MXPA05003797A - Glucagon - like peptide - 2 variants. - Google Patents

Abstract

The present invention relates to novel human glucagon-like peptide-2 (GLP-2) peptides and human glucagon-like peptide-2 derivatives which have a protracted profile of action due to increased resistance to degradation as well as polynucleotide constructs encoding such peptides, vectors and host cells comprising and expressing the polynucleotide, pharmaceutical compositions, uses and methods of treatment.

Description

1 PEPTIDE-2 TYPE GLUCAGON VARIANTS.

FIELD OF THE INVENTION The present invention relates to peptides and derivatives of peptide 2 of the novel human glucagon type (GLP-2) having a dilatation action profile. The invention further relates to methods of making and using these GLP-2 peptides and derivatives as well as to polynucleotide constructs encoding such GLP-2 peptides and host cells comprising and expressing GLP-2 peptides, pharmaceutical formulations, methods for the preparation of the formulations, uses and methods of treatment. BACKGROUND OF THE INVENTION Glucagon-like peptide 2 (GLP-2) is a peptide of a 33 amino acid residue produced in intestinal L cells and released after nutrient intake. The amino acid sequence of human peptide GLP-2 is given in Figure 1. The GLP-2 peptide is a product of the proglucagon gene. Proglucagon is expressed mainly in the pancreas and in the intestine and to a certain degree in specific neurons located in the brain. The post-translational processing of proglucagon is however different in the pancreas and in the intestine (Fig.2). In the pancreas, proglucagon is processed primarily to a pancreatic polypeptide Ref. : 162869 2 related to glucagon (GRPP), Glucagon and a main fragment of proglucagon. In contrast to this processing in the intestine, it results in glicentin, glucagon-like peptide-1 (GLP-1) and glucagon-like peptide-2 (GLP-2). The GLP-2 peptide conserved quite well between species although there are differences in sequences (Fig. 3). The pig GLP-2 peptide for example has 4 substitutions compared to human GLP-2. Interestingly, mouse GLP-2 has only two substitutions compared to human GLP-2. GLP-2 is secreted from the L cells in the large and small intestine. This secretion is regulated by the intake of nutrients. The concentration in the plasma of GLP-2 in subjects with normal fasting is around 15 pM which increases up to about 60 pM after a mixed food. The actions of GLP-2 are transduced by a receptor of the recently cloned glucagon-like peptide 2. The GLP-2 receptor represents a new member of the 7TM receptor superfamily coupled with protein G. GLP-2R is expressed in a highly tissue-specific form predominantly in the gastrointestinal tract (Fig. 4) and is coupled to the activation of GLP-2R for an increased activity of adenylate cyclase. The cells that express GLP-2R respond to GLP-2, but not to other peptides of the glucagon family (Glucagon, GLP-1 and GIP). 3 In the rat, GLP-2 has also been reported to be expressed in the brain or more specifically in the dorsomedial hypothalamic nucleus. This part of the brain is normally thought to be involved in feeding behavior and it has been shown that GLP-2 inhibits food intake when injected directly into the brain. The induction of intestinal epithelial proliferation by GLP-2 was demonstrated (Drucker, DJ et al (1996) Proc. Nati, Acad. Sci. USA 93: 7911-7916) and the treatment of gastrointestinal diseases by growing cells has been described. in a medium containing GLP-2 (Drucker, DJ and eneford, JR, WO 96/32414). WO 97/31943 refers to GLP-2 peptide analogs and to the use of certain GLP-2 peptide analogues for suppression of appetite or induction of satiety. WO 98/08872 refers to GLP-2 derivatives comprising a lipophilic substituent. WO 96/32414 and WO 97/39031 relate to specific analogs of the GLP-2 peptide. WO 98/03547 refers to GLP-2 peptide-specific analogs showing an antagonist activity. Although much attention has been directed to the pharmacological properties of GLP-2 compounds, until now little is known about their physical and chemical structure and solution properties. Such knowledge is a prerequisite for rational handling during, for example, the production, purification and work of formulation and is eventually important for understanding the structural basis for the mechanism of dilation. It is a major technical challenge to ensure a prolonged stability during storage (shelf life) of many protein-based drug products due to the inherent instability of the macromolecules. Thus, proteins are sensitive to both chemical and physical degradation unlike many small molecules. Chemical degradation involves covalent bonds such as hydrolysis, racemization, oxidation or cross-linking. The physical degradation involves conformational changes related to the native structure that include the loss of the higher order structure, aggregation, precipitation, or adsorption to the surfaces. GLP-2 is known to be prone to instability due to aggregation. Both degradation trajectories can ultimately lead to the loss of biological activity of the protein drug. The GLP-2. and GLP-2 analogues and fragments thereof are potentially useful in the treatment of gastrointestinal diseases. However, limitations in solubility and low stability against the actions of endogenous diaminopeptidyl peptidase limit the utility of these compounds and thus there is still a need for improvements in this field. 5 In O 99/43361 certain pharmaceutical formulations comprising GLP-2 having a lipophilic substituent are described. WO 01/49314 discloses formulations comprising GLP-2 or GLP-2 analogs in a physiological buffer solution containing L-histidine and a bulking agent selected from the group consisting of mannitol and sucrose at pH 5.5 to 7.9. The GLP-2 peptides and derivatives thereof are useful in the treatment of gastrointestinal disorders. However, the high purification limits the usefulness of these compounds and there is still the need for improvements in this field. Thus, it is an object of the present invention to provide GLP-2 peptides and derivatives thereof having a dilated profile of action relative to native GLP-2 while still retaining GLP-2 activity. It is a further object of the invention to provide a pharmaceutical composition comprising a compound according to the invention and the use of a compound of the invention to provide such a composition. It is also an object of the present invention to provide a method of treating gastrointestinal disorders. BRIEF DESCRIPTION OF THE INVENTION It has now been shown that the GLP-2 derivatives of the present invention exert trophic effects in the intestine. thick and thin through the stimulation of cell proliferation and the inhibition of apoptosis. The GLP-2 derivatives of the present invention can also stimulate the transport of glucose with enterocytes, reduce intestinal permeability and inhibit gastric emptying and the secretion of gastric acid. In its broadest aspect, the present invention relates to derivatives of the GLP-2 peptides. The derivatives according to the invention have interesting pharmacological properties, in particular they have a broader profile of action than the GLP-2 precursor peptides. The term "GLP-2 precursor peptide" as used herein refers to an amino acid sequence that is the backbone of a GLP-2 derivative. A simple system is used in the following to describe peptides, analog fragments and GLP-2 derivatives. Thus, for example, R20K-GLP-2 (1-31) designates a fragment of GLP-2 formally derived from GLP-2, by removing the amino acid residues at position 32 and 33 of SEQ ID NO: 1 and substituting the amino acid residue that arises naturally from arginine at position 20 of SEQ ID N0: 1 by a lysine. Similarly, R20K (Ne-tetradecanoyl) / K30R-GLP-2 (1-33) designates a derivative of a GLP-2 peptide analogue formally derived from GLP-2 by exchange of the naturally occurring amino acid residue of lysine in the 7 position 30 of SEQ ID NO: l with an arginine residue and the exchange of the naturally occurring arginine amino acid residue at position 20 of SEQ ID NO: l with a lysine residue and the tetradecanoylation of the e-amino group of the Lysine residue at position 20 relative to the amino acid sequence of SEQ ID NO: l. Similarly, L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) designates a derivative of a GLP-2 peptide analogue formally derived from GLP-2 by exchange of the naturally-occurring amino acid residue of lysine at position 30 of SEQ ID NO: 1 with an arginine residue and the exchange of the naturally occurring arginine amino acid residue at position 17 of SEQ ID NO: l with a lysine residue and the hexadecanoylation of the e-amino group of the lysine residue at position 17 in relation to to the amino acid sequence of SEQ ID NO: l by means of the ß alanine spacer (figures 5 and 6). In a first aspect, the invention relates to a GLP-2 peptide comprising an amino acid sequence of formula 1; His-X2-X3-Gly-X5-Phe-X7-X8-X9-X10-X1: LX: L2-X13-X14-X15-X: LS-X17-X18-Ala-Arg-X21-Phe-lle X24-Trp-Leu-lle-X28-Thr-Arg-lle-Thr-X33 (formula 1); or a fragment thereof; where X2 is Ala, Val or Gly; X3 is Asp, or Glu; X5 is Ser, or Lys; X7 is Ser, or Lys; X8 is Asp, 8 Glu, or Lys; X9 is Asp, Glu, or Lys; X10 is Met, Lys, Leu, Lie, or Nor-Leucine; X11 is Asn, or Lys; X12 is Thr, or Lys; X13 is lie, or Lys; X14 is Leu, or Lys; X15 is Asp, or Lys; X16 is Asn, or Lys; X 17 is Leu, or Lys; X18 is Ala, or Lys; X21 is Asp, or Lys; X24 is Asn, or Lys; X2a is Gln, or Lys; X33 is Asp, Glu, or Lys. In a second aspect, the invention relates to a polynucleotide construct encoding a GLP-2 peptide comprising the amino acid sequence of formula 1; His-X ^ X ^ Gly-X ^ Phe-X'-X'-X ^ X ^ -X ^ -X ^ -X ^ -X ^ -X ^ - ^ -X ^ -X18-Ala-Arg-X21 -Phe-lle-X2 -Trp-Leu-lle-X28-Thr-Arg-lle-Thr-X33 (formula 1); or a fragment thereof; where X2 is Ala, Val or Gly; X3 is Asp, or Glu; Xs is Ser, or Lys; X7 is Ser, or Lys; X8 is Asp, Glu, or Lys; X9 is Asp, Glu, or Lys; X10 is Met, Lys, Leu, Lie, or NorLeucine; X11 is Asn, or Lys; X12 is Thr, or Lys; X13 is lie, or Lys; X14 is Leu, or Lys; X15 is Asp, or Lys; X16 is Asn, or Lys, -X17 is Leu, or Lys; X18 is Ala, or Lys; X21 is Asp, or Lys; X24 is Asn, or Lys; X28 is Gln, or Lys; X33 is Asp, Glu, or Lys. In a third aspect, the invention relates to a host cell comprising a polynucleotide construct encoding a GLP-2 peptide comprising the amino acid sequence of formula 1; His-X2-X3-Gly-X5-Phe-X7-X8-X9-X10-X11-X12-X13-X1-X15-Xls-X17-X18-Ala-Arg-X21-Phe-lle-X24-Trp- Leu-lle-X28-Thr-Arg-lle-Thr-X33 (formula 1); or a fragment thereof; where X2 is Ala, Val or Gly; X3 is 9 Asp, or Glu; X5 is Ser, or Lys; X7 is Ser, or Lys; X8 is Asp, Glu, or Lys; X9 is Asp, Glu, or Lys; X10 is Met, Lys, Leu, Lie, or Nor-Leucine; X is Asn, or Lys; X12 is Thr, or Lys; X13 is lie, or Lys; X14 is Leu, or Lys; X15 is Asp, or Lys; Xie is Asn, or Lys; X17 is Leu, or Lys; X18 is Ala, or Lys; X21 is Asp, or Lys; X24 is Asn, or Lys; X28 is Gln, or Lys; X33 is Asp, Glu, or Lys. In one embodiment of the host cell is a eukaryotic cell. In one embodiment the host cell is a yeast cell. In a further aspect, the invention relates to a GLP-2 derivative comprising a GLP-2 peptide, wherein a lipophilic substituent is linked to one or more amino acid residues at a position relative to the amino acid sequence of SEQ ID N0 : 1 selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L14, D15, N16, L17, A18, D21, N24, and Q28 with the proviso that the lipophilic substituent is not bound to the N-terminal amino acid residue or the C-terminal amino acid residue of the GLP-2 peptide. In one embodiment, a lipophilic substituent is linked to amino acid residues at position S5 relative to the amino acid sequence of SEQ ID NO: 1. In one embodiment, a lipophilic substituent is linked to amino acid residues at the S7 position relative to the amino acid sequence of SEQ ID NO: 1. In one embodiment, a lipophilic substituent is linked to amino acid residues at the D8 position relative to the sequence of amino acid of SEQ · ID NO: l. In one embodiment, a lipophilic substituent is linked to amino acid residues at the E9 position relative to the amino acid sequence of SEQ ID NO: 1. In one embodiment, a lipophilic substituent is linked to amino acid residues at the MIO position relative to the amino acid sequence of SEQ ID NO: 1. In one embodiment, a lipophilic substituent is linked to amino acid residues at the Nll position relative to the amino acid sequence of SEQ ID NO: 1. In one embodiment, a lipophilic substituent is linked to amino acid residues at the T12 position relative to the amino acid sequence of SEQ ID NO: 1. In one embodiment, a lipophilic substituent is linked to amino acid residues at position 113 relative to the amino acid sequence of SEQ ID NO: 1. In one embodiment, a lipophilic substituent is linked to amino acid residues at position L14 relative to the amino acid sequence of SEQ ID NO: 1. In one embodiment, a lipophilic substituent is linked to amino acid residues at position D15 relative to the amino acid sequence of SEQ ID NO: 1. In one embodiment, a lipophilic substituent is linked to amino acid residues at position N16 relative to the amino acid sequence of SEQ ID N0: 1. In one embodiment, a lipophilic substituent is linked to amino acid residues at the position L17 relative to the amino acid sequence of SEQ ID NO: 1. In one embodiment, a substituent lipophilic binds to amino acid residues at position A 18 relative to the amino acid sequence of SEQ ID NO: 1. In one embodiment, a lipophilic substituent is linked to amino acid residues at position D21 relative to the amino acid sequence of SEQ. ID N0: 1. In one embodiment, a lipophilic substituent is linked to amino acid residues at position N24 relative to the amino acid sequence of SEQ ID NO: 1. In one embodiment, a lipophilic substituent is linked to an amino acid residue at position Q28 relative to the amino acid sequence of SEQ ID NO: l. It will be understood that the amino acid residues at the position relative to the amino acid sequence of SEQ ID NO: 1 can be any amino acid residue and not only an amino acid residue naturally presented to the position. In one embodiment, the lipophilic substituent is linked to a lysine. In a further aspect, the invention relates to a pharmaceutical composition comprising a GLP-2 derivative comprising a GLP-2 peptide, wherein a lipophilic substituent is linked to one or more amino acid residues at a position relative to the sequence of amino acid of SEQ ID NO: l selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L14, D15, N16, L17, A18, D21, N24, and Q28 with the condition of that the lipophilic substituent does not bind to the N-terminal amino acid residue or the C-terminal amino acid residue of the GLP-2 peptide. 12 In a further aspect, the invention relates to the use of a GLP-2 derivative comprising a GLP-2 peptide, wherein a lipophilic substituent is linked to one or more amino acid residues at a position relative to the amino acid sequence of SEQ. ID N0: 1 selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L14, D15, N16, L17, A18, D21, N24, and Q28 with the proviso that the substituent Lipophilic does not bind to the N-terminal amino acid residue or the C-terminal amino acid residue of the GLP-2 peptide; for the preparation of a medication. In a further aspect, the invention relates to the use of a GLP-2 derivative comprising a GLP-2 peptide, wherein a lipophilic substituent is linked to one or more amino acid residues at a position relative to the amino acid sequence of SEQ. ID NO: l selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L14, D15, N16, L17, Al8, D21, N2, and D28 with the proviso that the substituent lipophilic no. it is linked to the N-terminal amino acid residue or the C-terminal amino acid residue of the GLP-2 peptide; for the preparation of a drug with prolonged effect. In a further aspect, the invention relates to the use of a GLP-2 derivative comprising a GLP-2 peptide, wherein a lipophilic substituent is linked to one or more residues of amino acids at a position relative to the amino acid sequence of SEQ ID NO: 1 selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L14, D15, NI6, L17, A18, D21 , N24, and Q28 with the proviso that the lipophilic substituent does not bind to the N-terminal amino acid residue or the C-terminal amino acid residue of the GLP-2 peptide; for the preparation of a medicament for the treatment of small bowel syndrome, inflammatory bowel syndrome, Crohn's disease, colitis that includes collagen colitis, radiation colitis, chronic radiation enteritis, ulcerative colitis, tropical and non-tropical stomatitis (intolerance to gluten), celiac disease (gluten-sensitive enteropathy), damaged tissue after vascular obstruction or trauma, diarrhea eg tourist diarrhea and post-infectious diarrhea, chronic intestinal dysfunction, dehydration, bacteremia, sepsis, anorexia nervosa, damaged tissue after chemotherapy for example, intestinal mucositis caused by chemotherapy, premature infants including intestinal insufficiency in premature infants, infants before birth including intestinal insufficiency in infants before birth, scleroderma, gastritis that includes atrophic gastritis, atrophic gastritis postantrectomy and gastritis helicobacter pylori, pancreatitis, general septic shock ulcers, enteritis, cul-de-sac, obstruction 14 lymphatic, vascular disease and graft versus host and healed after surgical procedure, atrophy after radiation and chemotherapy, weight loss in Parkinson's disease, intestinal adaptation after surgical procedure, mucosal atrophy induced by parenteral nutrition, for example atrophy mucosal induced by total parenteral nutrition (TPN) and bone-related disorders including osteoporosis, hypercalcemia of malignancy, osteopenia due to bone metastasis, periodontal disease, hyperparathyroidism, periarticular erosions in rheumatoid arthritis, Paget's disease, osteodystrofxa, myositis ossificans, disease of Bechterew, malignant hypercalcemia, osteolytic lesions produced by bone metastasis, bone loss due to immobilization, bone loss due to deficiency of the sex steroid hormone, bone abnormalities due to steroid hormone treatment, bone abnormalities s due to cancer therapeutics, osteomalacia, Bechet's disease, osteomalacia, hyperostosis, osteopetrosis, metastatic bone disease, osteopenia induced by immobilization, or osteoporosis induced by glucocorticoids. In a further aspect, the invention relates to the use of the GLP-2 receptor agonist for the preparation of a medicament for the treatment of small bowel syndrome, inflammatory bowel syndrome, gastrointestinal Cro n, colitis that includes collagen colitis, radiation colitis, chronic radiation enteritis, ulcerative colitis, tropical and non-tropical stomatitis (gluten intolerance), celiac disease (gluten-sensitive enteropathy), damaged tissue after vascular obstruction or trauma, diarrhea eg tourist diarrhea and post-infectious diarrhea, chronic intestinal dysfunction, dehydration, bacteremia, sepsis, anorexia nervosa, tissue damaged after chemotherapy for example, intestinal mucositis produced by chemotherapy, premature infants including intestinal insufficiency in premature infants, infants prior to birth including intestinal insufficiency in infants prior to birth, scleroderma, gastritis that includes atrophic gastritis, atrophic gastritis postantrectomy and gastritis due to helicobacter pylori, pancreatitis, general septic shock ulcers, enteritis, cul-de-sac, lymphatic obstruction, disease vascular and inj erto against host and healed after surgical procedure, atrophy after radiation and chemotherapy, weight loss in Parkinson's disease, intestinal adaptation after surgical procedure, mucosal atrophy induced by parenteral nutrition, for example mucosal atrophy induced by parenteral nutrition Total (TPN) and bone-related disorders including osteoporosis, hypercalcemia of malignancy, osteopenia due to metastasis 16 of bone, periodontal disease, hyperparathyroidism, periarticular erosions in rheumatoid arthritis, Paget's disease, osteodystrophy, myositis ossificans, Bechterew's disease, malignant hypercalcemia, osteolytic lesions caused by bone metastasis, bone loss due to immobilization, bone loss due to bone deficiency of the sex steroid hormone, bone abnormalities due to steroid hormone treatment, bone abnormalities due to cancer therapeutics, osteomalacia, Bechet's disease, osteomalacia, hyperostosis, osteopetrosis, metastatic bone disease, immobilization-induced osteopenia, or glucocorticoid-induced osteoporosis . The term "premature infants," means any infant born before 37 weeks of gestation. The term includes both healthy infants and infants with damage and / or immature bowel. The term "infants prior to birth" means any infant before birth. The term includes both healthy fetuses and fetuses with damage and / or immature bowel. Animal studies indicate that GLP-2 is important for the maturation of the fetal small and large intestines. The intestines of infants born at term are prepared for immediate digestion of food, however, it is not the case for a premature baby. Therefore, the invention relates to the use of GLP-2 receptor agonists 17 for the general maturation of the intestines of premature newborns to accelerate and improve oral feeding as well as the treatment of damaged tissue that may occur in these infants. In a further aspect, the invention relates to the GLP-2 derivative of the invention for use as a medicament. In a further aspect, the invention relates to a method for the treatment of intestinal insufficiency or other condition that leads to malabsorption of nutrients in the intestine, the method comprising administering a therapeutically or prophylactically effective amount of a GLP-2 derivative which comprises a GLP-2 peptide, wherein a lipophilic substituent is linked to one or more amino acid residues at a position relative to the amino acid sequence of SEQ ID NO: 1 independently selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L14, D15, N16, L17, A18, D21, M24, and 028 with the proviso that the lipophilic substituent does not bind to the N-terminal amino acid residue or the amino acid residue of terminal C of the GLP-2 peptide; to a subject in need of it. In a further aspect, the invention relates to a method for the treatment of small bowel syndrome, inflammatory bowel syndrome, Crohn's disease, colitis that includes collagen colitis, radiation colitis, chronic radiation enteritis, ulcerative colitis, tropical and non-tropical stomatitis (intolerance to gluten), celiac disease (gluten-sensitive enteropathy), damaged tissue after vascular obstruction or trauma, diarrhea for example, tourist diarrhea and post-infectious diarrhea, chronic intestinal dysfunction, dehydration, bacteremia, sepsis, anorexia nervosa, tissue damaged after chemotherapy for example, intestinal mucositis produced by chemotherapy, premature infants including intestinal insufficiency in premature infants, infants prior to birth including intestinal insufficiency in infants prior to birth, scleroderma, gastritis including atrophic gastritis, atrophic gastritis postantrectomy and helicobacter pylori gastritis, pancreatitis, general septic shock ulcers, enteritis, cul-de-sac, lymphatic obstruction, vascular disease and graft with tracker and healed after surgical procedure, atrophy after radiation and chemotherapy, weight loss in Parkinson's disease, intestinal adaptation after surgical procedure, mucosal atrophy induced by parenteral nutrition, for example mucosal atrophy induced by total parenteral nutrition (TPN) and bone-related disorders including osteoporosis, hypercalcemia of malignancy, osteopenia due to metastasis 19 of bone, periodontal disease, hyperparathyroidism, periarticular erosions in rheumatoid arthritis, Paget's disease, osteodystrophy, myositis ossificans, Bechtere's disease, malignant hypercalcemia, osteolytic lesions produced by bone metastasis, bone loss due to immobilization, bone loss due to bone deficiency of the sex steroid hormone, bone abnormalities due to steroid hormone treatment, bone abnormalities due to cancer therapeutics, osteomalacia, Bechet's disease, osteomalacia, hyperostosis, osteopetrosis, metastatic bone disease, immobilization-induced osteopenia, or glucocorticoid-induced osteoporosis , the method comprises administering a therapeutically or prophylactically effective amount of a GLP-2 derivative comprising a GLP-2 peptide, wherein the lipophilic substituent is attached to one or more amino acid residues at a position relative to the amino acid sequence. SEQ ID NO: 1 selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L14, D15, N16, L17, A18, D21, N24, and Q28 with the proviso that the lipophilic substituent does not bind at the N-terminal amino acid residue residue or the C-terminal amino acid residue of the GLP-2 peptide; to a subject that needs it. In a further aspect, the invention relates to a method for the treatment of small bowel syndrome, inflammatory bowel syndrome, Crohn's disease, colitis including collagen colitis, radiation colitis, chronic radiation enteritis, ulcerative colitis, tropical and non-tropical stomatitis (gluten intolerance), celiac disease (gluten-sensitive enteropathy), damaged tissue after vascular obstruction or trauma, diarrhea eg tourist diarrhea and post-infectious diarrhea, chronic intestinal dysfunction, dehydration, bacteremia, sepsis, anorexia nervosa, damaged tissue after chemotherapy for example, intestinal mucositis produced by chemotherapy, premature infants including intestinal insufficiency in premature infants, infants before birth including intestinal insufficiency in infants before birth, scleroderma, gastritis that includes atrophic gastritis, atrophic gastritis postantrectomy and helicobacter pylori gastritis, pancreatitis, general septic shock ulcers, enteritis, cul-de sac , lymphatic obstruction, vascular disease and graft versus host and healed after surgical procedure, atrophy after radiation and chemotherapy, weight loss in Parkinson's disease, intestinal adaptation after surgical procedure, mucosal atrophy induced by parenteral nutrition, example mucosal atrophy induced by total parenteral nutrition (TPN) and bone-related disorders including osteoporosis, 21 hypercalcemia of malignancy, osteopenia due to bone metastasis, periodontal disease, hyperparathyroidism, periarticular erosions in rheumatoid arthritis, Paget's disease, osteodystrophy, myositis ossificans, Bechterew's disease, malignant hypercalcemia, osteolytic lesions caused by bone metastasis, bone loss due to immobilization, bone loss due to deficiency of the sex steroid hormone, bone abnormalities due to steroid hormone treatment, bone abnormalities due to cancer therapeutics, osteomalacia, Bechet's disease, osteomalacia, hyperostosis, osteopetrosis, metastatic bone disease, induced osteopenia by immobilization, or glucocorticoid-induced osteoporosis, the method comprises administering a therapeutically or prophylactically effective amount of an agonist GLP-2 receptor. In a further aspect, the invention relates to a method for producing the GLP-2 peptide comprising the amino acid sequence of formula 1; His-X ^ X ^ Gly-X ^ Phe-X'-X ^ X ^ X ^ - ^ - ^ - ^ - ^ - ^ - ^ - ^ -X18-Ala-Arg-X21-Phe-lle-X24- Trp-Leu-lle-X28-Thr-Arg-lle-Thr-X33 (formula 1), or a fragment thereof; where X2 is Ala, Val or Gly; X3 is Asp, or Glu; X5 is Ser, or Lys; X7 is Ser, or Lys; X8 is Asp, Glu, or Lys; X9 is Asp, Glu, or Lys; X10 is Met, Lys, Leu, Lie, or NorLeucine; X11 is Asn, or Lys; X12 is Thr, or Lys; X13 is lie, 22 or Lys; X is Leu, or Lys; X is Asp, or Lys; is Asn, or Lys; X17 is Leu, or Lys; X18 is Ala, or Lys; X21 is Asp, or Lys; X24 is Asn, or Lys; X28 is Gln, or Lys; X33 is Asp, Glu, or Lys, the method comprising culturing a host cell comprising a polynucleotide construct encoding a GLP-2 peptide comprising an amino acid sequence of formula I in an appropriate growth medium under conditions that allow expression of the polynucleotide construct and the recovery of the peptide resulting from the culture medium. It has further been discovered that GLP-2 and analogs thereof, modified GLP-2 and analogs thereof when formulated in an aqueous solution together with a buffer solution are physically stable when kept in the pH range from about 8 to about of 10. The present formulations are physically stable with a shelf life given at a recommended storage temperature (typically 2-3 years at 2-8 ° C). Additionally, the present formulations are physically stable during use (typically 1 month at accelerated temperatures for example 25 ° C or 37 ° C). The formulations of the invention are also chemically stable thereby rendering them self-stable and appropriate for invasive delivery means (eg, injection, subcutaneous, intramuscular, intravenous or infusion injection) as well as non-invasive. (nasal or pulmonary, transdermal or mucosal, for example, buccal). When the inventive formulation comprises a GLP-2 compound it is compared to the same formulation at a pH of less than 8.0, the physical stability is considerably increased, and typically the half-life is increased by at least a few seconds to several months in the tests used. An object of the present invention is to provide a pharmaceutical formulation comprising the GLP-2 compound, and a buffer solution, wherein the GLP-2 compound is present in a concentration from 0.1 mg / ml to 100 mg / ml, and wherein the formulation has a pH from 8.0 to 10. Another object of the present invention is to provide a method for preparing a physically stable pharmaceutical formulation of a GLP-2 compound comprising preparing a formulation comprising a GLP-2 compound and a buffer solution, wherein the GLP-2 compound is present in a concentration from 0.1 mg / ml to 100 mg / ml, and wherein the formulation has a pH from 8.0 to 10. In one aspect of the invention the formulation contains the GLP-2 compound in a concentration from 1 mg / ml to 100 mg / ml. In another aspect of the invention the formulation has a pH from 8.0 to 9. 24 It has further been discovered that GLP-2 derivatives when formulated in aqueous solutions together with a buffer solution are physically stable when kept in the pH range from about 7 to about 10. The present formulations are physically stable within a average life period given the recommended storage temperature (typically 2.3 years at 2-8 ° C). Additionally, the present formulations are physically stable during use (typically 1 month at accelerated temperatures at 25 ° C or 37 ° C). The formulations of the invention are also chemically stable thereby rendering them self-stable and appropriate for invasive delivery means (eg, injection, subcutaneous, intramuscular, intravenous or infusion injection) as well as non-invasive (eg, nasal or pulmonary, transdermal or mucosal, for example, buccal). When the inventive formulation comprises a GLP-2 derivative, it is compared to the same formulation at a pH less than 7.0, the physical stability is considerably increased, and typically the half-life is increased from a few seconds to several months in the tests used. An object of the present invention is, therefore, to provide a pharmaceutical formulation comprising the GLP-2 derivative, and a buffer solution, wherein the GLP-2 derivative is present in the concentration from 0.1 to 25%. mg / ml up to 100 mg / ml, and wherein the formulation has a pH from 7.0 to 10. Another object of the present invention is to provide a method for preparing a physically stable pharmaceutical formulation of the GLP-2 derivative comprising preparing a formulation that contains the GLP-2 derivative and a buffer solution, wherein the GLP-2 compound is present in a concentration from 0.1 mg / ml to 100 mg / ml, and wherein the formulation has a pH from 7.0 to 10. In one aspect of the invention the formulation contains a GLP-2 derivative in a concentration from 1 mg / ml to 100 mg / ml. In another aspect of the invention the formulation has a pH from 7.0 to 9. In a further aspect, the invention relates to a pharmaceutical formulation comprising a GLP-2 derivative and a buffer solution, wherein the GLP-2 derivative is a GLP-2 peptide, wherein the lipophilic substituent is optionally linked via a spacer, to one or more amino acid residues at a position relative to the amino acid sequence of SEQ ID NO: 1 independently selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L14, D15, M16, L17, A18, D21, N24, and Q28, where the GLP-2 derivative is present in a concentration from 0.1 mg / ml up to 100 mg / ml, and where the formulation has a pH from 7.0 to 10. 26 In a further aspect, the invention relates to a pharmaceutical formulation comprising an aqueous solution of a GLP-2 derivative and a buffer solution, wherein the GLP-2 derivative is a GLP-2 peptide, wherein the lipophilic substituent is linked optionally by means of a spacer, to one or more amino acid residues at a position relative to the amino acid sequence of SEQ ID NO: 1 independently selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L14, D15, N16, L17, A18, D21, N24, and Q28, wherein the GLP-2 derivative is present in a concentration from 0.1 mg / ml to 100 mg / ml, and wherein the formulation has a pH from 7.0 to 10. In a further aspect, the invention relates to a method of preparing a physically stable pharmaceutical formulation of a GLP-2 derivative comprising preparing a formulation containing the GLP-2 derivative and a solution buffer, where the derivative G LP-2 is a GLP-2 peptide, wherein the lipophilic substituent is linked, optionally via a spacer, to one or more amino acid residues at a position relative to the amino acid sequence of SEQ ID NO: 1 independently selected. from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L 14, D15, N16, L17, A18, D21, N24, and Q28, where the GLP-2 derivative is present in a concentration 27 from 0.1 mg / ml to 100 mg / ml, and wherein the formulation has a pH from 7.0 to 10. In a further aspect, the invention relates to a method for preparing a pharmaceutical formulation of a GLP-2 derivative comprising the preparation of an aqueous solution containing the GLP-2 derivative and a buffer solution, wherein the GLP-2 derivative is a GLP-2 peptide, wherein the lipophilic substituent is optionally linked, via a spacer, to one or more amino acid residues in a position relative to > the amino acid sequence of SEQ ID NO: 1 independently selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L14, D15, NI6, L17, A18, D21, N24, and Q28, wherein the GLP-2 derivative is present in a concentration from 0.1 mg / ml to 100 mg / ml, and wherein the formulation has a pH from 7.0 to 10. In a further aspect, the invention relates to a method for preparing a physically stable pharmaceutical formulation of a GLP-2 derivative comprising preparing a formulation containing the GLP-2 derivative, water and a buffer solution, wherein the GLP-2 derivative is a GLP-2 peptide, wherein the The lipophilic substituent is optionally linked, via a spacer, to one or more amino acid residues at a position relative to the amino acid sequence of SEQ ID NO: 1 independently. selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L14, D15, N16, L17, A18, D21, N24, and Q28, where the GLP-2 derivative is present in a concentration from 0.1 mg / ml to 100 mg / ml, and wherein the formulation has a pH from 7.0 to 10. In a further aspect, the present invention relates to a method for the treatment of intestinal insufficiency or other condition which leads to malabsorption of nutrients in the intestine, which comprises administering to a patient in need thereof, an effective amount of a pharmaceutical formulation comprising a pharmaceutical composition comprising the GLP-2 derivative and a buffer solution, wherein the GLP-2 derivative is a GLP-2 peptide, wherein the lipophilic substituent is optionally linked, via a spacer, to one or more amino acid residues at a position relative to the amino acid sequence of SEQ ID ?? : 1 independently selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L14, D15, N16, L17, A18, D21, N24, and Q28, where the LPG derivative -2 is present in a concentration from 0.1 mg / ml to 100 mg / ml, and where the formulation has a pH from 7.0 to 10. In one embodiment, intestinal insufficiency or another condition that leads to malabsorption of nutrients in the bowel is selected from the list consisting of small bowel syndrome, syndrome 29 inflammatory bowel disease, Crohn's disease, colitis including collagen colitis, radiation colitis, chronic radiation enteritis, ulcerative colitis, tropical and non-tropical stomatitis (intolerance to gluten), celiac disease (gluten-sensitive enteropathy), damaged tissue after of vascular obstruction or trauma, diarrhea eg tourist diarrhea and post-infectious diarrhea, chronic intestinal dysfunction, dehydration, bacteremia, sepsis, anorexia nervosa, tissue damaged after chemotherapy for example, intestinal mucositis produced by chemotherapy, premature infants including insufficiency bowel syndrome in premature infants, infants before birth including intestinal insufficiency in infants before birth, scleroderma, gastritis that includes atrophic gastritis, atrophic gastritis postantrectomla and helicobacter pylori gastritis, pancreatitis, general septic shock ulcers, enteritis, cul-de-sac obstruction lymphatic, vascular disease and graft versus host and healed after surgical procedure, atrophy after radiation and chemotherapy, weight loss in Parkinson's disease, intestinal adaptation after surgical procedure, mucosal atrophy induced by parenteral nutrition, for example mucosal atrophy induced by total parenteral nutrition (TPN) and bone-related disorders including osteoporosis, hypercalcemia of 30 malignancy, osteopenia due to bone metastasis, periodontal disease, hyperparathyroidism, periarticular erosions in rheumatoid arthritis, Paget's disease, osteodystrophy, myositis ossificans, Bechterew's disease, malignant hypercalcemia, osteolytic lesions caused by bone metastasis, bone loss due to immobilization , bone loss due to deficiency of the sex steroid hormone, bone abnormalities due to steroid hormone treatment, bone abnormalities due to cancer therapeutics, osteomalacia, Bechet's disease, osteomalacia, hyperostosis, osteopetrosis, metastatic bone disease, osteopenia induced by immobilization , or osteoporosis induced by glucocorticoids. DETAILED DESCRIPTION OF THE INVENTION Short bowel syndrome (SBS) is a devastating clinical condition found in a broad spectrum of clinical and surgical conditions. The most common causes include radiation, cancer, mesenteric vascular disease, Crohn's disease and trauma. With the improved care of patients with SBS, a greater number of patients are surviving for a longer period of time, thus magnifying the need for therapeutic interventions to reduce or eliminate the long-term problems associated with SBS. Although patients with SBS have up to seven foods by 31 They still have problems maintaining a normal body weight and these patients are often kept on parenteral nutrition at home (PNH) or in the hospital. Chemotherapy (CT) and radiation therapy (RT) for the treatment of cancers rapidly attacks the dividing cells. Since cells of the intestinal crypts (the simple tubular glands of the small intestine) proliferate rapidly, CT / RT tends to produce damage to the intestinal mucosa as an adverse effect. Gastroenteritis, diarrhea, dehydration, and in some cases, bacteremia and sepsis may occur. These side effects are severe for two reasons: they set the limit for the dose of therapy and with it the efficacy of the treatment and represent a potentially life threatening condition which requires an intensive and expensive treatment. Studies in animals have shown that damage to the intestinal mucosa induced by CT can be counteracted by GLP-2 peptides due to its potent intestinotrophic activity, which leads to an increase in the weight of the intestine, height of the villi, depth of the crypts and proliferation rate of crypt cells and importantly a reduction of crypt cell apoptosis, damage to the GI tract induced by RT and the potential protective effect of GLP-2 peptides follows the same reasoning as that of CT. 32 Inflammatory bowel disease (IBD) includes Crohn's disease, which mainly affects the small intestine and ulcerative colitis that occurs mainly in the distal colon and rectum. The pathology of IBD is characterized by chronic inflammation and destruction of the GI epithelium. The current treatment is directed towards the suppression of inflammatory mediators. The stimulation of the repair and regeneration of the epithelium by intestinotrophic agents such as the GLP-2 derivatives according to the present invention could represent an alternative or adjunct strategy for the treatment of IBD. Dextran sulfate (DS) induced colitis in rodents resembles ulcerative colitis in man with the development of mucosal edema, crypt erosions and abscesses leading to the formation of polyps and progression towards dysplasia and adenocarcinoma, but the precise mechanism underlying the toxicity of DS is not known. A beneficial effect of GLP-2 peptides on induced colitis (DS) in mice has been demonstrated. Mice receiving 5% DS in drinking water developed loose stools with swathes of blood after 4-5 days and lost 20-25% of their body weight after 9-10 days. Mice that were also treated subcutaneously twice a day for the entire period (9-10 days) with 350 ng or 750 ng A2G-GLP-2 (1-33) lost 33 significantly more body weight and appeared much healthier. The effects were dose dependent. By histology, DS mice treated with A2G-GLP-2 (1-33) showed a higher proportion of intact mucosal epithelium, increased colon length, crypt depth and mucosal area. These effects were partially mediated by improved stimulation of the proliferation of mucosal epithelial cells. It is concluded by the inventors of the present invention that there is therapeutic potential for the treatment of IBD of GLP-2 derivatives according to the present invention, potentially in combination with anti-inflammatory drugs. Thus, there is a potential for GLP-2 derivatives according to the present invention as an adjunct in anti-inflammatory therapy IBD. The predominant role of the GLP-2 derivatives according to the present invention in IBD would be to improve the regeneration of the compromised intestinal epithelium. The degradation of native GLP-2 (1-33) in vivo in humans presumably by dipeptidyl peptidase IV (DPP-IV) has been studied in detail. Infusions of GLP-2 (0.8 pmol / kg * min) increased the plasma level of intact GLP-2 (1-33) from 9 pM to 131 p was eliminated with a Ti / 2 value of 7 minutes. When a subcutaneous injection of GLP-2 (1-33) was given (400 mg = 106,000 pmol) the plasma concentration was increased to 1500 pM a maximum after 45 minutes. 3. 4 One hour after the subcutaneous injection, 69% of the GLP-2 (1-33) injected was still intact. In both studies the only degradation product detected by CLAR was GLP-2 (3-33) and it is concluded that GLP-2 is broadly degraded to GLP-2 (3-33) in humans presumably by DPP-IV. Thus, the aim of the present invention is to provide GLP-2 derivatives that are resistant to the degradation of DPPIV and that are thus more potent in vivo than the native GLP-2 peptide. The term "GLP-2 peptide" as used herein means any protein comprising the amino acid sequence 1-33 of native human GLP-2 (SÉQ ID NO: 1) or analogs thereof. This includes but is not limited to human native GLP-2 and analogs thereof. The term "GLP-2" as used herein is intended to include proteins having the amino acid sequence 1-33 of native human GLP-2 with the amino acid sequence of SEQ ID NO: 1. It also includes proteins with a slightly modified amino acid sequence, for example, an N-terminal modified terminus that includes deletions or additions of amino acids at the N-terminus provided that those proteins substantially retain the activity of GLP-2. "GLP-2" within the above definition includes natural allelic variations that may exist and be presented from one individual to the other. Also the degree and location of the glycosylation and other modifications to the Post-translation may vary depending on the host cells chosen and the nature of the cellular environment of the host. The terms "analogue" or "analogues", as used herein, are intended to designate a GLP-2 peptide having the sequence of SEQ ID NO: 1, wherein 1 or more amino acids of the GLP precursor protein. -2 have been replaced by another amino acid or where one or more amino acids of the GLP-2 precursor protein have been deleted and / or where one or more amino acids have been inserted into the protein and / or where one or more amino acids are have added to the GLP-2 precursor protein. Such addition can take place either at the N terminal end or the C terminal end of the GLP-2 precursor protein or both. The analog or analogs within this definition still have GLP-2 activity as measured by the ability to exert trophic effects in the large or small intestine. In an embodiment an analog is 70% identical with the sequence of SEQ ID NO: 1. In an embodiment an analog is 80% identical with the sequence of SEQ ID NO: l. In another embodiment an analog is 90% identical with the sequence of SEQ ID N0: 1. In a further embodiment an analog is 95% identical to the sequence of SEQ ID NO: 1. In a further embodiment an analogue is a GLP-2 peptide, wherein a total of up to 10 amino acid residues of SEQ ID NO: 1 is have exchanged with any residue of 36 amino acids. In a further embodiment, an analogue is a GLP-2 peptide wherein a total of up to 5 amino acid residues of SEQ ID NO: 1 has been exchanged with an amino acid residue. In a further embodiment an analog is a GLP-2 peptide wherein a total of up to three amino acid residues of SEQ ID NO: 1 has been exchanged with any amino acid residue. In a further embodiment an analog is a GLP-2 peptide, wherein a total of up to two amino acid residues of SEQ ID NO: 1 has been exchanged with some amino acid residue. In a further embodiment an analog is a GLP-2 peptide wherein a total of amino acid residue of SEQ ID NO: 1 has been exchanged with some amino acid residue. The term "a fragment thereof" as used herein, means any fragment of the peptide according to formula I or II with at least 15 amino acids and having a GLP-2 biological activity. The GLP-2 activity can be measured for the binding affinity to the GLP-2 receptor. In one modality, if fragment has 20 amino acids. In one embodiment, the fragment has at least 25 amino acids. In one embodiment, the fragment has at least 30 amino acids. In one embodiment, the fragment is in accordance with formula I or II with an elimination of amino acids with the C-terminus. In one embodiment, the fragment is in accordance with formula I or II with two amino acid deletions in formula C. In a 37 modality, the fragment is in accordance with formula I 0 II with three amino acid deletions in the C terminal. In one embodiment, the fragment is in accordance with the formula 1 or II with four terminal amino acid deletions C. In one embodiment the fragment is in accordance with formula I or II with an amino acid deletion at the N-terminus. In one embodiment the fragment is in accordance with formula I or II with two amino acid deletions at the N-terminus. In one embodiment the fragment is in accordance with formula I or II with three amino acid deletions at the N-terminus. In one embodiment the fragment is in accordance with formula I or II with four amino acid deletions at the N-terminus. The term "derivative" is used herein to designate a peptide in which one or more of the amino acid residues have been chemically modified, for example, by alkylation, acylation, formation of ester or amide formation. The term "a GLP-2 derivative" is used in the present text to designate a derivative of a GLP-2 peptide. In one embodiment the GLP-2 derivative according to the present invention has GLP-2 activity as measured by the ability to bind a GLP-2 receptor (GLP-2R) and / or exert trophic effects in the small or large intestine. In a modality 38 the GLP-2 receptor is selected from the list consisting of rat GLP-2R, mouse GLP-2R and human GLP-2R. The term "lipophilic substituent" is characterized by comprising 4-40 carbon atoms and has a solubility in water at 20 ° C in the range from about 0.1 mg / 100 ml of water to about 250 mg / 100 ml of water, such as in the range from about 0.3 mg / 100 ml of water to about 75 mg / 100 ml of water. For example, octanoic acid (C8) has a solubility in water at 20 ° C of 68 mg / 100 ml, decanoic acid (CIO) has a solubility in water at 20 ° C of 15 mg / 100 ml, and the acid Octadecanoic (C18) has a solubility in water at 20 ° C of 0.3 mg / 100 ml. The term "polynucleotide construct" is intended to indicate a polynucleotide segment that can be based on a naturally occurring complete or partial nucleotide sequence encoding the peptide of interest. The construct may optionally contain other polynucleotide segments. Similarly, the term "amino acids that can be encoded by the polynucleotide constructs" covers amino acids that can be encoded by the polynucleotide constructs defined above, that is, amino acids such as Ala, Val, Leu, Lie, Met, Phe, Trp, Pro, Gly, Ser, T r, Cys, Tyr, Asn, Glu, Lys, Arg, His, Asp and Gln. The term "a host cell", as used herein, represents any cell, including cells 39 hybrid, in which the heterologous DNA can be expressed. Typically, host cells include, but are not limited to, insect cells, yeast cells, mammalian cells, including human cells, such as BHK, CHO, HEK, and COS cells. In the present context, the term "treatment" means including both the prevention of an expected intestinal insufficiency or other condition leading to malabsorption of nutrients in the intestine, such as post-radiation atrophy, and regulation of intestinal insufficiency. already presented, such as in the inflammatory bowel syndrome, with the purpose of inhibiting or minimizing the effect of the condition that leads to poor absorption of nutrients in the intestine. Prophylactic administration with the GLP-2 derivative according to the invention is thus included in the term "treatment". The term "subject" as used herein is intended to mean any animal, in particular mammals, such as humans, and may, where appropriate, be used interchangeably with the term "patient." As used herein, the term "appropriate growth medium" means a medium containing nutrients and other components required for the growth of cells and the expression of the sequence of the cells. nucleic acid encoding the GLP-2 peptide of the invention.

To obtain a satisfactorily protective action profile of the GLP-2 derivative, the lipophilic substituent bonded to the GLP-2 portion, as an example, comprises 4-40 carbon atoms, such as 8-25 carbon atoms. The lipophilic substituent can be linked to an amino group of the GLP-2 portion by means of a carboxyl group of the lipophilic substituent which forms an amide bond with an amino group of the amino acid to which it is linked. As an alternative, the lipophilic substituent can be linked to the amino acid such that an amino group of the lipophilic substituent forms an amide bond with a carboxyl group of the amino acid. As an additional option, the lipophilic substituent can be linked to the GLP-2 portion by means of an aster bond. Formally, the aster can be formed either by the reaction between a carboxyl group of the GLP-2 portion and a hydroxyl group of the substituent to be or by the reaction between a hydroxyl group of the GLP-2 portion and a carboxyl group of the substituent a be. As a further alternative, the lipophilic substituent may be an alkyl group that is introduced into a primary amino group of the GLP-2 portion. In one embodiment the GLP-2 peptide is an isolated GLP-2 compound. In one embodiment, the GLP-2 derivative is an isolated GLP-2 compound. 41 In one embodiment the GLP-2 compound is an isolated GLP-2 compound. The term "isolated GLP-2 compound" refers to a compound of the present invention that (1) has been separated from at least about 50 percent polynucleotides, lipids, carbohydrates or other free materials (ie, contaminants) with which it is naturally associated. Preferably, the isolated compound or polypeptide is substantially free of any other contaminating polypeptides found in its natural environment that would interfere with its therapeutic, diagnostic, prophylactic or research use. Preferably, the isolated compound or polypeptide has been separated from at least about 70, such as 80, such as 90, such as 95 percent polynucleotides, lipids, carbohydrates or other free materials (ie, contaminants) with which associates naturally. In one embodiment of the invention the GLP-2 peptide consists of the amino acid sequence His-X2-X3-Gly-X5-Phe-X7-X8-X9-X10-X10-X11-X12-X13-X14-X15-X: L6 X17-X18-Ala-X20-X21-Phe-lle-X24-Trp-Leu-lle-X28-Thr-Arg-lle-Thr-X33 Or a fragment thereof; where X2 is Ala, Val or Gly; X3 is Asp, or Glu; X5 is Ser, or Lys; X7 is Ser, or Lys; X8 is Asp, Glu, or Lys; X9 is Asp, Glu, or Lys; X10 is Met, Lys, Leu, Lie, or Nor-Leucine; X11 is Asn, or Lys; X12 is Thr, or Lys; X13 is 42 lie, or Lys; X14 is Leu, or Lys X15 is Asp, or Lys; X16 is Asn, or Lys; X17 is Leu, or Lys; X18 is Ala, or Lys; X20 is Arg, or Lys; X21 is Asp, or Lys; X24 is Asn, or Lys; X28 is Gln, or Lys; X33 is Asp, Glu, or Lys. In one embodiment of the invention the GLP-2 peptide is in accordance with formula II His-X-X3-Gly-X5-Phe-X7-X8-X9-X10-X11-X11-X12-X: L3-X: L4- X15-X16-X17-X18-Ala-Arg-X21-Phe-lle-X24-Trp-Leu-lle-X28-Thr-X30-lle-Thr-X33 (formula II) or a fragment thereof; where X2 is Ala, Val or Gly; X3 is Asp, or Glu; X5 is Ser, or Lys; X7 is Ser, or Lys; X8 is Asp, Glu, or Lys; X9 is Asp, Glu, or Lys; X10 is Met, Lys, Leu, Lie, or Nor-Leucine; X11 is Asn, or Lys; X12 is Thr, or Lys; X13 is lie, or Lys; X14 is Leu, or Lys; X15 is Asp, or Lys; X1S is Asn, or Lys; X17 is Leu, or Lys, - X18 is Ala, or Lys; X20 is Arg, or Lys; X21 is Asp, or Lys; X24 is Asn, or Lys; X28 is Gln, or Lys; X30 is Arg, or Lys; X33 is Asp, Glu, or Lys (formula II). In a modality X2 is Ala. In an X2 mode it is Gly. In an X3 mode it is Asp. In an X3 mode it is Glu. In a modality X5 is Ser. In a modality X7 is Ser. In a modality X8 is Asp. In an X8 mode it is Glu. In an X9 mode it is Asp. In a modality X9 is Glu. In an X10 modality it is selected from the group consisting of Met, Leu, Lie, and Nor-Leucine. In an X11 mode it is Asn. In an X12 mode it is Thr. In a modality X13 is lie. In a 43 modality X is Leu. In an X15 mode it is Asp. In an X1S mode it is Asn. In a modality X17 is Leu. In a modality X18 is Ala. In a modality X21 is Asp. In an X24 mode, it is Asn. In an X28 mode, it is Gln. In an X33 mode it is Asp. In an X33 mode it is Glu. In an embodiment at least one amino acid independently selected from the list consisting of X5, X7, Xs, X9, X10, X, X12, X13, X14, X15, X16, X17, X18, X20, X21, X24, X28, and X33 is a Lys. In one embodiment the amino acid independently selected from the list consisting of Xs, X7, Xs, X9, X10, X, X22, X13, X14, X15, X16, X17, X18, X20, X21, X24, X28, and X33 is Lys. In one embodiment, the amino acid Xs is Lys. In one embodiment, amino acid X7 is Lys. In one embodiment, the amino acid X8 is Lys. In one embodiment, the amino acid Xs is Lys. In one embodiment, the amino acid X10 is Lys. In one embodiment the amino acid X11 is Lys. In one embodiment, the amino acid X12 is Lys. In one embodiment, the amino acid X13 is Lys. In one embodiment, amino acid X14 is Lys. In one embodiment, the amino acid X15 is Lys. In one embodiment, the amino acid X16 is Lys. In one modality, the amino acid X17 is Lys. In one modality, the amino acid X18 is Lys. In one embodiment, the amino acid X20 is Lys. In one embodiment, the amino acid X21 is Lys. In one embodiment, the amino acid X24 is Lys. In one modality, the amino acid X28 is Lys. In one embodiment, the amino acid X30 is Lys. In one embodiment, the amino acid X30 is Arg. In one embodiment, the amino acid X33 is Lys. In one embodiment of the invention the GLP-2 peptide is a GLP-2 peptide, wherein a total of up to 5 residues of 44 amino acids have been exchanged with any amino acid residue, such as 4 amino acid residues, 3 amino acid residues, 2 amino acid residues, or 1 amino acid residue. In one embodiment of the invention the GLP-2 peptide is selected from the list consisting of: GLP-2 (1-33), A2G-GLP-2 (1-33), K30R-GLP-2 (1-33); S5K-GLP-2 (1-33); S7K-GLP-2 (1-33); D8K-GLP-2 (1-33); E9K-GLP-2 (1-33) M10K-GLP-2 (1-33); N11K-GLP-2 (1-33); T12K-GLP-2 (1-33); 113K-GLP-2 (1-33); L14K-GLP-2 (1-33); D15K-GLP-2 (1-33); N16K-GLP-2 (1-33); L17K-GLP-2 (1-33); A18K-GLP-2 (1-33); D21K-GLP-2 (1-33); N24K-GLP-2 (1-33); Q28K-GLP-2 (1-33); S5K / K30R-GLP-2 (1-33); S7K / K3 OR-GLP-2 (1-33); D8K / K30R-GLP-2 (1-33); E9K / K3 OR-GLP-2 (1-33); M10K / K30R-GLP-2 (1-33); N11K / K3 OR-GLP-2 (1-33); T12K / K3 OR-GLP-2 (1-33); 113K / K30R-GLP-2 (1-33); L14K / K30R-GLP-2 (1-33); D15K / K3 OR-GLP-2 (1-33); NI 6K / K3 OR-GLP-2 (1-33); L17 / K3 OR-GLP-2 (1-33); A18K / K3 OR-GLP-2 (1-33); D21K / K3 OR-GLP-2 (1-33); N24K / K3 OR-GLP-2 (1-33); Q28K / K3 OR-GLP-2 (1-33); K30R / D33K-GLP-2 (1-33); D3E / K30R / D33E-GLP-2 (1-33); D3E / S5K / K30R / D33E-GLP-2 (1-33); D3E / S7K / K30R / D33E-GLP-2 (1-33); D3E / D8K / K30R / D33E-GLP-2 (1-33); D3E / E9K / K30R / D33E-GLP-2 (1-33); D3E / M10 / K30R / D33E-GLP-2 (1-33); D3E / N11K / K30R / D33E-GLP-2 (1-33); D3E / T12K / K30R / D33E-GLP-2 (1-33); D3E / 113K / K30R / D33E-GLP-2 (1-33); D3E / L14K / K30R / D33E-GLP-2 (1-33); D3E / D15 / K30R / D33E-GLP-2 (1-33); D3E / N16K / K30R / D33E-GLP-2 (1-33); D3E / L17K / K30R / D33E-GLP-2 (1-33); D3E / A18K / K30R / D33E-GLP-2 (1-33); D3E / D21 / K30R / D33E-GLP-2 (1-33); D3E / N24K / K30R / D33E-GLP-2 (1-33); and D3E / Q28 / K30R / D33E-GLP-2 (1-33).

Four. Five In one embodiment of the invention the GLP-2 receptor agonist is selected from the list consisting of: GLP-2 (1-33), A2G-GLP-2 (1-33), K30R-GLP-2 (1- 33); S5K-GLP-2 (1-33); S7K-GLP-2 (1-33); D8K-GLP-2 (1-33); E9K-GLP-2 (1-33); M10K-GLP-2 (1-33); N11-GLP-2 (1-33); T12K-GLP-2 (1-33); I13K-GLP-2 (1-33); L14K-GLP-2 (1-33); D15K-GLP-2 (1-33); N16K-GLP-2 (1-33); L17K-GLP-2 (1-33); A18K-GLP-2 (1-33); D21K-GLP-2 (1-33) N24K-GLP-2 (1-33); Q28K-GLP-2 (1-33); S5K / K3 OR-GLP-2 (1-33) S7K / K30R-GLP-2 (1-33); D8K / K3 OR-GLP-2 (1-33); E9K / K3 OR-GLP-2 (1-33) M M1100KK // KK33 OORR-GGLLPP-22 ((11--3333)); N11K / K3 OR-GLP-2 (1-33) T12K / K3 OR-GLP-2 (1-33) I13K / K3 OR-GLP-2 (1-33) L14K / K30R-GLP-2 (1-33) ) D15K / K3 OR-GLP-2 (1-33) N16K / K30R-GLP-2 (1-33) L17K / K30R-GLP-2 (1-33) A18K / K3 OR-GLP-2 (1-33) ) D21K / K3 OR-GLP-2 (1-33) N24K / K3 OR-GLP-2 (1-33) Q28K / K30R-GLP-2 (1-33) K30R / D33-GLP-2 (1-33) ) D3E / K30R / D33E-GLP-2 (1-33); D3E / S5K / 30R / D33E-GLP-2 (1-33); D3E / S7K / 30R / D33E-GLP-2 (1-33); D3E / D8K / K30R / D33E-GLP-2 (1-33); D3E / E9K / 30R / D33E-GLP-2 (1-33); D3E / M10K / K30R / D33E-GLP-2 (1-33) D3E / N11K / K30R / D33E-GLP-2 (1-33) D3E / T12K / K30R / D33E-GLP-2 (1-33) D3E / 113K / K30R / D33E-GLP-2 (1-33) D3E / L14K / K30R / D33E-GLP-2 (1-33) D3E / D15 / K30R / D33E-GLP-2 (1-33) D3E / N16K / K30R / D33E-GLP-2 (1-33) D3E / L17K / K30R / D33E-GLP-2 (1-33) D3E / A18K / K30R / D33E-GLP-2 (1-33) D3E / D21K / K30R / D33E-GLP-2 (1-33) D3E / N24K / K30R / D33E-GLP-2 (1-33); and D3E / Q28K / K30R / D33E-GLP-2 (1-33). In one embodiment of the invention the GLP-2 receptor agonist is a GLP-2 peptide. In one embodiment of the invention the agonist of 46 GLP-2 receptor is a derivative of GLP-2. In one embodiment of the invention the GLP-2 derivative comprises a GLP-2 peptide, wherein the GLP-2 peptide is in accordance with formula II His-X2-X3-Gly-X5-Phe-X7-X8-X9- X10-XirL-X1-X13-X14-X15-X1? -X17-X18-Ala-X20-X21-Phe-lle-X24-Trp-Leu-lle-X28-Thr-X30-lle-Thr-X33 (formula II) or a fragment thereof; where X2 is Ala, Val or GLY; X3 is Asp, or Glu; Xs is Ser, or Lys; X7 is Ser, or Lys; X8 is Asp, Glu, or Lys; X9 is Asp, Glu, or Lys; X10 is Met, Lys, Leu, Lie, or Nor-Leucine; X11 is Asn, or Lys; X12 is Thr, or Lys; X13 is lie, or Lys; X14 is Leu, or Lys; X15 is Asp, or Lys; X16 is Asn, or Lys; X17 is Leu, or Lys; X18 is Ala, or Lys; X20 is Arg, or Lys; X21 is Asp, or Lys; X24 is Asn, or Lys; X28 is Gin, or Lys; X30 is Arg, or Lys; X33 is Asp, Glu, or Lys (formula II). In one embodiment of the invention the GLP-2 derivative only has a lipophilic substituent linked to the GLP-2 peptide. In one embodiment of the invention, the lipophilic substituent comprises from 4 to 40 carbon atoms. In one embodiment of the invention, the lipophilic substituent comprises from 8 to 25 carbon atoms. In one embodiment of the invention, the lipophilic substituent comprises from 12 to 20 carbon atoms. In one embodiment of the invention the substituent 47 Lipophilic is bound to an amino acid residue such that a carboxyl group of the lipophilic substituent forms an amide bond with an amino group of the amino acid residue. In one embodiment of the invention the lipophilic substituent is linked to a Lys residue. In one embodiment of the invention the lipophilic substituent is linked to amino acid residues such that an amino group of the lipophilic substituent forms an amide bond with a carboxyl group of the amino acid residue. In one embodiment of the invention the lipophilic substituent is linked to the GLP-2 peptide by means of a spacer. In one embodiment of the invention, the spacer is a non-branched alkane, co-dicarboxylic acid group having from 1 to 7 methylene groups, such as 2 methylene groups whose spacer forms a bridge between an amino group of the GLP-2 peptide and a amino group of the lipophilic substituent. In one embodiment of the invention the spacer is an amino acid residue except a Cys residue, or a dipeptide. Examples of suitable spacers include β-alanine, gamma-aminobutyric acid (GABA), β-glutamic acid, succinic acid, Lys, Glu or Asp, or a dipeptide such as Gly-Lys. When the spacer is * succinic acid, a carboxyl group 48 it can form an amide bond with an amino group of the amino acid residue, and the other carboxyl group thereof can form an amide bond with an amino group of the lipophilic substituent. When the spacer is Lys, Glu or Asp, the carboxyl group thereof can form an amide bond with an amino group of the amino acid residue, and the spacer of the amino group thereof can form an amide bond with a carboxyl group of the lipophilic substituent. When Lys is used as the spacer, an additional spacer can, in some cases, be inserted between the Lys e-amino group and the lipophilic substituent. In one embodiment, such additional spacer is succinic acid which forms an amide bond with the e-amino group of Lys and with an amino group present in the lipophilic substituent. In another embodiment such additional spacer is Glu or Asp which forms an amide bond with the e-amino group of Lys and another amide bond with a carboxyl group present in the lipophilic substituent, that is, the lipophilic substituent is a lysine residue NE- acylated In one embodiment of the invention the spacer is selected from the list consisting of β-alanine, gamma-aminobutyric acid (GABA), β-glutamic acid, Lys, Asp, Glu, a dipeptide containing Asp, a dipeptide containing Glu , or a dipeptide containing Lys. In a modality of 49 invention the spacer is ß-alanine. In one embodiment of the invention the spacer is gamma-aminobutyric acid (GABA.). In one embodiment of the invention, the spacer is β-glutamic acid. In one embodiment of the invention, a carboxyl group of the precursor GLP-2 peptide forms an amide bond with an amino group of a spacer., and the carboxyl group of the amino acid or dipeptide spacer forms an amide bond with an amino group of the lipophilic substituent. In one embodiment of the invention an amino group of the precursor GLP-2 peptide forms an amide bond with a carboxylic group of a spacer, and an amino group of the spacer forms an amide bond with a carboxyl group of the lipophilic substituent. In one embodiment of the invention the lipophilic substituent comprises a partially or fully hydrogenated cyclopentane phenanthrene skeleton. In one embodiment of the invention, the lipophilic substituent is a straight or branched chain alkyl group. In one embodiment of the invention, the lipophilic substituent is the acyl group of a straight or branched chain fatty acid. In one embodiment of the invention the acyl group of a lipophilic substituent is selected from the group consisting of C¾ (CH2) nC0-, wherein n is 4 to 38, such as C¾ (CH2) 6C0-, 0¾ (0¾) 8G0- , a¾ «¾) a ??? -, <; ¾ (< ¾) uOO-, C¾ (OÍ2) 14C0-, Oí3 (CH2) 16O0-, C¾ (CH2) 13CO-, C¾ (d¾) 20GO- and < 3¾ «¾) 2200-. fifty In one embodiment of the invention, the lipophilic substituent is an acyl group of straight or branched chain α, α-dicarboxylic acid. In one embodiment of the invention the acyl group of the lipophilic substituent is selected from the group consisting of H00C (GH2) mC0-, wherein m is 4 to 38, such as HOOC (C¾) i4CO-, HOOC (C¾) i6CO-, HOOC (CH2) i8CO-, HOOC (CH2) 20CO- and HOOC (CH2) 22CO-. In one embodiment of the invention the lipophilic substituent is a group of the formula CH3 (CH2) p ((C¾) qCOOH) CHNH-CO (CH2) 2CO-, where p and g are integers and p + q is an integer from 8 to 40, such as from 12 to 35. In one embodiment of the invention the lipophilic substituent is a group of the formula C¾ (CH 2) rCO-NHCH (COOH) (CH 2) 2CO-, wherein r is an integer from 10 to 24 In one embodiment of the invention, the lipophilic substituent is a group of the formula CH3 (CH2) gCO-NHCH ((CH2) 2C00H) CO-, wherein s is an integer from 8 to 24.

In one embodiment of the invention the lipophilic substituent is a group of the formula COOH (CH2) tCO- wherein t is an integer from 8 to 24. In one embodiment of the invention the lipophilic substituent is a group of the formula - HCH ( COOH) (CH2) 4 H-CO (CH2) uCH3, wherein u is an integer from 8 to 18. In one embodiment of the invention the lipophilic substituent is a group of the formula -NHCH (COOH) (CH2) 4 H - 51 COCH ((CH2) 2COOH) NH-CO (CH2) "CH3, wherein w is an integer from 10 to 16. In one embodiment of the invention the lipophilic substituent is a group of the formula -NHCH (COOH) (CH2) 4NH ~ C0 (CH2) 2CH (C00H) NH-C0 (CH2) XCH3, wherein x is an integer from 10 to 16. In one embodiment of the invention the lipophilic substituent is a group of the formula -NHCH (COOH) ( C¾) 4NH-CO (CH2) 2CH (COOH) NHC0 (CH2) and CH3, wherein y is zero or an integer from 1 to 22. In one embodiment of the invention the lipophilic substituent is N-Litocoloyl. In one embodiment of the invention, the lipophilic substituent is N-Colloyl. In one embodiment of the invention, the GLP-2 derivative has a lipophilic substituent. In one embodiment of the invention, the GLP-2 derivative has two lipophilic substituents. In one embodiment of the invention, the GLP-2 derivative has three lipophilic substituents. In one embodiment of the invention, the GLP-2 derivative has four lipophilic substituents. In one embodiment of the invention the GLP-2 derivative is selected from the group consisting of S5 (3- (hexadecanoylamino) pyrionyl) -GLP-2 (1-33); S7K (3- (hexadecanoylamino) ropionyl) -GLP-2 (1-33); D8K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); 52 E9K (3- (hexadecanoylamino) ropionyl) -GLP-2 (1-33); M10K (3- (hexadecanoylamino) ropionyl) -GLP-2 (1-33); N 11 K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); T12K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); I13K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); L 14 K (3- (hexadecanoylamino) ropionyl) -GLP-2 (1-33); D15K (3-hexadecanoylamino) propionyl) -GLP-2 (1-33); N16K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33) L17K (3- (octanylamino) ropionyl) -GLP-2 (1-33); L17K (3- (nonanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (decanylamino) ropionyl) -GLP-2 (1-33); L17K (3- (undecanoylamino) ropionyl) -GLP-2 (1-33); L17K (3- (dodecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (tridekanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (tetradecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (pentadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (hexadecanoyl mino) propionyl) -GLP-2 (1-33); L17K (3- (heptadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (octadecanoylamino) ropionyl) -GLP-2 (1-33); L17K (3- (nonadecanoylamino) propionyl) -GLP-2 (1-33); L17k (3- (eicosanoylamino) propionyl) -GLP-2 (1-33); L17K ((S-4-carboxy-4- (octanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S-4-carboxy-4- (nonanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S -4-carboxy-4- (decanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S -4-carboxy-4- (undecanoylamino) butanoyl) -GLP-2 (1-33); 53 L17K ((S) -4-carboxy-4- (dodecanoylamino) butanoyl) -GLP-2 (1-33) L17K ((S) -4-carboxy-4- (tridekanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (tetradecanoylamino) butanoyl) -GLP-2 (1-33), -L17K ((S) -4-carboxy-4- (pentadecanoylamino) butanoyl) -GLP-2 ( 1-33); L17K ((S) -4-carboxy-4- (hexadecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (heptadecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (octadecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (nonadecanoylaraine) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (eicosanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (octanoylamino) butanoyl) -GLP-2 (1-33) L17K (4- (nonanoylamino) butanoyl) -GLP-2 (1-33) L17K (4- (decanoylamino) butanoyl) -GLP-2 ( 1-33) L17K (4- (undecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (dodecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (tridekanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (tetradecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (pentadecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (hexadecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (heptadecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (octadecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (nonadecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (eicosanoylamino) butanoyl) -GLP-2 (1-33); A18K (3- (hexadecanoylamino) ropionyl) -GLP-2 (1-33) D21K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33) N24K (3- (hexadecanoylamino) propionyl) -GLP-2 ( 1-33) 54 Q28K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); S5K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33); S7K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) D8K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); E9 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); M10K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), · N 11 K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33); T12K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); I13K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); L14K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33); D15K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); N16K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (octanoylamino) propionyl) / K30R-GLP-2 (1-33) L17K (3- (nonanoylamino) propionyl) / K30R-GLP-2 (1-33) L17K (3- (decanylamino) ropionyl) / K30R-GLP-2 (1-33) L17 (3- (undecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (dodecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (tridekanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (tetradecanoylamino) propionyl) / 30R-GLP-2 (1-33) L17K (3- (pentadecanoylamino) propionyl) / K30R-GLP-2 (1-33) L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (hetpadecanoylamino) propionyl) / K30R-GLP-2 (1-33) L17K (3- (octadecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3-nonadecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (eicosanoylamino) propionyl) / K30R-GLP-2 (1-33); 55 L17K ((S) -4-carboxy-4- (octanylamino) butanoyl) / K30R-GLP-2 (1-33); I_L7K ((S) -4-carboxy-4- (nonanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (decanoylamino) butanoyl) / K30R-GLP-2 (1-33.); L17K ((S) -4-carboxy-4- (undecanoylarra.no) utanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (dodecanoylamino) butanoyl) / K30R-GLP-2 (1-33 ·); L17K ((S) -4-carboxy-4- (tridekanoylamino) butanoyl) / 30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (tetradecanoylamino) butanoyl) / K30R-GLP-2 (1-33) L17K ((S) -4-carboxy-4- (pentadecanoylamino) butanoyl) / 30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (hexadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (heptadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (cctadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (nonadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (eicosanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (octanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (nonanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (decanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (undecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (dodecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (tridekanoylamino) butanoyl) / K30R-GLP-2 (1-33), -L17K (4- (tetradecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (pentadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (hexadecanoylamino) utanoyl) / K30R-GLP-2 (1-33); L17K (4- (heptadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17 (4- (octadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (nonadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); 56 L17K (4- (eicosanoylamino) butanoyl) / K30R-GLP-2 (1-33); A18K (3- (hexade cano i lamino) propionyl) / K30R-GLP-2 (1-33); D21K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); N24K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33); Q28K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); D3E / S5K (3- (hexadecanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33); D3E / S7K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / D8K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / E9 (3- (hexadecanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33); D3E / 10K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / N11K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / T12K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / I13K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L14K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / D15K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / N16K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17 (3- (octanylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (nonanoylami or) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (decanylamino) ropionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (unde cano i lamino) propionyl) / K30R / D33E-GLP-2 (1-33) D3E / L17K (3- (dodecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33) D3E / L17K (3- (tridekanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (tetradecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (pentadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); 57 D3E / L17K (3- (heptadecanoylarene) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (octadecanoylarnino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (nonadecanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33); D3E / L17K (3- (eicosanoylamino) ropionyl) / 30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (octanylamino) utanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17k ((s) -4 -carboxy-4- (nonanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (decanylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (undecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (dodecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (tridekanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (tetradecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (pentadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (hexadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (heptadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4 -carboxy-4- (octadecanoylamino) butanoyl) / K30R / D33E- 58 GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (nonadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (eicosanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (octanoylamino) utanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (nonanoylamino) utanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (decanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (unde cano i lamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17 (4- (dodecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (tridekanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33) / D3E / L17K (4- (tetradecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (pentadecanoylamino) butanoyl) / 30R / D33E-GLP-2 (1-33); D3E / L17K (4- (hexadecanoylamino) utanoyl) / K30R / D33E-GLP-2 (1-33) D3E / L17K (4- (heptadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (octadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (nonadecanoylamino) utanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (eicosanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / A18 (3- (hexadecanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33); D3E / D21 (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / N24K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); Y D3E / Q28K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33). In a further embodiment, the present invention relates to a GLP-2 derivative in which the C-terminal amino acid residue is present in the form of the amide. 59 In a further embodiment, the present invention relates to a GLP-2 derivative having a lipophilic substituent that can be negatively charged. In one embodiment the group that can be negatively charged is a carboxylic acid group. The precursor GLP-2 peptide can be produced by a method which comprises culturing a host cell that contains a DNA sequence encoding the GLP-2 peptide and is capable of expressing the GLP-2 peptide in an appropriate nutrient medium under conditions that they allow the expression of the GLP-2 peptide, after which the resulting GLP-2 peptide is recovered from the culture. The medium used for culturing the cells can be any conventional means suitable for growing the host cells, such as minimal or complex media containing appropriate complements. Appropriate media are available from commercial distributors or can be prepared in accordance with published recipes (for example, in catalogs of the American Type Culture Collection). The GLP-2 peptide produced by the cells can then be recovered from the culture medium by conventional methods including separating the host cells from the medium by centrifugation or filtration, precipitating the proteinaceous components of the supernatant or filtering by means of a salt, for example, sodium sulfate. ammonium. 60 purification by a variety of chromatography methods, for example, ion exchange chromatography, gel filtration, chromatography, affinity chromatography, or the like, depending on the type of GLP-2 peptide in question. The DNA sequence encoding the precursor GLP-2 peptide may appropriately be of genomic origin or cDNA, for example, a genomic or cDNA library and separation by exclusion for DNA sequences encoding all or part of the GLP-2 peptide can be obtained. by hybridization using synthetic oligonucleotide probes in accordance with standard techniques (see, for example, Sarnbrook, J, Fritsch, EF and Maniatis, T, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York, 1989). The DNA sequence encoding the GLP-2 peptide can also be prepared synthetically by stabilized standard methods, for example, the phosphoamidite method is described by Beaucage and Caruthers, Tetrahedron Letters 22 (1981), 1859-1869, or the method described by Matthes et al., EMBO Journal 3 (1984), 801-805. The DNA sequence can also be prepared by polymerase chain reaction using specific primers, for example as described in US 4,683, 202 or Saiki et al., Science 239 (1988), 487-491. The DNA sequence can be inserted into any vector that can conveniently be subjected to DNA procedures. recombinant, and the choice of vector frequently depends on the host cell into which it is introduced. In this way, the vector can be an autonomously replicating vector, that is, a vector that is presented as an extrachromosomal entity, the replication of which is independent of chromosomal replication, for example a plasmid. Alternatively, the vector can be one which, when introduced into a host cell, is integrated into the genome of the host cell and replicated together with the chromosomes in which it has been integrated. The vector is preferably an expression vector in which the DNA sequence encoding the GLP-2 peptide is operably linked to additional segments required for DNA transcription, such as a promoter. The promoter can be any DNA sequence which shows a transcriptional activity in the chosen host cell and can be derived from genes encoding proteins either homologous or heterologous to the host cell. Examples of suitable promoters for directing the transcription of the DNA encoding the GLP-2 peptide of the invention in a variety of host cells, are well known in the art, ref. for example Sambrook et al., supra. The DNA sequence encoding the GLP-2 peptide can also, if necessary, be operably connected to an appropriate terminator, polyadenylation signals, sequences 62 transcriptional augmentations, and translational enhancer sequences. The recombinant vector of the invention may further comprise a DNA sequence that allows the vector to replicate in the host cell in question. The vector may also comprise a selectable marker, for example, a gene of the product of which the complements have a defect in the host cell or one that confers resistance to the drug, for example, ampicillin, kanamycin, tetracycline, chloramphenicol, neomycin, hygromycin or methotrexate In order to direct the peptide GLP-2 precursor of the present invention in the secretory path of the host cells, the secretory signal sequence (also known as leader sequence, prepro sequence or pre sequence) can be provided in the recombinant vector. The secretory signal sequence is linked to the DNA sequence encoding the GLP-2 peptide in the correct reading structure. The secretory signal sequences are commonly placed 5 'to the DNA sequence encoding the GLP-2 peptide. The secretory signal sequence may be that which is normally associated with the GLP-2 peptide or may be from a gene encoding another secreted protein. The procedures used to ligate the DNA sequences encoding the present GLP-2 peptides, the promoter and optionally the terminator and / or the signal sequence. secretory, respectively, and to insert them into appropriate vectors that contain the information necessary for replication, are well known to those skilled in the art (ref., for example, Sambrook et al., supra). The host cell in which the DNA sequence or the recombinant vector is introduced can be any cell that is capable of producing the GLP-2 peptides present and include bacteria, yeast, fungi and higher eukaryotic cells. Examples of appropriate host cells well known and used in the art are, without limitation, E. coli, Saccharomyces cerevisiae, or mammalian BHK or CHO cell lines. The GLP-2 derivatives of the invention can be prepared by introducing the lipophilic substituent into the parent GLP-2 peptide using methods known per se, see for example WO 95/07931, the contents of which are therefore incorporated in their entirety for reference. The NE-acylation of a Lys residue can be carried out using an activated amide of the acyl group to be introduced as the acylating agent, for example, the amide with benzotriazole. The acylation is carried out in a polar solvent in the presence of a base. Pharmaceutical Compositions Pharmaceutical compositions containing a GLP-2 derivative in accordance with the present invention can be administer parenterally to patients who need such treatment. Parenteral administration can be carried out by subcutaneous, intramuscular or intravenous injection by means of a syringe, optionally a pen-type syringe. Alternatively, parenteral administration can be carried out by means of an infusion pump. An additional option is a composition which can be a powder or a liquid for the administration of the GLP-2 derivative in the form of a nasal or pulmonary cochlea. As a still further option, the GLP-2 derivative of the invention can also be administered transdermally, for example, from a patch, optionally an iontophoretic patch, or transmucosally, for example, buccally.

The pharmaceutical compositions containing a GLP-2 derivative of the present invention can be prepared by conventional techniques, for example, as described in Remington's Pharmaceutical Sciences, 1985 or in Remington: The Science and Practice of Pharmacy, 19a. Edition, 1995. Thus, the injectable compositions of the GLP-2 derivative of the invention can be prepared using conventional techniques of the pharmaceutical industry which involve dissolving and mixing the ingredients as appropriate to give the desired final product. Thus, according to one procedure, the GLP-2 derivative is dissolved in a quantity of water which is sometimes 65 less than the final volume of the composition to be prepared.

An isotonic agent, a preservative and a buffer is added as required and the pH value of the solution is adjusted if necessary using an acid, for example, hydrochloric acid, or a base, for example, aqueous sodium hydroxide. as necessary. Finally, the volume of the solution is adjusted with water to give the desired concentration of the ingredients. Examples of isotonic agents are sodium chloride, mannitol and glycerol. Examples of preservatives are phenol, m-cresol, methyl p-hydroxybenzoate and benzyl alcohol. Examples of suitable buffer solutions are sodium acetate and sodium phosphate. In addition to the aforementioned components, solutions containing a GLP-2 derivative according to the present invention may also contain a surfactant in order to improve the solubility and / or the stability of the derivative. A correction for the nasal administration of GLP-2 can, for example, be prepared as described in European Patent No. 272097 (for Novo Nordisk A / S) or in WO 93/18785. The GLP-2 derivatives of this invention can be used in the treatment of various diseases. The particular GLP-2 derivative to be used and the optimal dose level for 66 any patient will depend on the disease to be treated and on a variety of factors including the efficacy of the specific peptide derivative employed, the age, body weight, physical activity, and diet of the patient, in a possible combination with other drugs, and in the severity of the case. It is recommended that the dose of the GLP-2 derivative of this invention be determined for each individual patient by those skilled in the art in a similar manner as for the known GLP-2 precursor peptides. The pharmacological properties of the compounds of the invention can be tested for example, as described in the International Patent Application of the present No. PCT / DK97 / 00086, WO 97/31943 the contents of which are therefore incorporated in their entirety for reference. In a further aspect the invention relates to a pharmaceutical formulation comprising a GLP-2 compound, and a buffer solution, wherein the GLP-2 compound is present in a concentration from 0.1 mg / ml to 100 mg / ml, and in wherein the formulation has a pH from 8.0 to 10. In a further aspect the invention relates to a pharmaceutical formulation comprising an aqueous solution of a GLP-2 compound, and a buffer solution, wherein the GLP-2 compound is present in a concentration from 0.1 mg / ml to 100 mg / ml, and where the formulation has a pH from 8.0 to 10. 67 In a further aspect the invention relates to a method for preparing the physically stable pharmaceutical formulation of a GLP-2 compound comprising preparing a formulation containing the GLP-2 compound, and a buffer solution, wherein the GLP-2 compound is present in a concentration from 0.1 mg / rnl to 100 mg / ml, and wherein the formulation has a pH from 8.0 to 10. In a further aspect the invention relates to a method for preparing the physically stable pharmaceutical formulation of a GLP compound -2 comprising the preparation of an aqueous solution containing the GLP-2 compound, and a buffer solution, wherein the GLP-2 compound is present in a concentration from 0.1 mg / ml to 100 mg / ml, and wherein the formulation has a pH from 8.0 to 10. In a further aspect the invention relates to a method for preparing the physically stable pharmaceutical formulation of a GLP-2 compound comprising the preparation of a formulation containing the GLP-2 compound, water, and a buffer solution, wherein the GLP-2 compound is present in a concentration from 0.1 mg / ml to 100 mg / ml, and wherein the formulation has a pH from 8.0 to 10. In a further aspect the present invention relates to a method for the treatment of intestinal insufficiency or other condition that leads to malabsorption of nutrients in the intestine, which comprises administering to a patient that it requires an effective amount of the pharmaceutical formulation comprising an aqueous solution of the GLP-2 compound, and a buffer solution, wherein the GLP-2 compound is present in a concentration from 0.1 mg / ml to 100 mg / ml, and wherein the formulation has a pH from 8.0 to 10. In one embodiment intestinal insufficiency or another condition leading to malabsorption of nutrients in the intestine is selected from the list consisting of small bowel syndrome, inflammatory bowel syndrome, Crohn's disease, colitis that includes collagen colitis, radiation colitis, chronic radiation enteritis, ulcerative colitis, tropical and non-tropical stomatitis (gluten intolerance), celiac disease (gluten-sensitive enteropathy), damaged tissue after vascular obstruction or trauma, diarrhea such as tourist diarrhea and post-infectious diarrhea, chronic intestinal dysfunction, dehydration, bacteremia, sepsis, anorexia nervosa, tissue damaged after chemotherapy for example, intestinal mucositis caused by chemotherapy, premature infants including intestinal insufficiency in premature infants, infants before birth including intestinal insufficiency in infants before birth, scleroderma, gastritis that includes atrophic gastritis, gastritis atrophic postantrectomy and gastritis due to helicobacter pylori, pancreatitis, septic shock ulcers 69 general, enteritis, cul-de-sac, lymphatic obstruction, vascular disease and graft versus host and healed after surgical procedure, atrophy after radiation and chemotherapy, weight loss in Parkinson's disease, intestinal adaptation after surgical procedure, mucosal atrophy induced by parenteral nutrition, for example mucosal atrophy induced by total parenteral nutrition (TPN) and bone-related disorders including osteoporosis, hypercalcemia of malignancy, osteopenia due to bone metastasis, periodontal disease, hyperparathyroidism, periarticular erosions in rheumatoid arthritis , Paget's disease, osteodystrophy, myositis ossificans, Bechterew's disease, malignant hypercalcemia, osteolytic lesions produced by bone metastasis, bone loss due to immobilization, bone loss due to deficiency of the sex steroid hormone, bone abnormalities due to the treatment of steroid hormone, bone abnormalities due to cancer therapeutics, osteomalacia, Bechet's disease, osteomalacia, hyperostosis, osteopetrosis, metastatic bone disease, osteopenia induced by immobilization, or osteoporosis induced by glucocorticoids. The term "an effective amount" is the effective dose to be administered by a qualified practitioner, who can titrate it to achieve the desired response. Factors in consideration of the dose will include power, 70 bioavailability, fariracokinetic / farfracc profiles < ± desired moods, condition of treatment (eg, diabetes, obesity, weight loss, gastric ulcers), factors related to the patient (eg, weight, health, age, etc.), presence of co-administered medications (eg example, insulin, administration time, or other factors known to the medical practitioner In one embodiment of the invention the pharmaceutical formulation is an aqueous formulation, that is, a formulation comprising water Such formulation is typically a solution or a suspension. In a further embodiment of the invention the pharmaceutical formulation is an aqueous solution The term "aqueous formulation" is defined as a formulation comprising at least 50% w / w of water.Similarly, the term "aqueous solution" is defined as a solution comprising at least 50% w / w of water, and the term "aqueous suspension" is defined as a suspension comprising at least 50% w / w of water. d the pharmaceutical formulation is a frozen-dried formulation, to which the doctor or patient adds the solvent before using it. In another embodiment, the pharmaceutical formulation is a lyophilized formulation to which the doctor or patient adds the solvent before using it. Pharmaceutical compositions containing a GLP-2 compound according to the present invention 71 they can be administered parenterally to patients who need such treatment. Parenteral administration can be carried out by subcutaneous, intramuscular or intravenous injection by means of a syringe, optionally a pen-type syringe. Alternatively, parenteral administration can be carried out by means of an infusion pump. An additional option is a composition which may be a solution or suspension for the administration of the GLP-2 compound in the form of a nasal or pulmonary spray. Still as a further option, the pharmaceutical compositions containing the GLP-2 compound of the invention can also be adapted for transdermal administration, for example, of n patch, optionally to an iontophoretic patch, or transmucosal administration, for example buccal. A pharmaceutical formulation is found to be physically unstable when it exhibits turbidity. Some of the present formulations may be physically stable for more than 11 months and for more than 22 months at 5 ° C. The physical stability of the formulations is evaluated by visual inspection and turbidity after storing the formulation at different temperatures in filled filled glass cartridges for various periods of time. The visual inspection of the formulations is done in a sharp focused light with a dark backing. The turbidity of the formulation is characterized by a marker 72 visual that is in the range of turbidity degree from 0 to 3 (a formulation that does not show turbidity corresponds to a visual marker of 0, and a formulation that shows a visual turbidity in daylight corresponds to a visual marker of 3) . The formulation is classified physically unstable with respect to protein aggregation, when it shows visual turbidity in daylight. In one embodiment of the invention the pharmaceutical formulation comprising the GLP-2 compound is physically stable for more than 12 weeks and for more than 15 months at 5 ° C as measured by visual inspection. In another embodiment of the invention the pharmaceutical formulation comprising the GLP-2 compound is physically stable for more than 12 weeks at 25 ° C as measured by visual inspection. In a further embodiment of the invention the pharmaceutical formulation comprising the GLP-2 compound is physically stable for more than 12 weeks at 37 ° C as measured by visual inspection. In a further embodiment of the invention the formulation has a pH in the range of 7.6 to 10. In a further embodiment of the invention the formulation has a pH in the range of 7.7 to 10. In a further embodiment of the invention the formulation has a pH in the range from 7.8 to 10. In an additional mode of the 73 invention the formulation has a pH in the range from 7.9 to 10. In a further embodiment of the invention the formulation has a pH in the range from 8.0 to 10. In a further embodiment of the invention the formulation has a pH in the range from 8.0 to 9.5. In a further embodiment of the invention the formulation has a pH in the range of 8.0 to 9.0. In a further embodiment of the invention the formulation has a pH in the range from 8.0 to 8.5. In a further embodiment of the invention the formulation has a pH in the range from 8.5 to 10. In a further embodiment of the invention the formulation has a pH in the range from 8.5 to 9.5. In a further embodiment of the invention the formulation has a pH in the range from 8.5 to 9.0. In a further embodiment of the invention the formulation has a pH in the range from 9.0 to 10. In a further embodiment of the invention the formulation has a pH in the range from 9.0 to 9.5. In a further embodiment of the invention the formulation has a pH in the range from 9.5 to 10. In a further embodiment of the invention the buffer solution is selected from the group consisting of sodium acetate, sodium carbonate, citrate, glycylglycine, histidine. , glycine, lysine, arginine, sodium diacid phosphate, disodium acid phosphate, sodium phosphate, and tris (hydroxymethyl) -aminomethane, or mixtures thereof. Each of 74 these specific buffer solutions constitute an alternative embodiment of the invention. In a further embodiment of the invention the buffer is glycylglycine, sodium diacid phosphate, disodium acid phosphate, or mixtures thereof. It is an object of the present invention to provide a pharmaceutical formulation with an increased solubility of the GLP-2 compound. In a further embodiment of the invention the GLP-2 compound is present in a concentration from 0.1 mg / ml to 80 mg / ml. In a further embodiment of the invention the GLP-2 compound is present in a concentration from 1 mg / ml to 80 mg / ml. In a further embodiment of the invention the GLP-2 compound is present in a concentration from 0.1 mg / ml to 50 mg / ml. In a further embodiment of the invention the GLP-2 compound is present in a concentration from 1 mg / ml to 50 mg / ml. In a further embodiment of the invention the GLP-2 compound is present in a concentration from 0.1 mg / ml to 20 mg / ml. In a further embodiment of the invention the GLP-2 compound is present in a concentration from 1 mg / ml to 20 mg / ml. In a further embodiment of the invention the GLP-2 compound is present in a concentration from 0.1 mg / ml to 10 mg / ml. In a further embodiment of the invention the GLP-2 compound is present in an concentration from 1 mg / ml to 10 mg / ml. In a further embodiment of the invention the GLP-2 compound is present in a concentration from 0.1-5 mg / ml. In a further embodiment of the invention the GLP-2 compound is present in a concentration of 1-5 mg / ml. In a further embodiment of the invention the GLP-2 compound is present in a concentration from 0.1-0.5 mg / ml. In a further embodiment of the invention the GLP-2 compound is present in a concentration from 0.6-1 mg / ml. Each of these specific concentrations constitutes a range in an alternative embodiment of the invention. In a further embodiment of the invention the additional formulation comprises an acceptable pharmaceutical preservative. In a further embodiment of the invention the preservative is selected from the group consisting of phenol, m-cresol, methyl p-hydroxybenzoate, propyl p-hydroxybenzoate, 2-phenoxyethanol, butyl p-hydroxybenzoate, 2-phenylethanol, benzyl alcohol, chlorobutanol, and thimerosal, or mixtures thereof. Each of these specific preservatives constitutes an alternative embodiment of the invention. In a preferred embodiment of the invention, the preservative is phenol or m-cresol.

In a further embodiment of the invention the preservative is present in a concentration from 0.1 mg / ml to 20 mg / ml. In a further embodiment of the invention the preservative is present in a concentration 76 from 0.1 mg / ml to 5 mg / ml. In a further embodiment of the invention the preservative is present in a concentration from 5 mg / ml to 10 mg / ml. In a further embodiment of the invention the preservative is present in a concentration from 10 mg / ml to 20 mg / ml. Each of these specific concentration ranges constitutes an alternative embodiment of the invention. The use of a preservative in pharmaceutical compositions is well known to the skilled person. For convenience, reference is made to Remington: The Science and Practice of Pharmacy, 19th edition, 1995. In a further embodiment of the invention the additional formulation comprises an isotonic agent. In a further embodiment of the invention the isotonic agent is selected from the group consisting of a salt (eg, sodium chloride), a polyhydric alcohol (eg, propylene glycol, xylitol, mannitol, sorbitol or glycerol), a monosaccharide (eg, example, glucose or maltose), a disaccharide (e.g., sucrose), an amino acid (e.g., L-glycine, L-histidine, arginine, lysine, isoleucine, aspartic acid, tryptophan, threonine), polyethylene glycol (e.g., PEG400 ), or mixtures thereof. In a further embodiment of the invention the isotonic agent is selected from the group consisting of sodium chloride, glycerol, mannitol, glucose, sucrose, L-glycine, L-histidine, arginine, lysine or mixtures thereof. Each of these specific isotonic agents constitutes an alternative embodiment of the invention. In embodiments of the invention the isotonic agent is mannitol. In embodiments of the invention the isotonic agent is glycerol. In embodiments of the invention, the isotonic agent is sucrose. In a further embodiment of the invention the isotonic agent is present in a concentration from 1 mg / ml to 50 mg / ml. In a further embodiment of the invention the isotonic agent is present in a concentration from 1 mg / ml to 7 mg / ml. In a further embodiment of the invention the isotonic agent is present in a concentration from 8 mg / ml to 16 mg / ml. In a further embodiment of the invention the isotonic agent is present in a concentration from 17 mg / ml to 50 mg / ml. Each of these specific concentration ranges constitutes an alternative embodiment of the invention. The use of an isotonic agent in pharmaceutical compositions is well known to the skilled person. For convenience, reference is made to Remington: The Science and Practice of Pharmacy, 19TH Edition, 1995. In a further embodiment of the invention the additional formulation comprises a glue agent. In a further embodiment of the invention the chelating agent is selected from salts of ethylenediaminetetraacetic acid 78 (EDTA), citric acid, and aspartic acid, and mixtures thereof. Each of these specific chelating agents constitutes an alternative embodiment of the invention. In a further embodiment of the invention the chelating agent is present in a concentration from 0. 1 mg / ml to 5 mg / ml. In a further embodiment of the invention the chelating agent is present in a concentration from 0.1 mg / ml to 2 mg / ml. In a further embodiment of the invention the chelating agent is present in a concentration from 2mg / ml to 5mg / ml. The use of a chelating agent in pharmaceutical compositions is well known to the skilled person. For convenience, reference is made to Remington: The Science and Practice of Pharmacy, 19th Edition, 1995. In a further embodiment of the invention the additional formulation comprises a stabilizer selected from the group consisting of high molecular weight polymers or low molecular compounds. In a further embodiment of the invention the stabilizer is selected from polyethylene glycol (e.g., PEG 3350), polyvinylalcohol (PVA), polyvinylpyrrolidone, carboxymethyl cellulose, different salts (e.g., sodium chloride), L-glycine, L-histidine , imidazole, arginine, lysine, isoleucine, aspartic acid, tryptophan, threonine and mixtures thereof. Each of these specific stabilizers constitutes a modality alternative of the invention. In a preferred embodiment of the invention the stabilizer is selected from the group consisting of L-histidine, imidazole and arginine. In a further embodiment of the invention the high molecular weight polymer is present in a concentration from 0.1 mg / ml to 50 mg / ml. In a further embodiment of the invention the high molecular weight polymer is present in a concentration from 0.1 mg / ml to 5 mg / ml. In a further embodiment of the invention the high molecular weight polymer is present in a concentration from 5mg / ml to 10mg / ml. In a further embodiment of the invention the high molecular weight polymer is present in a concentration from 10mg / ml to 20mg / ml. In a further embodiment of the invention the high molecular weight polymer is present in a concentration from 20 mg / ml to 30 mg / ml. In a further embodiment of the invention the high molecular weight polymer is present in a concentration from 30mg / ml to 50mg / ml. In a further embodiment of the invention the low molecular weight compound is present in a concentration from 0.1 mg / ml to 50 mg / ml. In a further embodiment of the invention the low molecular weight compound is present in a concentration from 0.1 mg / ml to 5 mg / ml. In a further embodiment of the invention the low molecular weight compound is present in a concentration from 80 5mg / ml up to 10mg / ml. In a further embodiment of the invention the low molecular weight compound is present in a concentration from 10mg / ml to 20mg / ml. In a further embodiment of the invention the low molecular weight compound is present in a concentration from 20 mg / ml to 30 mg / ml. In a further embodiment of the invention the low molecular weight compound is present in a concentration from 30mg / ml to 50mg / ml. The use of a stabilizer in pharmaceutical compositions is well known to the skilled person. For convenience, reference is made to Remington: The Science and Practice of Pharmacy, 19th edition, 1995. In a further embodiment of the invention the formulation further comprises a surfactant. In a further embodiment of the invention the surfactant is selected from a detergent, ethoxylated castor oil, polyglycolized glycerides, acetylated monoglycerides, sorbitan fatty acid esters, poloxamers, such as 188 and 407, polyoxyethylene sorbitan fatty acid esters, derivatives polyoxyethylene such as alkylated and alkoxylated derivatives (tweens, e.g., Tween-20, or Tween-80), monoglyceride or ethoxylated derivatives thereof, diglyceride or polyoxyethylene derivatives thereof, glycerol, cholic acid or derivatives thereof. same, lecithins, alcohols and phospholipids, glycerophospholipids (lecithins, cefaliñas, 81 phosphatidyl serine), glyceroglycolipids (galactopyransoid), sphingofosfollpidos (sphingomyelin), and sphingoglycolipids (ceramides, gangliosides), DSS (doped sodium, CAS record no [577-11-7]), doped calcium, CAS record no [128-49- 4]), doped potassium, CAS record no [7491-09-0]), SDS (sodium dodecyl sulfate or sodium lauryl sulfate), dipalmitoyl phosphatidic acid, sodium caprylate, bile acids and salts thereof and conjugates of glycine or taurine, ursodeoxycholic acid, sodium cholate, sodium deoxycholate, sodium taurocholate, sodium glycocholate, N-hexadecyl-N, -dimethyl-3-ammonium-1-propanesulfonate, monovalent anionic surfactants (alkyl aryl sulfonates) ), palmitoyl lysophosphatidyl-L-serine, lysophospholipids (for example, esters of l-acyl-sn-glycero-3-ethanolamine phosphate, choline, serine or threonine), alkyl derivatives, alkoxy, (alkyl ester), alkoxy ( alkyl ester) of lysophosphatidyl and phosphatidylcholine, for example, derivatives of lauroyl and miristoil of lysophosphatidylcholine, dipalmitoylphosphatidylcholine, and modifications of the polar major group, which is hills, ethanolamines, phosphatidic acid, serines, threonines, glycerol, inositol, and DODAC, DOTMA, DCP, BISHOP, lysophosphatidylserine and lysophosphatidyltreonine positively charged, surfactants zwitterionics (for example, N-alkyl-N, N-dimethylammonium-l-propanesulfonates, 3-colamido-l-82 propyldimethylammonium-1-propansulfonate, dodecylphosphocholine, myristoyl lysophosphatidylcholine, chicken egg lysolecithin), cationic surfactants (quaternary ammonium bases) (eg, cetyltrimethylammonium bromide, cetylpyridinium chloride), nonionic surfactants, block copolymers of polyethylene oxide / polypropylene oxide (Pluronics / Tetronics, Triton X-100, Dodecyl ß-D-glucopyranoside) or polymeric surfactants (Tween-40, Tween-80, Brij-35), fusidic acid derivatives (for example , sodium tauro-dihydrofusidate, etc.), long-chain fatty acids and salts thereof C6-C12 (for example, oleic acid and caprylic acid), acylcarnitines and derivatives, derivatives of lysine, arginine or histidine IS ^ -acilates, or side chain acylated lysine or arginine derivatives, N-acylated dipeptide derivatives comprising any combination of lysine, arginine or histidine and a neutral or acidic amino acid, derivatives -a Crystals of a tripeptide comprising any combination of a neutral amino acid and two charged amino acids, or the surfactant may be selected from the group consisting of imidazoline derivatives, or mixtures thereof. Each of these specific surfactants constitutes an alternative embodiment of the invention. The use of a surfactant in pharmaceutical compositions is well known to the skilled person. For convenience, 83 reference is made to Remington: The Science and Practice of Pharmacy, 19TH Edition, 1995. In one embodiment of the invention the pharmaceutical formulation comprising the GLP-2 derivative is physically stable for more than 12 weeks and for more than 15 months at 5 weeks. ° C as measured by visual inspection. In another embodiment of the invention the pharmaceutical formulation comprising the GLP-2 derivative is physically stable for more than 12 weeks at 25 ° C as measured by visual inspection. In a further embodiment of the invention the pharmaceutical formulation comprising the GLP-2 derivative is physically stable for more than 12 weeks at 37 ° C as measured by visual inspection. In a further embodiment of the invention the formulation comprising the GLP-2 derivative has a pH in the range from 7.0 to 10. In a further embodiment of the invention the formulation comprising the GLP-2 derivative has a pH in the range from 7.0 to 9.5. In a further embodiment of the invention the formulation comprising the GLP-2 derivative has a pH in the range of 7.0 to 9.0. In a further embodiment of the invention the formulation comprising the GLP-2 derivative has a pH in the range of 7.0 to 8.5. In a further embodiment of the invention the formulation comprising the GLP-2 derivative has a pH at 84 range from 7.0 to 8.0. In a further embodiment of the invention the formulation comprising the GLP-2 derivative has a pH in the range of 7.0 to 7.5. In a further embodiment of the invention the formulation comprising the GLP-2 derivative has a pH in the range of 7.5 to 10. In a further embodiment of the invention the formulation comprising the GLP-2 derivative has a pH in the range from 8.0 to 10. In a further embodiment of the invention the formulation comprising the GLP-2 derivative has a pH in the range from 8.5 to 10. In a further embodiment of the invention the formulation comprising the GLP-2 derivative has a pH in the range from 9.0 to 10. In a further embodiment of the invention the formulation comprising the GLP-2 derivative has a pH in the range from 9.5 to 10. In a further embodiment of the invention the formulation comprising the GLP-derivative 2 has a pH in the range from 7.5 to 9.5. In a further embodiment of the invention the formulation comprising the GLP-2 derivative has a pH in the range of 7.5 to 9.0. In a further embodiment of the invention the formulation comprising the GLP-2 derivative has a pH in the range of 7.5 to 8.5. In a further embodiment of the invention the formulation comprising the GLP-2 derivative has a pH in the range of 7.5 to 8.0. In a further embodiment of the invention the formulation comprising the GLP-2 derivative has a pH in the range of 8.0 85 up to 9.5. In a further embodiment of the invention the formulation comprising the GLP-2 derivative has a pH in the range of 8.0 to 9.0. In a further embodiment of the invention the formulation comprising the GLP-2 derivative has a pH in the range of 8.0 to 8.5. In a further embodiment of the invention the formulation comprising the GLP-2 derivative has a pH in the range from 8.5 to 9.5. In a further embodiment of the invention the formulation comprising the GLP-2 derivative has a pH in the range from 8.5 to 9.0. In a further embodiment of the invention the formulation comprising the GLP-2 derivative has a pH in the range from 9.0 to 9.5. It is an object of the present invention to provide a pharmaceutical formulation with an increased solubility of the GLP-2 derivative. In a further embodiment of the invention the GLP-2 derivative is present in a concentration from 0.1 mg / ml to 80 mg / ml. In a further embodiment of the invention the derivative GLP-2 is present in a concentration from 1 mg / ml to 80 mg / ml. In a further embodiment of the invention the GLP-2 derivative is present in a concentration from 0.1 mg / ml to 50 mg / ml. In a further embodiment of the invention the GLP-2 derivative is present in a concentration from 1 mg / ml to 50 mg / ml. In a further embodiment of the invention the GLP-2 derivative is 86 present in a concentration from 0.1 mg / ml to 20 mg / ml. In a further embodiment of the invention the GLP-2 derivative is present in a concentration from 1 mg / ml to 20 mg / ml. In a further embodiment of the invention the GLP-2 derivative is present in a concentration from 0.1 mg / ml to 10 mg / ml. In a further embodiment of the invention the GLP-2 derivative is present in a concentration from 1 mg / ml to 10 mg / ml. In a further embodiment of the invention the GLP-2 derivative is present in a concentration from 0.1-5 mg / ml. In a further embodiment of the invention the GLP-2 derivative is present in a concentration of 1-5 mg / ml. In a further embodiment of the invention the GLP-2 derivative is present in a concentration from 0.1-0.5 mg / ml. In a further embodiment of the invention the GLP-2 derivative is present in a concentration from 0.6-1 mg / ml. Each of these specific concentrations constitutes ranges an alternative embodiment of the invention. In the present context the GLP-2 compound and the GLP-2 derivative bind to a GLP-2 receptor, preferably with an affinity constant (KD) or a power (EC50) of below 1 μ ?, for example, below of 100 nM. The term "GLP-2 compound" encompasses GLP-2 peptides as well as GLP-2 derivatives. Examples of such GLP-2 compounds which can be used in the present formulation, have been described in, for example, WO 87 96/29342, WO 97/31943, WO 98/08872, O 96/32414, WO 97/39031, which are incorporated, by way of reference, for reference. The candidate GLP-2 compounds, which may be used in accordance with the present invention, may be, for example, the GLP-2 analogs as described in WO 96/32414, WO 97/39031, WO 98/03547, GLP-2 derivatives as described in WO 96/29342, WO 97/31943, WO 98/08872, incorporated herein by reference. In one embodiment of the invention the GLP-2 compound is a GLP-2 derivative comprising a GLP-2 peptide, wherein a lipophilic substituent is linked to one or more amino acid residues at a position relative to the amino acid sequence of SEQ ID NO: 1 selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L14, D15, N16, L17, A18, D21, N24, and Q28. In one embodiment a lipophilic substituent is linked to amino acid residues at the S5 position relative to the amino acid sequence of SEQ ID NO: 1. In one embodiment a lipophilic substituent is linked to amino acid residues at the S7 position relative to the amino acid sequence of SEQ ID NO: 1. In one embodiment a lipophilic substituent is linked to amino acid residues at the D8 position relative to the amino acid sequence of SEQ ID NO: 1. In a mode a lipophilic substituent is bound to residues of amino acids at position E9 relative to the amino acid sequence of SEQ ID NO: 1. In a modality a substituent Lipophilic binds to amino acid residues at the MIO position relative to the amino acid sequence of SEQ ID NO: 1. In one embodiment a lipophilic substituent is linked to amino acid residues at the Nll position relative to the amino acid sequence of SEQ. ID NO: 1. In one embodiment a lipophilic substituent is linked to amino acid residues at the T12 position relative to the amino acid sequence of SEQ ID NO: 1. In one embodiment a lipophilic substituent is linked to amino acid residues at the position 113 in relation to the amino acid sequence of SEQ ID NO: 1. In one embodiment a lipophilic substituent is linked to amino acid residues at the L14 position relative to the amino acid sequence of SEQ ID NO: 1. In one embodiment a substituent lipophilic is bound to amino acid residues at position D15 relative to the amino acid sequence of SEQ ID NO: 1. In a mode a lipophilic substituent is linked to amino acid residues at position N16 in relation to the amino acid sequence of SEQ ID NO: 1. In one embodiment a lipophilic substituent is linked to amino acid residues at the L17 position relative to the amino acid sequence of SEQ ID NO: 1. In one embodiment a lipophilic substituent is linked to amino acid residues at the Al8 position relative to to the amino acid sequence of SEQ ID NO: 1. In one embodiment a lipophilic substituent is linked to amino acid residues at position D21 in relation to the amino acid sequence of SEQ ID NO: 1. In one embodiment a substituent lipophilic is linked to amino acid residues at the N24 position relative to the amino acid sequence of SEQ ID NO: 1. In one embodiment a lipophilic sutuent is linked to amino acid residues at the Q28 position relative to the amino acid sequence of SEQ. ID NO: 1. It will be understood that an amino acid residue at the position relative to the amino acid sequence of SEQ ID NO: 1 can be any amino acid residue and not only the amino acid residue naturally present in that position. In one embodiment the lipophilic sutuent is linked to a lysine. In a further alternative, the lipophilic sutuent can be linked to the GLP-2 peptide by means of a spacer such that a carboxyl group of the spacer forms an amide bond with an amino group of the GLP-2 peptide. A spacer should contain at least two functional groups, one linked to the functional group of the lipophilic sutuent and the other to a functional group of the precursor GLP-2 peptide. The term "spacer" is used in the present text to designate a bivalent amount which contains at least two functional groups, one linked to the functional group of the lipophilic sutuent and the other to a functional group of the GLP-2 compound. Examples of suitable spacers are succinic acid, lysyl, glutamyl, asparagyl, glycyl, beta-alanyl and gamma-aminobutanoyl, or a dipeptide such as Gly-Lys, each of 90 which constitutes an individual modality. When the spacer is succinic acid, a carboxyl group thereof can form an amide bond with an amino group of the amino acid residue, and the other carboxyl group thereof can form an amide bond with an amino group of the lipophilic sutuent. When the spacer is lysyl, glutamyl, asparagyl, glycyl, beta-alanyl or gamma-aminobutanoyl, the carboxyl group thereof can form an amide bond with an amino group of the amino acid residue, and the amino group thereof can form an amide bond with a carboxyl group of the lipophilic sutuent. When Lys is used as the spacer, an additional spacer can, in some cases, be inserted between the Lys e-amino group and the lipophilic sutuent. In a preferred embodiment, such additional spacer is succinic acid which forms an amide bond with the e-amino group of Lys and with an amino group present in the lipophilic sutuent. In another preferred embodiment such additional spacer is Glu or Asp which forms an amide bond with the e-amino group of Lys and another amide bond with a carboxyl group present in the lipophilic sutuent, that is, the lipophilic sutuent is an Is- acylated lysine. In one embodiment, the spacer is an amino acid residue except Cys or Met, or a dipeptide such as Gly-Lys. For purposes of the present invention, the phrase "a 91"dipeptide such as Gly-Lys" means any combination of two amino acids except Cys or Met, typically a dipeptide wherein the C-terminal amino acid residue is Lys, His or Trp, typically Lys, and the N-terminal amino acid residue is Ala , Arg, Asp, Asn, Gly, Glu, Gln, Fie, Leu, Val, Phe, Pro, Ser, Tyr, Thr, Lys, His and Trp Typically, an amino group of the GLP-2 compound forms an amide bond with a carboxylic group of the amino acid residue or dipeptide spacer, and an amino group of the amino acid residue or dipeptide spacer forms an amide bond with a carboxyl group of the lipophilic sutuent In a further embodiment of the invention the lipophilic sutuent has from 8 to 40 carbon atoms In a further embodiment of the invention the lipophilic sutuent has from 10 to 24 carbon atoms In a further embodiment of the invention the lipophilic sutuent has from 12 to 24 carbon atoms. Additionality of the invention The lipophilic sutuent has from 12 to 18 carbon atoms. In a further embodiment of the invention the lipophilic sutuent has from 14 to 18 carbon atoms. In a further embodiment of the invention the spacer is present. In a further embodiment of the invention the spacer is selected from an amino acid. In a further embodiment of the invention, the spacer is a residue of 92 amino acid except Cys or Met. In another embodiment, the spacer is a dipeptide such as Gly-Lys. In a further embodiment the spacer is selected from lysyl, glutamyl, asparagyl, glycyl, beta-alanyl and gamma-aminobutanoyl, each of which constitutes an individual embodiment. Typically the spacers used are glutamyl, aminobutyroyl, and beta-alanyl (beta-Ala). In another embodiment, the spacer is a non-branched α, β-dicarboxylic alkane group having from 1 to 7 methylene groups, which spacer forms a bridge between an amino group of the precursor peptide and an amino group of the lipophilic substituent. Typically, the spacer is succinic acid. The lipophilic substituents contain a functional group which can be linked to one of the following groups of an amino acid of the precursor GLP-2 peptide: (a) amino group bonded to the alpha carbon of the N-terminal amino acid, (b) the linked carboxy group to the alpha carbon of the terminal amino acid C, (c) epsilon-amino group of any residue Lys, (d) carboxy group of the R group of any duo Asp and Glu, (e) the hydroxy group of the R group of any 93 residue Tyr, Ser and Thr (f) the amino group of the R group of any residue Trp, Asn, Gln, Arg, and His, or (g) the thiol group of the R group of any Cys residue. In a further embodiment of the invention, the lipophilic substituent is linked to the carboxy group of the R group of any Asp and Glu residue. In a further embodiment of the invention, a lipophilic substituent is linked to the carboxy group bonded to the alpha carbon of the C-terminal amino acid. In a further embodiment of the invention, a lipophilic substituent is linked to the epsilon-amino group of any Lys residue. Each lipophilic substituent contains a functional group which can be linked to a functional group of an amino acid of the precursor GLP-2 peptide. For example, a lipophilic substituent can contain a carboxyl group which can be linked to an amino group of the precursor GLP-2 peptide via an amide bond. In a further embodiment of the invention, the lipophilic substituent comprises a partially or fully hydrogenated cyclopentane phenanthrene skeleton. In a further embodiment of the invention, the lipophilic substituent is a straight or branched chain alkyl group. 94 In a further embodiment of the invention, the lipophilic substituent is an acyl group of the straight or branched chain fatty acid. In a further embodiment of the invention the lipophilic substituent is an acyl group having the formula CH3 (CH2) NCO-, wherein n is an integer from 4 to 38. In a further embodiment n is an integer from 12 to 38. In additional embodiments the lipophilic substituent is selected from the following individual embodiments CH3 (CH2) 12C0-, CH3 (CH2) 14CO-, CH3 (C¾) i6CO-, CH3 (CH2) 1BC0-, CH3 (CH2) 20CO- and CH3 (CH2) ) 22CO-. In a specific embodiment, the lipophilic substituent is tetradecanoyl. In another specific embodiment, the lipophilic substituent is hexadecanoyl. In another embodiment of the present invention, the lipophilic substituent has a group which is negatively charged such as a carboxylic acid group. For example, the lipophilic substituent can be an acyl group of a straight or branched chain alkane dicarboxylic acid of the formula HOOC (CH2) mCO-, wherein m is an integer from 4 to 38, preferably an integer from 12 to 38, and more preferably it is HOOC (CH2) 14CO-, HOOC (C¾) i6CO-, HOOC (CH2) 18CO-, HOOC (CH2) 20CO- or HOOC (CH2) 22CO-.

Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of lmg / ml of L17 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml mannitol, and 5mg / ml phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml mannitol, and 5mg / ml phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), 96 disodium acid phosphate, 36.9mg / ml mannitol, and 5mg / ml phenol, at pH 8.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at pH 8.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at pH 8.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml L17K (3- (hexadecanoylamino) pyrionyl) / 30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at pH 8.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5 mg / ml of phenol, at pH 8.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml mannitol, 5mg / ml phenol, and 1.55mg / ml L-His, at pH 8.0 Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of sodium mg / ml L17K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2- (1-33), disodium acid phosphate, 36.9 mg / ml mannitol, 5 mg / ml phenol, and 1.55 mg / ml L-His, at a pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), 98 disodium acid phosphate, 36.9 mg / ml mannitol, 5 mg / ml phenol, and 1.55 mg / ml L-His, at pH 8.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at pH 8.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at pH 8.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at pH 8.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at pH 8.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, and 5 mg / ml phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml of glycerol, and 5 mg / ml of phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml of glycerol, and 5 mg / ml of phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) ropionil) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml of glycerol, and 7 mg / ml of phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), dithioxide acid phosphate, 16.0 mg / ml of glycerol, and 7 mg / ml of phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), 100 disodium acid phosphate, 16.0 mg / ml glycerol, and 7 mg / ml phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), glycylglycine, 16.0 mg / ml of glycerol, and 5mg / ml phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) pyrionyl) / K30R-GLP-2 (1-33), glycylglycine, 16.0 mg / ml of glycerol, and 5mg / ml phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycylglycine, 16.0 mg / ml of glycerol, and 5mg / ml phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), glycylglycine, 16.0 mg / ml glycerol, and 7 mg / ml phenol, at an H 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) pyrionyl) / K30R-GLP-2 (1-33), glycylglycine, 16.0 mg / ml of glycerol, and 7 mg / ml phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycylglycine, 16.0mg / ml of glycerol, and 7 mg / ml phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 17.0mg / ml of mannitol, and 18mg / ml of benzyl alcohol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 17.0mg / ml of mannitol, and 18mg / ml of benzyl alcohol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / sodium diacid phosphate, 17.0 mg / ml mannitol, and 18mg / ml of benzyl alcohol, at an H 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 17.0mg / ml of mannitol, and 18mg / ml of benzyl alcohol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate sodium, 38.5mg / ml mannitol, and either 3mg / ml m-cresol or 1.5mg / ml phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml L17K (3 ~ (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate sodium, 38.5mg / ml mannitol, and either 3mg / ml m-cresol or 1.5mg / ml phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate sodium, 38.5mg / ml mannitol, and either 3mg / ml m-cresol or 1.5mg / ml phenol, at pH 8.0. 103 Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K3OR-GLP-2 (1-33), disodium acid phosphate / diacid phosphate sodium, 38.5mg / ml mannitol, and either 3mg / ml m-cresol or 1.5mg / ml phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium phosphate / phosphate sodium diacid, 17.0 mg / ml mannitol, and 18 mg / ml benzyl alcohol, at pH 8.8. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 17. Omg / ml of mannitol, and 18 mg / ml of benzyl alcohol, at a pH of 8.8. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 17. Omg / ml of mannitol, and 18 mg / ml of benzyl alcohol, at a pH of 8.8. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), 104 disodium acid phosphate / sodium diacid phosphate, 17.0 mg / ml of raanitol, and 18 mg / ml of benzyl alcohol, at pH 8.8. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, and 5mg / ml of phenol, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, and 5mg / ml of phenol, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, and 5mg / ml of phenol, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17 (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, and 5mg / ml of phenol, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9mg / ml mannitol, 5mg / ml phenol, and either lmg / ml EDTA or 1.55mg / ml L-His, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), glycine, 36.9mg / ml of mannitol, 5mg / ml phenol, and 1mg / ml EDTA / l .55mg / ml L-His, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 5 mg / ml phenol, and 1.55 mg / ml L-His, at pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 5 mg / ml phenol, and 1.55 mg / ml L-His, at pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 5 mg / ml phenol, and 1.55 mg / ml L-His, at pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), 106 disodium acid phosphate, 16.0 mg / ml glycerol, 7 mg / ml phenol, and 1.55 mg / ml L-His, at pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 7 mg / ml phenol, and 1.55 mg / ml L-His, at pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 7 mg / ml phenol, and 1.55 mg / ml L-His, at pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 5 mg / ml phenol, and either 1 mg / ml EDTA or 1.55 mg / ml L-His, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 5 mg / ml phenol, and either 1 mg / ml EDTA or 1.55 mg / ml L-His, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) pyrionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml mannitol, 5mg / ml phenol, and either 4mg / ml Poloxamer 188 or 30mg / ml PEG 35000, at pH 9.4.

Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 5 mg / ml phenol, and either 4 mg / ml Poloxamer 188 or 30 mg / ml PEG 35000, at pH 9.4.

Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 5mg / ml phenol, and either 4mg / ml Poloxamer 188 or 30mg / ml PEG 35000, at pH 9.4.

Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 5mg / ml phenol, and either 4mg / ml Poloxamer 188 or 30mg / ml PEG 35000, at pH 9.4.

Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0mg / ml of glycerol, and 7mg / ml of phenol, at a pH of 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, and 7 mg / ml phenol, at pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), disodium acid phosphate, 16.0mg / ml of glycerol, and 7mg / ml of phenol, at a pH of 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, lS. Omg / ml of glycerol, and 7mg / ml of phenol, at a pH of 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0mg / ml of glycerol, and 7mg / ml of phenol, at a pH of 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of 'L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9 mg / ml mannitol, and 5mg / ml phenol, at pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of raanitol, and 5mg / ml of phenol, at a pH of 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 < l-33), disodium acid phosphate, 36.9mg / ml mannitol, and 5mg / ml phenol, at pH 8.. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at a pH of 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml of L17 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at a pH of 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, -36.9 mg / ml mannitol, 5 mg / ml phenol, and 1.55 mg / ml L-His, at pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml mannitol, 5mg / ml phenol, and 1.55mg / ml L-His, at pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at a pH of 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 3S. 9mg / ml mannitol, 5mg / ml phenol, and 1.55mg / ml L-His, at pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at a pH of 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), 111 disodium acid phosphate, 36.9mg / ml of raanitol, and 5mg / ml of phenol, at a H 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17 (3- (hexadecyloxylamino) propionyl) / K30R-GLP-2 (1-33), disodium phosphate acid, 36.9mg / ml of raanitol, and 5mg / ml of phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml of L17 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at a pH of 7.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml mannitol, and 5mg / ml phenol, at pH 7.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at a pH of 7.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at a pH of 7.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at a pH of 7.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9 mg / ml mannitol, 5 mg / ml phenol, and 1.55 mg / ml L-His, at 7.0 H. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) pyrionyl) K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at a pH of 7.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml mannitol, 5mg / ml phenol, and 1.55mg / ml L-His, at pH 7.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at a pH of 7.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at a pH of 7.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at a pH of 7.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml of glycerol, and 5 mg / ml of phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), 115 disodium acid phosphate, 16.0 mg / ml glycerol, and 5 mg / ml phenol, at a 7.0 H. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2- (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, and 5 mg / ml phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) ropionil) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml of glycerol, and 7 mg / ml of phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml L17K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml of glycerol, and 7 mg / ml of phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml of glycerol, and 7 mg / ml of phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml mannitol, and 5mg / ml phenol, at 7.0 H. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17 (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), glycylglycine, 16.0 mg / ml of glycerol, and 5mg / ml phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycylglycine, 16.0 mg / ml of glycerol, and 5mg / ml phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycylglycine, 16.0 mg / ml of glycerol, and 5mg / ml phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycylglycine, 16.0 mg / ml of glycerol, and 7 mg / ml phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) pyrionyl) / K30R-GLP-2 (1-33), glycylglycine, 16.0 mg / ml of glycerol, and 7 mg / ml phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml. of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycylglycine, 16.0 mg / ml of glycerol, and 7 mg / ml of phenol, at a H 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 17.0 mg / ml of mannitol, and 18 mg / ml of benzyl alcohol, at a pH of 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 17.0mg / ml of mannitol, and 18mg / ml of benzyl alcohol, at a pH of 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 17.0mg / ml of mannitol, and 18mg / ml of benzyl alcohol, at a pH of 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium hydrogen phosphate / diacid phosphate of sodium, 17.0mg / ml of mannitol, and I8mg / ml of benzyl alcohol, at a pH of 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml 118 of Ll7K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium hydrogen phosphate / sodium diacid phosphate, 38.5mg / ml mannitol, and either 3tng / ml m-cresol or 1.5mg / ml phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 38.5mg / ml of mannitol, and either 3trg / ml of m-cresol or 1.5mg / ml of phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylanu.no) propionyl) / K30R-GLP-2 (1-33), disodium phosphate / sodium diacid phosphate, 38.5mg / ml mannitol, and either 3mg / ml m-cresol or 1.5mg / ml phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) prcpionyl) / 30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate sodium, 38.5mg / ml mannitol, and either 3mg / ml m-cresol or 1.5mg / ml phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium phosphate / phosphate sodium diacid, 17.0 mg / ml mannitol, and 18 mg / ml benzyl alcohol, at pH 7.8. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml 119 of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / sodium diacid phosphate, 17.0mg / ml mannitol, and 18mg / ml benzyl alcohol, at a pH 7.8. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33), disodium hydrogen phosphate / diacid phosphate of sodium, 17.0mg / ml of mannitol, and 18mg / ml of benzyl alcohol, at a pH of 7.8. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml L17 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 17.0mg / ml of mannitol, and 18mg / ml of benzyl alcohol, at a pH of 7.8. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33), glycine, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, and 5mg / ml of phenol, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, and 5rg / ml of phenol, at pH 9.4. 120 Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, and 5mg / ml of phenol, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9mg / ml of mannitol, 5mg / ml phenol, and either lmg / ml EDTA or 1.55mg / ml L-His, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 5mg / ml phenol, and lmg / ml EDTA / 1.55mg / ml L-His, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 5 mg / ml phenol, and 1.55 mg / ml L-His, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 5 mg / ml phenol, and 1.55 mg / ml L-His, at pH 7.4. Typically, the invention relates to a formulation 121 Pharmaceutical consisting of an aqueous solution of 5 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 5 mg / ml phenol, and 1.55 mg / ml of L-His, at a pH of 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 7 mg / ml phenol, and 1.55 mg / ml L-His, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 7 mg / ml phenol, and 1.55 mg / ml L-His, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 7 mg / ml phenol, and 1.55 mg / ml L-His, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) pyrionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 5mg / ml phenol, and either lmg / ml EDTA or 1.55mg / ml L-His, at pH 9.4. Typically, the invention relates to a formulation 122 Pharmaceutical consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K3OR-GLP-2 (1-33), glycine, 36.9mg / ml of mannitol, 5mg / ml of phenol, and either 1 mg / ml EDTA or 1.55mg / ml L-His, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9mg / ml of mannitol, 5mg / ml phenol, and either 4mg / ml Poloxamer 188 or 30mg / ml PEG 35000, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), glycine, 36.9mg / ml of mannitol, 5mg / ml phenol, and either 4mg / ml Poloxamer 188 or 30mg / ml PEG 35000, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 5mg / ml phenol, and either 4mg / ml Poloxamer 188 or 30mg / ml PEG 35000, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K3OR-GLP-2 (1-33), glycine, 36.9mg / ml of mannitol, 5mg / ml phenol, and either 4mg / ml Poloxamer 188 or 30mg / ml PEG 35000, at pH 9.4. Typically, the invention relates to a formulation 123 Pharmaceutical consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, and 7 mg / ml of phenol, at a pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0mg / ml of glycerol, and 7mg / ml of phenol, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0mg / ml of glycerol, and 7mg / ml of phenol, at a pH of 7.. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0mg / ml of glycerol, and 7mg / ml of phenol, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0mg / ml of glycerol, and 7mg / ml of phenol, at pH 7.4. Typically, the invention relates to a formulation 124 Pharmaceutical consisting of a 1 mg / ml aqueous solution of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml mannitol, and 5mg / ml of phenol, at a pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at pH 7.4.

Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, and 5mg / ml of phenol, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), 125 disodium acid phosphate, 36.9 mg / ml mannitol, 5 mg / ml phenol, and 1.55 mg / ml L-His, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 3S. 9mg / ml mannitol, 5mg / ml phenol, and 1.55mg / ml L-His, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml of L17K (3- (hexadecanoylamino) pyrionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), 126 disodium acid phosphate, 36.9 mg / ml mannitol, 10 mg / ml sucrose, and 5 mg / ml phenol, at 8.0 H. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2- (1-33), disodium acid phosphate, 36.9 rng / ml mannitol, 10 mg / ml sucrose, and 5 mg / ml phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9 mg / ml mannitol, 10 mg / ml sucrose, and 5 mg / ml phenol, at pH 8.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at a pH of 8.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K3 OR-GLP-2 (1-33), disodium acid phosphate, 36.9 mg / ml mannitol, 10 mg / ml sucrose, and 5 mg / ml phenol, at pH 8.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at a pH of 8.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at a pH of 8.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K3 OR-GLP-2 (1-33), 128 disodium acid phosphate, 36.9 mg / ml mannitol, 10 mg / ml sucrose, 5 mg / ml phenol and 1.55 mg / ml L-His, at 8.0 H.

Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol and 1.55 mg / ml of L-His, at pH 8.0.

Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol and 1.55 mg / ml of L-His, at pH 8.0.

Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol and 1.55 mg / ml of L-His, at pH 8.0.

Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol and 1.55 mg / ml of L-His, at pH 8.0.

Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), 129 disodium acid phosphate, 36.9 mg / ml mannitol, 10 mg / ml sucrose, 5 mg / ml phenol and 1.55 mg / ml L-His, at pH 8.1.

Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol and 1.55 mg / ml of L-His, at pH 8.1.

Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol and 1.55 mg / ml of L-His, at pH 8.1.

Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9rrg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at a pH of 8.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at a pH of 8.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), 130 disodium acid phosphate, 16.0 mg / ml glycerol, and 5 mg / ml phenol, at H 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml of glycerol, and 5 mg / ml of phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml of glycerol, and 5 mg / ml of phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml of glycerol, and 7 mg / ml of phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml of glycerol, and 7 mg / ml of phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), 131 disodium acid phosphate, 16.0 mg / ml glycerol, and 7 mg / ral phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml L17 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylatinum) propionyl) / K30R-GLP-2 (1-33), glycylglycine, 16.0 mg / ml of glycerol, and 5mg / ml phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycylglycine, 16.0 mg / ml of glycerol, and 5mg / ml phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycylglycine, 16.0 mg / ml of glycerol, and 5 mg / ml phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycylglycine, 16.0 mg / ml of glycerol, and 7 mg / ml phenol, at pH 8.0.

Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml 132 of L17K (3- (hexadecanoylanno) propionyl) / K30R-GLP-2 (1-33), glycylglycine, 16.0 mg / ml glycerol, and 7 mg / ml phenol, at pH 8.0.

Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycylglycine, 16. 0 mg / ml glycerol, and 7 mg / ml phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 17.0 mg / ml of mannitol, 10 mg / ml of sucrose, and 18 mg / ml of benzyl alcohol, at a pH of 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 17.0 mg / ml of mannitol, 10 mg / ml of sucrose, and 18 mg / ml of benzyl alcohol, at a pH of 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 17.0 mg / ml of mannitol, 10 mg / ml of sucrose, and 18 mg / ml of benzyl alcohol, at a pH of 8.0. Typically, the invention relates to a formulation 133 Pharmaceutical consisting of an aqueous solution of 5 mg / ml L17K (3- (hexadecanoylamino) ropionil) / K30R-GLP-2 (1-33), disodium acid phosphate / sodium diacid phosphate, 17.0 mg / ml mannitol , 10 mg / ml of sucrose, and 18 mg / ml of benzyl alcohol, at a pH of 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 38.5mg / ml of mannitol, 10mg / ml of sucrose, and either 3mg / ml of m-cresol or 1.5mg / ml of phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml L17 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 38.5mg / ml of mannitol, 10mg / ml of sucrose, and either 3mg / ml of m-cresol or 1.5mg / ml of phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 38.5mg / ml of mannitol, 10mg / ml of sucrose, and either 3mg / ml of m-cresol or 1.5mg / ml of phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml 134 of L17K (3- (hexadecanoylamino) ropionil) / K30R-GLP-2 (1-33), disodium acid phosphate / sodium diacid phosphate, 38.5 mg / ml mannitol, 10 mg / ral sucrose, and either 3 mg / ml of m-cresol or 1.5mg / ml of phenol, at pH 8.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 17.0 mg / ml of mannitol, 10 mg / ml of sucrose, and I8mg / ml of benzyl alcohol, at a pH of 8.8. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 17.0 mg / ml of mannitol, 10 mg / ml of sucrose, and 18 mg / ml of benzyl alcohol, at a pH of 8.8. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 17.0 mg / ml of mannitol, 10 mg / ml of sucrose, and 18 mg / ml of benzyl alcohol, at a pH of 8.8. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), 135 disodium acid phosphate / diacid sodium phosphate, 17.0 mg / ml mannitol, 10 mg / ml sucrose, and 18 mg / ml benzyl alcohol, at pH 8.8. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17 (3- (hexadecanoylamino) propionyl) / K3OR-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 10 mg / ml sucrose, and 5 mg / ml phenol, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 10 mg / ml sucrose, and 5 mg / ml phenol, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 10 mg / ml sucrose, and 5 mg / ml phenol, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 10 mg / ml sucrose, and 5 mg / ml phenol, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml 136 of L17K (3- (hexadecanoylamino) ropionil) / K3OR-GLP-2 (1-33), glycine, 3S.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol, and either 1 mg / ml EDTA or 1.55mg / ml L-His, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol, and lmg / ml of EDTA / l. 55 mg / ml of L-His, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 5 mg / ml phenol, and 1.55 mg / ml L-His, at pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 5 mg / ml phenol, and 1.55 mg / ml L-His, at pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K3OR-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 5 mg / ml phenol, and 1.55 mg / ml L-His, at pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml 137 of L17K (3- (hexadecanoylamino) propionyl) / K3 OR-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 7 mg / ml phenol, and 1.55 mg / ml L- His, at a pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml L17K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 7 mg / ml phenol, and 1.55 mg / ml L-His, at pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 7 mg / ml phenol, and 1.55 mg / ml L-His, at pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9mg / ml of mannitol, 10 mg / ml sucrose, 5 mg / ml phenol, and either lmg / ml EDTA or 1.55 mg / ml L-His, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml L17K (3- (hexadecanoylamino) pyrionyl) / K3OR-GLP-2 (1-33), glycine, 36.9mg / ml mannitol, 10 mg / ml sucrose, 5 mg / ml phenol, and either 1 mg / ml EDTA or 1.55 mg / ml L-His, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml 138 of L17K (3- (hexadecanoylamino) ropionil) / K3 OR-GLP-2 (1-33), glycine, 3 € .9mg / ml mannitol, 10 mg / ml sucrose, 5mg / ml phenol, and either 4 mg / ml of Poloxamer 188 or 30 mg / ml of PEG 35000, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), glycine, 36.9mg / ml of mannitol, 10 mg / ml sucrose, 5 mg / ml phenol, and either 4 mg / ml Poloxamer 188 or 30 mg / ml PEG 35000, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), glycine, 36.9mg / ml of mannitol, 10 mg / ml sucrose, 5 mg / ml phenol, and either 4 mg / ml Poloxamer 188 or 30 mg / ml PEG 35000, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) pyrionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 10 mg / ml sucrose, 5 mg / ml phenol, and either 4 mg / ml Poloxamer 188 or 30 mg / ml PEG 35000, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K3OR-GLP-2 (1-33), 139 disodium acid phosphate, 16. Omg / ml glycerol, and 7 mg / ml phenol, at pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16. Omg / ml of glycerol, and 7mg / ml of phenol, at a pH of 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16. Omg / ml of glycerol, and 7mg / ml of phenol, at a pH of 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16. Omg / ml glycerol, and 7mg / ml phenol, at pH 8.. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16. Omg / ml of glycerol, and 7mg / ml of phenol, at a pH of 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9 mg / ml mannitol, 10 mg / ml sucrose, and 5 mg / ml phenol, at pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml L17K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at a pH of 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at a pH of 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at a pH of 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at a pH of 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), 141 disodium acid phosphate, 36.9 mg / ml mannitol, 10 mg / ml sucrose, 5 mg / ml phenol, and 1.55 mg / ml L-His, at pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at a pH of 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at a pH of 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at a pH of 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2- (1-33), disodium acid phosphate, 36.9 mg / ml mannitol, 10 mg / ml 142 sucrose, 5mg / ml phenol, and 1.55mg / ml L-His, at pH 8.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), 143 disodium acid phosphate, 36.9 mg / ml mannitol, 10 mg / ml sucrose, and 5 mg / ml phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at a pH of 7.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at a pH of 7.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at a pH of 7.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and Smg / ml of phenol, at a pH of 7.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9 mg / ml mannitol, 10 mg / ml sucrose, and 5 mg / ml phenol, at pH 7.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium-acid phosphate, 36.9 mg / ml mannitol, 10 mg / ml sucrose, 5 mg / ml phenol, and 1.55 mg / ml L-His, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at a pH of 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at a pH of 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9 mg / ml mannitol, 10 mg / ml sucrose, 5 mg / ml phenol, and 1.55 mg / ml L-His, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml 145 of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9 mg / ml mannitol, 10 mg / ml sucrose, 5 mg / ml phenol, and 1.55 mg / ml of L-His, at a pH of 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at a pH of 7.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9 mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at a pH of 7.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at a pH of 7.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at a pH of 7.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml of L17K (3-146 (hexadecanoylamino) ropionil) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml mannitol, 10 mg / ml sucrose, 5mg / ml phenol, and 1.55rg / ml L- His, at a pH 7.1. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml of glycerol, and 5 mg / ml of phenol, at a pH of 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml of glycerol, and 5 mg / ml of phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml of glycerol, and 5 mg / ml of phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml of glycerol, and 7 mg / ml of phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml 147 of L17 (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, and 7 mg / ml phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml of glycerol, and 7 mg / ml of phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17 (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33), glycylglycine, 16.0 mg / ml of glycerol, and 5mg / ml phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycylglycine, 16.0 mg / ml of glycerol, and 5mg / ml phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycylglycine, 16.0mg / ml glycerol, and 5mg / ml phenol, at a H 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), glycylglycine, 16.0mg / ml of glycerol, and 7 mg / ml phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycylglycine, 16.0 mg / ml of glycerol, and 7 mg / ml phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) pyrionyl) / K30R-GLP-2 (1-33), glycylglycine, 16.0 mg / ml of glycerol, and 7 mg / ml phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 17.0 mg / ml of mannitol, 10 mg / ml of sucrose, and 18 mg / ml of benzyl alcohol, at a pH of 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml 149 of L17K (3- (hexadecanoylamino) ropionyl) / 30R-GLP-2 (1-33), disodium acid phosphate / sodium diacid phosphate, 17.0 mg / ml mannitol, 10 mg / ml sucrose, and 18 mg / ml of benzyl alcohol, at a pH of 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 17.0 mg / ml of mannitol, 10 mg / ml of sucrose, and 18 mg / ml of benzyl alcohol, at a pH of 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium hydrogen phosphate / diacid phosphate of sodium, 17.0 mg / ml of mannitol, 10 mg / ml of sucrose, and 18 mg / ml of benzyl alcohol, at a pH of 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate sodium, 38.5mg / ml mannitol, 10mg / ml sucrose, and either 3mg / ml m-cresol or 1.5mg / ml phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), 150 disodium acid phosphate / sodium diacid phosphate, 38.5mg / ml mannitol, 10mg / ml sucrose, and either 3mg / ml m-cresol or 1.5mg / ml phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate sodium, 38.5mg / ml mannitol, 10mg / ml sucrose, and either 3mg / ml m-cresol or 1.5mg / ml phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium hydrogen phosphate / diacid phosphate sodium, 38.5mg / ml mannitol, 10mg / ml sucrose, and either 3mg / ml m-cresol or 1.5mg / ml phenol, at pH 7.0. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 17.0 mg / ml of mannitol, 10 mg / ml of sucrose, and 18 mg / ml of benzyl alcohol, at a pH of 7.8. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 17.0 mg / ml 151 of mannitol, 10 mg / ml of sucrose, and 18 mg / ml of benzyl alcohol, at a pH of 7.8. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate / diacid phosphate of sodium, 17. Omg / ml of mannitol, 10 mg / ml of sucrose, and 18 mg / ml of benzyl alcohol, at a pH of 7.8. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium hydrogen phosphate / diacid phosphate of sodium, 17. Omg / ml of mannitol, 10 mg / ml of sucrose, and 18 mg / ml of benzyl alcohol, at a pH of 7.8. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at a pH of S4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 10 mg / ml sucrose, and 5 mg / ml phenol, at pH 9.4. Typically, the invention relates to a formulation 152 Pharmaceutical consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 10 mg / ml of sucrose, and 5mg / ml phenol, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 10 mg / ml sucrose, and 5 mg / ml phenol, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 10 mg / ml sucrose, 5 mg / ml phenol, and either lmg / ml EDTA or 1.55 mg / ml L-His, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 10 mg / ml sucrose, 5 mg / ml phenol, and lmg / ml EDTA / 1.55 mg / ml L-His, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 5 mg / ml phenol, and 1.55 mg / ml L-His, at pH 7.4. 153 Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 5 mg / ml phenol, and 1.55 mg / ml L-His, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 5 mg / ml phenol, and 1.55 mg / ml L-His, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 7 mg / ml phenol, and 1.55 mg / ml L-His, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 7 mg / ml phenol, and 1.55 mg / ml L-His, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, 7 mg / ml phenol, and 1.55 mg / ml L-His, at pH 7.4. 154 Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17K (3 ~ (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33), glycine, 36.9mg / ml of mannitol, 10 mg / ml sucrose, 5 mg / ml phenol, and either lmg / ml EDTA or 1.55 mg / ml L-His, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33), glycine, 36.9mg / ml of mannitol, 10 mg / ml sucrose, 5 mg / ml phenol, and either lmg / ml EDTA or 1.55 mg / ml L-His, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9mg / ml of mannitol, 10 mg / ml sucrose, 5 mg / ml phenol, and either 4 mg / ml Poloxamer 188 or 30 mg / ml PEG 35000, at pH 9.. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 10 mg / ml sucrose, 5 mg / ml phenol, and either 4 mg / ml Poloxamer 188 or 30 mg / ml PEG 35000, at pH 9.4. Typically, the invention relates to a formulation 155 Pharmaceutical consisting of an aqueous solution of 3 mg / ml of L17K (3- (hexadecanoylamino) ropionil) / K3OR-GLP-2 (1-33), glycine, 36.9 mg / ml of mannitol, 10 mg / ml of sucrose, 5mg / ml phenol, and either 4mg / ml Poloxamer 188 or 30mg / ml PEG 35000, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K3 OR-GLP-2 (1-33), glycine, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol, and either 4 mg / ml of Poloxamer 188 or 30 mg / ml of PEG 35000, at pH 9.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0mg / ml of glycerol, and 7mg / ml of phenol, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K3 OR-GLP-2 (1-33), disodium acid phosphate, 16.0 mg / ml glycerol, and 7mg / ml phenol, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml of L17 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0mg / ml of glycerol, and 7mg / ml of 156 phenol, at a pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0mg / ml of glycerol, and 7mg / ml of phenol, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 16.0mg / ml of glycerol, and 7mg / ml of phenol, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml L17K (3- (hexadecanoylamino) propionyl) / 3OR-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of 157 sucrose, and 5mg / ml phenol, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, and 5 mg / ml of phenol, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 1 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 2 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 3 mg / ml 158 of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9 mg / ml mannitol, 10 mg / ml sucrose, 5 mg / ml phenol, and 1.55 mg / ml of L-His, at a pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 5 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K3OR-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution of 7 mg / ml of L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), disodium acid phosphate, 36.9mg / ml of mannitol, 10 mg / ml of sucrose, 5 mg / ml of phenol, and 1.55 mg / ml of L-His, at pH 7.4. Typically, the invention relates to a pharmaceutical formulation consisting of an aqueous solution, wherein the disodium acid phosphate is present in a concentration of 8 mM. The present invention is further illustrated by the following examples which, however, are not constructed as limiting the scope of protection. The features described in the above description and in the following examples may, either separately or in any way combination thereof, being material for carrying out the invention in various forms thereof.

Modalities: 1. A GLP-2 peptide comprising the amino acid sequence of the formula I His-X2-X3-Gly-X5-Phe-X7-X8-X9-X9-X10-Xll-X12-X13-X14-X15-X16 X17-X18-Ala-Arg-X21-Phe-Ile-X24-Trp-Leu-Ile-X28-Thr-Arg-Ile-Thr-X33 (formula I) or a fragment thereof; where X2 is Ala, Val or Gly; X3 is Asp, or Glu; X5 is Ser, or Lys; X7 is Ser, or Lys; X8 is Asp, Glu, or Lys; X9 is Asp, Glu, or Lys; XI0 is Met, Lys, Leu, Lie, or Nor-Leucine; Xll is Asn, or Lys; X12 is Thr, or Lys; X13 is lie, or Lys; X14 is Leu, or Lys; X15 is Asp, or Lys; X16 is Asn, or Lys; X17 is Leu, or Lys; X18 is Ala, or Lys; X21 is Asp, or Lys; X24 is Asn, or Lys; X28 is Gln, or Lys; X33 is Asp, Glu, or Lys. 2. The GLP-2 peptide according to mode 1, which consists of the amino acid sequence His-X2-X3-Gly-X5-Phe-X7-X8-X9-X10-Xll-X12-X13-X14-X15 X16-X17-X18-Ala-X20-X21-Phe-Ile-X24-Trp-Leu-Ile-X28-Thr-Arg-Ile-T r-X33 or a fragment thereof; where X2 is Ala, Val or Gly; X3 is Asp, or Glu; X5 is Ser, or Lys; X7 is Ser, or Lys; X8 is Asp, Glu, or Lys; X9 is Asp, Glu, or Lys; XI O is Met, Lys, 160 Leu, lie, or Nor-Leucina; Xll is Asn, or Lys; X12 is Thr, or Lys; X13 is lie, or Lys; X14 is Leu, or Lys; X15 is Asp, or Lys; X16 is Asn, or Lys; X17 is Leu, or Lys; X18 is Ala, or Lys; X20 is Arg, or Lys; X21 is Asp, or Lys; X24 is Asn, or Lys; X28 is Gln, or Lys; X33 is Asp, Glu, or Lys. 3. The GLP-2 peptide according to embodiments 1 or 2, wherein X2 is Ala. 4. The GLP-2 peptide according to embodiments 1 or 2, wherein X2 is Gly. 5. The GLP-2 peptide according to any of the embodiments 1-4, wherein X3 is Asp. 6. The GLP-2 peptide according to any of the embodiments 1-4, wherein X3 is Glu. 7. The GLP-2 peptide according to any of the embodiments 1-6, wherein X5 is Ser. 8. The GLP-2 peptide according to any of the embodiments 1-7, wherein X7 is Ser. 9. The GLP-2 peptide according to any of the modalities 1-8, wherein X8 is Asp. 10. The GLP-2 peptide according to any of the modalities 1-8, wherein X8 is Glu. 11. The GLP-2 peptide according to any of embodiments 1-10, wherein X9 is Asp. 12. The GLP-2 peptide according to any of the embodiments 1-10, wherein X9 is Glu. 161 13. The GLP-2 peptide according to any of the embodiments 1-12, wherein X10 is selected from the group consisting of Met, Leu, Lie, and Nor-Leucine. 14. The GLP-2 peptide according to any of the embodiments 1-13, wherein xyl is Asn. 15. The GLP-2 peptide according to any of the embodiments 1-14, wherein X12 is Thr. 16. The GLP-2 peptide according to any of the embodiments 1-15, wherein X13 is lie. 17. The GLP-2 peptide according to any of embodiments 1-16, wherein X14 is Leu. 18. The GLP-2 peptide according to any of the embodiments 1-17, wherein X15 is Asp. 19. The GLP-2 peptide according to any of the embodiments 1-18, wherein X16 is Asn. 20. The GLP-2 peptide according to any of the embodiments 1-19, wherein X17 is Leu. 21. The GLP-2 peptide according to any of the embodiments 1-20, wherein X18 is Ala. 22. The GLP-2 peptide according to any of the embodiments 1-21, wherein X21 is Asp. 23. The GLP-2 peptide according to any of the embodiments 1-22, wherein X24 is Asn. 24. The GLP-2 peptide according to any of the embodiments 1-23, wherein X28 is Gln. 162 25. The GLP-2 peptide according to any of the embodiments 1-24, wherein X33 is Asp. 26. The GLP-2 peptide according to any of the embodiments 1-24, wherein X33 is Glu. 27. The GLP-2 peptide according to any of embodiments 1-26, wherein at least one amino acid independently selected from the list consisting of X5, X7, X8, X9, X10, Xll, X12, X13, X14, X15, X16, X17, X18, X20, X21, X24, X28, and X33 is a Lys. 28. The GLP-2 peptide according to any of embodiments 1-27, wherein a total of up to 5 amino acid residues have been exchanged with any a-amino acid residue, such as 4 amino acid residues, 3 amino acid residues, 2 amino acid residues, or 1 amino acid residue. 29. The GLP-2 peptide according to mode 1, wherein the peptide is selected from the list consisting of K30R-GLP-2 (1-33); S5K-GLP-2 (1-33); S7K-GLP-2 (1-33) D8K-GLP-2 (1-33); E9K-GLP-2 (1-33); M10-GLP-2 (1-33); N11K-GLP-2 (1-33); T12K-GLP-2 (1-33); 163 I13K-GLP-2 (1 -33) L14K-GLP-2 (1 -33) D15-GLP- • 2 (1 -33) N16K-GLP-2 (1 -33) L17-GLP-2 (1 - 33) A18-GLP-2 (1 -33) D21K-GLP-2 (1 -33) N24K-GLP-2 (1 -33) Q28K-GLP-2 (1 -33) S5K / K30R-GLP -2 ( 1-33); S7K / 30R-GLP -2 (1-33); D8K / K30R-GLP -2 (1-33); E9K / K30R-GLP -2 (i -33); M10K / K30R- • GLP- • 2 (1-33); N11K / K30R-| GLP-|2 (1-33); T12K / K30R-| GLP-2 (1-33); I13K / K30R- • GLP-|2 (1-33); L14K / K30R-| GLP- • 2 (1-33); D15K / K30R- • GLP-2 (1-33); N16K / K30R-| GLP-2 (1-33); L17K / K30R-| GLP-|2 (1-33); A18K / K30R- • GLP-2 (1-33); D21K / K30R- • GLP-2 (1-33); N24K / K30R- • GLP-2 (1-33); Q28K / K30R- • GLP-2 (1-33); 164 K30R / D33K-GLP-2 (1-33); D3E / K30R / D33E-GLP-2 (1-33); D3E / S5 / K30R / D33E-GLP-2 (1-33); D3E / S7K / K30R / D33E-GLP-2 (1-33); D3E / D8K / K30R / D33E-GLP-2 (1-33); D3E / E9 / 30R / D33E-GLP-2 (1-33); D3E / M10 / K30R / D33E-GLP-2 (1-33); D3E / N11K / K30R / D33E-GLP-2 (1-33); D3E / T12K / K30R / D33E-GLP-2 (1-33); D3E / I13 / K30R / D33E-GLP-2 (1-33); D3E / L14K / K30R / D33E-GLP-2 (1-33); D3E / D15 / K30R / D33E-GLP-2 (1-33); D3E / N16K / K30R / D33E-GLP-2 (1-33); D3E / L17K / K30R / D33E-GLP-2 (1-33); D3E / A18K / K30R / D33E-GLP-2 (1-33); D3E / D21K / K30R / D33E-GLP-2 (1-33); D3E / N24K / 30R / D33E-GLP-2 (1-33); and D3E / Q28K / K30R / D33E-GLP-2 (1-33). 30. A polynucleotide construct that encodes a GLP-2 peptide according to any of the embodiments 1-29. 31. A host cell comprising the polynucleotide construct according to mode 30. 32. The host cell according to mode 31, which is a eukaryotic cell. 165 33. The host cell_ in accordance with mode 32, where the cell is a yeast cell. 34. A GLP-2 derivative comprises a GLP-2 peptide, wherein a lipophilic substituent is linked to one or more amino acid residue at a position relative to the amino acid sequence of SEQ ID NO: 1 independently selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L14, D15, N16, L17, A18, D21, N24, and Q28 with the proviso that the lipophilic substituent does not bind in the residue of terminal amino acid N or the C-terminal amino acid residue of the GLP-2 peptide. 35. The GLP-2 derivative according to embodiment 34, wherein the GLP-2 peptide is in accordance with formula II His-X2-X3-Gly-X5-Phe-X7 ~ X8-X9-X10-Xll- X12-X13-X14-X15-XlS-X17-X18-Ala ~ X20-X21-Phe-Ile-X24-Trp-Leu-Ile-X28-Thr-X30-Ile-Thr-X33 (formula II) or a fragment of the same; where X2 is Ala, Val or Gly; X3 is Asp, or Glu; X5 is Ser, or Lys; X7 is Ser, or Lys; X8 is Asp, Glu, or Lys; X9 is Asp, Glu, or Lys; X10 is Met, Lys, Leu, Lie, or Nor-Leucine; Xll is Asn, or Lys; X12 is Thr, or Lys; X13 is lie, or Lys; X14 is Leu, or Lys; X15 is Asp, or Lys; X16 is Asn, or Lys; X17 is Leu, or Lys; X18 is Ala, or Lys; X20 is Arg, or Lys; X21 is Asp, or Lys; X24 is Asn, or Lys; X28 is Gln, or Lys; X30 is Arg, or Lys; X33 is Asp, Glu, or Lys (formula II). 166 36. The GLP-2 derivative according to embodiments 34 or 35, wherein the GLP-2 peptide is in accordance with any of the modes 1-29. 37. The GLP-2 derivative according to any of the embodiments 34-36, wherein only one lipofilic substituent is bound to the GLP-2 peptide. 38. The GLP-2 derivative according to any of embodiments 34-37, wherein the lipoxylic substituent comprises from 4 to 40 carbon atoms. 39. The GLP-2 derivative in accordance with the modality 38, wherein the lipofxyl substituent comprises from 8 to 25 carbon atoms. 40. The GLP-2 derivative according to the embodiment 38, wherein the lipophilic substituent comprises from 12 to 20 carbon atoms. 41. The GLP-2 derivative according to any of embodiments 34-40, wherein the lipofxyl substituent is linked to an amino acid residue, such that a carboxyl group of the lipophilic substituent forms an amide bond with an amino group of the amino group. amino acid residue. 42. The GLP-2 derivative according to embodiment 41, wherein the amino acid residue is a Lys residue. 43. The GLP-2 derivative according to any of embodiments 34-40, wherein the lipofxyl substituent is linked to an amino acid residue such that a group 167 amino of the lipophilic substituent forms an amide bond with a carboxyl group of the amino acid residue. 44. The GLP-2 derivative according to any of embodiments 34-43, wherein the lipophilic substituent is linked to the GLP-2 peptide by means of a spacer. 45. The GLP-2 derivative in accordance with the modality 44, wherein the spacer is an unbranched alkane dicarboxylic acid group having from 1 to 7 methylene groups, such as two methylene groups whose spacer forms a bridge between an amino group of the GLP-2 peptide and an amino group of the lipophilic substituent. 46. The GLP-2 derivative according to embodiment 44, wherein the spacer is an amino acid residue except a Cys residue, or a dipeptide. 47. The GLP-2 derivative in accordance with the modality 46, wherein the spacer is selected from the list consisting of β-alanine, gamma-aminobutyric acid (GABA), β-glutamic acid, Lys, Asp, Glu, a dipeptide containing Asp, a dipeptide containing Glu, or a dipeptide containing Lys. 48. A GLP-2 derivative according to embodiments 46 or 47, wherein a carboxyl group of the parent GLP-2 peptide forms an amide bond with an amino group of the spacer, and the carboxyl group of the amino acid or dipeptide spacer forms a bond amide with an amino group of 168 lipophilic substituent. 49. A GLP-2 derivative according to embodiments 46 or 47, wherein an amino group of the precursor GLP-2 peptide forms an amide bond with a carboxyl group of the spacer, and an amino group of the spacer forms an amide bond with a carboxyl group of the lipophilic substituent. 50. A GLP-2 derivative according to any of embodiments 34-49, wherein the lipophilic substituent comprises a partially or fully hydrogenated cyclopentanphenatrene skeleton. 51. A GLP-2 derivative according to any of embodiments 34-50, wherein the lipophilic substituent is a straight or branched chain alkyl group. 52. A GLP-2 derivative according to any of embodiments 34-50, wherein the lipophilic substituent is the acyl group of a straight or branched chain fatty acid. 53. A GLP-2 derivative according to embodiment 52, wherein the acyl group is selected from the group comprising CH3 (CH2) nC0-, wherein n is 4 to 38, such as CH3 (CH2) sC0-, CH3 (CH2) 8CO-, C¾ (C¾) IQCO-, C¾ (CH2) 12C0-, CH3 (CH2) 14C0-, C¾ (CH2) 16C0-, CH3 (C¾) i8C0-, C¾ (CH2) 20CO- and CH3 (CH2) 22C0-. 54. A GLP-2 derivative according to any of embodiments 34-49, wherein the lipophilic substituent 169 is an acyl group of a straight or branched chain α, α-dicarboxylic acid. 55. A GLP-2 derivative according to the embodiment 59, wherein the acyl group is selected from the group comprising HOOC (CH2) mCO-, wherein m is 4 to 38, such as H00C (CH2) 14C0-, HOOC (CH2) a6CO-, HOOC (CH2) 18C0-, HOOC (CH2) 20CO- and HOOC (CH2) 22C0-. 56. A GLP-2 derivative according to any of embodiments 34-49, wherein the lipophilic substituent is a group of the formula C¾ (CH2) p ((C¾) qC00H) CH H-CO (CH2) 2CO-, wherein p and q are integers and p + q is an integer from 8 to 40, such as from 12 to 35. 57. A GLP-2 derivative according to any of embodiments 34-49, wherein the lipophilic substituent is a group of the formula C¾ (C¾) rCO-NHCH (COOH) (CH 2) 2 C 0 -, wherein r is an integer from 10 to 24. 58. A GLP-2 derivative according to any of the embodiments 34-49, wherein the lipophilic substituent is a group of the formula C¾ (CH 2) sCO-NHCH ((CH 2) 2COOH) CO-, where s is an integer from 8 to 24. 59. A GLP-2 derivative according to any of the embodiments 34-49, wherein the lipophilic substituent is a group of the formula COOH (CH2) tCO- wherein t is an integer from 8 to 24. 60. A GLP-2 derivative in accordance with any d e 170 embodiments 34-49, wherein the lipophilic substituent is a group of the formula - HCH (COOH) (CH 2) 4 H - C 0 (CH 2) UCH 3, where u is an integer from 8 to 18. 61. A GLP derivative -2 according to any of embodiments 34-49, wherein the lipophilic substituent is a group of the formula -NHCH (COOH) (CH2) 4NH-COCH ((CH2) 2C00H) H-C0 (CH2) WCH3, in where w is an integer from 10 to 16. 62. A GLP-2 derivative according to any of embodiments 34-49, wherein the lipophilic substituent is a group of the formula - HCH (COOH) (C¾) 4NH-CO (CH2) 2CH (COOH) NH-CO (CH2) xCH3, wherein x is an integer from 10 to 16. 63. A GLP-2 derivative according to any of embodiments 34-49, wherein the lipophilic substituent is a group of the formula -NHCH (COOH) (CH2) 4NH-CO (CH2) 2CH (COOH) HCO (CH2) and CH3, wherein y is zero or an integer from 1 to 22. 64. A GLP-2 derivative of conformity with any of the modalities 34-63, which has lipophilic substituents. 65. A GLP-2 derivative according to any of the embodiments 34-64, which is selected from the group consisting of S5K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33).

S7K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33) D8K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33) E9K (3- (hexadecanoylamino) ropionyl) -GLP-2 ( 1-33) M10K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); N 11 K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); T12 (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); I13K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); L 14 K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); D15K (3- (hexadecanoylamino) ropionyl) -GLP-2 (1-33); N16K (3- (hexadecanoylamino) ropionyl) -GLP-2 (1-33); L17K (3- (octanylamino) ropionyl) -GLP-2 (1-33); L17K (3- (nonanoylamino) propionyl) -GLP-2 (1-33), -L17K (3- (decanylamino) propionyl) -GLP-2 (1-33); L17K (3- (undecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (dodecanoylamino) propionyl) -GLP-2 (1-33); L17 (3- (tridekanoylamino) ropionyl) -GLP-2 (1-33); L17 (3- (tetradecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (pentadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (heptadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (octadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (nonadecanoylamino) ropionyl) -GLP-2 (1-33); L17K (3- (eicosanoylamino) propionyl) -GLP-2 (1-33); L17K ((s; -4-carboxy-4- (octanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (nonanoylamino) butanoyl) -GLP-2 (1-33); 172 L17K ((S) -4-carboxy-4- (decanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (undecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (dodecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (tridekanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (tetradecanoylamino) butanoyl) -GLP-2 (1-33); L17 ((S) -4-carboxy-4- (pentadecanoylaraino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (hexadecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (heptadecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (octadecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (nonadecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (eicosanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (octanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (nonanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (decanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (undecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (dodecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (tridekanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (tetradecanoylamino) butanoyl) -GLP-2 (1-33); L17 (4- (pentadecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (exadecanoilami or) butanoyl) -GLP-2 (1-33); L17K (4- (heptadecanoylamino) butanoyl) -GLP-2 (1-33) L17K (4- (octadecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (nonadecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (eicosanoylamino) butanoyl) -GLP-2 (1-33); A18K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); 173 D21K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33) N24 (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33) Q28K (3- (hexadecanoylamino) propionyl) -GLP-2 ( 1-33) S5K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); S7K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); D8K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); E9K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), -M10K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) N11K (3- (hexadecanoylamino) propionyl) ) / K30R-GLP-2 (1-33) T12K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) I13 (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1- 33) L14K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) D15K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) N16K (3- (hexadecanoylamino) propionyl) ) / K30R-GLP-2 (1-33) L17K (3- (octanylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (nonanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (decanylamino) ropionyl) / K30R-GLP-2 (1-33); L17K (3- (undecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (dodecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (tridekanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (tetradecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (pentadecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (heptadecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (octadecanoylamino) propionyl) / K30R-GLP-2 (1-33); 174 L17K (3- (nonadecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (eicosanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K ((S) -4- -carboxy-4- (octanylamino) butanoyl) / 0R-GLP-2 (1-33); L17K ((S) -4- -carboxy-4- (nonanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4- -carboxy-4- (decanylamino) utanoyl) / K30R-GLP-2 (1-33); | L17K ((S) -4- -carboxy-4- (undecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4- -carboxy-4- (dodecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4- -carboxy-4- (tridekanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4- -carboxy-4- (tetradecanoylamino) butanoyl) / 30R-GLP-2 (1-33); L17K ((S) -4- -carboxy-4- (pentadecanoylamino) butanoyl) / 30R-GLP-2 (1-33); L17 ((S) -4- -carboxy-4- (hexadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4- -carboxy-4- (heptadecanoylamino) butanoyl) / 30R-GL _? - 2 (1-33); L17K ((S) -4- -carboxy-4- (octadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4- -carboxy-4- (nonadecanoylamino) butanoyl) / 30R-GLP-2 (1-33); L17K ((S) -4- -carboxy-4- (eicosanoyleneoy) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (octanoi lamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (nonanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (decanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (undecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (dodecanoylamino) butanoyl) / 30R-GLP-2 (1-33); L17K (4- (tridekanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (tetradecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (pentadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (hexadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (heptadecanoylamino) butanoyl) / 30R-GLP-2 (1-33); 175 L17K (4- (octadecanoylamino) butanoyl) / 30R-GLP-2 (1-33); L17K (4- (nonadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (eicosanoylamino) butanoyl) / 30R-GLP-2 (1-33); A18K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33); D21K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); N24K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33); Q28 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); D3E / S5K (3- (hexadecanoylamino) ropionyl) / K30R / D33E-GLP-2 (1-33); D3E / S7K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / D8K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / E9K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / M10K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / N11K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / T12K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / I13K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L14K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / D15K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / N16K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (octanylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (nonanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (decanylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (undecanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33); D3E / L17K (3- (dodecanoylamino) ropionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (tridekanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (tetradecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); 176 D3E / L17K (3- (pentadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (heptadecanoylaraine) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17 (3- (octadecanoylamino) p2X) pionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (nonadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (eicosanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (octanylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (nonanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17 ((S) -4-carboxy-4- (decanylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (undecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (dodecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (tridekanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (tetradecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (pentadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (hexadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- 177 (heptadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (octadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (nonadecanoilamino) utanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (eicosanoylamino) butanoyl) / 30R / D33E-GLP-2 (1-33); D3E / L17K (4- (octanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (nonanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (decanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (undecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (dodecanoylamino) butanoyl) / 30R / D33E-GLP-2 (1-33); D3E / L17K (4- (tridekanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (tetradecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (pentadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (hexadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (heptadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (octadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (nonadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (D4 - (eicosanoylamino) butanoyl) / K30R / D33 E-GLP -2 (1-33); D3E / A18K (3- (hexadecanoylamino) ropionyl) / K30R / D33E-GLP-2 (1-33); D3E / D21K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / N24K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); Y D3E / 028K (3- (hexadecanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33). 66. A pharmaceutical composition comprising a 178 GLP-2 derivative comprises a GLP-2 peptide, wherein a lipophilic substituent is linked to one or more amino acid residues at a position relative to the amino acid sequence of SEQ ID NO: 1 selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L14, D15, 16, L17, 7? 18, D21, N24, and Q28 with the proviso that the lipofxyl substituent does not bind at the terminal amino acid residue N or the C-terminal amino acid residue of the GLP-2 peptide. 67. A pharmaceutical composition comprising a GLP-2 derivative as defined in any of embodiments 34-65, and, optionally, a pharmaceutically acceptable carrier. 68. The use of a GLP-2 derivative as defined in any of embodiments 34-65 for the preparation of a medicament. 69. The use of a GLP-2 derivative as defined in any of embodiments 34-65 for the preparation of a medicament with a protective effect. 70. The use of a GLP-2 derivative as defined in any of embodiments 34-65 for the preparation of a medicament for the treatment of intestinal insufficiency or another condition that leads to malabsorption of nutrients in the intestine. 71. The use of a GLP-2 derivative as defined in any of the 34-65 modalities for the preparation of a medicine for the treatment of small bowel syndrome, inflammatory bowel syndrome, Crohn's disease, colitis that includes collagen colitis, radiation colitis, chronic radiation enteritis, ulcerative colitis, tropical and non-tropical stomatitis (intolerance to gluten), celiac disease (gluten sensitive enteropathy), damaged tissue after vascular obstruction or trauma, diarrhea eg tourist diarrhea and post-infectious diarrhea, chronic intestinal dysfunction, dehydration, bacteremia, sepsis, anorexia nervosa, tissue damaged after chemotherapy by example, intestinal mucositis produced by chemotherapy, premature infants including intestinal insufficiency in premature infants, infants before birth including intestinal insufficiency in infants before birth, scleroderma, gastritis including atrophic gastritis, atrophic gastritis postantrectomy and gastritis by helicobacter pylori, bread creatitis, general septic shock ulcers, enteritis, cul-de-sac, lymphatic obstruction, vascular disease and graft versus host and healed after surgical procedure, atrophy after radiation and chemotherapy, weight loss in Parkinson's disease, adaptation intestinal after surgical procedure, mucosal atrophy induced by parenteral nutrition, for example mucosal atrophy induced by total parenteral nutrition (TPN) and disorders 180 related to bones including osteoporosis, hypercalcemia of malignancy, osteopenia due to bone metastasis, periodontal disease, hyperparathyroidism, periarticular erosions in rheumatoid arthritis, Paget's disease, osteodystrophy, myositis ossificans, Bechterew's disease, malignant hypercalcemia, osteolytic lesions caused by metastasis of bones, bone loss due to immobilization, bone loss due to deficiency of the sex steroid hormone, bone abnormalities due to treatment with steroid hormone, bone abnormalities due to cancer therapeutics, osteomalacia, Bechet's disease, osteomalacia, hyperostosis, osteopetrosis metastatic bone disease, osteopenia induced by immobilization, or osteoporosis induced by glucocorticoids. 72. A method for the treatment of intestinal insufficiency or other condition that leads to malabsorption of nutrients in the intestine, the method comprising administering a therapeutically or prophylactically effective amount of a GLP-2 derivative as defined in any of the embodiments. -65; to a subject who needs it. 73. A method for the treatment of small bowel syndrome, inflammatory bowel syndrome, Crohn's disease, colitis that includes collagen colitis, radiation colitis, chronic radiation enteritis, ulcerative colitis, tropical and non-tropical stomatitis (intolerance 181 to gluten), celiac disease (gluten-sensitive enteropathy), damaged tissue after vascular obstruction or trauma, diarrhea such as tourist diarrhea and post-infectious diarrhea, chronic intestinal dysfunction, dehydration, bacteremia, sepsis, anorexia nervosa, damaged tissue after chemotherapy for example, intestinal mucositis caused by chemotherapy, premature infants including intestinal insufficiency in premature infants, infants before birth including intestinal insufficiency in infants prior to birth, scleroderma, gastritis that includes atrophic gastritis, gastritis atrophic postantrectomy and gastritis by helicobacter pylori , pancreatitis, general septic shock ulcers, enteritis, cul-de-sac, lymphatic obstruction, vascular disease and graft versus host and healed after surgical procedure, atrophy after radiation and chemotherapy, weight loss in Parkinson's disease, adapt intestinal ion after surgical procedure, mucosal atrophy induced by parenteral nutrition, for example mucosal atrophy induced by total parenteral nutrition (TPN) and bone-related disorders including osteoporosis, hypercalcemia of malignancy, osteopenia due to bone metastasis, periodontal disease, hyperparathyroidism, periarticular erosions in rheumatoid arthritis, Paget's disease, osteodystrophy, myositis 182 ossificans, Bechterew's disease, malignant hypercalcemia, osteolytic lesions produced by bone metastasis, bone loss due to immobilization, bone loss due to deficiency of the sex spheroidal hormone, bone abnormalities due to treatment with spheroid hormone, bone abnormalities due to Therapeutics of cancer, osteomalacia, Bechet's disease, osteomalacia, hyperostosis, osteopetrosis, metastatic bone disease, immobilization-induced osteopenia, or glucocorticoid-induced osteoporosis, the method comprises administering a therapeutically or prophylactically effective amount of a GLP-2 derivative as defined in any of the embodiments 34-65; to a subject who needs it. 74. A method for producing the GLP-2 peptide defined in any of the embodiments 1-29, the method comprises culturing a host cell as defined in any one of the embodiments 31-33 in an appropriate growth medium under conditions that they allow the expression of the polynucleotide construct and recover the resulting peptide from the culture medium. Additional modalities: Ib. A pharmaceutical formulation comprising a GLP-2 compound, and a buffer solution, wherein the GLP-2 compound is present in a concentration from 0.1 mg / ml to 100 mg / ml, and wherein the formulation has a pH of 183 from 8.0 to 10, or a formulation dried by freezing it. 2b. The formulation according to the Ib modality also comprises water. 3b. A pharmaceutical formulation comprising an aqueous solution of a GLP-2 compound, and a buffer solution, wherein the GLP-2 compound is present in a concentration from 0.1 mg / ml to 100 mg / ml, and wherein the formulation has a pH from 8.0 to 10. 4b. The formulation according to any of the modes Ib-3b, wherein the GLP-2 compound is presented in a concentration from 1 mg / ml to 100 mg / ml. 5b. The formulation according to any of the embodiments lb-4b, wherein the formulation has a pH from 8.5 to 10. 6b. The formulation according to any of the embodiments lb-5b, wherein the formulation has a pH from 9.0 to 10. 7b. The formulation according to any of the modes lb-6b, wherein the GLP-2 compound is present in a concentration from 0.1 mg / ml to 80 mg / ml, 0.1 mg / ml to 50 mg / ml, 0.1 mg / ml up to 20 mg / ml, 0.1 mg / ml up to 10 mg / ml, typically from 0.1-5 mg / ml. 8b. The formulation according to any of the embodiments lb-7b, wherein the GLP-2 compound is present in a concentration from 1 mg / ml to 80 mg / ml, 1 mg / ml to 50 mg / ml, 1 mg / ml to 20 mg / ml, 1 mg / ml to 10 mg / ml, typically from 1-5 mg / ml. 9b. The formulation according to any of the embodiments Ib-8b also comprises a preservative. 10b. The formulation according to the modality 9b, wherein the preservative is presented in a concentration from 0.1 mg / ml to 20 mg / ml. 11b. The formulation according to any of the embodiments lb-10b, further comprises an isotonic agent. 12b. The formulation according to the method 11b, wherein the isotonic agent is presented in a concentration from 1 mg / ml to 50 mg / ml. 13b. The formulation according to any of embodiments lb-12b also comprises a chelating agent. 14b. The formulation according to mode 13b, wherein the chelating agent is present in a concentration from 0.1 mg / ml to 5 mg / ml. 15b. The formulation according to any of the modes lb ~ 14b, further comprises a stabilizer. 16b. The formulation according to mode 15b, wherein the stabilizer is selected from the group consisting of L-histidine, imidazole and arginine. 17b. The formulation according to the modality 16b, where the stabilizer is a high-weight polymer 185 Molecular and / or a low molecular weight compound and is presented in a concentration from 0.1 mg / ml to 50 mg / ml. 18b. The formulation according to any of the embodiments lb-17b, further comprises a surfactant. 19b. The formulation according to any of the embodiments lb-18b, wherein the GLP-2 compound is selected from the list consisting of GLP-2 (1-33), A2G-GLP-2 (1-33), and analogues thereof. same. 20b. The formulation according to any of the embodiments lb-18b, wherein the GLP-2 compound is a GLP-2 derivative. 21b. The formulation according to embodiment 20b, wherein the GLP-2 derivative is a GLP-2 peptide, wherein an amino acid residue of the precursor peptide has a lipophilic linked substituent, optionally by means of a spacer. 22b. The formulation according to mode 21b, wherein the GLP-2 derivative is a GLP-2 peptide, wherein a lipophilic substituent is linked to one or more amino acid residues at the position relative to the amino acid sequence of the SEQ ID N0: 1 independently selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L14, D15, N16, L17, A18, D21, N24, and Q28. 23b. The formulation according to embodiment 22b, wherein the GLP-2 peptide is according to formula II 186 His-X2-X3-Gly-X5-Phe-X7-X8-X9-X10-Xll-X12-X13-X14-X15-X16-X17-X18-Ala-X20-X21-Phe-Ile-X24-Trp- Leu-Ile-X28-Thr-X30-Ile-Thr-X33 (formula II) or a fragment thereof; where X2 is Ala, Val or Gly; X3 is Asp, or Glu; X5 is Ser, or Lys; X7 is Ser, or Lys X8 is Asp, Glu, or Lys; X9 is Asp, Glu, or Lys; XI0 is Met, Lys, Leu, Lie, or Nor-Leucine; Xll is Asn, or Lys; X12 is Thr, or Lys; X13 is lie, or Lys X14 is Leu, or Lys; X15 is Asp, or Lys; X16 is Asn, or Lys; X17 is Leu, or Lys; X18 is Ala, or Lys; X20 is Arg, or Lys; X21 is Asp, or Lys; X24 is Asn, or Lys; X28 is Gln, or Lys; X30 is Arg, or Lys; X33 is Asp, Glu, or Lys (formula II). 24b. The formulation according to any of the embodiments 22b or 23b, wherein the GLP-2 peptide comprises the amino acid sequence of the formula I His-X2 ~ X3-Gly-X5-Phe-X7-X8-X9-X10-Xll -X12-X13-X14-X15-X16-X17-X18-Ala-Arg-X21-Phe-Ile-X24-Trp-Leu-Ile-X28-Thr-Arg-Ile-Thr-X33 (formula I) or a fragment thereof; where X2 is Ala, Val or Gly; X3 is Asp, or Glu; X5 is Ser, or L s; X7 is Ser, or Lys; X8 is Asp, Glu, or Lys; X9 is Asp, Glu, or Lys; X10 is Met, Lys, Leu, Lie, or Nor-Leucine; Xll is Asn, or Lys; X12 is Thr, or Lys X13 is lie, or Lys; X14 is Leu, or Lys; X15 is Asp, or Lys; X16 is Asn, or Lys; X17 is Leu, or Lys; X18 is Ala, or Lys; X21 is Asp, or Lys; X24 is Asn, or Lys; X28 is Gln, or Lys; X33 is Asp, Glu, or Lys.187 25b. The formulation according to any of the embodiments 22b-24b, wherein the GLP-2 peptide consists of the amino acid sequence His-X2-X3-Gly-X5-Phe-X7-X8-X9-X10-Xll-X12- X13-X14-X15-X16-X17-X18-Ala-X20-X21-Phe-Ile-X24-Trp -] or a fragment thereof; where X2 is Ala, Val or Gly; X3 is Asp, or Glu; X5 is Ser, or Lys; X7 is Ser, or Lys; X8 is Asp, Glu, or Lys; X9 is Asp, Glu, or Lys; XIO is Met, Lys, Leu, Lie, or Nor-Leucine; Xll is Asn, or Lys; X12 is Thr, or Lys; X13 is lie, or Lys; X14 is Leu, or Lys; X15 is Asp, or Lys; X16 is Asn, or Lys; X17 is Leu, or Lys; X18 is Ala, or Lys; X20 is Arg, or Lys; X21 is Asp, or Lys; X24 is Asn, or Lys; X28 is Gln, or Lys; X33 is Asp, Glu, or Lys. 26b. The formulation according to any of the embodiments 23b-25b, wherein X2 is Ala. 27b. The formulation according to any of the modes 23b-25b, wherein X2 is Gly. 28b. The formulation according to any of the embodiments 23b-27b, wherein X3 is Asp. 29b. The formulation according to any of the embodiments 23b-27b, wherein X3 is Glu. 30b. The formulation according to any of the modes 23b-29b, wherein X5 is Ser. 31b. The formulation according to any of the modes 23b-30b, wherein X7 is Ser. 32b. The formulation in accordance with any of 188 the modes 23b-31b, wherein X8 is Asp. 33b. The formulation according to any of the embodiments 23b-31b, wherein X8 is Glu. 34b. The formulation according to any of the modalities.23-33, where X9 is Asp. 35b. The formulation according to any of the embodiments 23b-33b, wherein X9 is Glu. 36b. The formulation according to any of the modes 23b-35b, wherein X10 is selected from the group consisting of Met, Leu, Lie, and Nor-Leucine. 37b. The formulation according to any of the embodiments 23b-36b, wherein Xll is Asn. 38b. The formulation according to any of the embodiments 23b-37b, wherein X12 is Thr. 39b. The formulation according to any of the modes 23b-38b, wherein X13 is lie. 40b. The formulation according to any of the modes 23b-39b, wherein X14 is Leu. 41b. The formulation according to any of the embodiments 23b-40b, wherein X15 is Asp. 42b. The formulation according to any of the embodiments 23b-41b, wherein X16 is Asn. 43b. The formulation according to any of the modes 23b-42b, wherein X17 is Leu. 44b. The formulation in accordance with any of 189 the modes 23b-43b, where X18 is Ala. 45b. The formulation according to any of the embodiments 23b-44b, wherein X21 is Asp. 46b. The formulation according to any of the modes 23b-45b, wherein X24 is Asn. 47b. The formulation according to any of the embodiments 23b-46b, wherein X28 is Gln. 48b. The formulation according to any of the embodiments 23b-47b, wherein X33 is Asp. 49b. The formulation according to any of the embodiments 23b-47b, wherein X33 is Glu. 50b. The formulation according to any of the modes 23b-25b, wherein at least one amino acid independently selected from the list consisting of X5, X7, X8, X9, X10, Xll, X12, X13, X14, X15, X16, X17 , X18, X20, X21, X24, X28, and X33 is a Lys. 51b. The formulation according to any of the 2Ib-50b modalities, wherein a total of above 5 amino acid residues have been exchanged with any a-amino acid residue, such as 4 amino acid residues, 3 amino acid residues, 2 residues of amino acid, or 1 amino acid residue. 52b. The formulation according to any of the embodiments 21b-25b, wherein the GLP-2 peptide is selected from the list consisting of 190 K30R-GLP-2 (1-33) S5K-GLP-2 (1-33); S7K-GLP-2 (1-33); D8K-GLP-2 (1-33); E9K-GLP-2 (1-33); M10K-GLP-2 (1-33) N11K-GLP-2 (1-33) T12K-GLP-2 (1-33) I13K-GLP-2 (1-33) L14K-GLP-2 (1-33) D15K-GLP-2 (1-33) N16K-GLP-2 (1-33) L17K-GLP-2 (1-33) A18K-GLP-2 (1-33) D21K-GLP-2 (1-33) N24K-GLP-2 (1-33) Q28K-GLP-2 (1-33) S5K / K30R-GLP-2 (1-33); S7K / 30R-GLP-2 (1-33); D8K / K30R-GLP-2 (1-33); E9 / K30R-GLP-2 (1-33); M10K / K30R-GLP-2 (1-33) N11K / K30R-GLP-2 (1-13) T12K / 30R-GLP-2 (1-33) I13K / K30R-GLP-2 (1-33) 191 L14K / K30R-GLP-2 (1-33) D15K / K30R-GLP-2 (1-33) N16K / 30R-GLP-2 (1-33) L17K / K30R-GLP-2 (1-33) A18K / K30R-GLP-2 (1-33) D21 / K30R-GLP-2 (1-33) N24 / K30R-GLP-2 (1-33) Q28K / K30R-GLP-2 (1-33) K30R / D33K- GLP-2 (1-33) D3E / K30R / D33E-GLP-2 (1-33); D3E / S5K / K30R / D33E-GLP-2 (1-33); D3E / S7K / K30R / D33E-GLP-2 (1-33); D3E / D8K / K30R / D33E-GLP-2 (1-33); D3E / E9K / K30R / D33E-GLP-2 (1-33); D3E / 10K / K30R / D33E-GLP-2 (1-33) D3E / N11K / K30R / D33E-GLP-2 (1-33) D3E / T12K / K30R / D33E-GLP-2 (1-33) D3E / I13K / K30R / D33E-GLP-2 (1-33) D3E / L14K / K30R / D33E-GLP-2 (1-33) D3E / D15K / K30R / D33E-GLP-2 (1-33) D3E / N16K / K30R / D33E-GLP-2 (1-33) D3E / L17K / K30R / D33E-GLP-2 (1-33) D3E / A18K / K30R / D33E-GLP-2 (1-33) D3E / D21K / K30R / D33E-GLP-2 (1-33) D3E / N24K / K30R / D33E-GLP-2 (1-33) and 192 D3E / Q28K / K30R / D33E-GLP-2 (1-33) 53b. The formulation according to any of the embodiments 21b-52b, wherein only one lipophilic substituent is bound to the GLP-2 peptide. 54b. The formulation according to any of the embodiments 21b-53b, wherein the lipophilic substituent comprises from 4 to 40 carbon atoms. 55b. The formulation according to embodiment 54b, wherein the lipophilic substituent comprises from 8 to 25 carbon atoms. 56b. The formulation according to embodiment 55b, wherein the lipophilic substituent comprises from 12 to 20 carbon atoms. 57b. The formulation according to any of the embodiments 21b-56b, wherein the lipophilic substituent is linked to an amino acid residue such that a carboxyl group of the lipophilic substituent forms an amide bond with an amino group of the amino acid residue. 58b. The formulation according to the embodiment 57b, wherein the amino acid residue is a Lys residue. 59b. The formulation according to any of the embodiments 21b-58b, wherein the lipophilic substituent is linked to an amino acid residue such that an amino group of the lipophilic substituent forms an amide bond with a carboxyl group of the amino acid residue. 193 60b. The formulation according to any of the embodiments 21b-59b, wherein the lipophilic substituent is linked to the GLP-2 peptide by means of a spacer. 61b. The formulation in accordance with embodiment 60b, wherein the spacer is a group of unbranched alkane-dicarboxylic acid having from 1 to 7 methylene groups, such as two methylene groups whose spacer forms a bridge between a group amino acid of the GLP-2 peptide and an amino group of the lipophilic substituent. 62b. The formulation according to embodiment 60b, wherein the spacer is an amino acid residue except a Cys residue, or a dipeptide. 63b. The formulation according to embodiment 62b, wherein the spacer is selected from the list consisting of β-alanine, gamma-aminobutyric acid (GABA), β-glutamic acid, Lys, Asp, Glu, a dipeptide containing Asp, a dipeptide containing Glu, or a dipeptide containing Lys. 64b. The formulation according to embodiments 62b or 63b, wherein a carboxyl group of the parent peptide GLP-2 forms an amide bond with an amino group of the spacer, and the carboxyl group of the amino acid or dipeptide spacer forms an amide bond with a group amino of the lipophilic substituent. 65b. The formulation according to the embodiments 62b or 63b, wherein an amino group of the GLP-2 peptide 194 The precursor forms an amide bond with a carboxyl group of the spacer, and an amino group of the spacer forms an amide bond with a carboxyl group of the lipophilic substituent. 66b. The formulation according to any of the embodiments 21b-65b, wherein the lipophilic substituent comprises a partially or fully hydrogenated cyclopentanphenatrene skeleton. 67b. The formulation according to any of the embodiments 21b-66b, wherein the lipophilic substituent is a straight or branched chain alkyl group. 68b. The formulation in accordance with any of the modalities 21b-66b, wherein the lipophilic substituent is the acyl group of a straight or branched chain fatty acid. 69b. The formulation according to embodiment 68b, wherein the acyl group is selected from the group comprising CH3 (CH2) nCO-, wherein n is 4 to 38, such as CH3 (CH2) 6CO-, CH3 (CH2) 8CO- , CH3 (CH2) 10CO-, CH3 (CH2) 12CO-, CH3 (CH2) 14CO-, CH3 (CH2) 16CO-, CH3 (CH2) 18CO-, CH3 (CH2) 20CO- and CH3 (CH2) 22CO-. 70b. The formulation according to any of the embodiments 21b-65b, wherein the lipophilic substituent is an acyl group of a straight or branched chain α-dicarboxylic acid. 71b. The formulation according to embodiment 68b, wherein the acyl group is selected from the group comprising 195 HOOC (CH2) mCO-, wherein m is 4 to 38, such as H00C (CH2) 14C0-, HOOC (CH2) 16CO-, HOOC (CH2) 18C0-, HOOC (CH2) 20CO- and HOOC (CH2) 22C0-. 72b. The formulation according to any of the embodiments 21b-65b, wherein the lipophilic substituent is a group of the formula CH3 (CH2) p ((CH2) qCOOH) CHNH-CO (CH2) 2CO-, wherein p and q are integers and p + q is an integer from 8 to 40, such as from 12 to 35. 73b. The formulation according to any of the embodiments 21b-65b, wherein the lipophilic substituent is a group of the formula CH3 (CH2) rCO-NHCH (COOH) (CH2) 2CO-, wherein r is an integer from 10 to 24 74b. a formulation according to any of the embodiments 21b-65b, wherein the lipophilic substituent is a group of the formula CH3 (CH2) sCO-NHCH ((CH2) 2C00H) CO-, wherein s is an integer from 8 to 24 75b. The formulation according to any of the embodiments 21b-65b, wherein the lipophilic substituent is a group of the formula COOH (CH2) tCO- wherein t is an integer from 8 to 24. 76b. The formulation according to any of the embodiments 2 Ib-65b, wherein the lipophilic substituent is a group of the formula HCH (COOH) (CH2) 4NH-C0 (CH2) uCH3, wherein u is an integer from 8 to 18 77b. The formulation in accordance with any of 196 the embodiments 21b- 65b, wherein the lipophilic substituent is a group of the formula ICH (COOH) (CH2) 4NH-C0CH ((CH2) 2G30H) NH-C0 (CH2) wCH3, wherein w is an integer from 10 to 16. 78b. The formulation according to any of the embodiments 21b- 65b, wherein the lipophilic substituent is a group of the formula MICH (COOH) (CH2) 4m-CO ((_ H2) 2CH (CC) OH) m-8 (ai2) xCH3, where x is an integer from 10 to 16. 79b. The formulation according to any of the embodiments 21b-65b, wherein the lipophilic substituent is a group of the formula NHCH (COOH) (CH2) 4NH-CO (CH2) 2CH (COOH) NHCO (CH2) and CH3, wherein is zero or an integer from 1 to 22. 80b. The formulation according to any of the modes 21b-79b, which has two lipophilic substituents. 81b. The formulation according to mode 20b, wherein the GLP-2 derivative is selected from the group consisting of S5 (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); S7K (3- (hexadecanoylamino) propionyl.). -GLP-2 (1-33); D8K (3- (hexadecanoylamino) pyrionyl) -GLP-2 (1-33); E9K (3- (hexadecanoylamino) propionyl) - GLP-2 (1-33); M10K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); N11K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); T12K (3 - (hexadecanoylamino) ropionyl) -GLP-2 (1-33); I13 (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); 197 L 14 K (3-hexadecanoylamino) propionyl) -GLP-2 (1-33); D15K (3-hexadecanoylamino) propionyl) -GLP-2 (1-33); N16K (3-hexadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3-octanoylamino) propionyl) -GLP-2 (1-33); L17K (3-nonanoylamino) ropionyl) -GLP-2 (1-33); L17K (3-decanoylamino) ropionyl) -GLP-2 (1-33); L17K (3-undecanoylamino) propionyl) -GLP-2 (1-33); L17K (3-dodecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- tridecanoylamino) propionyl} -GLP-2 (1-33); L17K (3-tetradecanoylamino) propionyl) -GLP-2 (1-33), -L17K (3-pentadecanoylamino) pyrionyl) -GLP-2 (1-33); L17K (3-hexadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- heptadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3-octadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- nonadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- eicosanoylamino) propionyl) -GLP-2 (1-33); L17K ((S-4-carboxy-4- (octanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S-4-carboxy-4- (nonanoylamino) butanoyl) -GLP-2 (1-33) L17K ((S -4-carboxy-4- (decanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S-4-carboxy-4- (undecanoylamino) butanoyl) -GLP-2 (1 -33); L17K ((S-4-carboxy-4- (dodecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S-4-carboxy-4- (tridekanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) 4-carboxy-4- (tetradecanoylanno) butanoyl). -GLP-2 (1-33); L17K ((S) 4-carboxy-4- (pentadecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) 4-carboxy-4- (hexadecanoylamino) butanoyl) -GLP-2 (1-33); 198 L17 ((S) -4-carboxy-4- (heptadecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (octadecanoylamino) butanoyl) -GLiP-2 (1-33); L17K ((S) -4-carboxy-4- (nomdecanoylamino) butanoyl) -GL _? -2 (1-33); L17K ((S) -4-carboxy-4- (eicosanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (octanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (nonanoylamino) utanoyl) -GLP-2 (1-33); L17K (4- (decanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (undecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (dodecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (tridekanoylamino) utanoyl) -GLP-2 (1-33); L17K (4- (tetradecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4 ~ (pentadecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (hexadecanoylamino) butanoyl) -GI-P-2 (1-33); L17K (4- (heptadecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (octadecanoylamino) butanoyl) -GLP-2 (1-33) L17K (4- (nonadecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (eicosanoylamino) utanoyl) -GLP-2 (1-33); A18K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); D21K (3- (hexadecanoylamino) pyrionyl.). -GLP- (1-33); N24K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); Q28K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); S5K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) S7K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33) D8K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) E9K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33) 199 M10 (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33) N11K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33) T12K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) I13K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33) L14K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) D15K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) N16K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) L17K (3- (octanylamino) ropionyl) / K30R-GLP-2 (1-33); L17K (3- (nonanoylamino) propionyl) / 30R-GLP-2 (1-33); L17K (3- (decanylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (undecanoylamino) ropionyl) / K30R-GLP-2 (1-33); L17K (3- (dodecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (tridekanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (tetradecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (pentadecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33); L17K (3- (heptadecanoylamino) ropionyl) / K30R-GLP-2 (1-33); L17K (3- (octadecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (nonadecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (eicosanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (octanoylamino) butanoyl) / 30R-GLP-2 (1-33) L17K ((S) -4-carboxy-4- (nonanoylamino) butanoyl) / K30R-GLP- 2 (1-33) L17K ((S) -4-carboxy-4- (decanoylamino) butanoyl) / K30R-GLP-2 (1-33) L17K ((S) -4-carboxy-4- (undecanoylamino) butanoyl ) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (dodecanoylamino) butanoyl) / K30R-GLP-2 (1-33); 200 L17K ((S -4-carboxy-4- (tridekanoyl) butanoyl) / K30R-GLP-2 (1-33); L17K ((S -4 ~ carboxy-4- (tetradecanoylamino) butanoyl) / 30R-GLP-2 (1-33); L17K ((S -4-carboxy-4- (pentadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S -4-carboxy-4- (hexadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S-4-carboxy-4- (heptadecanoylamino) butanoyl) / 30R-GEJP-2 (1-33); L17 ((S -4-carboxy-4- (octadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); Li7K ((s; -4-carboxy-4- (nonadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S -4-carboxy-4- (eicosanoylamino) butanoyl) / K30R-GL.P-2 (1-33); L17K (4-octanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4-nonanoylamino) butanoyl) / 30R-GLP-2 (1-33); L17K (4- decaylaminoJbutanoyl) / 30R-GLP-2 (1-33); L17K (4- undecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4-dodecanoylacyl) butanoyl) / 30R-GI-P-2 (1-33); L17K (4- tridecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- tetradecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- pentadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- hexadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4-heptadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- octadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- nonadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- eicosanoylamino) butanoyl) / K30R-GLP-2 (1-33); A18K (3-hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) D21K (3-hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) N24K (3-hexadecanoylamino) propionyl) / K30R-GLP -2 (1-33) Q28K (3-hexadecanoylamino) prqpionyl) / K30R-GLP-2 (1-33) 201 D3E / S5K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / S7K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / D8K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / E9K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / M10K (3- (hexadecanoyl) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / N11K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / T12K (3- (hexadecanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33); D3E / I13K (3- (hexadecanoylatane) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L14K (3- (hexadecanoylarnino) propioiiyl) / 30R / D33E-GLP-2 (1-33); D3E / D15K (3- (hexadecanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33); D3E / N16K (3- (hexadecanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33); D3E / L17K (3- (octanylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (nonanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17 (3- (decanylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (undecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17 (3- (dodecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (tridecanoilarru.no) ropionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (tetradecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17 (3- (pentadecanoylamino) ropionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17 (3- (hexadecanoylamino) ropionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (heptadecanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33); D3E / L17 (3- (octadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (nonadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (eicosanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33) D3E / L17K ((S) -4-carboxy-4- (octanoylamino) butanoyl) / K30R / D33E-202 GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (nonanoylamino) butanoyl) / K30R / D33E GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (decanylamino) butanoyl) / K30R / D33E GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (undecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (dodecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (tridekanoylamino) butanoyl) / 30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (tetradecanoylamino) butanoyl) / 30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (pentadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (hexadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17 ((S) -4-carboxy-4- (heptadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33) D3E / L17K ((S) -4-carboxy-4- (octadecanoylamino) butanoyl ) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (nonadecanoylamino) butanoyl) / 30R / D33E-GLP-2 (1-33); D3E / L17 ((S) -4-carboxy-4- (eicosanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); 203 D3E / L17K (4- (octanoylamino) butanoyl) / 30R / D33E-GLP-2 (1-33); D3E / L17K (4- (nonane i lamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (decanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33), - D3E / L17K (4- (unde canoalino) butanoyl) / K30R / D33E-GLP-2 (1 -33); D3E / L17K (4- (dodecanoylamino) utanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (tridekanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (tetradecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (pentadecanoylaira.no) butanoyl) / 30R / D33E-GLP-2 (1-33); D3E / L17K (4- (hexadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (heptadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (octadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17 (4- (nonadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (eicosanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / A18K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / D21K (3- (hexadecanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33); D3E / N24K (3- (hexadecanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33); Y D3E / Q28KD- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33). 82b. A method for preparing a physically stable pharmaceutical formulation of a GLP-2 compound comprising preparing a formulation containing the GLP-2 compound, and a buffer solution, wherein the GLP-2 compound is presented in a concentration of 0.1 mg / ml up to 100 mg / ml, and where the formulation has a pH from 8.0 to 10. 83b. The method according to the method 82b, wherein the pharmaceutical formulation is as defined in 204 any of the modalities Ib-8Ib. 84b. A composition comprises a GLP-2 compound, and a buffer solution, wherein the GLP-2 compound is presented in a concentration from 0.1 mg / ml to 100 mg / ml, and wherein the composition has a pH from 8.0 'to 10. , or a formulation dried by freezing it. 85b. The composition according to the embodiment 84b also comprises water. 86b. A composition comprises an aqueous solution of a GLP-2 compound, and a buffer solution, wherein the GLP-2 compound is present in a concentration from 0.1 mg / ml to 100 mg / ml, and wherein the composition has a pH from 8.0 to 10. Additional modalities: 1c. A pharmaceutical formulation comprising a GLP-2 derivative, and a buffer solution, or a freeze-dried formulation thereof, wherein the GLP-2 derivative is a GLP-2 peptide, wherein a lipophilic substituent is linked, optionally via of a spacer, to one or more amino acid residues at a position relative to the amino acid sequence of SEQ ID MO: l independently selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L14, D15, N16, L17, A18, D21, N24, and Q28, where the GLP-2 derivative is present in a concentration from 0.1 mg / ml to 100 mg / ml, 205 and wherein the formulation has a pH from 7.0 to 10. 2c. The formulation according to the embodiment 1c also comprises water. 3c. A pharmaceutical formulation comprising an aqueous solution of a GLP-2 derivative, and a buffer solution, wherein the GLP-2 derivative is presented in a concentration from 0.1 mg / ml to 100 mg / ml, and wherein the formulation has a pH from 7.0 to 10. 4c. The formulation according to any of the modes lc-3c, wherein the GLP-2 derivative is presented in a concentration from 1 mg / ml to 100 mg / ml. 5c. The formulation according to any of the modes lc-4c, wherein the formulation has a pH from 7.0 to 9.0. 6c. The formulation according to any of the embodiments lc-5c, wherein the formulation has a pH from 7.0 to 8.0. 7c. The formulation according to any of the modes lc-6c, wherein the GLP-2 derivative is present in a concentration from 0.1 mg / ml to 80 mg / ml, 0.1 mg / ml to 50 mg / ml, 0.1 mg / ml up to 20 mg / ml, 0.1 mg / ml up to 10 mg / ml, typically from 0.1-5 mg / ml. 8c. The formulation according to any of the modes lc-7c, wherein the GLP-2 derivative is present in a concentration from 1 mg / ml to 80 mg / ml, 1 mg / ml 206 up to 50 mg / ml, 1 mg / ml up to 20 mg / ml, 1 mg / ml up to 10 mg / ml, typically from 1-5 mg / ml. 9c. The formulation according to any of the modes lc-8c also comprises a preservative. 10c. The formulation in accordance with mode 9c, wherein the preservative is presented in a concentration from 0.1 mg / ml to 20 mg / ml. 11c. The formulation according to any of the embodiments lc-10c, further comprises an isotonic agent. 12c. The formulation according to the method 11c, wherein the isotonic agent is presented in a concentration from 1 mg / ml to 50 mg / ml. 13c. The formulation according to any of the modes lc-12c, further comprises a chelating agent. 14c. The formulation according to the modality 13c, where the chelating agent. it is presented in a concentration from 0.1 mg / ml to 5 mg / ml. 15c. The formulation according to any of the embodiments lc-14c, further comprises a stabilizer. 16c. The formulation according to embodiment 15c, wherein the stabilizer is selected from the group consisting of L-histidine, imidazole and arginine. 17c. The formulation according to embodiment 16c, wherein the stabilizer is a high molecular weight polymer and / or a low molecular weight compound and is presents in a concentration from 0.1 mg / ml to 50 mg / ml. 18c. The formulation according to any of the embodiments lc-17c, further comprises a surfactant. 19c. The formulation according to any of the embodiments lc-18c, wherein the GLP-2 peptide is in accordance with formula II His-X2-X3-Gly-X5-Phe-X7-X8-X9-X10-Xll-X12 -X13-X14-X15-X16-X17-X18-Ala-X20-X21-Phe-Ile-X24-Trp-Leu-Ile-X28 ~ Thr-X30-Ile-Thr-X33 (Formula II) or a fragment of same; where X2 is Ala, Val or Gly; X3 is Asp, or Glu; X5 is Ser, or Lys; X7 is Ser, or Lys; X8 is Asp, Glu, or Lys; X9 is Asp, Glu, or Lys; XI0 is Met, Lys, Leu, He, or Nor-Leucine; Xll is Asn, or Lys; X12 is Thr, or Lys; X13 is He, or Lys; X14 is Leu, or Lys; X15 is Asp, or Lys; XI6 is Asn, or Lys; X17 is Leu, or Lys; X18 is Ala, or Lys; X20 is Arg, or Lys; X21 is Asp, or Lys; X24 is Asn, or Lys; X28 is Gln, or Lys; X30 is Arg, or Lys; X33 is Asp, Glu, or Lys (formula II). 20c. The formulation according to any of the embodiments lc-19c, wherein the GLP-2 peptide comprises the amino acid sequence of the formula I His-X2-X3-Gly-X5-Phe-X7-X8-X9-X10-Xll -X12-X13-X14-X15-X16-X17-X18-Ala-Arg-X21-Phe-Ile-X24-Trp-Leu-Ile-X28-Thr-Arg-Ile-Thr-X33 (formula 1) or a fragment thereof; where X2 is Ala, Val or Gly; X3 is Asp, or Glu; X5 is Ser, or Lys; X7 is Ser, or Lys; X8 is 208 Asp, Glu, or Lys; X9 is Asp, Glu, or Lys; XI0 is Met, Lys, Leu, He, or Nor-Leucine; Xll is Asn, or Lys; X12 is Thr, or Lys; X13 is lie, or Lys; X14 is Leu, or Lys; X15 is Asp, or Lys; X16 is Asn, or Lys; X17 is Leu, or Lys; X18 is Ala, or Lys; X21 is Asp, or Lys; X24 is Asn, or Lys; X28 is Gln, or Lys; X33 is Asp, Glu, or Lys. 21c. The formulation according to any of the embodiments lc-20c, wherein the GLP-2 peptide consists of the amino acid sequence His-X2-X3-Gly-X5 ~ Phe-X7-X8-X9 ~ X10-Xll-X12- X13-X14-X15-X16-X17-X18-Ala-X20-X21-Phe-Ile-X24-Trp-Leu-Ile-X28-Thr-Arg-Ile-Thr-X33 or a fragment thereof; where X2 is Ala, Val or Gly; X3 is Asp, or Glu; X5 is Ser, or Lys; X7 is Ser, or Lys; X8 is Asp, Glu, or Lys; X9 is Asp, Glu, or Lys; X10 is Met, Lys, Leu, Lie, or Nor-Leucine; Xll is Asn, or Lys; X12 is Thr, or Lys; X13 is lie, or Lys; X14 is Leu, or Lys; X15 is Asp, or Lys; X16 is Asn, or Lys; X17 is Leu, or Lys; X18 is Ala, or Lys; X20 is Arg, or Lys; X21 is Asp, or Lys; X24 is Asn, or Lys; X28 is Gln, or Lys; X33.es Asp, Glu, or Lys. 22c. The formulation according to any of the embodiments 19c-21c, wherein X2 is Ala. 23c. The formulation according to any of the embodiments 19c-21c, wherein X2 is Gly. 24c. The formulation according to any of the embodiments 19c-23c, wherein X3 is Asp. 209 25c. The formulation according to any of the embodiments 19c-23c, wherein X3 is Glu. 2Ge The formulation according to any of the embodiments 19c-25c, wherein X5 is Ser. 27c. The formulation according to any of the embodiments 19c-26c, wherein X7 is Ser. 28c. The formulation according to any of the embodiments 19c-27c, wherein X8 is Asp. 29c. The formulation according to any of the embodiments 19c-27c, wherein X8 is Glu. 30c. The formulation according to any of the embodiments 19c-29c, wherein X9 is Asp. 31c. The formulation according to any of the embodiments 19c-29c, wherein X9 is Glu. 32c. The formulation according to any of the embodiments 19c-31c, wherein XI0 is selected from the group consisting of Met, Leu, Lie, and Nor-Leucine. 33c. The formulation according to any of the embodiments 19c-32c, wherein Xll is Asn. 34c. The formulation according to any of the embodiments 19c-33c, wherein X12 is Thr. 35c. The formulation according to any of the modalities 19c-34c, wherein X13 is lie. 36c. The formulation according to any of the embodiments 19c-35c, wherein X14 is Leu. 210 37c. The formulation in accordance with any of the modalities 19c-3Sc, where X15 is Asp. 38c. The formulation according to any of the embodiments 19c-37c, wherein X16 is Asn. 39c. The formulation according to any of the modalities 19c-38c, wherein X17 is Leu. 40c. The formulation according to any of the modalities 19-39, where X18 is Ala. 41c. The formulation according to any of the embodiments 19c-40c, wherein X21 is Asp. 42c. The formulation according to any of the embodiments 19c-41c, wherein X24 is Asn. 43c. The formulation according to any of the embodiments 19c-42c, wherein X28 is Gln. 44c. The formulation according to any of the embodiments 19c-43c, wherein X33 is Asp. 45c. The formulation according to any of the embodiments 19c-44c, wherein X33 is Glu. 46c. The formulation according to any of the embodiments 19c-45c, wherein at least one amino acid independently selected from the list consisting of X5, X7, X8, X9, X10, Xll, X12, X13, XI4, X15, X16, X17 , X18, X20, X21, X24, X28, and X33 is a Lys. 47c. The formulation in accordance with any of the modalities lc-46c, where a total of above 5 211 amino acid residues have been exchanged with any a-amino acid residue, such as 4 amino acid residues, 3 amino acid residues, 2 amino acid residues, or 1 amino acid residue. 48c. The formulation according to any of the embodiments lc-47c, wherein the GLP-2 peptide is selected from the list consisting of K30R-GLP-2 (1-33); S5K-GLP-2 (1-33); S7K-GLP-2 (1-33); D8-GLP-2 (1-33); E9-GLP-2 (1-33); M10K-GLP-2 (1-33); N11-GLP-2 (1-33); T12K-GLP-2 (1-33); I13K-GLP-2 (1-33); L14K-GLP-2 (1-33); D15K-GLP-2 (1-33); N16K-GLP-2 (1-33); L17K-GLP-2 (1-33); A18K-GLP-2 (1-33); D21K-GLP-2 (1-33); N24K-GLP-2 (1-33); Q28K-GLP-2 (1-33); S5K / K30R-GLP-2 (1-33); 212 S7K / K30R-GLP-2 (1-33); D8K / K30R-GLP-2 (1-33); E9K / K30R-GLP-2 (1-33); M10K / K30R-GLP-2 (1-33); N11K / K30R-GLP-2 (1-33); T12K / K30R-GLP-2 (1-33); I13K / K30R-GLP-2 (1-33); L14K / K30R-GLP-2 (1-33); D15K / K30R-GLP-2 (1-33); N16K / K30R-GLP-2 (1-33); L17K / 30R-GLP-2 (1-33); A18K / K30R-GLP-2 (1-33); D21K / K30R-GLP-2 (1-33); N24K / K30R-GLP-2 (1-33); Q28K / 30R-GLP-2 (1-33); K30R / D33K ^ GLP-2 (1-33); D3E / K30R / D33E-GLP -2 (1-33) D3E / S5K / K30R / D33E-GLP-2 (1-33); D3E / S7K / K30R / D33E-GLP-2 (1-33); D3E / D8K / K30R / D33E-GLP-2 (1-33); D3E / E9K / K30R / D33E-GLP-2 (1-33); D3E / M10K / K30R / D33E-GLP-2 (1-33) D3E / N11K / K30R / D33E-GLP-2 (1-33) D3E / T12K / 30R / D33E-GLP-2 (1-33) D3E / I13K / K30R / D33E-GLP-2 (1-33) 213 D3E / L14K / K30R / D33E-GLP-2 (1-33); D3E / D15K / K30R. / D33E-GLP-2 (1-33); D3E / N16K / K30R / D33E-GLP-2 (1-33); D3E / L17K / K30R / D33E-GLP-2 (1-33); D3E / A18K / K30R / D33E-GLP-2 (1-33); D3E / D21K / K30R / D33E-GLP-2 (1-33); D3E / N24K / K30R / D33E-GLP-2 (1-33); and D3E / Q28K / K30R / D33E-GLP-2 (1-33). 49c. The formulation according to any of the embodiments lc-48c, wherein only one lipophilic substituent is bound to the GLP-2 peptide. 50c. The formulation according to any of the embodiments cc-49c, wherein the lipophilic substituent comprises from 4 to 40 carbon atoms. 51c. The formulation according to the modality 50c, wherein the lipophilic substituent comprises from 8 to 25 carbon atoms. 52c. The formulation according to the embodiment 51c, wherein the lipophilic substituent comprises from 12 to 20 carbon atoms. 53c. The formulation according to any of the embodiments lc-52c, wherein the lipophilic substituent is linked to an amino acid residue such that a carboxyl group of the lipophilic substituent forms an amide bond with an amino group of the amino acid residue. 214 54c. The formulation according to embodiment 53c, wherein the amino acid residue is a Lys residue. 55c. The formulation according to any of the embodiments lc-54c, wherein the lipophilic substituent is linked to an amino acid residue such that an amino group of the lipophilic substituent forms an amide bond with a carboxyl group of the amino acid residue. 56c. The formulation according to any of the modes le-55c, wherein the lipophilic substituent is linked to the GLP-2 peptide by means of a spacer. 57c. The formulation according to embodiment 56c, wherein the spacer is a group of unbranched alkane-dicarboxylic acid having from 1 to 7 methylene groups, such as two methylene groups whose spacers form a bridge between a group amino of the GLP-2 peptide and an amino group of the lipophilic substituent. 58c. The formulation according to embodiment 56c, 'wherein the spacer is an amino acid residue except a Cys residue, or a dipeptide. 59c. The formulation according to embodiment 58c, wherein the spacer is selected from the list consisting of β-alanine, gamma-aminobutyric acid (GABA), β-glutamic acid, Lys, Asp, Glu, a dipeptide containing Asp, a dipeptide containing Glu, or a dipeptide containing Lys. 60c. The formulation in accordance with the modalities 215 58c or 59c, wherein a carboxyl group of the GLP-2 peptide precursor forms an amide bond with an amino group of the spacer, and the carboxyl group of the amino acid or dipeptide spacer forms an amide bond with an amino group of the lipophilic substituent. 61c. The formulation according to embodiments 58c or 59c, wherein an amino group of the parent GLP-2 peptide forms an amide bond with a carboxylic group of the spacer, and an amino group of the spacer forms an amide bond with a carboxyl group of the lipophilic substituent . 62c. The formulation according to any of the embodiments le-61c, wherein the lipophilic substituent comprises a partially or fully hydrogenated cyclopentanphenatrene skeleton. 63c. The formulation according to any of the embodiments lc-62c, wherein the lipophilic substituent is a straight or branched chain alkyl group. 64c. The formulation according to any of the embodiments 1c-62c, wherein the lipophilic substituent is the acyl group of a straight or branched chain fatty acid. 65c. The formulation according to the embodiment 64c, wherein the acyl group is selected from the group comprising CH3 (CH2) nCO-, wherein n is 4 to 38, such as CH3 (CH2) 6C0-, CH3 (CH2) 8C0- , CH3 (CH2) 10CO-, ?? 3 (CH2) 1200-, CH3 (CH2) 1400-, CH3 (CH2) 16C0-, CH3 (CH2) 18C0-, CH3 (CH2) 20CO- and CH3 (CH2) 2 2CO-. 216 66c. The formulation according to any of the embodiments lc-61c, wherein the lipophilic substituent is an acyl group of a straight or branched chain α-dicarboxylic acid. 67c. The formulation according to the modality 66c, where acyl group is selected from the group that comprises HOOC (CH2) mCO-, where m is 4 to 38, such as H00C (CH2) 14C0-, HOOC (CH2) 16C0-, HOOC (CH2) 18C0-, HOOC (CH2) 20CO- and HOOC (CH2) 22CO-. 68c. The formulation according to any of the embodiments le-61c, wherein the lipophilic substituent is a group of the formula CH3 (CH2) p ((CH2) qCOOH) CHNH- CO (CH2) 2CO-, wherein p and q are integers and p + q is an integer from 8 to 40, such as from 12 to 35. 69c. The formulation according to any of the embodiments lc-61c, wherein the lipophilic substituent is a group of the formula CH3 (CH2) rCO-NHCH (COOH) (CH2) 2CO-, wherein r is an integer from 10 to 24 70c. The formulation according to any of the preferred embodiments, wherein the lipophilic substituent is a group of the formula CH 3 (CH 2) s CO-HCH ((CH 2) 2 COOH) CO-, wherein s is an integer from 8 to 24 71c. The formulation according to any of the embodiments lc-61c, wherein the lipophilic substituent is a group of the formula COOH (CH2) tCO- wherein t is a 217 whole from 8 to 24. 72c. The formulation according to any of the embodiments le-61c, wherein the lipophilic substituent is a group of the formula HCH (COOH) (CH2) 4NH-C0 (CH2) uCH3, wherein u is an integer from 8 to 18. 73c. The formulation according to any of the embodiments le-61c, wherein the lipophilic substituent is a group of the formula HCH (COOH) (CH2) 4NH-COCH ((CH2) 2C00H) NH-CO (CH2) wCH3, wherein w is an integer from 10 to 16. 74c. The formulation according to any of the embodiments le-61c, wherein the lipophilic substituent is a group of the formula NHCH (COOH) (CH2) NH-CO (CH2) 2CH (COOH) NH-CO (CH2) xCH3, in where x is an integer from 10 to 16. 75c. The formulation according to any of the embodiments le-61c, wherein the lipophilic substituent is a group of the formula NHCH (COOH) (CH2) 4NH-CO (CH2) 2CH (COOH) NHCO (CH2) and CH3, wherein is zero or an integer from 1 to 22. 76c. The formulation according to any of the modes le-75c, which have two lipophilic substituents. 77c. The formulation according to any of the modes lc-18c, wherein the GLP-2 derivative is 218 selects from the group consisting of S5 (3- (hexadecanoylamino) ropionyl) -GLP-2 (1-33); S7K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33), -D8K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); E9K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); M10K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); N 11 K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); T12K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); I13K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); L 14 K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); D15K (3- (hexadecanoylamino) ropionyl) -GLP-2 (1-33); N16K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (octanylamino) propionyl) -GLP-2 (1-33); L17K (3- (nonanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (decanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (undecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (dodecanoylamino) propionyl) -GLP-2 (1-33); L17KÍ3- (tridecanoylamino) propionyl) -GLP-2 (1-33); L17 (3- (tetradecanoylamino) ropionyl) -GLP-2 (1-33); L17K (3- (pentadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (heptadecanoylamino) ropionyl) -GLP-2 (1-33); L17K (3- (octadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (nonadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (eicosanoylamino) propionyl) -GLP-2 (1-33); 219 L17K ((S) -4-carboxy-4- (octanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (nonanoilamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (decanoyl ami or) bu noyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (unde canoalino) butanoyl) -GLP-2 (1-33) L17K ((S) -4-carboxy-4- (dodecanoylamino) utanoyl) -GLP-2 (1-33) L17K ((S) -4-carboxy-4- (tridekanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (tetradecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (pentadecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (hexadecanoylamino) butanoyl) -GLP-2 (1-33); L17 ((S) -4-carboxy-4- (heptadecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (octadecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (nonadecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4-carboxy-4- (eicosanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (octanoylamino) butanoyl) -GLP-2 (1-33); L17K (4 (nonanoylamino) butanoyl) -GLP-2 (1-33); L17K (4 (decanylamino) butanoyl) -GLP-2 (1-33); L17 (4 (unde cano i lamí no) butanoil) -GLP-2 (1-33); L17K (4 (dodecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4 (tridekanoylamino) butanoyl) -GLP-2 (1-33); L17K (4 (tetradecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4 (pentadecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4 (hexadecanoylamino) utanoyl) -GLP-2 (1-33); L17K (4 (heptadecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4 (octadecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4 (nonadecanoylamino) butanoyl) -GLP-2 (1-33); 220 L17K (4- (eicosanoylamino) butanoyl) -GLP-2 (1-33); A18 (3- (hexadecanoylamino) ropionyl) -GLP-2 (1-33) D21K (3- (hexadecanoylamino) ropionyl) -GLP-2 (1-33) N24K (3- (hexadecanoylamino) ropionyl) -GLP-2 ( 1-33) Q28K (3- (hexadecanoylamino) ropionyl) -GLP-2 (1-33) S5K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); S7K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33); D8K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); E9K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33); 10K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33) N11K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33) T12K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) I13 (3- (hexadecanoylamino) ropionyl) / 30R-GLP-2 (1-33) L14K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) D15K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33) N16K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) L17 (3- (octanoylamino) propionyl) / 30R-GLP-2 (1-33) L17K (3- (nonanoylamino) ropionyl) / K30R-GLP-2 (1-33) L17K (3- (decanoylamino) ropionyl) / K30R-GLP-2 (1-33) L17K (3- (undecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (dodecanoylamino) ropionyl) / K30R-GLP-2 (1-33); L17 (3- (tridekanoylamino) ropionyl) / K30R-GLP-2 (1-33); L17K (3- (tetradecanoylamino) propionyl) / K30R-GLP-2 (1-33) L17K (3- (pentadecanoylamino) propionyl) / K30R-GLP-2 (1-33) L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); 221 L17K (3- (heptadecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (octadecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (nonadecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (eicosanoylamino) propionyl) / K30R-GLP-2 (1-33) L17K ((S) -4-carboxy-4- (octanylamino) butanoyl) / 30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (nonanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (decanylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (undecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (dodecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (tridekanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (tetradecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (pentadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (hexadecanoylamino) butanoyl) / 30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (heptadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (octadecanoylamino) butanoyl) / 30R-GLP-2 (1-33), - L17K ((S) -4-carboxy-4- (nonadecanoylamino) butanoyl) / K30R- GLP-2 (1-33); L17K ((S) -4-carboxy-4- (eicosanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4 ~ (octanylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (nonanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (decanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (undecanoylamino) utanoyl) / K30R-GLP-2 (1-33); L17K (4- (dodecanoylamino) butanoyl) / 30R-GLP-2 (1-33); L17K (4- (tridekanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (tetradecanoylamino) butanoyl) / 30R-GLP-2 (1-33); L17K (4- (pentadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); 222 L17K (4- (hexadecanoylamino) butanoyl / K30R-GLP-2 (1-33); L17K (4- (heptadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (octadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (nonadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (eicosanoylamino) butanoyl) / K30R-GLP-2 (1 -33); A18K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33); D21K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); N24 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); Q28K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); D3E / S5K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / S7K (3- (hexadecanoylamino) ropionyl) / K30R / D33E-GLP-2 (1-33); D3E / D8K (3- (hexadecanoylamino) ropionyl) / K30R / D33E-GLP-2 (1-33); D3E / E9K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / M10K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / N11K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / T12KO- (hexadecanoylamino) propionyl) / K30R / D33E-GL P-2 (1-33); D3E / I13K (3- (hexadecanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33); D3E / L14K (3- (hexadecanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33); D3E / D15K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33) D3E / N16K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (octanylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (nonanoi lamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (decanoi lamino) ropionyl) / 30R / D33E-GLP-2 (1-33); D3E / L17K (3- (undecanoylamino) ropionyl) / K30R / D33E-GLP-2 (1-33) D3E / L17 (3- (dodecanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33) 223 D3E / L17K (3- (tridecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (tetradecanoylanno) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (pentadecanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33); D3E / L17K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (heptadecanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33); D3E / L17 (3- (octadecanoylamino) propionyl) / K 0R / D33E-GLP-2 (1-33); D3E / L17K (3- (nomdecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (eicosanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (octanylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (nonanoi lamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (decanylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17 ((S) -4-carboxy-4- (undecanoylamino) utanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (dodecanoylamino) butanoyl) / 30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (tridekanoylamino) butanoyl) / 30R / D33E-GLP-2 (1-33); D3E / L17 ((S) -4-carboxy-4- (tetradecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (pentadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4-242 (hexadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (heptadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) ~ 4-carboxy-4- (octadecanoylamino) utanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (nonadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (eicosanoylamino) butanoyl) / 30R / D33E-GLP-2 (1-33); D3E / L17K (4- (octanoylamino) utanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (nonane i lamino) utanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (decanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (unde cano i lamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (dodecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (tridekanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (tetradecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (pentadecanoylamino) butanoyl) / 30R / D33E-GLP-2 (1-33); D3E / L17K (4- (hexadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17 (4- (heptadecanoylamino) butanoyl) / 30R / D33E-GLP-2 (1-33); D3E / L17K (4- (octadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (nonadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (eicosanoylamino) utanoyl) / K30R / D33E-GLP-2 (1-33); D3E / A18K (3- (hexadecanoylamino) ropionyl) / K30R / D33E-GLP-2 (1-33); D3E / D21K (3- (hexadecanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33); D3E / N24K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); and 225 D3E / Q28K (3- (hexadecanoylane) propionyl) / K30R / D33E-GLP-2 (1-33). 78c. A method for preparing a physically stable pharmaceutical formulation of a GLP-2 derivative, wherein the GLP-2 derivative is a GLP-2 peptide, wherein a lipophilic substituent is linked, optionally via a spacer, to one or more residues of amino acid at a position relative to the amino acid sequence of SEQ ID NO: 1 independently selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L14, D15, N16, L17 , A18, D21, N24, and Q28, the method comprising preparing a formulation containing the GLP-2 derivative, and a buffer solution, wherein the GLP-2 derivative is present in a concentration from 0.1 mg / ml to 100 mg / ml, and where the formulation has a pH from 7.0 to 10. 79c. The method according to the embodiment 82c, wherein the pharmaceutical formulation is as defined in any of the modes lc-77c. 80c. A composition comprising a GLP-2 derivative, and a buffer solution, or a freeze-dried formulation thereof, wherein the GLP-2 derivative is a GLP-2 peptide, wherein a lipophilic substituent is linked, optionally by means of a spacer, to one or more amino acid residues in the position relative to the amino acid sequence of SEQ ID NO: 1 independently selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113 , L14, D15, N16, L17, A18, D21, N24, and Q28, in 226 wherein the GLP-2 derivative is presented in a concentration from 0.1 mg / ml to 100 mg / ml, and wherein the composition has a pH from 7.0 to 10. 81c. The composition according to the embodiment 80c also comprises water. 82c. A composition composition comprises an aqueous solution of a GLP-2 derivative, and a buffer solution, wherein the GLP-2 derivative is GLP-2 peptide, wherein a lipophilic substituent is linked, optionally by means of a spacer, to one or more amino acid residues at the position relative to the amino acid sequence of SEQ ID NO: 1 independently selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L14, D15, N16 , L17, A18, D21, N24, and Q28, wherein the GLP-2 derivative is presented in a concentration from 0.1 mg / ml to 100 mg / ml, and wherein the composition has a pH from 7.0 to 10. In the In this context, the three-letter or one-letter indications of the amino acids have been used in their conventional meaning as indicated in Table 1. Unless explicitly indicated, the amino acids mentioned herein are amino acids L. In addition, the ends of the left and right of a sequence of am of a peptide are, respectively, the N and C terms unless otherwise specified. 227 Table 1: Abbreviations for amino acids: Code of threeCode of a Amino Acid letter Glycine Gly G Proline Pro P Alaniña Wing A Valine Val V Leucine Leu L Isoleucine lie I Methionine Met M Cysteine Cys C Phenylalanine Phe F Tyrosine Tyr and Tryptophan Trp w Histidine His H Lysine Lys K Arginine Arg R Glutamine Gln Q Asparagine Asn N Glu E Acid Glutamic Acid Asp D aspartic Serine Ser S Threonine Thr T 228 The present invention is further illustrated by the following examples, which, however, are not constructed as limiting the scope of protection. The features described in the foregoing description and in the following examples may, both separately and in any combination thereof, be material for realizing the invention in various forms thereof. BRIEF DESCRIPTION OF THE FIGURES Fig. 1. The amino acid sequence of the 33 human GLP-2 residues. The N-terminal His-Ala indicates the split sequence of aminopeptidase dipeptidyl peptidase IV during the metabolism of GLP-2. The residues Arg20 and Lys30 are two basic amino acid residues in GLP-2. Fig. 2. Specific processing of proglucagon tissue in the pancreas and intestine. Fig. 3. Sequence alignment of highly conserved GLP-2 peptide. The amino acid residues in bold represent those that differ from the human GLP-2 sequence. Fig. 4. Quantification of the distribution of GLP-2R AR in various rat tissues. Fig.5 L17K1K30R-GLP-2 (1-33) acylated with β-alanine C16 Figs. 6a-6c. Examples with chemical structure of the use of different spacers according to the invention with the lipophilic substituent being a hexadecanoyl. 229 Fig. 7. Plasmid of S. cerevisiae for the expression and secretion of GLP-2 peptide analogues. Fig. 8. Bioassay in mice. Response study to the dose of GLP-2 derivatives. Observed data points (Mean ± SD) and placed curves of data of relative weights of the small intestine. Fig. 9. Bioassays in mice. Response study to the dose of GLP-2 derivatives. Residuals of relative data of the weight of the small intestine. Fig. 10. Bioassays in mice. Response study to the dose of GLP-2 derivatives. Observed data points (Means + SD) and placed curves of data of relative weights of the small intestine. Fig. 11. Bioassays in mice. Response study to the dose of GLP-2 derivatives. Residual data of the weight of the small intestine. Fig. 12. SEQ ID NO. 1, SEQ ID NO. 2, and SEQ ID NO. 3. EXAMPLES The following abbreviations are used: DDE: 1- (4,4-dimethyl-2,6-dioxocyclohex-l-ylidene) ethyl. DEC : ?,?' -diisopropylcarbodiimide. DIEA: diisopropylethylamine. HBTU: 2- (lH-Benzotriazol-1-yl) -1, 1,3,3-tetramethyluronium hexafluoro phosphate. HOAt: N-hydroxy-9-azabenzotriazole. 230 T BS: 2,4,6 trinitrobenzenesulfonic acid. DMF: N, N-Dimethylformamide. DCC: N, N-Dicyclohexylcarbodiimide. MP: N-Methyl-2-pyrrolidone. EDPA: N-Ethyl-N, N-diisopropylamine. EGTA: Ethylene glycol bis (ß-aminoethyl ether) -?,?,? ,? ' -tetraacetic GTP: Guanosin 5'-triphosphate. TFA: Trifluoroacetic acid. THF: Tetrahydrofuran. H-Glu (OH) -0Bufc: L-glutamic acid a-tert-butyl ester.

Cap-ONSu: 2,5-dioxopyrrolidin-1-yl ester of octanoic acid. Lau-ONSu: 2,5-dioxopyrrolidin-1-yl ester of dodecanoic acid Myr-ONSu: 2,5-dioxopyrrolidin-1-yl ester of tetradecanoic acid. Pal-ONSu: 2,5-dioxopyrrolidin-1-yl ester of hexadecanoic acid.

Ste-ONSu: 2,5-dioxopyrrolidin-l-yl ester of octadecanoic acid CLiAR: High resolution liquid chromatography, amu: units of atomic mass. Lit-Glu (ONSu) -OB ^ 1: β-2, 5-dioxopyrroline-1-yl ester of the α-t-butyl ester of IS ^ -Litocoyl-L-glutamic acid,. Cap-Glu (ONSu) -OBu11:? -2,5-dioxopyrrolidin-1-yl ester of the α-t-butyl ester of Na-octanoyl-L-glutamic acid. Cac-Glu (UNSu) -0Bufc:? -2,5-dioxopyrrolidin-1-yl ester of the α-t-butylyl ester of Nardecanoyl-L-glutamic acid. Lau-Glu (ONSu) -OBufc:? -2,5-dioxopyrrolidin-1-yl ester of the N -dodecanoyl-L-glutamic acid cc-t-butyl ester. Myr-Glu (ONSu) -OBu11:? -2,5-dioxopyrrolidin-1-yl ester of the isc-t-decadecanoyl-L-glutamic acid t-butyl ester.

Pal-Glu (ONSu) -OBufc: Diester-t-butyl-y-2, 5-dioxopyrrolidin-1-yl of Na-hexadecanoyl- (L) -glutamic acid. Ste-Glu (ONSu) -OBu Diester -t-butyl-y-2, 5-dioxopyrrolidin-1-yl of N-octadecanoyl- (L) -glutamic acid. Lau- -Ala-ONSu: 2,5-dioxopyrrolidin-1-yl ester of Np-Dodecanoyl-p-alanine. ??? - ß-Ala-ONSu: 2, 5-dioxopyrrolidin-1-yl ester of Np-tetradecanoyl-p-alanine Pal-P-Ala-ONSu: 2, 5-dioxopyrrolidin-1-yl ester of NP -hexadecanoyl-P-alanine. Lau-GABA-ONSu: 2, 5-dioxopyrrolidin-1-yl ester of Kf-dodecanoyl-y-aminobutyric acid. Myr-GABA-ONSu: 2, 5-dioxopyrrolidin-1-yl ester of Nr-tetradecanoyl-y-aminobutyric acid. Pal-GABA-ONSu: 2, 5-dioxopyrrolidin-1-yl ester of Is -Hexadecanoyl-y-aminobutyric acid. Ste-GABA-ONSu: 2, 5-dioxopyrrolidin-1-yl ester of NY-octadecanoyl-y-aminobutyric acid. 232 Pal-Isonip-ONSu: 2, 5-dioxopyrrolidin-1-yl ester of N-hexadecanoyl-piperidine-4-carboxylic acid. Pal-Glu (OBu ") -ONSu: α-t-butyl ester of the cis-2,5-dioxopyrrolidin-1-yl ester of JS ^ -Hexadecanoyl-L-glutamic acid HOOC- (CH2) s-COONSu : 2-5-dioxopyrrolidin-1-yl ester of α-carboxyheptanoic acid HOOC- (CH 2) lo-COONSu: 2,5-dioxopyrrolidin-1-yl ester of α-carboxiundecanoic acid HOOC- (CH 2) 12 -COONSu: 2-, 5-dioxopyrrolidin-1-yl ester of α-carboxitridecanoic acid, HOOC- (CH 2) 14-COONSu: 2, 5-dioxopyrrolidin-1-yl ester of α-carboxypentadecanoic acid, HOOC- (CH 2) ) 16-COONSu: 2-, 5-dioxopyrrolidin-1-yl ester of α-carboxyheptanoic acid HOOC- (CH 2) 18-COONSu: 2,5-dioxopyrrolidin-1-yl ester of β-carboxinonadecanoic acid. 1 Preparation of GLP-2 Peptide Analog Derivatives by Peptide Synthesis Acylation was given in the fully protected resin bound peptide, where only the e-amino group to be acylated is deprotected The peptide bound to the resin appropriately p Rotected is synthesized using Fmoc chemistry, for example; Boc- [1-33, Lys (Dde)] -Resin 233 | -2% Hydrazine / DMF treatment to remove the Dde group. 4- Acylation with Fmoc-Glu (? -OH) -OBufc by means of HOAt / DIC / DIEA / MP. |- Piperidine treatment to remove the Fmoc group. l Acylation with C16 acid by means of HOAt / DIC / DIEA / NMP. Deprotection TFA. | Purification CLAR. |1 Lyophilization • Analysis by CL-MS and analytical HPLC. The chain length of the fatty acid and the spacer can then be variable. Maintaining the position of fixed acylation, three spacers: β-glutamic acid, α-aminobutyric acid, β-alanine and non-spacer, and three fatty acids (C12, C14 and C16) as well as colic, lithocholic, and pentylbenzoic acids were tested Synthesis of Protected Peptidyl Resin: Protected Amino Acid Derivatives Used: Fmoc-Ala-OH, Fmoc-Arg (Pmc) -OH, Fmoc-Asn (Trt) -OH, Fmoc-Asp (OBut) -OH, Boc-His (Boc) ) -OH, Fmoc-His (Trt) -OH, Fmoc-Gln (Trt) -OH, Fmoc-Glu (OBut) -OH, Fmoc-Gly-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc -Lys (Boc) -OH, Fmoc-Lys (Dde) -OH, Boc-Lys (Fmoc) -OH, Fmoc-Met-OH, Fmoc-Phe-OH, Fmoc-Ser (But) -OH, Fmoc-Thr (But) -OH, Fmoc-Trp (Boc) -OH Synthesis of N -hexadecanoyl-Glu (ONSu) -OBu. "To a suspension of H-Glu (OH) -OBu11 (4.2 g, 20.6 mmol), 234 DMF (500 ml) and EDPA (2.65 g, 20.6 mmol) was added dropwise a solution of Pal-ONSu (7.3 g, 20.6 mmol) in DMF (100 ml). The reaction mixture was stirred for 64 hours at room temperature and then concentrated in vacuo to a total volume of 20 ml. The residue was partitioned between 10% aqueous citric acid (300 ml) and ethyl acetate (250 ml), and the phases were separated. The organic phase was concentrated in vacuo and the residue was dissolved in DMF (50 ml). The resulting solution was added dropwise to a 10% aqueous solution of citric acid (500 ml) maintained at 0 ° C. The precipitated compound was collected and washed with ice water and dried in a vacuum drying oven. The dried compound was dissolved in DMF (45 ml) and HONSu (2.15 g)., 18.7 mmol) was added. To the resulting mixture was added a solution of?,? '-dicyclohexylcarbodiimide (3.5 g, 17 mmol) in dichloromethane (67 ml). The reaction mixture was stirred for 16 hours at room temperature, and the precipitated compound was filtered off completely. The precipitate was recrystallized from n-heptane / 2-propanol to give the title compound (6.6 g, 72%). Example 2 Synthesis of D3E / L17K ((S) -4-carboxy-4- (hexadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33). 2. Synthesis of the protected peptidyl resin: The protected peptidyl resin was synthesized from 235 conformance with the Fmoc strategy on an Applied Biosystems 431A peptide synthesizer on a rare 0.25 scale using the FastMoc UV protocols supplied by the manufacturer, which employ HBTU (2 - (lH-Benzotriazol-1-yl) -1.1 , 3,3 tetramethyluronium hexafluorophosphate) by coupling in MMP (N-methyl pyrrolidone), and UV monitoring of the deprotection of the Fmoc protection group. The starting resin (400 mg) used for the synthesis was resin (4- ((2 ', 4'-dimethoxyphenyl) - (Fmoc-Glu (OBut) -Op-Benzyloxybenzyl (Wang resin) (Novabiochem, Bad Soden, Germany , cat. #: 04-12-2052) with a substitution capacity of 0.53 mmol / g The protected amino acid derivatives used were Fmoc-Ala-OH, Fmoc-Arg (Pmc) -OH, Fmoc-Asn (Trt) -OH, Fmoc-Asp (OBut) -OH, Boc-His (Boc) -OH, Fmoc-Gln (Trt) -OH, Fmoc-Glu (OBut) -OH, Fmoc-Gly-OH, Fmoc-Ile-OH , Fmoc-Leu-OH, Fmoc-Lys (DDE) -OH, Fmoc-Met-OH, Fmoc-Phe-OH, Fmoc-Ser (But) -OH, Fmoc-Thr (But) -OH, Fmoc-Tr ( Boc) -OH The yield was 870 mg of peptidyl resin 2.b Removal and acylation of Dde A to the protected peptidyl resin resulting from (1.a) (290 mg, 72 [mu] g) was added MMP (N-ethyl pyrrolidone) (2 ml), and a freshly prepared solution of 2% hydrazine hydrate in MP (10 ml). The reaction mixture was stirred for 3 minutes at room temperature, and then filtered (glass filter). More of the hydrazine solution (22 ml) was added in 236 the filter, the hydrazine was allowed to react for 15 minutes on the filter, and then it was completely filtered by applying vacuum. The resin was then extensively washed with NMP, dichloromethane and NMP. To the deprotected Dde resin in NMP ("5 mL) was added N-CiS-Glu-a-OtBu-y-ONSu (? -succinimidyl ester of the a-tert-butyl ester of Kf-hexadecanoyl-L acid. -glutamic) (4eq), and DIEA (diisopropylethylamine) (4 eq). The reaction mixture was stirred for 1 hour at room temperature. Then more N-Cis-Glu- -OtBu-y-ONSu (4eq) was added, along with DIEA (4 eq). The reaction mixture was stirred overnight at room temperature. The reaction mixture was filtered and the resin washed extensively with NMP, dichloromethane, 2-propanol, methanol and diethyl ether. 2.c Cleavage of the acylated peptide from the resin: The peptide was unfolded from the protected peptidyl resin when shaken with a mixture of TFA (trifluoroacetic acid) (2 ml), triisopropylsilane (50 μm) and water (50 μm) for 60 minutes at room temperature. The splitting mixture was filtered and the filtrate was concentrated to about 1 ml by a stream of nitrogen. The crude peptide was precipitated from this oil with diethyl ether (49.5 ml), washed 3 times with diethyl ether (3 times 50 ml) and dried to a white powder. 237 2. d Purification of the peptide: The crude peptide was dissolved in water / acetonitrile (65:35) (100 ml) was adjusted to pH 7.5 with H40H and purified by semi-preparative HPLC on a 25 mm x 250 mm column packed with 7 μ of silica C-18. The column was eluted with a gradient of 50 to 70% acetonitrile against 0.1% TFA / water at 10 ml / min at a temperature of 40 ° C for 47 minutes. Fractions containing peptides were collected, diluted with 3 volumes of water and lyophilized. The final product obtained was characterized by RP-CLAR / ion dew mass spectrometry (CLEM) (retention time and molecular mass) and by analytical RP-CLAR (retention time and amount of peptide). The amount of peptide was calculated by comparing the response of the UV detector with that of a GLP-2 standard where the amount has been determined by amino acid analysis. The RP-CLAR analysis was performed on a Vydac 218TP54 4.6mm x 250mm 5μ C-18 silica column (The Separations Group, Hesperia) with UV detection at 214 nm. The column was equilibrated with 0.1% TFA / H20 and eluted by a gradient of 0 to 90% of C¾CN against 0.1% TFA / water for 50 minutes at 42 ° C, with a flow rate of 0.5ml / minute. The retention time was found to be 35.8 minutes, and the peptide yield is 29.3mg. The LC-MS analysis was performed using a Symmetry 3.0 mm x 150 mm 5μ C-18 silica column (aters, Milford ??., 238 USA) that was eluted at 1 ml / min at room temperature. It was equilibrated with 5% CH3CM / 0.1% TFA / ¾0 and eluted by a gradient of 5% CH3CN / 0.1% TFA / H20 to 90% C¾CN / 0.1% TFA / ¾0 for 15 minutes. In addition to UV detection at 214nm, a fraction of the eluted column is introduced into the ion spray interface of a mass spectrometer PE-Sciex API 100. The mass range 300-3000 amu is checked every 2 seconds during the run . Using these conditions, the retention time of the product as determined from the UV trace is found to be 6.1 minutes, and the molecular mass is found to be 4204.4 amu, which is in accordance with the expected structure within the experimental error of the method ( ± 1 amu). Example 3 Synthesis of D3E / K30R / D33E / 34K ((S) -4-carboxy-4- (hexadecanoylamino) butanoyl) -GLP-2 (1-33) (Lys residue added at terminal C). The starting resin used for the synthesis was Fmoc-Lys (Dde) -2CI-Trityl resin, prepared from Fmoc-Lys (Dde) -OH and 2-CI-Trityl chloride resin (Novabiochem, Bad Soden, Germany . cat. #: 01-64-0114) after the procedure described by the manufacturer (substitution capacity of 1.13 mmol / g). Protected peptidyl resin (200mg, 85μ? T ?? 1) was synthesized in accordance with the Fmoc strategy as in 239 example (2a), D of deprotected and acylated with N-Ci6-Glu-a-OtBu-y-ONSu (? -succinimidyl ester of the oc-tert-butyl ester of hexadecanoyl-L-glutamic acid) as described in (2.b). The splitting from the resin and the purification were made in accordance with (2.c and 2.d). The retention time obtained under the elution conditions described in (2.d) was 36.7 minutes, and the yield of peptide was 1.3 mg. By CL-MS analysis of the product, a retention time of 6.6 minutes was found from the trace of UV, and the molecular mass was found to be 4319.4 amu, which is in accordance with the expected structure within the experimental error of the method (+ 1 amu). Example 4 Synthesis of D3E / L17K (4- (hexadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33). The protected peptidyl resin (200mg, 21μp ??1) was synthesized according to the Fmoc strategy as in example (2.a), Dde deprotected and acylated with C16-GABA-ONSu (N-hexadecanoyl succinimidyl ester -and-amino-butyric) as described in (2.b) for acylation with N-Ci6-Glu-cc-OtBu-y-ONSu. The splitting from the resin and the purification were made in accordance with (2.c and 2.d). The splitting from the resin and the 240 purification were made in accordance with example (2.c) and (2.d). The retention time obtained under the elution conditions described in (2.d) was 3S.5 minutes, and the yield of peptide was 1.9mg. By CL-MS analysis of the product, a retention time of 4.9 minutes was found from the trace of UV, and the molecular mass was found to be 4161.0 amu, which is in accordance with the expected structure within the experimental error of the method (± 1 amu). Example 5 Synthesis of D3E / L17K (3- (hexadecanoylamino) propionyl) K30R / D33E-GLP-2 (1-33). The protected peptidyl resin (200mg, 21μp ??1) was synthesized according to the Fmoc strategy as in example (2.a), Dde deprotected and acylated with Ci6-oil-P-Ala-ONSu (N-ester). hexadecanoyl-P-alanine-succinimidyl) as described in (2.b) for acylation with N-C1e-Glu- -OtBu-y-ONSu. The splitting from the resin and the purification were made in accordance with (2.c and 2.d). The splitting from the resin and the purification were made in accordance with (2.c and 2.d). The retention time obtained under the elution conditions described in (2.d) was 36.0 minutes, and the yield of peptide was 2.8 mg. 241 By CL-MS analysis of the product, a retention time of 4.7 minutes was found from the trace of UV, and the molecular mass was found to be 4146.6 amu, which is in accordance with the expected structure within the experimental error of the method (+ 1 amu).

Example 6 Synthesis of D3E / L17K (hexadecanoyl) / K30R / D33E-GLP-2 (1-33). The protected peptidyl resin (200mg, 21μ ??? 1) was synthesized in accordance with the Fraoc strategy as in example (2.a), Dde deprotected and acylated with Ci6-oil-0NSu (succinimidyl ester of hexadecanoic acid) as described in (2.b) for acylation with N-Ci6-Glu- -OtBu-y-ONSu.

The splitting from the resin and the purification were made in accordance with (2.c and 2.d). The retention time obtained under the elution conditions described in (2.d) was 36.9 minutes, and the peptide yield was 2.6 mg. By the CL-MS analysis of the product, a retention time of 5.1 minutes was found from the trace of UV, and the molecular mass was found to be 4076.4 amu, which is in accordance with the expected structure within the experimental error of the method (± 1 amu). 242 Example 7 Synthesis of D3E / L17K (colloyl) / K30R / D33E-GLP-2 (1-33). The protected peptidyl resin (250mg, 27μt ??1) was synthesized as in the example (2.a). The protective group Dde was removed as in example (2.b). To the mixture of cholic acid (817mg), HOAt (N-hydroxy-9-azabenzotriazole) (135mg) and DIC (N, N'-diisopropylcarbodiimide) (155μ1) was added a mixture of MP and dichloromethane (1: 1 v / v) (4ml). The reaction mixture was stirred at room temperature for 15 minutes. The peptidyl resin was then added, together with DIEA (diisopropylethylamine) (170μ1). The reaction mixture was stirred overnight at room temperature. The resin was then filtered, washed thoroughly with NMP, and then with dichloromethane, 2-propanol, methanol and diethyl ether. The splitting from the resin and the purification were made in accordance with (2.c and 2.d). The retention time obtained under the elution conditions described in (2.d) was 30.0 minutes, and the peptide yield was 2.2mg. By CL-MS analysis of the product, a retention time of 4.2 minutes was found from the trace of UV, and the molecular mass was found to be 4228.2 amu, which is in accordance with the expected structure within the experimental error of the method (± 1 amu). 243 Example 8 Synthesis of 1 H ((S) -4-carboxy-4- (hexadecanoylamino) butanoyl) / D3E / K30R / D33E-GLP-2 (1-33). 8.a Synthesis of the protected peptidyl resin: The protected peptidyl resin was synthesized according to the Fmoc strategy on an Applied Biosystems 431A peptide synthesizer on a 0.25 mmol scale using FastMoc UV protocols supplied by the manufacturer using mid-coupling by HBTU (2- (IH-Benzotriazol-1-yl-) -1,1,3, 3 tetramethyluronium hexafluorophosphate) in NMP (N-methyl pyrrolidone), and UV monitoring of the deprotection of the Fmoc protection group. The starting resin (454mg, 0.25mmol) used for the synthesis was resin (4 - ((2 ', 4'-dimethoxyphenyl) - (Fmoc-Glu (OBut) -Op-Benzyloxybenzyl (Wang resin) (Novabiochem, Bad Soden , Germany, cat. #: 04-12-2052) with a substitution capacity of 0.55 mmol / g The protected amino acid derivatives used were Fmoc-Ala-OH, Fmoc-Arg (Pmc) -OH, Fmoc-Asn ( Trt) -OH, Fmoc-Asp (OBut) -OH, Fmoc-His (Trt) -OH, Fmoc-Gln (Txt) -OH, Fmoc-Glu (OBut) OH, Fmoc-Gly-OH, Fmoc-Ile- OH, Fmoc-Leu-OH, Fmoc-Met-OH, Fmoc-Phe-OH, Fmoc-Ser (But) -OH, Fmoc-Thr (But) -OH, Fmoc-Trp (Boc) -OH. 1707 mg of peptidyl resin. 244 8. b Acylation. To the peptidyl resin (200mg, 29μt ??? 63) en_MP («5mi), was added N-C16-Glu-a-OtBu-y-ONSu (? -succinimidyl ester of the ester a-tert -butyl of Na-hexadecanoyl-L-glutamic acid) (4eq), and DIEA (diisopropylethylamine) (4 eq). The reaction mixture was stirred for 1 hour at room temperature. Then more N-Cis-Glu-a-OtBu-y-ONSu (4eq) was added, along with DIEA (4 eq). The reaction mixture was stirred overnight at room temperature. The reaction mixture was filtered and the resin washed extensively with NMP, dichloromethane or, 2-propanol, methanol and diethyl ether. The splitting from the resin and the purification were made in accordance with (2.c and 2.d). The retention time obtained under the elution conditions described in (2.d) was 37.0 minutes, and the yield of peptide was 6.0mg. By CL-MS analysis of the product, a retention time of 6.5 minutes was found from the trace of UV, and the molecular mass was found to be 4189.8 amu, which is in accordance with the expected structure within the experimental error of the method (± 1 amu). 245 Example 9 Synthesis of HIK-N5- ((S) -4-carboxy-4- (exadecanoylamino) butanoyl) / D3E / K30R / D33E-GLP-2 (1-33). 9.a Synthesis of the protected peptidyl resin: The protected peptidyl resin was synthesized according to the Fmoc strategy on an Applied Biosystems 431A peptide synthesizer on a 0.25 mmol scale using the FastMoc UV protocols supplied by the manufacturer using medium-sized couplings. HBTU (2- (lH-Benzotriazol-1-yl-) -1, 1,3, 3 tetramethyluronium hexafluorophosphate) in MP (N-methyl pyrrolidone), and UV monitoring of the deprotection of the Fmoc protection group. The starting resin (434mg, 0.24mmol) used for the synthesis was (4 - ((2 ', 4'-dimethoxyphenyl) - (Fmoc-Glu (OBut) -Op-Benzyloxybenzyl resin (Wang resin) (Novabiochem, Bad Soden, Germany, cat. #: 04-12-2052) with a substitution capacity of 0.55 mmol / g The protected amino acid derivatives used were Fmoc-Ala-OH, Fmoc-Arg (Pmc) -OH, Fmoc-Asn (Trt) -OH, Fmoc-Asp (OBut) -OH, Fmoc-His (Trt) -OH, Fmoc-Gl (Trt) -OH, Fmoc-Glu (OBut) -OH, Fmoc-Gly-OH, Fmoc Ile-OH, Fmoc-Leu-OH, Boc-Lys (Fmoc) -OH, Fmoc-Met-OH, Fmoc-Phe-OH, Fmoc-Ser (But) -OH, Fmoc-Thr (But) -OH, Fmoc -Trp (Boc) -OH The yield was 1551mg of peptidyl resin. 246 9. b Acylation To the peptidyl resin (200mg, 31 μt 1 1ß3) in NMP (¾ 5ml), N-Cig-Glu-a-OtBu-y-ONSu (β-succinyrazidyl ester of the C-C ester) was added. tert-butyl of Na-hexadecanoyl-L-glutamic acid) (4eq), and DIEA (diisopropylethylamine) (4 eq). The reaction mixture was stirred for 1 hour at room temperature. Then more N-Cls-Glu-a-OtBu-y-ONSu (4eq) was added, along with DIEA (4 eq). The reaction mixture was stirred overnight at room temperature. The reaction mixture was filtered and the resin washed extensively with NMP, dichloromethane, 2-propanol, methanol and diethyl ether. The splitting from the resin and the purification were made in accordance with (2.c and 2.d). The retention time obtained under the elution conditions described in (2.d) was 36.8min, and the yield of the peptide was 4.4mg. By CL-MS analysis of the product, a retention time of 6.4 minutes was found from the trace of UV, and the molecular mass was found to be 4180.2 amu, which is in accordance with the expected structure within the experimental error of the method (± 1 amu). 247 Example 10 Synthesis of HIK-N0- ((S) -4-carboxy- (hexadecanoylamino) butanoyl) / D3E / K30R / D33E-GLP-2 (1-33) 10.a Synthesis of the protected peptidyl resin : The protected peptidyl resin was synthesized according to the Fmoc strategy on an Applied Biosystems 431A peptide synthesizer on a 0.25 mmol scale using the FastMoc UV protocols supplied by the manufacturer which linkages mediated by HBTU (2- (1H-Benzotriazole-) hexafluorophosphate. l-il-) -1, 1, 3, 3 tetramethyluronium) in NMP (N-methyl pyrrolidone), and UV monitoring of the deprotection of the Fmoc protection group.The starting resin (455mg, 0.25mmol) used for the synthesis it was resin (4- ((2 ', 4' -dimethoxyphenyl) - (Fmoc-Glu (OBut) -Op-Benzyloxybenzyl (Wang resin) (Novabiochem, Bad Soden, Germany, cat. #: 04-12-2052) with a substitution capacity of 0.55 mmol / g The protected amino acid derivatives used were Fmoc-Ala-OH, Fmoc-Arg (Pmc) -OH, Fmoc-Asn (Trt) -OH, Fmoc-Asp (OB ut) -OH, Fmoc-His (Trt) -OH, Fmoc-Gln (Trt) -OH, Fmoc-Glu (OBut) OH, Fmoc-Gly-OH,. Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Thys (Dde) -OH, Fmoc-Met-OH, Fmoc-Phe-OH, Fmoc-Ser (But) -OH, Fmoc-Thr (But) -OH , Fmoc-Trp (Boc) -OH. The yield was 1167mg of peptidyl resin. 248 10. b Acylation To the peptidyl resin (200mg, 43μt ≤ 1e3) in NMP («5ml), N-Ci6-Glu-a-OtBu-y-ONSu (β-succinimidyl ester of the α-tertiary ester) was added. butyl of Na-hexadecanoyl-L-glutainic acid) (4eq), and DIEA (diisopropylethylamine) (4 eq). The reaction mixture was stirred for 1 hour at room temperature. Then more N-Cis-Glu-a-OtBu-y-ONSu (4eq) was added, along with DIEA (4 eq). The reaction mixture was stirred overnight at room temperature. The reaction mixture was filtered and the resin washed extensively with NMP, dichloromethane, 2-propanol, methanol and diethyl ether. The protecting group Dde was then removed as in (2.b). The splitting from the resin and the purification were made in accordance with (2.c and 2.d). The retention time obtained under the elution conditions described in (2.d) was 37.0 minutes, and the peptide yield was 4.0 mg. By CL-MS analysis of the product, a retention time of 6.5 minutes was found from the UV trace, and the molecular mass was found to be 4180.2 amu, which is in accordance with the expected structure within the experimental error of the method (± 1 amu). 249 The characterization includes the retention time in an analytical RP-CLAR system, retention time in a LC-MS system and a molecular weight determination in the LC-MS system. The total amount of the peptide synthesized was calculated by comparing the peak areas with those of the GLP-2 standard. The results obtained are summarized in Table 2.

Table 2: CLAR characterization and mass spectrometry of synthesized GLP-2 derivatives. CLAR, tr (mn): retention time in minutes in the RP-CLAR system (see methods). LS-EM, tr (mn): retention time in minutes in the RP-CLAR system / ion dew mass spectrometry (see methods). PM: Molecular weight. 250 EXAMPLE 2 Construction of synthesis block: Construction of block 1 ester of mono-tert-butyl of EicosAndioic acid: added to eicosandioic acid (3 g, 8.76 mmol) 251 toluene (25 mL) and N, N-dimethylformamide di-tert-butylacetal (2.1 mL, 8.76 mmol). The mixture was heated at 95 ° C for 30 minutes, the mixture was filtered and evaporated in an oil, which was redissolved in dichloromethane and washed with water. The organic phase was dried and evaporated to give 722 mg (21%) of the title compound, which was subsequently used without any further purification. NMR (CDC13): d 10.90 (br s, 1H), 2.35 (t, 2H), 20 (t, 2H), 1.60 (m, 4H), 1.45 (s, 9H); 1.40-1.20 (m, 28H).

Synthesis of L17K (3- (α-caboxypentadecanoylamino) propionyl) K30R / D33E-GLP-2 (1-33) 59.a Synthesis of the protected peptidyl resin: The protected peptidyl resin was synthesized according to the Fmoc strategy in an Applied Biosystems 431A peptide synthesizer on a 0.25 mol scale using FastMoc UV protocols supplied by the manufacturer which used mid-HBTU (2-H-Benzotriazol-1-yl-) -1,1,3,3 tetramethyluronium hexafluorophosphate linkages) or HATU (0- (7-azabenzotriazol-1-yl) -1, 1, 3, 3-tetramethyluronium hexafluorophosphate) in MP (N-methylpyrrolidone), and UV is monitored for deprotection of the protection of the Fmoc group. The starting resin (400 mg) which was used for the synthesis was the resin (4 - ((2 ', 4'-dimethoxyphenyl) - (Fmoc-Glu (OBut) -O-p-Benzyloxybenzyl (resin 252 Wang) (Novabiochem, Bad Soden, Germany cat. #: 04-12-2052) with a substitution capacity of 0.53 mmol / g. The protected amino acid derivatives used were Fmoc-Ala-OH, Fmoc-Arg (Pmc) -OH, Fmoc-Asn (Trt) -OH, Fmoc-As (OBut) -OH, Boc-His (Boc) -OH, Fmoc -Gln (Trt) -OH, · Fmoc-Glu (OBut) -OH, Fmoc- (FmocHmb) Gly-OH, Fmoc-lle-OH, Fmoc-Leu-OH, Fmoc-Lys (DDE) -OH, Fmoc Met-OH, Fmoc-Phe-OH, Fmoc-Ser (But) -OH, Fmoc-Thr (But) -OH, Fmoc-Trp (Boc) -OH. 59.b Removal and acylation of Dde A to the protected peptidyl resin resulting from (59. a) (300 mg, 75, μt ???) was added a fresh solution prepared from hydrazine hydrate 2% in NMP (12ML). The reaction mixture was stirred for 3 minutes at room temperature, and then filtered. More hydrazine solution (20 mL) was added to the reaction mixture, stirred for 15 minutes and then filtered. The resin was then washed extensively with NMP (5 x 20 mL). Fmoc-beta-alanine (93. mg, 0.30 mmol), 3-hydroxy-l, 2,3-benzotriazin- (3H) -one (49 mg, 0.30 mmol) and diisopropylethylamine (13 μL, 0.075 mmol) were dissolved in NMP (20 mL) and added to the Dde deprotection resin,?,? -diisopropylcarbodiimide (46 μL, 0.3 mmol) and the mixture was stirred overnight. The resin was filtered and washed with NMP (5 x 20 mL). The resin was treated with piperidine (20% in NMP, 20 mL) for 10 minutes, followed by another 253 Piperidine treatment (20% in NMP, 20 mL) for 10 minutes. The resin was filtered and washed with NMP. (5 x 20 mL).

The mono- (2, 5-dioxopyrrolidin-1-yl) hexadecanedioic acid ester (Ebashi et al. EP511600) (107 mg, 0.3 mmol) was dissolved in NMP (20 mL), added to the resin and stirred for the night at room temperature. The reaction mixture was filtered and the resin washed extensively with NMP, dichloromethane, 2-propanol, methanol and diethyl ether. 2. c Release of acylated peptide from the resin: The peptide was unfolded from the protected peptidyl resin by shaking with a mixture of TFA (trifluoroacetic acid) (20 ml), triisopropylsilane (500 μl) and water (500 μl) during 60 minutes at room temperature. The splitting mixture was filtered and the filtrate was concentrated to approximately 2 ml by a stream of nitrogen. The crude peptide was precipitated from this oil with diethyl ether (10 ml), washed 3 times with diethyl ether (3 times 10 ml) and dried to a white powder. 2. d Peptide purification: The crude peptide was dissolved in water / acetonitrile (65:35) until pH 7.5 was adjusted with NH4OH and purified by preparative HPLC (Water, Prep LC2000) in a 25 mm x 250 mm column packed with C- 18 silica. The column eluted with 254 a gradient of 43 to 60% acetonitrile against 0.1% TFA / water at 10 ml / minutes at room temperature for 40 minutes. Fractions containing the peptide were collected, diluted with 3 volumes of water and lyophilized, yield determined by dry weight 21 mg. The final product was characterized by RP-CLAR / ion spray mass spectrometry (LC-MS) (retention time and molecular mass) The LC-MS analysis was carried out using a Symmetry 3.0 mm x 150 mm silica column 5μ C-18 (Waters, Milford MA., USA) which was eluted at 1 ml / minute at room temperature. This was equilibrated with 5% CH3CN / 0.1% TFA / ¾0 and eluted by a gradient of 5% CH3CN / 0.1% TFA / ¾0 to 90% CH3CN / 0.1% TFA / H20 for 10 min. In addition to the UV detection at 214 nm, a fraction of the elution column was introduced into the ion spray interface of a mass spectrometer PE-Sciex API 100. The mass range 300-2000 amu was checked every 2 seconds during the run. Using these conditions, the retention time of the product determined from the UV trace was found to be .3.84 minutes, and the molecular mass peaks identified were 1042.1 (m / 4) and 1388.6 (m / 3) which are in accordance with the expected structure within the experimental error of the method (± 1 amu). 255 Example 60 Synthesis of L17K (3- (o-caboxinonadecanoylamino) ropionyl) K30R / D33E-GLP-2 (1-33) The protected peptidyl resin (100 mg, 25 μt ??) was synthesized according to the Fmoc strategy as in the example (59.a), D of deprotected and acylated with Fmoc-beta-alanine followed by removal of the Fmoc group is given as described in 59. b. The acylation with mono-tert-butyl ester of eicosandioic acid is given as follows. The mono-tert-butyl ester of eicosandioic acid (40 mg, 0.1 mmol), 3-idroxy-1,2, 3-benzotriazin-4 (3H) -one (16 mg, 0.1 mmol) and diisopropylethylamine (4 μL, 0.025) mmol) was dissolved in NMP (2 mL) and added to the deprotected Fmoc resin,?,? -diisopropylcarbodiimide (15 μL, 0.1 mmol) and the mixture was stirred overnight. The splitting of the resin and purification is given according to (59. c and 59. d). The final product obtained was characterized by RP-CLAR / ion spray mass spectrometry (LC-MS) (retention time and molecular mass) and by analytical RP-CLAR (retention time and amount of peptide). The amount of peptide was calculated by comparing the UV response detector with that of a GLP-2 standard where the amount was determined by amino acid analysis. The RP-CLAR analysis was carried out on a Vydac column 218TP54 4.6mm 256 x 250mm 5μ C-18 silica (The Separations Group, Hesperia) with UV detection at 214 nm. The column was equilibrated with 0.1% TFA / H20 and eluted by a gradient of 0 to 90% CH3CN agonist 0.1% TFA / water for 50 minutes at 42 ° C, with a flow of 0.5 ml / min. The retention time was found to be 35.0 min. , and the yield of peptide was 100 μg. The CL-EM analysis of the product gave the same conditions as described in 59. d, a retention time of 4.25 minutes was found from the UV trace, and the identified molecular mass peaks were 1055.1 (m / 4) and 1407.6 (m / 3) which are in accordance with the expected structure. Example 61 Preparation of GLP-2 peptide analogs by recombinant technology in yeast. The yeast expression system The host strain, which was used to express the GLP-2 precursors is a polyploid strain designated ME1719. ME1719 has phenotypes which lack two aspartyl proteases, that is, (1) yapsin 1 (previously called YAP3p) which split the terminal C side of mono or dibasic amino acid residues (Egel-Mitani, M, Flygenring , HA &; Hansen, M. T., YEAST 6: 127-137, 1990) and (2) vacuolar protease A (PRAlp) responsible for the activation of other proteases such as protease B, carboxypeptidase Y, aminopeptidase I, R asa, alkaline phosphatase, trehalase acid 257 and exopolyphosphatase. ME1719 can stably produce small peptides in high yield, which contains mono or dibasic amino acids. Among other peptides, such as glucagon and GLP-1, GLP-2 is the most advantageous for using this yeast strain (Egel-Mitani., M., Brandt, J. and Vad, K.: Method for the production of polypeptides is described in US Pat. No. 6,110, 703, 29.08.2000 and Egel-Mitani, M., Anderson, AS, Diers, I, Hach, M., Thim, L., Hastrup, S. and Vad, K.: Enzyme and Microbial Technology 26: 671-677-2000). However, the triosephosphate isomerase (TP11) gene has been broken in this strain, whose phenotype makes it possible to use glucose as a selection marker for yeast transformants, which allows obtaining a high biomass, high yield so far in continuous fermentation . In order to express human GLP-2 in yeast, S. cerevisiae, in which the human amino acid sequence is obtained from EMBL (V01515 HSGLUC), the use of the yeast codon was introduced to optimize GLP-2 production. In the present example the data for four plasmids of analogous expression of GLP-2 peptide are included; 1) A2G-GLP-2 (1-33), 2) M10K / 30R-GLP-2 (1-33), 3) M10L / L17K / K30R-GLP-2 (1-33), 4) L17K / K30R -GLP-2 (1-33). Amino acid DNA mutations are made in accordance with the wild-type amino acid sequence 258 (HADGSFSDEMNTILDNLAARDFINWLIQTKI D) with the corresponding use of yeast codon. The DNA sequence of GLP-2 peptide analogs is inserted into an expression vector (Fig. 7). As shown in Fig. 7, expression of GLP-2 is driven by the T-PI promoter, the leader sequence of MFoc signal followed by the GLP-2 coding sequence inserted within the restriction enzyme sites Ncol and Xbal . Methods for preparing a DNA construct using the polymerase chain reaction using specific primers are well known to those skilled in the art (PCR reference Proto-cols, 1990, Academic Press, San Diego, California, USA) and can used for the preparation of any GLP-2 peptide analogue according to the invention. Fermentation and yield determination For small scale batch cultures, the transformants are inoculated into 5 ml of YPD + Ca2 + medium (1% yeast extract, 2% peptone, 5mM CaCl2) and cultivated with shaking (200rpm) to 30 ° C for 3 days. The culture supernatants are analyzed by HPLC after the cells have been removed by centrifugation. The following CLAR method is used: Column: C4 Jupiter, 300Á, 5um, 4.6x250mm Buffer solution A: 0.10% TFA Buffer B: 0.07% TFA in CH3CN 259 Flow: 1 ml / min Gradient: 30-60% B for 15 min at room temperature. The following yields of GLP-2 peptide analogs are obtained in small scale cultures (5 ml) in host strain ME1729: Purification and characterization All GLP-2 peptide analogs according to the present invention can be purified using the general purification scheme that follows: No Global Performance Stage 1 Fermentation Fluid 100% t 2 Capture Column 75% t 3 Precipitation 71% t 4 Hydroxyapatite Column 60% t 5 Source Column 30Q 53% t 6 Column RP-CLAR 45% t 7 Precipitation 43% 260 The purified peptides are analyzed by amino acid sequence analysis and mass spectrometry. The N-terminal amino acid sequences are determined by automated Edman degradations using a model 494 protein sequencer from Applied Biosystem essentially as described by the manufacturer. By using an optimizing system, it is possible to determine the partial sequence of either as 300-500 fmol of the peptide. The mass spectrometric analysis is performed on a Voyager RP MALDI-TOF instrument (Perseptive Biosystems Inc., Framingham, ??) equipped with a nitrogen laser (337 nm). The instrument is operated in a linear mode with delayed extraction, and the voltage acceleration at the ion source was 25kV. The preparation of the sample is done as follows: 1 μ? of sample solution with 1 μ? of matrix solution (alpha-cyano-4-hydroxy-cinnamic acid dissolved in 5: 4: 1 (v / v / v) of acetonitrile: water mixture: 3% (v / v) of TFA) and deposited 1 μ? on the sample plate and allowed to dry. Calibration is performed using external standards and the accuracy of mass determinations is within 0.1%.

PM Peptide Found Calculated PM GLP-2 Native 3767 3766.2 A2GLP-2 (1-33) 3751 3752.1 M10K / K30R-GLP-2 (1-33) 3733 3805.2 M10L / L17K / K30R-GLP-2 (1-33) 3793 3791.2 L17K / K30R-GLP-2 (1-33) 3809 3809.2 261 Preparation of GLP-2 derivatives from the GLP-2 peptides prepared by recombinant technology in yeast. The following general procedure was used for the acylation of GLP-2 peptides prepared by recombinant technology in yeast: 50 mg of the lyophilized peptide was dissolved in 3.2 ml of water at 4 ° C. The pH was adjusted to 12.2 with 1M NaOH. The solution was allowed to stand for 2 minutes at 10 ° C and the pH was adjusted to 9.5 with 1 M HAc. 7 xuL of cold N-Methyl-2-pyrrolidone at 4 ° C (NMP) was added and the temperature adjusted to 10 ° C. The pH was adjusted to 11.5 with triethylamine. The acylation reagent (e.g., Pal-β-Ala-ONSu) was dissolved in NMP to a concentration of 20 mg / ml. A volume of 0.78 ml of this solution was added to the peptide solution and the acylation reaction was allowed to continue for 15 minutes at 15 ° C under agitation. The reaction was stopped by the addition of 0.55 ml of a 100 mg / ml glycine solution and the pH was adjusted to 8.5 with 5M HAc. The acylated GLP-2 peptide analog was purified by RP-CLAR. Examples of different acylation reagents that may be used in accordance with this example include but are not limited to: Lau-Glu (ONSuJ-OBu ester? -2,5-dioxypyrrolidin-1-yl of the at-butyl ester of Is. -Dodecanoil-L-glutamic. 262 Pal-Glu (ONSu) -OBut: diester oc-t-butyl-y-2, 5-dioxypyrrolidin-l-yl of Na-hexadecanoyl- (L) -glutamic acid. Lau - ^ - Ala-ONSu: 2,5-dioxopyrrolidin-1-yl ester of? Β-Dodecanoil-β-alaniña. Myr- -Ala-ONSu: β-Tetradecanoyl-fé-alanine 2,5-dioxopyrrolidin-1-yl ester. Pal-P-Ala-ONSu: 2,5-dioxopyrrolidin-1-yl ester of Ns-Hexadecanoyl-S-alanine. Lau-GABA-ONSu: 2,5-dioxopyrrolidin-1-yl ester of ??-Docecanoyl-β-aminobutyric acid. Myr-GABA-ONSu: 2, 5-dioxopyrrolidin-1-yl ester of NY-Tetradecanoyl-y-aminobutyric acid. Pal-GABA-ONSu: 2, 5-dioxypyrrolidin-1-yl ester of NY-Hexadecanoyl-y-aminobutyric acid. Ste-GABA-ONSu: 2, 5-dioxopyrrolidin-1-yl ester of NY-Octadecanoyl-y-aminobutyric acid.

Purification and characterization of acylated GLP-2 peptide analogs (GLP-2 derivatives): The acylated analogues were purified using the following general scheme: Acylated analogues are characterized by mass spectrometry analysis as described. Example 62 Bioassay in mice. Study of response to the dose of GLP-2 derivatives. Table 3. The model parameter is estimated following a nonlinear regression analysis of doses and the weights of the small intestine in relation to body weight. Table 4. The model parameter is estimated following the non-linear regression analysis of doses and the weights of the small intestine. Table 5. Body weight, small intestine weight and relative small intestine weight of mice treated with L17 (3- (tetradecanoylamino) propionyl) / K30R-GLP-2 (1-33). Table 6. Body weight, weight of the small intestine and relative small intestine weight of mice treated with L17K (3- (hexadecanoylamino) propionyl) / 30R-GLP-2 (1-33). 264 Table 7. Body weight, weight of the small intestine and relative small intestine weight of mice treated with A2G-GLP-2 (1-33). Table 8. Body weight, weight of the small intestine and relative small intestine weight of control mice. GLP-2 derivatives are developed for the treatment of people with various gastrointestinal diseases including small bowel syndrome. The objective of the present study is to establish the dose-response relationship of the induced growth GLP-2 derivative of the small intestine of mice using L17K (3- (tetradecanoylamino) propionyl) / K30R-GLP-2 (1-33), L17K (3 - (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33), and A2G-GLP-2 (1-33) in 7 days, subcutaneous doses for 10 days. The following GLP-2 derivatives and analogs were tested: 1. L17K (3- (tetradecanoylamino) propionyl) / K30R-GLP-2 (1-33). 2. L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33). 3. A2G-GLP-2 (1-33). All the derivatives were dissolved and diluted in buffer containing: 1.42 mg / ml disodium acid phosphate, 36.9 mg / ml mannitol, 5 mg / ml phenol, pH 8.0. 189 female C57B1 mice were used in this study. 265 All the animals are divided into four groups: Group 1: Controls Group 2: L17 (3 - (tetradecanoylamino) propionyl) / K30R-GLP-2 (1-33) Group 3: L17 (3- (hexadecanoylamino) ropionyl) / K3 OR-GLP-2 (1-33) Group 4: A2G-GLP-2 (1-33) Dosage All animals receive a daily subcutaneous injection of 100 μ? for 10 days with the following dose: Dosage ^ g group Treatment A B C D E F G 1 Saline Control 2 L17K (3- 22 11 5.5 2.75 1.375 0.678 0.344 tetradecanoyl amino) own nil) / K30R-GLP-2 (1-33) 3 L17K (3-35 17.5 8.75 4.375 2.188 1.094 0.547 hexadecanoylamino) propionyl) / K 30R-GLP-2 (1-33) 4 A2GGLP-2 (1-33) 33 16.5 8.25 4.125 2.063 1.031 0.512 266 Samples On day 10 the animals are weighed before being sacrificed. The intestine of each animal is carefully removed and the small intestine is dissected, rinsed with saline and weighed. Data analysis The body weight, weight of the small intestine and weight of the small intestine in relation to body weight is reported for all animals and is used generating the dose-response relationship. The treatment-induced increase in absolute and relative small bowel weights is calculated for each treatment group, since this is considered the pharmacologically relevant efficacy parameter. A Michaelis-Menten model generalized, with factor? of accuracy corresponding to Hillslope in the semilogarithmic dose-response curve and ED represents the level of efficacy of support at D = 0, was used as the dose-response model. The Emax is the maximum effect observed and ED50 is the dose that gives an effect equal to 50% of Eraax. The model was used because of its greater flexibility compared to a four-parameter logical dose-response model (1). The model was adjusted for data using nonlinear regression in order to determine the estimates for Emax, ED50,? and E0. 267 The virtue of the adjustment was evaluated by visual inspection of the groups showing observed data points along with placed curves and residual points. The estimated parameters are presented together with CV% and 95% C.I.

In order to count the variability in the level of backup efficacy, control data are included in the non-linear regression analysis as D = 0 for all three treatment groups. Non-linear regression analyzes were performed using WinNonlin professional, version 3.1, P arsight. The non-linear regression was performed using the algorithm (Levenberg and Hartley). Results Body weight, small intestine weight and relative small intestine weight are shown for all animals from each dose level and treatment groups in tables 5-8. The results of the non-linear regression analysis and the placed curve of the dose-response model for the weight of the small intestine and the weight data of the relative small intestine are shown in Tables 3 and 4 and Figures 8-11. 268 The dose response ratios are visualized in Figures 8 and 10. Response curves at similar doses are observed for the L17K (3- (tetradecanoylamino) propionyl) / K30R-GLP-2 (1-33) and L17K derivatives (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33) when the weight of the small intestine and the weight of the relative small intestine are used as effective parameters. This indicates that the effect of the treatment on body weights is not misrepresented with the dose response relationship for any of the derivatives. For A2G-GLP-2 (1-33) however, is a plane identified? different when the weight of the small intestine is used as an effective parameter. This is not observed for relative small bowel weight, which indicates that the treatment will affect body weight or that effective levels may be distinguished from backup levels. The adjustments of the curve in Figures 8 and 10 indicate that the model can adequately describe the dose-response relationship between weight and dose of the small intestine, and in relation to weight and in relation to the weight and dose of the small intestine. the three compounds tested. No systematic trends appear nor in the residual groups in Figures 9 and 11. Therefore, an error in the model can not be observed. The parameter estimates in Tables 3 and 4 show E0 levels that are estimated with near-high accuracy 269 (CV% < 5) when both the weight of the small intestine and the weight data of the relative small intestine are examined. Estimated higher Emax are obtained for both L17K (3- (tetradecanoylamino) propionyl) / K30R-GLP-2 (1-33) and L17K (3- (hexadecanoylatinum) propionyl) / 30R-G] _iP-2 (1-33) ) compared to A2G-GLP-2 (1-33). The increase in compared to A2G-GLP-2 (1-33) was 33% and 16% when using the relative small intestine weight as an effective parameter for L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP- 2 (1-33) and L17K (3 - (tetradecanoylamino) propionyl) / K3 OR-GLP-2 (1-33) respectively and 67% and 34% when the weight of the small intestine is used. The treatment-induced increase (Emax-E0) in the weight of the small intestine and the weight of the relative small intestine is determined as a secondary parameter during the procedure of location of the curve. An increase of 1.7 and 2.5 times greater in relation to the weight of the intestine compared to A2G-GLP-2 (1-33) is observed for L17K (3- (tetradecanoylamino) propionyl) / K3 OR-GLP-2 (1-33) and L17K (3- (hexadecanoylamino) propionyl) / K3 OR-GLP-2 (1-33) respectively. The increase when the weight of the absolute small intestine was measured was 4.9 and 8.6 times higher respectively. A relatively low accuracy in the ED50 estimate is observed for A2G-GLP-2 (1-33) due to the close interval between the backup level and the Emax level, in the case of relative weight placement of the small intestine, 270 because the full dose-response curve should be obtained. This was to a certain degree true for L17K (3- (hexadecanoylamino) propionyl) / K30R GLP-2 (1-33) since the most baa dose used induces an effect corresponding to 30-40% of E ^. The lack of information in the initial part of the dose-response curve would reduce the precision when estimating the ED50 value. In general, through the estimates for ED50 obtained by L17K (3- (tetradecanoylamino) propionyl) / K30R-GLP-2 (1-33) and L17K (3- (hexadecanoylamino) ropionyl) / K3 OR-GLP-2 (1 -33) the size is compared and they are comparable in size and much smaller than those estimated for A2G-GLP-2 (1-33). However due to a large variation in ED50 a relative power estimate between the test derivatives is difficult. In conclusion, L17 (3- (hexadecanoylamino) ropionyl) / 30R-GLP-2 (1-33) and L17K (3- (tetradecanoylamino) propionyl) / K3 OR-GLP-2 (1-33) induces 67% and 34% increase in Emax compared to A2G-GLP-2 (1-33). An 8-fold increase in small bowel weight is induced by L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) compared to one induced by A2G-GLP-2 (1-33) . 271 Table 3. Estimation of the model parameter following a nonlinear regression analysis of doses and weights of the small intestine in relation to body weight.

L17K (3- L17K (3- (tet- (hexa- Treatment A2G-GLP-2 (1-33) radecanoylamino) pro decane and lamtno) propion i IJ / K30R-pionil) / K30R-GLP-GLP-2. { 1-33) 2 (1-33) Estimated parameters (CV%) 0.0425 (2.4) 0.0426 (3.0) 0.0424 (2.9) Ema 0.0548 (33.3) 0.0636 (2.2) 0.0727 (5.4) EDso (pg) 15.04 (470) 1.00 (18.5) 0.90 (41.3) 0. 0123 (151) 0.0211 (9.3) 0.0303 (13.7) And 0.6625 (109) 2.0485 (32.2) 0.7249 (41.2) 95% Confidence Intervals ¾ 0.0405 - 0.0446 0.0400 - 0.0451 0.0399-0.0449 0. 0184-0.0912 0.0609 - 0.0663 0.0649-0.0805 ED50 0-156.17 0.63-1.37 0.16-1.65 -0.0278 - 0.0503 0.0234-0.0296 0.0256 - 0.O407 Y -0.7761-2.1012 0.7336-3.3633 0.1284-1.3214 272 Table 4. Estimates of the model parameter following a non-linear regression analysis of doses and weights of the small intestine. L17K (3- L17K (3- Treatment A2G-GLP-2 (1-33) (tet- (hexadecanoylamino) radecane and larnino) propionate) / K30R-1) / K30R-GLP-2 (1-33) GLP-2 (1-33) Estimated parameters (CV%) ¾ (g) 1.1095 (2.0) 1.0993 (3.5) 1.1008 (3.8) E ™ x (g) 1.2180 (2.3) 1.6270 (2.9) 2.0310 (13.1) EDso (g) 3.98 (70.9) 1.09 (25.0) 1.99 (111) In »» - Eo (g) 0.1085 (34.8) 0.5278 (12.3) 0.9302 (29.3) and 8.4169 (1869) 1.8184 (38.9) 0.5889 ( 52.9) 95% Confidence intervals Eo (g) 1.0661-1.1529 1.0219-1.1768 1.0175-1.1842 Emax (g) 1.1613-1.2748 1.5345-1.7195 1.4999-2.5621 EDR, (pg) 0-9.60 0.55-1.64 0-6.40 E ™, - Eo (g) 0.0345 - 0.1837 0.4021 -0.6579 0.3967-1.4725 and -305.2302-322.0639 0.4085-3.2282 -0.0320-1.2099 273 Table 5. Body weight, small intestine weight and relative small intestine weight of mice treated with L17 (3- (tetradecanoylamino) propionyl) / K30R-GLP-2 (1-33). Weight Weight of intestine Weight of intestine Level of Slim body dose slim / weight body dose g 9 25.88 1.45 0.0560 27.59 1.75 0.0634 26.57 1.60 0.0602 24.31 1.54 0.0633 A 22 24.11 1.27 0.0527 24.48 1.53 0.0625 25.25 1.78 0.0705 23.14 1.23 0.0532 Mean ± SD 25.17 ± 1.45 1.5188 ± 0.1996 0.0602 ± 0.0060 B 11 24.04 27.14 1.83 0.0674 274 22. 35 1.60 0.0716 29.45 2.09 0.0710 28.00 1.55 0.0554 24.29 1.83 0.0753 25.54 1.63 0.0638 26.59 1.71 0.0643 Mean ± SD 25.93 ± 2.32 1.7486 ± 0.1857 0.0670 ± 0.0066 25.94 1.51 0.0582 28.15 2.00 0.0710 22.40 1.57 0.0701 5.5 21.48 1.44 0.0670 c 24.72 1.36 0.0550 26.11 1.59 0.0609 24.33 1.65 0.0678 30.32 1.66 0.0547 Mean ± SD 25.43 ± 2.89 1.5975 ± 0.1921 0.0631 ± 0.0067 25.31 1.71 0.0676 29.88 1.64 0.0549 25.64 1.95 0.0761 2.75 22.62 1.48 0.0654 D 25.10 1.46 0.0582 25.34 1.46 0.0576 22.39 1.30 0.0581 25.47 1.45 0.0569 Mean ± SD 25.22 ± 2.29 1.5563 * 0.2025 0.0618 ± 0.0072 28.11 1.51 0.0537 25.84 1.50 0.0580 23.86 1.32 0.0553 1.375 24.06 1.42 0.0590 E 23.98 1.21 0.0505 23.49 1.24 0.0528 23.04 1.44 0.0625 24.73 1.41 0.0570 Mean ± SD 24.64 ± 1.64 1.3813 ± 0.1131 0.0561 ± 0.0038 275 28. 54 1.27 0.0445 30.18 1.49 0.0494 25.83 1.18 0.0457 0.67B 27.35 1.62 0.0592 F 24.24 1.11 0.0458 26.81 1.30 0.0485 24.59 1.05 0.0427 24.19 1.30 0.0537 Mean ± SD 26.47 ± 2.17 1.2900 ± 0.1896 0.0487 ± 0.0055 23.34 1.01 0.0433 26.30 1.08 0.0411 24.58 1.34 0.0545 0.344 25.43 1.11 0.0436 G 24.68 0.99 0.0401 27.69 1.41 0.0509 25.13 1.34 0.0533 22.58 0.85 0.0376 Mean ± SD 24.97 ± 1.60 1.1413 ± 0.2003 0.0456 ± 0.0064 276 Table 6. Body weight, small intestine weight and relative small intestine weight of mice treated with L17K (3 - (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33).

Dosage Body Weight Weight of the intestine Weight of the intestine Level of slim thin / body weight dose MS Q 29.69 1.89 0.0637 26.35 2.03 0.0770 28.34 1.91 0.0674 35 25.24 1.78 0.0705 A 26.16 1.61 0.0615 23.80 1.72 0.0723 27.05 2.06 0.0762 25.65 1.77 0.0690 1.8463 ± Mean ± SD 26.54 ± 1.84 0.0957 ± 0.0055 0.1546 29.80 1.90 0.0638 26.57 1.85 0.0696 32.71 2.54 0.0777 17.5 24.96 2.05 0.0821 B 24.66 1.54 0.0624 21.39 1.47 0.0687 27.99 1.95 0.0697 26.74 1.62 0.0606 1.8650 ± Mean ± SD 26.85 ± 3.44 0.0693 ± 0.0075 0.3423 23.32 1.58 0.0678 27.39 1.85 0.0675 26.51 2.01 0.0758 8.75 23.53 1.60 0.0680 c 26.31 1.67 0.0635 27.07 2.07 0.0765 23.64 2.08 0.0880 26.72 1.80 0.0674 Mean ± SD 25.56 ± 1.74 1.8325 ± 0.0718 ± 0.0079 277 0. 2052 _ 25.11 1.47 0.0585 26.05 1.71 0.0656 25.00 1.68 0.0672 D 4.375 25.36 1.59 0.0627 23.79 1.41 0.0593 27.40 1.81 0.0661 26.31 1.48 0.0563 23.73 1.42 0.0598 1.5713 ± Mean ± SD 25.35 ± 1.25 0.0619 ± 0.0040 0.1492 24.71 1.36 0.0550 21.35 1.30 0.0609 27.79 1.80 0.0648 28.66 1.84 0.0642 E 2.188 25.95 1.45 0.0559 26.62 1.65 0.0620 22.40 1.58 0.0705 27.71 1.70 0.0613 1.5850 ± Mean ± SD 25.65 ± 2.64 0.0618 ± 0.0050 0.1996 22.75 1.36 0.0598 25.35 1.46 0.0576 22.99 1.50 0.0652 26.65 1.73 0.0649 F 1.094 25.54 1.41 0.0552 24.68 1.56 0.0632 29.29 1.72 0.0587 24.51 1.40 0.0571 1.5175 ± Mean ± SD 25.22 ± 2.09 0.0602 ± 0.0038 0.1423 G 0.547 24.31 1.28 0.0527 25.29 1.31 0.0518 24.00 1.44 0.0500 26. 59 1.52 0.0572 24.42 1.27 0.0520 25.95 1.33 0.0513 23.65 29.00 1.57 0.0541 1.3886 ± Mediar SD 25.40 ± 1.77 0.0541 ± 0.0033 0.1313 278 Table 7. Body weight, weight of the small intestine and relative small intestine weight of mice treated with A2G-GLP-2 (1-33). of the intestine Dosage Level Body weight Weight of intestine Weight loss slim dose / body weight M9 g 9 26.17 1.25 0.0478 27.69 1.30 0.0469 23.33 1.40 0.0600 22.35 1.10 0.0492 A 33 28.25 1.28 0.0453 22.85 1.17 0.0512 24.94 1.41 0.0565 21.40 0.93 0.0435 1.2300 ± Mean ± SD 24.62 ± 2.55 0.0501 ± 0.0057 0.1602 21.72 0.96 0.0442 26.13 1.17 0.0448 25.43 1.37 0.0539 24.44 1.28 0.0524 B 16.5 23.80 1.07 0.0450 25.13 1.24 0.0493 23.06 1.25 0.0542 22.76 1.08 0.0475 1.1775 ± Mean ± SD 24.06 ± 1, 50 0.0489 ± 0.0042 0.1337 26.62 1.26 0.0473 24.63 1.16 0.0471 24.27 1.19 0.0490 28.30 1.37 0.0484 c 8.25 26.94 1.06 0.0393 25.12 1.23 0.0490 24.89 1.46 0.0587 25.51 1.24 0.0486 Mean ± SD 25.79 ± 1.38 1.2463 ± 0.0484 ± 0.0052 279 0. 1235 26.28 1.15 0.0438 26.49 1.04 0.0393 27.19 1.46 0.0537 26.01 1.19 0.0458 D 4.125 28.58 1.24 0.0434 22.74 1.15 0.0506 23.49 0.88 0.0375 28.52 1.26 0.0442 1.1713 ± Mean ± SD 26.16 ± 2.12 0.0448 ± 0.0054 0.1687 21.54 0.93 0.0432 21.97 0.98 0.0446 26.21 1.22 0.0465 2. 063 25.39 1.18 0.0465 E 26.80 1.04 0.0388 26.64 1.21 0.0454 23.36 1.00 0.0428 22.25 1.04 0.0467 1.0750 ± Mean ± SD 24.27 ± 2.23 0.0443 ± 0.0027 0.1124 24.10 1.09 0.0452 23.15 1.10 0.0475 26.06 1.18 0.0453 1. 031 28.91 1.31 0.0453 F 27.15 1.18 0.0435 25.89 1.11 0.0429 23.41 1.30 0.0555 24.83 1.08 0.0435 1.1688 ± Mean ± SD 25.44 ± 1.97 0.0461 ± 0.0041 0.0923 G 0.512 24.03 0.92 0.0383 23.21 1.09 0.0470 26.10 1.09 0.0418 280 Table 8. Body weight, weight of the small intestine of the relative small intestine of control mice Weight of the intestine Weight of the intestine Dose Level Slim body weight / body weight dose W g 9 24.39 0.99 0.0406 22.58 0.86 0.0381 22.76 1.08 0.0475 24.93 1.03 0.0413 25.4Q 0.99 0.0389 27.12 1.13 0.0417 25.34 1.42 0.0560 27.55 1.20 0.0436 27.38 1.02 0.0373 0 24.96 1.02 0.0409 Control 24.77 1.31 0.0529 25.88 1.05 0.0406 28.86 1.08 0.0374 22.89 1.06 0.0463 24.57 1.07 0.0435 26.67 1.08 0.0405 31.59 1.26 0.0399 32.69 1.36 0.0416 27.28 1.03 0.0378 23.60 0.97 0.0411 1.1005 ± Mean ± SD 26.06 ± 2.70 0.0424 ± 0.0050 0.1411 281 Example 63 Metabolic stability of selected GLP-2 derivatives. The degradation of GLP-2 derivatives in vivo in pigs has been studied and the Ti / 2 value determined for GLP-2 derivatives determined in accordance with the present invention (T ': Terminal elimination half-life) (Table 9). All test substances are dissolved in 20 mM phosphate buffer pH 7.4. Female LYD hybrid pigs weighing 50-75 kg were used. All test substances were dosed 0.5 nmol / kg. The dosage volume was approximately 1 ml per animal. Subcutaneous injections were given on the right side of the neck approximately 7 cm from the ear and 9 cm from the middle of the neck. The injections were given with a stop device on the needle, allowing 0.5 cm of the inserted needle. Blood samples were taken from each catheter in the vein of the ear. The catheter was rinsed with 50 IE heparin / ml in physiological saline. During sampling the first mi of blood drawn was discarded. Blood samples are kept on ice for no longer than 20 minutes. Before centrifugation (4 ° C, 4000 rpm, 10 min). After centrifugation, the plasma is isolated and transferred to tubes 282 Micronic in duplicate. The plasma samples are analyzed by ELISA.

Table 9: 283 L17K (4- (Hexade- L17K 30R-GLP-2 e-L s-canoylamino) butanoi l) / 30R C16 GABA 3.8 ± 0.6 (1-33) 17 -GLP-2 (1-33) D3E / S7K ((S) -4-carboxy -4- (haxado- acid D3E / S7K / K30R D33 e-Lys-? -glutamic canoiamino) butanoyl) / 30R C16 280 E-GLP-2 (1-33) 7 / D33E-GLP-2 (1-33) D3E / D8K ((S) -4-carboxy-4-acid (hexado- D3E D8K 3QR / D33 e-Lys-? -glutamic canolamino) butane l) / K30R C16 31.9 E-GLP-2 (1- 33) 8 / D33E-GLP-2 (1-33) D3E / N11 K ((S 4-carboxy-4-acid (hexado-D3E / N11K K30RD3 e-Lys-? -g! Utamcocoamine) butanoi) / K30R C16 53.1 3E-GLP-2. 33) 11 / D33E-GLP-2 (1-33) D3E / T12K ((S) -4-carboxy-4-acid (exact- D3E / T12K / K30R / D33 e-Lys-? -glutamcocanamine) butano1) / K30R C16 29.4 E-GLP-2 ( 1-33) 12 D33E-GLP-2 (1-33) D3E / L17K ((S) -4-carboxy-4-acid (hexado-D3E / L17K / K30R / D33 e-Lys-? -glutamico canoi iamino) butanoi) / K30R C16 16.2 E-GLP-2 (1 -33) 17 7D33E-GLP-2 (1-33) 284 Example 64 Pharmaceutical formulations. Buffer solution and optionally a preservative, optionally an isotonic agent, optionally additional additives selected from a chelating agent, stabilizer (e.g., imidazole or certain amino acids (basic charge) such as histidine or arginine) and surface active agent were optionally dissolved., and the pH was adjusted to the specific pH. Subsequently, the GLP-2 compound was dissolved under slow stirring. The pH was adjusted to the specific using sodium hydroxide and / or hydrochloric acid. Finally, the formulation was sterilized by filtration through a 0.22 μt sterile filter ?. The physical stability of the formulations was assessed by visual inspection and turbidity after storing the formulation in glass top cap cartridges for various periods of time. The cartridges were stored at 5 ° C ± 3 ° C and / or at elevated temperatures (eg, 25 ° C or 37 ° C). The visual inspection of the formulations is done in an acute light approach with a dark backing. The turbidity of the formulation is characterized by a visual marker in the range of turbidity degree from 0 to 3 (the formulation does not show turbidity corresponding to a visual marker of 0, and the formulation shows visual turbidity in the daylight corresponding to a visual marker of 3). The formulation is classified physically unstable with 285 Regarding protein aggregation, when it shows visual turbidity in daylight. Turbidity is also measured in Nephelometric turbidity units (NTU) with a nephelometer, which is calibrated with a Formazin standard. The formulation with a turbidity of > 10 NTU is seen as physically unstable. The concentrations of GLP-2 compound are based on UV absorbance using e28? = 5700 M "1 cm" 1. Analytical CLAR. The contents of the GLP-2 compound in samples is quantified by reverse phase HPLC using a C4 column and a standard TFA / MeCN elution gradient. The GLP-2 formulation can be evaluated by equilibrium solubility; A GLP-2 compound is dissolved at a concentration of 2 mg / ml in the appropriate buffer solution and the solution is filtered through a 0. 45 μta. From the storage solution samples are removed the pH is adjusted to the desired value, and the samples are incubated at 23 ° C for 24 hours. After centrifugation (20,000 g in 20 minutes at 23 ° C) of each sample, the pH is measured and the solubility is estimated from the absorbance measurements (or CLAR analysis) of the supernatant. The GLP-2 formulation can also be evaluated by the accelerated stability test; 286 samples are prepared of the GLP-2 compound of 2 mg / mL in a-d buffer solutions and transferred to 0.2 mL CLAR vials that are sealed leaving "without" liquid air interfaces. After incubation at defined temperatures in the range of 4-45 ° C, the content of the GLP-2 compound as a function of time is determined by HPLC analysis. The GLP-2 formulation can also be evaluated for physical stability; The fluorescent pigment of thioflavin T (ThT) binds the beta structure which is constituted by amyloid protein. The resulting increase in the fluorescent quantum field of the bound pigment is used to predict the tendency of the GLP-2 compound to fibrillate under a variety of solvent conditions. Briefly, the GLP-2 compound is dissolved under the conditions of interest, a trace of ThT is added, the solutions are placed in 96-well microtiter plates where the fluorescence is read as a function of time using a predefined temperature regime and agitation encodings to effect accelerated amyloid formation. The resulting fluorescence against the time data then predicts the relative tendency of the GLP-2 compound to fibrillate under a set of conditions. The GLP-2 formulation can also be evaluated by analytical ultracentrifugation; 287 experiments are performed sedimentation in speed at 23 ° C with a Beckman Optima XL-A ultracentrifuge equipped for simultaneous data capture using both absorbance and interference optics. The GLP-2 formulation can also be evaluated by circular dichroism spectroscopy. The near and far UV CD spectra are recorded at room temperature using a Jasco J-715 spectropolarimeter calibrated with (+) - 10-camphorsulfonic acid. Example 65 Pharmaceutical formulations of GLP-2 derivatives. Buffer solution and optionally a preservative, optionally an isotonic agent, optionally additional additives selected from chelating agent, stabilizer (e.g., imidazole and certain amino acids (basic loading) such as histidine or arginine) and surfactants are optionally dissolved, and the pH is adjusted up to the specific pH. Subsequently, the GLP-2 derivative dissolves under slow agitation. The pH is adjusted to the specific using sodium hydroxide and / or hydrochloric acid. Finally, the formulation is sterilized by filtration through a sterile 0.22 μt filter ?. The physical stability of the formulations was evaluated by means of visual inspection and turbidity after storing the formulation in lid glass cartridges 288 higher for several periods of time. The cartridges were stored at 5 ° C ± 3 ° C and / or at elevated temperatures (for example, 25 ° C or 37 ° C). The visual inspection of the formulations is done in an acute light approach with a dark backing. The turbidity of the formulation is characterized by a visual marker in the range of turbidity degree from 0 to 3 (the formulation does not show turbidity corresponding to a visual marker of 0, and the formulation shows visual turbidity in the daylight corresponding to a visual marker of 3). The formulation is classified physically unstable with respect to protein aggregation, when it shows visual turbidity in daylight. Turbidity is also measured in Nephelometric turbidity units (NTU) with a nephelometer, which is calibrated with a Formazin standard. The formulation with a turbidity of >; 10 NTU is seen as physically unstable. The concentrations of GLP-2 compound are based on UV absorbance using e28? = 5700 1? G1 cm "1. Analytical CLAR The contents of the GLP-2 compound in samples is quantified by reverse phase HPLC using a C4 column and a standard TFA / MeCN elution gradient The GLP-2 formulation can be evaluated by equilibrium solubility, a GLP-2 compound is dissolved at a concentration of 2 mg / ml in solution 289 appropriate buffer and the solution is filtered through a 0.45 μ filter. . From the storage solution samples are removed the pH is adjusted to the desired value, and the samples are incubated at 23 ° C for 24 hours. After centrifugation (20,000 g in 20 minutes at 23 ° C) of each sample, the pH is measured and the solubility is estimated from the absorbance measurements (or CLAR analysis) of the supernatant. The GLP-2 formulation can also be evaluated by the accelerated stability test; samples of the GLP-2 compound of 2 mg / mL are prepared in a-d buffer solutions and transferred to 0.2 mL CLAR vials that are sealed leaving "without" liquid air interfaces. After incubation at defined temperatures in the range of 4-45 ° C, the content of the GLP-2 compound as a function of time is determined by HPLC analysis. The GLP-2 formulation can also be evaluated for physical stability; The fluorescent pigment thioflavin T (ThT) binds the beta structure that is constituted by amyloid protein. The resulting increase in the fluorescent quantum field of the bound pigment is used to predict the tendency of the GLP-2 compound to fibrillate under a variety of solvent conditions. 290 Briefly, the GLP-2 derivative is dissolved under the conditions of interest, a trace of ThT is added, the solutions are placed in 96-well microtiter plates where the fluorescence is read as a function of time using a predefined temperature regime and agitation encodings to effect accelerated amyloid formation. The resulting fluorescence against the time data then predicts the relative tendency of the GLP-2 compound to fibrillar under a set of conditions. The GLP-2 formulation can also be evaluated by analytical ultracentrifugation; sedimentation experiments are performed at a speed of 23 ° C with a Beckman Optima XL-A ultracentrifuge equipped for simultaneous data capture using both absorbance and interference optics. The GLP-2 formulation can also be evaluated by circular dichroism spectroscopy. The near and far UV CD spectra are recorded at room temperature using a Jasco J-715 spectropolarimeter calibrated with (+) - 10-camphorsulfonic acid. Example 66 Freeze-dried pharmaceutical formulations. When a lyophilized product is provided, an essential characteristic refers to the properties of the product. freeze-dried cake. It is necessary to have good properties for this form and structure, that is, they should not collapse so that such collapsed cakes can be hard or even impossible to dissolve (reconstitute) before being used. Conversely, the physical structure of the lyophilized cake may not be as diffuse and smooth. Therefore, lyophilized pharmaceutical formulations of GLP-2 and variants are produced using mannitol, sucrose (bulking agents), and glycylglycine (bulking agent) at the following final concentrations: GLP-2 and variants: 0.1-100 mg / ml Sucrose: 10 mg / ml Mannitol: 37 mg / ml Glycylglycine: 1.32 mg / mL The pH is adjusted to 8.00 ± 0.03 using NaOH / 0.1 N HCl. The solutions are filled into appropriate vials and lyophilized using standard lyophilization methods such as is described by Wang et al, International Journal of Pharmaceutics 203 (2000): 1-60 (see section 4, page 16 onwards). The reconstitution of the lyophilized formulation is carried out using an appropriate amount of water. It is noted that in relation to this date, the best method known to the applicant to carry out the aforementioned invention, is that which is clear from the present description of the invention.

Claims (1)

1. 292 CLAIMS Having described the invention as above, the content of the following claims is claimed as property. 1. A GLP-2 peptide characterized in that it comprises the amino acid sequence of the formula I His-X2-X3-Gly-X5-Phe-X7-X8-Xs-X10-X11-X12-X13-X14-X15-X15-X16- X17-X18-Ala-Arg-X2? - Phe-Ile-X24-Trp-Leu-Lle-X28-Thr-Arg-Ile-Thr-X33 (formula 1) or a fragment thereof; where X2 is Ala, Val or Gly; X3 is Asp, or Glu; X5 is Ser, or Lys; X7 is Ser, or Lys; X8 is Asp, Glu, or Lys; X9 is Asp, Glu, or Lys; X10 is Met, Lys, Leu, Lie, or Norleucine; X11 is Asn, or Lys; X12 is Thr, or Lys; X13 is lie, or Lys; X14 is Leu, or Lys; X15 is Asp, or Lys; X1S is Asn, or Lys; X17 is Leu, or Lys; X18 is Ala, or Lys; X21 is Asp, or Lys; X24 is Asn, or Lys; X28 is Gln, or Lys; X33 is Asp, Glu, or Lys. 2. The GLP-2 peptide according to claim 1, characterized in that it consists of the amino acid sequence His-X2-X3-Gly-X5-Phe-X7-X8-X9-X10-X11-X12-X13-X14- X15-X16-X17-X18-Ala-X20-X2: 1-Phe-Ile "X24-Trp-Leu-Lle-X28-Thr-Arg-Ile-Thr-X33 or a fragment thereof, wherein X2 is Ala , Val or Gly, X3 is Asp, or Glu, X5 is Ser, or Lys, X7 is Ser, or Lys, X8 is Asp, Glu, or Lys, X9 is Asp, Glu, or Lys, X10 is Met, Lys, Leu, lie, or Norleucine, X11 is Asn, or Lys, X12 is Thr, or Lys, X13 is lie, or Lys, X14 is Leu, or Lys, X15 is Asp, or Lys, X16 is Asn, or Lys; X17 is Leu, or Lys, X18 is Ala, or Lys, X20 is Arg, or 293 Lys; X21 is Asp, or Lys; X24 is Asn, or Lys; X28 is Gln, or Lys; X33 is Asp, Glu, or Lys. 3. The GLP-2 peptide according to claim 1 or 2, characterized in that X2 is Ala. 4. The GLP-2 peptide in accordance with the claim 1 6 2, characterized in that X2 is Gly. 5. The GLP-2 peptide according to any of claims 1-4, characterized in that X3 is Asp. 6. The GLP-2 peptide according to any of claims 1-4, characterized in that X3 is Glu. 7. The GLP-2 peptide according to any of claims 1-6, characterized in that X5 is Ser. 8. The GLP-2 peptide according to any of claims 1-7, characterized in that X7 is Ser. 9. The GLP-2 peptide according to any of claims 1-8, characterized in that X8 is Asp. 10. The GLP-2 peptide according to any of claims 1-8, characterized in that Xs is Glu. 11. The GLP-2 peptide according to any of claims 1-10, characterized in that X9 is Asp. 12. The GLP-2 peptide according to any of claims 1-10, characterized in that X9 is Glu. 13. The GLP-2 peptide according to any of claims 1-12, characterized in that X10 is selected from the group consisting of Met, Leu, Lie, and Norleucine. 294 14. The GLP-2 peptide according to any of claims 1-13, characterized in that X11 is Asn. 15. The GLP-2 peptide according to any of claims 1-14, characterized in that X12 is Thr. 16. The GLP-2 peptide according to any of claims 1-15, characterized in that X13 is lie. 17. The GLP-2 peptide according to any of claims 1-16, characterized in that X14 is Leu. 18. The GLP-2 peptide according to any of claims 1-17, characterized in that X15 is Asp. 19. The GLP-2 peptide according to any of claims 1-18. characterized because X16 is Asn. 20. The GLP-2 peptide according to any of claims 1-19, characterized in that X17 is Leu. 21. The GLP-2 peptide according to any of claims 1-20, characterized in that X18 is Ala. 22. The GLP-2 peptide according to any of claims 1-21, characterized in that X21 is Asp. 23. The GLP-2 peptide according to any of claims 1-22, characterized in that X24 is Asn. 24. The GLP-2 peptide according to any of claims 1-23, characterized in that X23 is Gln. 25. The GLP-2 peptide according to any of claims 1-24, characterized in that X33 is Asp. 26. The GLP-2 peptide according to any of 295 claims 1-24, characterized in that X is Glu. 27. The GLP-2 peptide according to any of claims 1-26, characterized in that at least one amino acid independently selected from the list consisting of X5, X7, X8, X9, X10, X11, X12, x13, x14, x15, xls, x17, X18, X20, X21, X24, X28, and X33 is a Lys. 28. The GLP-2 peptide according to any of claims 1-27, characterized in that a total of up to 5 amino acid residues are exchanged with any amino acid residue, such as 4 amino acid residues, 3 amino acid residues, 2 residues of amino acids, or 1 amino acid residue. 29. The GLP-2 peptide according to claim 1, characterized in that the peptide is selected from the list consisting of K30R-GLP-2 (1-33); S5K-GLP-2 (1-33); S7K-GLP-2 (1-33); D8K-GLP-2 (1-33); E9K-GLP-2 (1-33); M10-GLP-2 (1-33) N11K-GLP-2 (1-33) T12K-GLP-2 (1-33) I13K-GLP-2 (1-33) L14K-GLP-2 (1-33) 296 D15 - GLP - 2 (1 - 33) N16K - GLP - 2 (1 - 33) L17K - | GLP - 2 (1 - 33) A18 - | GLP - 2 (1 - 33) D21K - • GLP - 2 (1 -33) N24K-GLP-2 (1 -33) Q28K- • GLP-2 (1 -33) S5K / K30R-GLP-2 (1-33); S7K / K30R-GLP-2 (1-33); D8K / K30R-GLP-2 (1-33); E9K / K30R-GLP-2 (1-33); M10K / K3 OR-GLP-2 (1 -33) N11K / K3 OR-GLP-2 (1 -33) T12K / K3 OR-GLP-2 (1 -33) I13K / K30R-GLP-2 (1 -33) L14 / K3 OR-GLP-2 (1 -33) D15K / K3 OR-GLP-2 (1 -33) N16K / 3 OR-GLP-2 (1 -33) L17K / 3 OR-GLP-2 (1 -33) A18K / K3 OR-GLP-2 (1 -33) D21K / K3 OR-GLP-2 (1 -33) N24K / 30R-GLP-2 (1 -33) Q28K / 30R-GLP-2 (1 -33) K30R / D33K-GLP-2 (1-33) D3E / K30R / D33E-GLP-2 (1-33); 297 D3E / S5K / K30R / D33E-GLP-2 (1-33); D3E / S7K / K30R / D33E-GLP-2 (1-33); D3E / D8K / K30R / D33E-GLP-2 (1-33); D3E / E9K / K30R / D33E-GLP-2 (1-33); D3E / M10K / K30R / D33E-GLP-2 (1-33); D3E / N11K / K30R / D33E-GLP-2 (1-33); D3E / T12K / K30R / D33E-GLP-2 (1-33); D3E / I13 / K30R / D33E-GLP-2 (1-33); D3E / L14K / K30R / D33E-GLP-2 (1-33); D3E / D15K / K30R / D33E-GLP-2 (1-33); D3E / N16K / K30R / D33E-GLP-2 (1-33); D3E / L17K / K30R / D33E-GLP-2 (1-33); D3E / A18K / K30R / D33E-GLP-2 (1-33); D3E / D21K / K30R / D33E-GLP-2 (1-33); D3E / N24K / K30R / D33E-GLP-2 (1-33); and D3E / Q28K / K30R / D33E-GLP-2 (1-33). 30. A polynucleotide construct, characterized in that it encodes a GLP-2 peptide according to any of claims 1-29. 31. A host cell, characterized in that it comprises the polynucleotide construct according to claim 30. 32. The host cell according to claim 31, characterized in that it is a eukaryotic cell. 298 33. The host cell according to claim 32, characterized in that the cell is a yeast cell. 34. A GLP-2 derivative comprising a GLP-2 peptide, characterized in that a lipophilic substituent is linked to one or more amino acid residues at a relative position for the amino acid sequence of SEQ ID NO: 1 independently selected from the list consists of S5, S7, D8, E9, MIO, Nll, Tl2, 113, L14, D15, NI6, L17, A18, D21, N24, and Q28 with the proviso that the lipophilic substituent does not bind to the terminal amino acid residue N or the C-terminal amino acid residue of the GLP-2 peptide. 35. The GLP-2 derivative according to claim 34, characterized. orgue peptide GLP-2 is according to formula II His-X2-X3-Gly-X5-Phe-X7-X8-X9-X10-X11-X: L2-X13-X14-X15-X16-X: L7 -X18-Ala-X20-X21-Phe-Ile-X24-Trp-Leu-Lle-X28-Thr-X30-Lle-Thr-X33 (formula II) or a fragment thereof; where X2 is Ala, Val or Gly; X3 is Asp, or Glu; Xs is Ser, or Lys; X7 is Ser, or Lys; X8 is Asp, Glu, or Lys; X9 is Asp, Glu, or Lys; X10 is Met., Lys, Leu, lie, or Norleucine; X11 is Asn, or Lys; X12 is T r, or Lys, - X13 is lie, or Lys; X14 is Leu, or Lys; X15 is Asp, or Lys; X16 is Asn, or Lys; X17 is Leu, or Lys; X18 is Ala, or Lys; X20 is Arg, or Lys; X21 is Asp, or Lys; X24 is Asn, or Lys; X28 is Gln, or Lys; X30 is Arg, or Lys; X33 is Asp, Glu, or Lys (formula II). 299 36. The GLP-2 derivative according to any of claims 34 or 35, characterized in that the GLP-2 peptide is according to any of claims 1-29. 37. The GLP-2 derivative according to any of claims 34-36, characterized in that only one lipophilic substituent is bound to the GLP-2 peptide. 38. The GLP-2 derivative according to any of claims 34-37, characterized in that the lipophilic substituent comprises from 4 to 40 carbon atoms. 39. The GLP-2 derivative according to claim 38, characterized in that the lipophilic substituent comprises from 8 to 25 carbon atoms. The GLP-2 derivative according to claim 38, characterized in that the lipophilic substituent comprises from 12 to 20 carbon atoms. 41. The GLP-2 derivative according to any of claims 34-40, characterized in that the lipophilic substituent is linked to an amino acid residue in a form such that the carboxyl group of the lipophilic substituent forms an amide bond with an amino group of the amino acid residue. 42. The GLP-2 derivative according to claim 41, characterized in that the amino acid residue is a Lys residue. 300 43. The GLP-2 derivative according to any of claims 34-40, characterized in that the lipophilic substituent is linked to an amino acid residue in such a way that an amino group of the lipophilic substituent forms an amide bond with a caboxyl group of the residue of amino acid 44. The GLP-2 derivative according to any of claims 34-43, characterized in that the lipophilic substituent is linked to the GLP-2 peptide by means of a spacer 45. The GLP-2 derivative according to claim 44, characterized because the spacer is an unbranched alkali metal, dicarboxylic acid group having from 1 to 7 methylene group, such as 2 methylene groups with a spacer that bridges between an amino group of the GLP-2 peptide and an amino group of the lipophilic substituent. 46. The GLP-2 derivative according to claim 44, characterized in that the spacer is an amino acid residue except a Cys residue, or a dipeptide. 47. The GLP-2 derivative according to claim 46, characterized in that the spacer is selected from the list consisting of β-alanine, gamma-aminobutyric acid (GABA), β-glutamic acid, Lys, Asp, Glu, a dipeptide containing Asp, a dipeptide containing Glu, or a dipeptide containing Lys. 301 48. A GLP-2 derivative according to claim 46 or 47, characterized in that a carboxyl group of the precursor peptide GLP-2 forms an amide bond with an amino group of the spacer, and the carboxyl group of the amino acid or dipeptide spacer forms an amide bond with an amino group of the lipophilic substituent. 49. A GLP-2 derivative according to claim 46 or 47, characterized in that an amino group of the precursor peptide GLP-2 forms an amide bond with a carboxyl group of the spacer, and an amino group of the spacer forms an amide bond with a carboxyl group of the lipophilic substituent. 50. A GLP-2 derivative according to any of claims 34-49, characterized in that the lipophilic substituent comprises a partially or completely hydrogenated cyclopentanphenatrene skeleton. 51. A GLP-2 derivative according to any of claims 34-50, characterized in that the lipophilic substituent is a straight or branched chain alkyl group. 52. A GLP-2 derivative according to any of claims 34-50, characterized in that the lipophilic substituent is the acyl group of a straight or branched chain fatty acid. 53. A GLP-2 derivative according to claim 52, characterized in that the acyl group is selects from the group comprising CH3 (C¾) nCO-, wherein n is 4 to 38, such as CH3 (CH2) eC0-, CH3 (CH2) 8CO ~, CH3 (CH2) 10CO-, CH3 (CH2) 12CO-, C6 (CH2) 14C0-, C6 (C6) 1SC0-, CH3 (C6) 18CO-, CH3 (C6) 20CO- and CH3 (C6) 22CO-. 54. A GLP-2 derivative according to any of claims 34-49, characterized in that the lipophilic substituent is an acyl group of a straight or branched chain α, β-dicarboxylic acid. 55. A derivative · GLP-2 according to claim 52, characterized in that the acyl group is selected from the group comprising HOOC (CH2) mC0-, where m is 4 to 38, such as HOOC (CH2) 14C0-, HOOC (CH2) i6CO-, H00C (CH2) isC0-, HOOC (CH2) 20CO- and HOOC (CH2) 22CO-. 56. A GLP-2 derivative according to any of claims 34-49, characterized in that the lipophilic substituent is a group of the formula CH3 (CH2) P ((CH2) gCOOH) CHNH-CO (CH2) 2CO-, in where p and q are integers and p + q is an integer from 8 to 40, such as from 12 to 35. 57. A GLP-2 derivative according to any of claims 34-49, characterized in that the lipophilic substituent is a group of the formula CH3 (CH2) rC0-NHCH (C00H) (CH2) 2CO-, wherein r is an integer from 10 to 24. 58. A GLP-2 derivative according to any of claims 34-49, characterized in that the lipophilic substituent is a group of the formula 303 CH3 (CH2) sCO-NHCH ((CH2) 2COOH) CO-, where s is an integer from 8 to 24. 59. A GLP-2 derivative according to any of claims 34-49, characterized in that the lipophilic substituent is a group of the formula COOH (CH2) tCO- where t is an integer from 8 to 24. 60. A GLP-2 derivative according to any of claims 34-49, characterized in that the lipophilic substituent is a group of the formula HCH (COOH) (C¾) 4 H-CO (CH 2) UCH 3, wherein u is an integer from 8 to 18. 61. A GLP-2 derivative according to any of claims 34-49, characterized in that the Lipophilic substituent is a group of the formula HCH (COOH) (CH 2) 4 H-COCH ((C¾) 2COOH) NH-CO (CH 2) WCH 3, wherein w is an integer from 10 to 16. 62. A derivative GLP- 2 according to any of claims 34-49, characterized in that the lipophilic substituent is a group of the formula NHCH (COOH) (CH2) 4NH-C0 (CH2) 2CH (COOH) NH-CO (CH2) XCH3, wherein x is an integer from 10 to 16. 63. A GLP-2 derivative according to any of claims 34-49, characterized in that the lipophilic substituent is a group of the formula NHCH (COOH) (CH2) 4NH-CO (CH2) 2CH (COOH) NHCO (CH2) and CH3, where y is 304 zero or an integer from 1 to 22. 64. A GLP-2 derivative according to any of claims 34-63, characterized in that it has two lipophilic substituents. 65. A GLP-2 derivative according to any of claims 34-64, characterized in that it is selected from the group consisting of S5K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); S7K (3- (hexadecanoylamino) ropionyl) -GLP-2 (1-33); D8K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); E9K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); M10 (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); N11K (3- (hexadecanoylamino) propioni1) -GLP-2 (1-33); T12K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); I 13 K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); L14K (3- (hexadecanoylamino) ropionyl) -GLP-2 (1-33); D15K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); N16 (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (octanylamino) ropionyl) -GLP -2 (1-33); L17K (3- (nonanoylamino) ropionyl) -GLP -2 (1-33); L17K (3- (decanylamino) ropionyl) -GLP -2 (1-33); L17K (3- (undecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (dodecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (tridekanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (tetradecanoylamino) propionyl) -GLP-2 (1-33); 305 L17K (3- (pentadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (exadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (octadecanoylamino) ropionyl) -GLP-2 (1-33); L17K (3- (nonadecanoylamino) propionyl) -GLP-2 (1-33); L17K (3- (eicosanoylamino) propionyl) -GLP-2 (1-33); L17K ((S) -4 -carboxy-4- (octanylamino) butanoyl) -GLP-2 (1-33); L17 ((S) -4 -carboxy-4- (nonanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4 -carboxy-4- (decanylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4 -carboxy-4- (undecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4 -carboxy-4- (dodecanoylamino) butanoyl) -GLP-2 (1-33) L17K ((S) -4 -carboxy-4- (tridekanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4- -carboxy-4- (tetradecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4- - carboxy - -4- (pentadecanoylamino) butanoyl) -GLP-2 (1-33) L17K ((S) -4- -carboxy-4- (hexadecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4- -carboxy-4- (heptadecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4- -carboxy-4- (octadecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4- -carboxy-4- (nonadecanoylamino) butanoyl) -GLP-2 (1-33); L17K ((S) -4- - carboxy - -4- (eicosanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (octanoylamino) butanoyl) -GLP-2 (1-33); L17 (4- (nonanoylamino) utanoyl) -GLP-2 (1-33); L17K (4- (decanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (undecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (dodecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (tridekanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (tetradecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (pentadecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (hexadecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (heptadecanoylamino) butanoyl) -GLP-2 (1-33); L17K (4- (octadecanoylamino) utanoyl) -GLP-2 (1-33); L17K (4- (nonadecanoylamino) utanoyl) -GLP-2 (1-33); L17K (4- (eicosanoylamino) butanoyl) -GLP-2 (1-33); A18K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); D21K (3- (hexadecanoylamino) ropionyl) -GLP-2 (1-33); N24K (3- (hexadecanoylamino) propionyl) -GLP-2 (1-33); Q28K (3- (hexadecanoylamino) ropionyl) -GLP-2 (1-33); S5 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) S7K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) D8K (3- (hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33) E9K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) M10K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); N 11 K (3- (hexadecanoylamino) propionyl) / K 3 OR-GLP-2 (1-33); T12K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); I 13 (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); L14K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); D15K (3- (hexadecanoylamino) propionyl) / K3 OR-GLP-2 (1-33); N16K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (octanoylamino) propionyl) / K30R-GLP-2 (1--33) L17K (3- (nonanoylamino) propionyl) / 30R-GLP-2 (1--33) L17K (3- (decanylamino) ropionyl) / K30R-GLP-2 (1-33) L17K (3- (undecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (dodecanoylamino) ropionyl) / K30R-GLP-2 (1-33); L17K (3- (tridekanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (tetradecanoylamino) ropionyl) / K30R-GLP-2 (1-33); L17K (3- (pentadecanoylamino) ropionyl) / K30R-GLP-2 (1-33); L17K (3- (hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (heptadecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (octadecanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K (3- (nonadecanoylamino) ropionyl) / K30R-GLP-2 (1-33); L17K (3- (eicosanoylamino) propionyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (octanylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (nonanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (decanylamino) butanoyl) / K30R-GLP-2 (1-33); L17 ((S) -4-carboxy-4- (undecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (dodecanoylamino) butanoyl) / K30R-GLP-2 (1-33), -L17K ((S) -4-carboxy-4- (tridekanoylamino) utanoyl) / 30R- GIP-2 (1-33); L17K ((S) -4-carboxy-4- (tetradecanoylamino) butanoyl) / 30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (pentadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (he-εdecanoylamino) butanoyl) / K30R-GE_P-2 (1-33); L17K ((S) -4-carboxy-4- (heptadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (octadec ^ rkDilarriino) butanoyl) / K30R-GLP-2 (1-33); L7K ((S) -4-carboxy-4- (nomdecanoylamino) butanoyl) / 30R-GLP-2 (1-33); L17K ((S) -4-carboxy-4- (eicosanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- (octanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17 (4- (nonanoylamino) butanoyl) / K30R-GLP-2 (1-33); 308 L17K (4-decanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- undecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4-dodecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- tridecanoylamino) butanoyl) / K30R-GLP-2 (1-33), -L17 (4-tetradecanoylamino) utanoyl) / K30R-GLP-2 (1-33); L17K (4- pentadecanoylamino) butanoyl) / 30R-GLP-2 (1-33); L17K (4- hexadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4-heptadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- octadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- nonadecanoylamino) butanoyl) / K30R-GLP-2 (1-33); L17K (4- eicosanoylamino) butanoyl) / K30R-GLP-2 (1-33); A18K (3-hexadecanoylamino) ropionyl) / K30R-GLP-2 (1-33) D21 (3-hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) N24K (3-hexadecanoylamino) propionyl) / K30R-GLP -2 (1-33) Q28K (3-hexadecanoylamino) propionyl) / K30R-GLP-2 (1-33) D3E / S5K 3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP- (1-33); D3E / S7K 3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP- (1-33); D3E / D8 3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP- (1-33); D3E / E9K 3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / M10K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); 309 D3E / N11K (3-hexadecanoylamino) prc ionyl) / K30R / D33E-GLP-2 (1-33); D3E / T12K (3- hexadecanoylannane) propionyl) / 30R / D33E-3LP-2 (1-33); D3E / I13K (3-hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L14K (3-hexadecanoylamino) ropionyl) / K30R / D33E-GLP-2 (1-33); D3E / D155K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / N16K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (octanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33) D3E / L17K (3- (nonanoylamino) ropionyl) / 30R / D33E-G3__P-2 (1-33) D3E / L17K (3- (decanylamino) propionyl) / K30R / D33E-GLP-2 (1-33) D3E / L17K (3- (undecanoylamino) ropionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (dodecanoylamino) ropionyl) / 30R / D33E-GLP-2 (1-33) / D3E / L17K (3- (tridekanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17 (3- (tetradecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (pentadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (hexadecanoylamino) ropionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (heptadecanoylamino) ropionyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (3- (octadecanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33) / D3E / L17 (3- (nonadecanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33); D3E / L17K (3- (eicosanoylamino) propionyl) / 30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (octanylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (nonanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (decanylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); 310 D3E / L17K ((S) -4-carboxy-4- (undecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (dodecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (tridekanoylamino) utanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (tetradecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (pentadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (hexadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (heptadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (octadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (nonadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K ((S) -4-carboxy-4- (eicosanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (octanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (nornylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (decanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (imdecanoylamino.no) butanoyl) / K30R / D33E-GLP-2 (1-33) D3E / L17K (4- (dodecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33) 311 D3E / L17 (4- (tridecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (tetradecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (pentadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (hexadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (hdecanoylamino) utanoyl) / 30R / D33E-GLP-2 (1-33); D3E / L17K (4- (octadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (nonadecanoylamino) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / L17K (4- (eicosanoylanu.no) butanoyl) / K30R / D33E-GLP-2 (1-33); D3E / A18K (3- (hexadecanoylamino) ropionyl) / K30R / D33E-GLP-2 (1-33); D3E / D21K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); D3E / N24K (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33); and D3E / Q28 (3- (hexadecanoylamino) propionyl) / K30R / D33E-GLP-2 (1-33). 66. A pharmaceutical composition comprising a GLP-2 derivative, characterized in that it comprises a GLP-2 pde, wherein a lipophilic substituent is linked to one or more amino acid residues at a position relative to the amino acid sequence of SEQ ID N0 : 1 selected from the list consisting of S5, S7, D8, E9, MIO, Nll, T12, 113, L14, D15, N16, L17, A18, D21, N24, and Q28 with the proviso that the lipophilic substituent does not it binds to the amino acid residue of the N-terminus or to the amino acid residue of the C-terminus of the GLP-2 pde. 67. A pharmaceutical composition characterized in that it comprises a GLP-2 derivative as defined in any of claims 34-65, and optionally a carrier 312 pharmaceutically acceptable. 68. The use of a GLP-2 derivative as defined in any of claims 34-65 for the preparation of a medicament. 69. The use of a GLP-2 derivative as defined in any of claims 34-65 for the preparation of a medicament with prolonged effect. 70. The use of a GLP-2 derivative as defined in any of claims 34-65 for the preparation of a medicament for the treatment of intestinal insufficiency or other condition that leads to malabsorption of mutants in the intestine. 71. The use of a GLP-2 derivative as defined in any of claims 34-65 for the preparation of a medicament for the treatment of small bowel syndrome, inflammatory bowel syndrome, Crohn's disease, colitis including colitis, collagen, radiation colitis, chronic radiation enteritis, ulcerative colitis, tropical and non-tropical stomatitis (intolerance to gluten), celiac disease (gluten-sensitive enteropathy), damaged tissue after vascular obstruction or trauma, diarrhea eg tourist diarrhea and post-infectious diarrhea, chronic intestinal dysfunction, dehydration, bacteremia, sepsis, anorexia nervosa, damaged tissue after chemotherapy for example, mucositis 313 intestinal caused by chemotherapy, premature infants including intestinal insufficiency in premature infants, infants before birth including intestinal insufficiency in infants before birth, scleroderma, gastritis including atrophic gastritis, atrophic gastritis postantrectomy and gastritis due to elicobacter pylori, pancreatitis, septic shock ulcers general, enteritis, cul-de-sac, lymphatic obstruction, vascular disease and graft versus host and healed after surgical procedure, atrophy after radiation and chemotherapy, weight loss in Parkinson's disease, intestinal adaptation after surgical procedure, mucosal atrophy induced by parenteral nutrition, for example mucosal atrophy induced by total parenteral nutrition (TPN) and bone-related disorders including osteoporosis, hypercalcemia of malignancy, osteopenia due to bone metastasis, periodontal disease, h hyperparathyroidism, periarticular erosions in rheumatoid arthritis, Paget's disease, osteodystrofxa, myositis ossificans, Bechterew's disease, malignant hypercalcemia, osteolytic lesions caused by bone metastasis, bone loss due to immobilization, bone loss due to deficiency of the steroid hormone sex, bone abnormalities due to treatment with steroid hormone, bone abnormalities due to therapeutics of 314 cancer, osteomalacia, Bechet's disease, osteomalacia, hyperostosis, osteopetrosis, metastatic bone disease, osteopenia induced by immobilization, or osteoporosis induced by glucocorticoids. 72. A method for the treatment of intestinal insufficiency or other condition that leads to malabsorption of nutrients in the intestine, characterized in that it comprises administering a therapeutically or prophylactically effective amount of a GLP-2 derivative according to any of claims 34-65.; to a subject that needs it. 73. A method for the treatment of small bowel syndrome, inflammatory bowel syndrome, Crohn's disease, colitis that includes collagen colitis, radiation colitis, chronic radiation enteritis, ulcerative colitis, tropical and non-tropical stomatitis (gluten intolerance) ), celiac disease (gluten-sensitive enteropathy), damaged tissue after vascular obstruction or trauma, diarrhea eg tourist diarrhea and post-infectious diarrhea, chronic intestinal dysfunction, dehydration, bacteremia, sepsis, anorexia nervosa, damaged tissue after chemotherapy for example, intestinal mucositis caused by chemotherapy, premature infants including intestinal insufficiency in premature infants, infants before birth including insufficiency 315 bowel syndrome in infants before birth, scleroderma, gastritis including atrophic gastritis, atrophic gastritis postantrectomy and helicobacter pylori gastritis, pancreatitis, general septic shock ulcers, enteritis, cul-de-sac, lymphatic obstruction, vascular disease and graft versus host and healed after surgical procedure, atrophy after radiation and chemotherapy, weight loss in Parkinson's disease, intestinal adaptation after surgical procedure, mucosal atrophy induced by parenteral nutrition, for example mucosal atrophy induced by total parenteral nutrition (TPN) and bone-related disorders including osteoporosis, hypercalcemia of malignancy, osteopenia due to bone metastasis, periodontal disease, hyperparathyroidism, periarticular erosions in rheumatoid arthritis, Paget's disease, osteodystrophy, myositis ossificans, Bechterew's disease, malignant hypercalcemia , osteolytic lesions produced by bone metastasis, bone loss due to immobilization, bone loss due to deficiency of the sex steroid hormone, bone abnormalities due to steroid hormone treatment, bone abnormalities due to cancer therapeutics, osteomalacia, Bechet, osteomalacia, hyperostosis, osteopetrosis, metastatic bone disease, osteopenia induced by immobilization, or osteoporosis 316 induced by glucocorticoids, the method is characterized in that it comprises administering a therapeutically or prophylactically effective amount of the GLP-2 derivative as defined in any of claims 34-65, to a subject in need thereof. 74. A method for producing the GLP-2 peptide according to any of claims 1-29, characterized in that it comprises culturing the host cell according to any of claims 31-33 in an appropriate growth medium under conditions that allow the expression of the polynucleotide construct and recover the resulting peptide from the culture medium.