim 28, further characterized in that it is in a form of at least one selected from a liquid, gas or solution, mixture, suspension, emulsion or dry colloid, a lyophilized preparation or a powder.
32.- The use of at least one nucleic acid, polypeptide or antibody of a mimetic body of the hinge region, mimic of the EPO, according to at least one of claims 1-20, for preparing a composition for diagnosing or treating a condition related to the EPO ligand in a cell, tissue, organ or animal.
33. The use claimed in claim 32, wherein the composition comprises 0.001-50 mg of the antibody of the mimetibody cenfral of the hinge region, mimic of EPO; 0.000001-500 mg of the mimetic body of the hinge region, EPO mimetic; or 0.0001-100 μg of the nucleic acid of the central mimetibody of the hinge region, EPO mimic per kilogram of cells, tissue, organ or animal.
34. The use claimed in claim 32, wherein the composition is formulated to be administrable by at least one selected parenteral mode, subcutaneous, iníramuscular, infravenous, infraarticular, inírabronchial, iníraabdominal, iníracapsular, infracartilaginous, inirachial, inraceal, intracelebelar, intracerebroventricular, intracholic, intracervical, intragastric, intrahepatic, intramyocardial, intraosy, inírapélvico, nírapericárdico, iníraperifoneal, infrapleural, iníraprosíático, intrapulmonar, Intrarectal, intrarenal, nireretinal, intraspinal, intrasynovial, intrathoracic, intrauterine, intravesical, intralesional, bolus, vaginal, recial, buccal, sublingual, iníranasal or fransdermal.
The use claimed in claim 32, wherein said composition is administerable before, concurrently or subsequently, at least one composition comprising an effective amount of at least one compound or polypeptide selected from at least one of a Defective brand or reporter, a TNF antagonist, an antiepileptic drug, a drug for the cardiovascular system (CV), a drug for the central nervous system (CNS), a drug for the autonomic nervous system (ANS), a drug for the respiratory tract, a drug for the gastrointestinal tract (Gl), a hormonal drug, a fluid balance or electrolyte drug, a blood drug, an antineoplastic, a drug for immunomodulation, an ophthalmic, otic or nasal drug, a topical drug, a nufritivo drug, a cytokine or a cifocin antagonist.
36.- A device comprising at least one polypeptide, antibody or nucleic acid of an isolated central mimetibody of the mimetic hinge region of the EPO, according to at least one of claims 1-20, wherein the device is suitable to bring into contact or administer at least one of the polypeptide, antibody or nucleic acid of a central mimetibody of the hinge region, EPO mimetic, mediating at least one selected mode of parenteral, subcutaneous, intramuscular, intravenous, intraarticular, intrabronchial , Intraabdominal, incacapsular, incarartilaginous, intracavity, intracellular, ntracelebelar, intracerebroventricular, intracranial, intracervical, iníragásirico, inirahepalic, inréchalcardic, iníraósieo, nellarílco, nírapericardico, inraperiíoneal, nfrapleural, infraprosíático, intrapulmonar, inírarrectal, intrarenal, intraretinal, intratraspinal, intrasinovial, intraforácico, intrauterine, intravesical, iníralesional, bolo, vaginal, recial, buccal, sublingual, iníranasal or transdermal.
37. An article of manufacture for pharmaceutical use or diagnosis in humans, comprising a packaging material and a container comprises at least one polypeptide, anibody or nucleic acid of a central isolated mimetibody of the mimic hinge region of the EPO, according to at least one of claims 1-20.
38.- The article of manufacture according to claim 37, further characterized in that the container is a component of a parenteral, subcutaneous, intramuscular, intravenous, narticular, inirabronchial, intraabdominal, intracapsular, intracartilage, intracavity, or parenteral device or delivery system. intracelial, intracelebelar, ntracerebroventricular, intracolic, níracervical, níragásírico, inírahepáíico, iníramiocárdico, intraósteo, inírapélvico, intrapericardial, intraperitoneal, intrapleural, intraprosíáíico, intrapulmonary, intrarrecíal, inírarrenal, infrarreíinal, intraspinal, intrasynovial, intrathoracic, intrauterine, intravesical, intralesional , bolus, vaginal, rectal, buccal, sublingual, intranasal or transdermal.
39. A method for producing at least one polypeptide, antibody or nucleic acid of a mimei-body isolated from the mimic hinge region of the EPO, in accordance with at least one of the claims 1-20, comprising providing at least one host cell, transgenic animal, transgenic plant, plant cell, capable of expressing in delectable or recoverable amounts the polypeptide, antibody or nucleic acid. 40.- At least one polypeptide, antibody or nucleic acid of a mimic member of the hinge region, mimic of the EPO, produced by a method in accordance with claim 39.
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US60/507,349 | 2003-09-30 |
Publications (1)
Publication Number | Publication Date |
---|---|
MXPA06003677A true MXPA06003677A (en) | 2006-12-13 |
Family
ID=
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US7241733B2 (en) | Mammalian EPO mimetic CH1 deleted mimetibodies, compositions, methods and uses | |
AU2004277884B2 (en) | Human EPO mimetic hinge core mimetibodies, compositions, methods and uses | |
US7718176B2 (en) | Human EPO mimetic hinge core mimetibodies, compositions, methods and uses | |
US8071103B2 (en) | Pharmaceutical composition comprising a human GLP-1 mimetibody | |
WO2004002417A2 (en) | Mammalian ch1 deleted mimetibodies, compositions, methods and uses | |
WO2005081687A2 (en) | Human hinge core mimetibodies, compositions, methods and uses | |
JP2007508011A (en) | Human hinge core mimetibody, compositions, methods and uses | |
MXPA06011425A (en) | Human glp-1 mimetibodies, compositions, methods and uses. | |
MXPA06003677A (en) | Human epo mimetic hinge core mimetibodies, compositions, methods and uses | |
AU2011202563A1 (en) | Human EPO mimetic hinge core mimetibodies, compositions, methods and uses |