MXPA01006221A - Subtilase enzymes of the i-s1 and i-s2 sub-groups having an additional amino acid residue in an active site loop region - Google Patents
Subtilase enzymes of the i-s1 and i-s2 sub-groups having an additional amino acid residue in an active site loop regionInfo
- Publication number
- MXPA01006221A MXPA01006221A MXPA/A/2001/006221A MXPA01006221A MXPA01006221A MX PA01006221 A MXPA01006221 A MX PA01006221A MX PA01006221 A MXPA01006221 A MX PA01006221A MX PA01006221 A MXPA01006221 A MX PA01006221A
- Authority
- MX
- Mexico
- Prior art keywords
- amino acid
- subtylase
- acid residue
- subtilase
- variant
- Prior art date
Links
- 102000004190 Enzymes Human genes 0.000 title claims abstract description 119
- 108090000790 Enzymes Proteins 0.000 title claims abstract description 119
- 101710028865 SBT Proteins 0.000 title claims abstract description 69
- 125000000539 amino acid group Chemical group 0.000 title claims abstract description 69
- 239000003599 detergent Substances 0.000 claims abstract description 63
- 229940088598 Enzyme Drugs 0.000 claims description 86
- 150000001413 amino acids Chemical class 0.000 claims description 61
- 239000000203 mixture Substances 0.000 claims description 60
- 108091005771 Peptidases Proteins 0.000 claims description 40
- 239000004365 Protease Substances 0.000 claims description 36
- 238000006011 modification reaction Methods 0.000 claims description 35
- 230000004048 modification Effects 0.000 claims description 34
- 229940110715 ENZYMES FOR TREATMENT OF WOUNDS AND ULCERS Drugs 0.000 claims description 28
- 229940114721 Enzymes FOR DISORDERS OF THE MUSCULO-SKELETAL SYSTEM Drugs 0.000 claims description 25
- 229940093738 Enzymes for ALIMENTARY TRACT AND METABOLISM Drugs 0.000 claims description 25
- 229940019336 antithrombotic Enzymes Drugs 0.000 claims description 25
- 229940020899 hematological Enzymes Drugs 0.000 claims description 25
- 229940083249 peripheral vasodilators Enzymes Drugs 0.000 claims description 25
- 229920001850 Nucleic acid sequence Polymers 0.000 claims description 23
- 238000003780 insertion Methods 0.000 claims description 23
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 21
- 238000005406 washing Methods 0.000 claims description 20
- 238000006467 substitution reaction Methods 0.000 claims description 16
- 241000193830 Bacillus <bacterium> Species 0.000 claims description 13
- 230000002255 enzymatic Effects 0.000 claims description 13
- 108090001060 lipase Proteins 0.000 claims description 11
- 102000004882 lipase Human genes 0.000 claims description 11
- 238000004519 manufacturing process Methods 0.000 claims description 11
- 239000004367 Lipase Substances 0.000 claims description 10
- 235000019421 lipase Nutrition 0.000 claims description 10
- 230000000813 microbial Effects 0.000 claims description 10
- 102000013142 Amylases Human genes 0.000 claims description 8
- 108010065511 Amylases Proteins 0.000 claims description 8
- 102200089422 KRT2 S101G Human genes 0.000 claims description 8
- 102200015648 PPP4C N76D Human genes 0.000 claims description 8
- 235000019418 amylase Nutrition 0.000 claims description 8
- 102200003340 RNF31 V104A Human genes 0.000 claims description 6
- 102200020420 TSSK2 K27R Human genes 0.000 claims description 6
- 230000000717 retained Effects 0.000 claims description 6
- 241000193422 Bacillus lentus Species 0.000 claims description 5
- 241000894006 Bacteria Species 0.000 claims description 5
- 230000035772 mutation Effects 0.000 claims description 5
- 229910052698 phosphorus Inorganic materials 0.000 claims description 5
- 241000233866 Fungi Species 0.000 claims description 4
- 102200006512 IDS S87N Human genes 0.000 claims description 4
- 229940040461 Lipase Drugs 0.000 claims description 4
- 102200081857 NCF1 S99G Human genes 0.000 claims description 4
- 229910052799 carbon Inorganic materials 0.000 claims description 4
- 229910052739 hydrogen Inorganic materials 0.000 claims description 4
- 230000002209 hydrophobic Effects 0.000 claims description 4
- 229910052757 nitrogen Inorganic materials 0.000 claims description 4
- 229910052721 tungsten Inorganic materials 0.000 claims description 4
- 229940106157 CELLULASE Drugs 0.000 claims description 3
- 102200074519 CLCNKB V104I Human genes 0.000 claims description 3
- 108010059892 Cellulase Proteins 0.000 claims description 3
- 230000028327 secretion Effects 0.000 claims description 3
- 229910052727 yttrium Inorganic materials 0.000 claims description 3
- 239000004382 Amylase Substances 0.000 claims description 2
- 102200023610 CDC20 S103A Human genes 0.000 claims description 2
- 102220403215 SEMA3D G97N Human genes 0.000 claims description 2
- 102200032059 SH2D1A S57P Human genes 0.000 claims description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 claims description 2
- 108010005400 cutinase Proteins 0.000 claims description 2
- 238000004851 dishwashing Methods 0.000 claims description 2
- 229910052720 vanadium Inorganic materials 0.000 claims description 2
- 241000228212 Aspergillus Species 0.000 claims 1
- 102000033147 ERVK-25 Human genes 0.000 claims 1
- 102000004316 Oxidoreductases Human genes 0.000 claims 1
- 108090000854 Oxidoreductases Proteins 0.000 claims 1
- 102200049396 SERPINF2 A98G Human genes 0.000 claims 1
- OZAIFHULBGXAKX-UHFFFAOYSA-N precursor Substances N#CC(C)(C)N=NC(C)(C)C#N OZAIFHULBGXAKX-UHFFFAOYSA-N 0.000 claims 1
- 229910052717 sulfur Inorganic materials 0.000 claims 1
- 108090000787 Subtilisin Proteins 0.000 description 52
- 102000035443 Peptidases Human genes 0.000 description 39
- 235000001014 amino acid Nutrition 0.000 description 38
- 210000004027 cells Anatomy 0.000 description 33
- 235000018102 proteins Nutrition 0.000 description 27
- 102000004169 proteins and genes Human genes 0.000 description 26
- 108090000623 proteins and genes Proteins 0.000 description 26
- 229920003013 deoxyribonucleic acid Polymers 0.000 description 24
- 235000019833 protease Nutrition 0.000 description 21
- DHMQDGOQFOQNFH-UHFFFAOYSA-N glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 19
- 238000000034 method Methods 0.000 description 13
- 239000004471 Glycine Substances 0.000 description 12
- 230000000875 corresponding Effects 0.000 description 12
- 239000002609 media Substances 0.000 description 12
- 108010084185 Cellulases Proteins 0.000 description 11
- 102000005575 Cellulases Human genes 0.000 description 11
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 11
- MTCFGRXMJLQNBG-REOHCLBHSA-N L-serine Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 10
- 239000000654 additive Substances 0.000 description 10
- 238000004140 cleaning Methods 0.000 description 10
- 239000000047 product Substances 0.000 description 10
- 235000014469 Bacillus subtilis Nutrition 0.000 description 9
- 230000000996 additive Effects 0.000 description 9
- 230000001580 bacterial Effects 0.000 description 9
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 8
- 102000012479 Serine Proteases Human genes 0.000 description 8
- 108010022999 Serine Proteases Proteins 0.000 description 8
- 108010056079 Subtilisins Proteins 0.000 description 8
- 102000005158 Subtilisins Human genes 0.000 description 8
- 238000006243 chemical reaction Methods 0.000 description 8
- 239000000463 material Substances 0.000 description 8
- 239000000758 substrate Substances 0.000 description 8
- -1 BSSDY Proteins 0.000 description 7
- 241000588724 Escherichia coli Species 0.000 description 7
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 7
- 239000012535 impurity Substances 0.000 description 7
- 230000003248 secreting Effects 0.000 description 7
- 229940025131 Amylases Drugs 0.000 description 6
- KGBXLFKZBHKPEV-UHFFFAOYSA-N Boric acid Chemical compound OB(O)O KGBXLFKZBHKPEV-UHFFFAOYSA-N 0.000 description 6
- 102000003992 Peroxidases Human genes 0.000 description 6
- 108090000437 Peroxidases Proteins 0.000 description 6
- 239000008187 granular material Substances 0.000 description 6
- 239000007788 liquid Substances 0.000 description 6
- 238000000746 purification Methods 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 229960002989 Glutamic Acid Drugs 0.000 description 5
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 5
- UIIMBOGNXHQVGW-UHFFFAOYSA-M NaHCO3 Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 5
- 239000004327 boric acid Substances 0.000 description 5
- 238000010367 cloning Methods 0.000 description 5
- 230000000694 effects Effects 0.000 description 5
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 5
- 238000000855 fermentation Methods 0.000 description 5
- 230000004151 fermentation Effects 0.000 description 5
- 230000002538 fungal Effects 0.000 description 5
- 235000013922 glutamic acid Nutrition 0.000 description 5
- 239000004220 glutamic acid Substances 0.000 description 5
- 229920001184 polypeptide Polymers 0.000 description 5
- 230000002797 proteolythic Effects 0.000 description 5
- 101710018965 subC Proteins 0.000 description 5
- 230000001131 transforming Effects 0.000 description 5
- 108091005650 Basic proteases Proteins 0.000 description 4
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 4
- 239000002253 acid Substances 0.000 description 4
- 238000007792 addition Methods 0.000 description 4
- 108090000637 alpha-Amylases Proteins 0.000 description 4
- 102000004139 alpha-Amylases Human genes 0.000 description 4
- 238000010276 construction Methods 0.000 description 4
- 235000014113 dietary fatty acids Nutrition 0.000 description 4
- 239000000194 fatty acid Substances 0.000 description 4
- 150000004665 fatty acids Chemical class 0.000 description 4
- 238000006460 hydrolysis reaction Methods 0.000 description 4
- 231100000219 mutagenic Toxicity 0.000 description 4
- 230000003505 mutagenic Effects 0.000 description 4
- DNIAPMSPPWPWGF-UHFFFAOYSA-N propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- BTUDGPVTCYNYLK-UHFFFAOYSA-N 2,2-dimethylglutaric acid Chemical compound OC(=O)C(C)(C)CCC(O)=O BTUDGPVTCYNYLK-UHFFFAOYSA-N 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 3
- 229960005261 Aspartic Acid Drugs 0.000 description 3
- 229960003071 Bacitracin Drugs 0.000 description 3
- 108010001478 Bacitracin Proteins 0.000 description 3
- 229960005091 Chloramphenicol Drugs 0.000 description 3
- WIIZWVCIJKGZOK-RKDXNWHRSA-N Chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 3
- 241000196324 Embryophyta Species 0.000 description 3
- 241000192125 Firmicutes Species 0.000 description 3
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 3
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 3
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- 108020005203 Oxidases Proteins 0.000 description 3
- 210000001322 Periplasm Anatomy 0.000 description 3
- 239000004473 Threonine Substances 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-N acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- 229940024171 alpha-amylase Drugs 0.000 description 3
- 230000003321 amplification Effects 0.000 description 3
- 230000000692 anti-sense Effects 0.000 description 3
- 235000003704 aspartic acid Nutrition 0.000 description 3
- CLKOFPXJLQSYAH-ABRJDSQDSA-N bacitracin A Chemical compound C1SC([C@@H](N)[C@@H](C)CC)=N[C@@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]1C(=O)N[C@H](CCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CC=2N=CNC=2)C(=O)N[C@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)NCCCC1 CLKOFPXJLQSYAH-ABRJDSQDSA-N 0.000 description 3
- 239000007844 bleaching agent Substances 0.000 description 3
- UXVMQQNJUSDDNG-UHFFFAOYSA-L cacl2 Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 3
- 239000001110 calcium chloride Substances 0.000 description 3
- 229910001628 calcium chloride Inorganic materials 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- 230000029087 digestion Effects 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- 244000005700 microbiome Species 0.000 description 3
- 238000010369 molecular cloning Methods 0.000 description 3
- 238000002703 mutagenesis Methods 0.000 description 3
- 231100000350 mutagenesis Toxicity 0.000 description 3
- 238000003199 nucleic acid amplification method Methods 0.000 description 3
- 229920001223 polyethylene glycol Polymers 0.000 description 3
- 108091007521 restriction endonucleases Proteins 0.000 description 3
- 102220281548 rs898765598 Human genes 0.000 description 3
- 238000002741 site-directed mutagenesis Methods 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- 102200050020 ACER3 E33G Human genes 0.000 description 2
- 229960001230 Asparagine Drugs 0.000 description 2
- 241000193744 Bacillus amyloliquefaciens Species 0.000 description 2
- 241000194108 Bacillus licheniformis Species 0.000 description 2
- 241000194103 Bacillus pumilus Species 0.000 description 2
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 2
- 210000000805 Cytoplasm Anatomy 0.000 description 2
- 241001522878 Escherichia coli B Species 0.000 description 2
- 241000223218 Fusarium Species 0.000 description 2
- 241000193385 Geobacillus stearothermophilus Species 0.000 description 2
- 241000223198 Humicola Species 0.000 description 2
- 241001480714 Humicola insolens Species 0.000 description 2
- 229960000310 ISOLEUCINE Drugs 0.000 description 2
- 102100004459 KLK11 Human genes 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- XUJNEKJLAYXESH-REOHCLBHSA-N L-cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 2
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 2
- 108010049190 N,N-dimethylcasein Proteins 0.000 description 2
- 229920000272 Oligonucleotide Polymers 0.000 description 2
- 229960005190 Phenylalanine Drugs 0.000 description 2
- 241000589516 Pseudomonas Species 0.000 description 2
- 229920005654 Sephadex Polymers 0.000 description 2
- 239000012507 Sephadex™ Substances 0.000 description 2
- 229920002684 Sepharose Polymers 0.000 description 2
- 241000187747 Streptomyces Species 0.000 description 2
- 241000223258 Thermomyces lanuginosus Species 0.000 description 2
- RWQNBRDOKXIBIV-UHFFFAOYSA-N Thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- 210000002268 Wool Anatomy 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 108010082503 alkaline elastase YaB Proteins 0.000 description 2
- 150000001408 amides Chemical class 0.000 description 2
- 101700024251 apr Proteins 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 238000010170 biological method Methods 0.000 description 2
- 239000011248 coating agent Substances 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 238000011156 evaluation Methods 0.000 description 2
- 239000004744 fabric Substances 0.000 description 2
- 150000002191 fatty alcohols Chemical class 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- KFZMGEQAYNKOFK-UHFFFAOYSA-N iso-propanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 2
- 239000004310 lactic acid Substances 0.000 description 2
- 235000014655 lactic acid Nutrition 0.000 description 2
- 229920000847 nonoxynol Polymers 0.000 description 2
- IAYPIBMASNFSPL-UHFFFAOYSA-N oxane Chemical group C1CO1 IAYPIBMASNFSPL-UHFFFAOYSA-N 0.000 description 2
- 230000036961 partial Effects 0.000 description 2
- 229920005862 polyol Polymers 0.000 description 2
- 150000003077 polyols Chemical class 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 238000002708 random mutagenesis Methods 0.000 description 2
- 125000003616 serine group Chemical class [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 2
- 150000004760 silicates Chemical class 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 108060007849 sprT Proteins 0.000 description 2
- 239000001384 succinic acid Substances 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 239000002699 waste material Substances 0.000 description 2
- ZLMZUBWMXYINBC-JSCBLRFUSA-N (4S,4aS,5aS,6S,12aR)-4-(dimethylamino)-1,6,10,11,12a-pentahydroxy-6-methyl-3,12-dioxo-4,4a,5,5a-tetrahydrotetracene-2-carboxamide;(3R,4S,5S,6R,7R,9R,11R,12R,13S,14R)-6-[(2S,3R,4S,6R)-4-(dimethylamino)-3-hydroxy-6-methyloxan-2-yl]oxy-14-ethyl-7,12,13-trihy Chemical compound C1=CC=C2[C@](O)(C)[C@H]3C[C@H]4[C@H](N(C)C)C(=O)C(C(N)=O)=C(O)[C@@]4(O)C(=O)C3=C(O)C2=C1O.O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)C(=O)[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 ZLMZUBWMXYINBC-JSCBLRFUSA-N 0.000 description 1
- 229920000160 (ribonucleotides)n+m Polymers 0.000 description 1
- KUXGUCNZFCVULO-UHFFFAOYSA-N 2-(4-nonylphenoxy)ethanol Chemical compound CCCCCCCCCC1=CC=C(OCCO)C=C1 KUXGUCNZFCVULO-UHFFFAOYSA-N 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K 2qpq Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 102200050024 ACER3 S99A Human genes 0.000 description 1
- 102220443525 ACHE G97S Human genes 0.000 description 1
- 241001019659 Acremonium <Plectosphaerellaceae> Species 0.000 description 1
- 229920002126 Acrylic acid copolymer Polymers 0.000 description 1
- 229960000643 Adenine Drugs 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Natural products NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N Ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229940064005 Antibiotic throat preparations Drugs 0.000 description 1
- 229940083879 Antibiotics FOR TREATMENT OF HEMORRHOIDS AND ANAL FISSURES FOR TOPICAL USE Drugs 0.000 description 1
- 229940042052 Antibiotics for systemic use Drugs 0.000 description 1
- 229940042786 Antitubercular Antibiotics Drugs 0.000 description 1
- 241000193752 Bacillus circulans Species 0.000 description 1
- 241000193749 Bacillus coagulans Species 0.000 description 1
- 241000194107 Bacillus megaterium Species 0.000 description 1
- 240000008371 Bacillus subtilis Species 0.000 description 1
- 229940075615 Bacillus subtilis Drugs 0.000 description 1
- 241000193388 Bacillus thuringiensis Species 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 241000149420 Bothrometopus brevis Species 0.000 description 1
- 241000589513 Burkholderia cepacia Species 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate dianion Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 210000000349 Chromosomes Anatomy 0.000 description 1
- 108090000317 Chymotrypsin Proteins 0.000 description 1
- 229920001405 Coding region Polymers 0.000 description 1
- 229920002676 Complementary DNA Polymers 0.000 description 1
- 241000222511 Coprinus Species 0.000 description 1
- 244000251987 Coprinus macrorhizus Species 0.000 description 1
- 229940104302 Cytosine Drugs 0.000 description 1
- OPTASPLRGRRNAP-UHFFFAOYSA-N Cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 1
- QIVBCDIJIAJPQS-SECBINFHSA-N D-tryptophane Chemical compound C1=CC=C2C(C[C@@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-SECBINFHSA-N 0.000 description 1
- 102000016559 DNA Primase Human genes 0.000 description 1
- 108010092681 DNA Primase Proteins 0.000 description 1
- MUCZHBLJLSDCSD-UHFFFAOYSA-N Diisopropyl fluorophosphate Chemical compound CC(C)OP(F)(=O)OC(C)C MUCZHBLJLSDCSD-UHFFFAOYSA-N 0.000 description 1
- 108010083608 Durazym Proteins 0.000 description 1
- 108010042407 Endonucleases Proteins 0.000 description 1
- 102000004533 Endonucleases Human genes 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 241000223221 Fusarium oxysporum Species 0.000 description 1
- 229960002442 Glucosamine Drugs 0.000 description 1
- 235000010469 Glycine max Nutrition 0.000 description 1
- UYTPUPDQBNUYGX-UHFFFAOYSA-N Guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 1
- 229940093922 Gynecological Antibiotics Drugs 0.000 description 1
- 210000004209 Hair Anatomy 0.000 description 1
- 240000005979 Hordeum vulgare Species 0.000 description 1
- 235000007340 Hordeum vulgare Nutrition 0.000 description 1
- 210000003000 Inclusion Bodies Anatomy 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N Kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- 108010029541 Laccase Proteins 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- 108010000655 M-protease Proteins 0.000 description 1
- 102100003028 MANBA Human genes 0.000 description 1
- 101700067221 MANBA Proteins 0.000 description 1
- 108060005135 MPL Proteins 0.000 description 1
- 102000005741 Metalloproteases Human genes 0.000 description 1
- 108010006035 Metalloproteases Proteins 0.000 description 1
- WHNWPMSKXPGLAX-UHFFFAOYSA-N N-Vinylpyrrolidone Chemical compound C=CN1CCCC1=O WHNWPMSKXPGLAX-UHFFFAOYSA-N 0.000 description 1
- KJPHTXTWFHVJIG-UHFFFAOYSA-N N-ethyl-2-[(6-methoxypyridin-3-yl)-(2-methylphenyl)sulfonylamino]-N-(pyridin-3-ylmethyl)acetamide Chemical compound C=1C=C(OC)N=CC=1N(S(=O)(=O)C=1C(=CC=CC=1)C)CC(=O)N(CC)CC1=CC=CN=C1 KJPHTXTWFHVJIG-UHFFFAOYSA-N 0.000 description 1
- SNQQPOLDUKLAAF-UHFFFAOYSA-N Nonylphenol Chemical class CCCCCCCCCC1=CC=CC=C1O SNQQPOLDUKLAAF-UHFFFAOYSA-N 0.000 description 1
- 101700047009 PCSK6 Proteins 0.000 description 1
- 102100003489 PCSK6 Human genes 0.000 description 1
- 241000194109 Paenibacillus lautus Species 0.000 description 1
- 229940072417 Peroxidase Drugs 0.000 description 1
- HXITXNWTGFUOAU-UHFFFAOYSA-N Phenylboronic acid Chemical class OB(O)C1=CC=CC=C1 HXITXNWTGFUOAU-UHFFFAOYSA-N 0.000 description 1
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 1
- 229920002504 Poly(2-vinylpyridine-N-oxide) Polymers 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 108010059820 Polygalacturonase Proteins 0.000 description 1
- 241000168225 Pseudomonas alcaligenes Species 0.000 description 1
- 241000589540 Pseudomonas fluorescens Species 0.000 description 1
- 241000589630 Pseudomonas pseudoalcaligenes Species 0.000 description 1
- 241000589774 Pseudomonas sp. Species 0.000 description 1
- 241000589614 Pseudomonas stutzeri Species 0.000 description 1
- 241000577556 Pseudomonas wisconsinensis Species 0.000 description 1
- XPPKVPWEQAFLFU-UHFFFAOYSA-J Pyrophosphate Chemical compound [O-]P([O-])(=O)OP([O-])([O-])=O XPPKVPWEQAFLFU-UHFFFAOYSA-J 0.000 description 1
- 101710028810 RC0047 Proteins 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 229940080237 Sodium Caseinate Drugs 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 241000187398 Streptomyces lividans Species 0.000 description 1
- LSNNMFCWUKXFEE-UHFFFAOYSA-L Sulphite Chemical compound [O-]S([O-])=O LSNNMFCWUKXFEE-UHFFFAOYSA-L 0.000 description 1
- BGRWYDHXPHLNKA-UHFFFAOYSA-N Tetraacetylethylenediamine Chemical compound CC(=O)N(C(C)=O)CCN(C(C)=O)C(C)=O BGRWYDHXPHLNKA-UHFFFAOYSA-N 0.000 description 1
- 241001313536 Thermothelomyces thermophila Species 0.000 description 1
- 241001494489 Thielavia Species 0.000 description 1
- 229940113082 Thymine Drugs 0.000 description 1
- 229940024982 Topical Antifungal Antibiotics Drugs 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 229940035893 Uracil Drugs 0.000 description 1
- 108020005202 Viral DNA Proteins 0.000 description 1
- 101700006119 XYL1 Proteins 0.000 description 1
- 101700047052 XYLA Proteins 0.000 description 1
- 101700051122 XYLD Proteins 0.000 description 1
- 101700065756 XYN4 Proteins 0.000 description 1
- 101700001256 Xyn Proteins 0.000 description 1
- 102200106305 ZNF461 N87S Human genes 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- NIXOWILDQLNWCW-UHFFFAOYSA-N acrylic acid Chemical compound OC(=O)C=C NIXOWILDQLNWCW-UHFFFAOYSA-N 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 1
- 101700053141 aex-5 Proteins 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- 150000008051 alkyl sulfates Chemical class 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- 239000003945 anionic surfactant Substances 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000844 anti-bacterial Effects 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- 125000000511 arginine group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 1
- 239000003899 bactericide agent Substances 0.000 description 1
- 230000000721 bacterilogical Effects 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 230000003115 biocidal Effects 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 108010089934 carbohydrase Proteins 0.000 description 1
- 125000004432 carbon atoms Chemical group C* 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 238000005341 cation exchange Methods 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 235000013339 cereals Nutrition 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 230000002759 chromosomal Effects 0.000 description 1
- 229960002376 chymotrypsin Drugs 0.000 description 1
- 230000000295 complement Effects 0.000 description 1
- 239000008139 complexing agent Substances 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 238000005260 corrosion Methods 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- 230000004059 degradation Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 229940079919 digestives Enzyme preparations Drugs 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 239000001177 diphosphate Substances 0.000 description 1
- 235000011180 diphosphates Nutrition 0.000 description 1
- 229910000397 disodium phosphate Inorganic materials 0.000 description 1
- GMSCBRSQMRDRCD-UHFFFAOYSA-N dodecyl 2-methylprop-2-enoate Chemical compound CCCCCCCCCCCCOC(=O)C(C)=C GMSCBRSQMRDRCD-UHFFFAOYSA-N 0.000 description 1
- 239000000428 dust Substances 0.000 description 1
- 238000010410 dusting Methods 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N edta Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 238000004453 electron probe microanalysis Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 150000002148 esters Chemical group 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 239000002979 fabric softener Substances 0.000 description 1
- 239000000706 filtrate Substances 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 235000013312 flour Nutrition 0.000 description 1
- 229960005051 fluostigmine Drugs 0.000 description 1
- 239000006260 foam Substances 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 230000002068 genetic Effects 0.000 description 1
- 108010061330 glucan 1,4-alpha-maltohydrolase Proteins 0.000 description 1
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 description 1
- 125000000404 glutamine group Chemical group N[C@@H](CCC(N)=O)C(=O)* 0.000 description 1
- 150000002332 glycine derivatives Chemical class 0.000 description 1
- 239000001963 growth media Substances 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 229910001385 heavy metal Inorganic materials 0.000 description 1
- 230000002363 herbicidal Effects 0.000 description 1
- 239000004009 herbicide Substances 0.000 description 1
- 125000003372 histidine group Chemical class [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 1
- 239000003752 hydrotrope Substances 0.000 description 1
- 150000003949 imides Chemical class 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 229940079866 intestinal antibiotics Drugs 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 108010059345 keratinase Proteins 0.000 description 1
- 239000010985 leather Substances 0.000 description 1
- 125000001909 leucine group Chemical group [H]N(*)C(C(*)=O)C([H])([H])C(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 230000000670 limiting Effects 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 108010003855 mesentericopeptidase Proteins 0.000 description 1
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 1
- 239000003595 mist Substances 0.000 description 1
- 108010073682 nattokinase Proteins 0.000 description 1
- 230000001264 neutralization Effects 0.000 description 1
- MGFYIUFZLHCRTH-UHFFFAOYSA-N nitrilotriacetic acid Chemical compound OC(=O)CN(CC(O)=O)CC(O)=O MGFYIUFZLHCRTH-UHFFFAOYSA-N 0.000 description 1
- 235000013615 non-nutritive sweetener Nutrition 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 229940005935 ophthalmologic Antibiotics Drugs 0.000 description 1
- 230000003287 optical Effects 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 230000003204 osmotic Effects 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- PNIJRIIGBGFYHF-UHFFFAOYSA-N perborate(2-) Chemical compound O[B-]1(O)OO[B-](O)(O)OO1 PNIJRIIGBGFYHF-UHFFFAOYSA-N 0.000 description 1
- 239000002304 perfume Substances 0.000 description 1
- 150000004965 peroxy acids Chemical class 0.000 description 1
- NJRWNWYFPOFDFN-UHFFFAOYSA-L phosphonate(2-) Chemical compound [O-][P]([O-])=O NJRWNWYFPOFDFN-UHFFFAOYSA-L 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229920002006 poly(N-vinylimidazole) polymer Polymers 0.000 description 1
- 229920000058 polyacrylate Polymers 0.000 description 1
- 229920005646 polycarboxylate Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 229920000023 polynucleotide Polymers 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 229920005996 polystyrene-poly(ethylene-butylene)-polystyrene Polymers 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 235000004252 protein component Nutrition 0.000 description 1
- 210000001938 protoplasts Anatomy 0.000 description 1
- 230000035484 reaction time Effects 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 102220285757 rs747302288 Human genes 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 1
- 235000017557 sodium bicarbonate Nutrition 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 235000019832 sodium triphosphate Nutrition 0.000 description 1
- VQOIVBPFDDLTSX-UHFFFAOYSA-M sodium;3-dodecylbenzenesulfonate Chemical compound [Na+].CCCCCCCCCCCCC1=CC=CC(S([O-])(=O)=O)=C1 VQOIVBPFDDLTSX-UHFFFAOYSA-M 0.000 description 1
- MWNQXXOSWHCCOZ-UHFFFAOYSA-L sodium;oxido carbonate Chemical compound [Na+].[O-]OC([O-])=O MWNQXXOSWHCCOZ-UHFFFAOYSA-L 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 101700072241 sprC Proteins 0.000 description 1
- 101710033661 sprD Proteins 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 230000001954 sterilising Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 101700042926 subB Proteins 0.000 description 1
- 108010004307 subtilisin J Proteins 0.000 description 1
- 150000003457 sulfones Chemical class 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 108010075550 termamyl Proteins 0.000 description 1
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 230000002103 transcriptional Effects 0.000 description 1
- 238000000844 transformation Methods 0.000 description 1
- 150000003626 triacylglycerols Chemical class 0.000 description 1
- 239000001226 triphosphate Substances 0.000 description 1
- 235000011178 triphosphate Nutrition 0.000 description 1
- UNXRWKVEANCORM-UHFFFAOYSA-I triphosphate(5-) Chemical compound [O-]P([O-])(=O)OP([O-])(=O)OP([O-])([O-])=O UNXRWKVEANCORM-UHFFFAOYSA-I 0.000 description 1
- 229960001322 trypsin Drugs 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 125000000430 tryptophan group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C2=C([H])C([H])=C([H])C([H])=C12 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 101700065693 xlnA Proteins 0.000 description 1
- 101700006979 xyl2 Proteins 0.000 description 1
- 101710017636 xynS20E Proteins 0.000 description 1
- 239000010457 zeolite Substances 0.000 description 1
Abstract
Subtilase enzymes of the I-S1 and I-S2 sub-groups having an additional amino acid residue in position 100 of the active site loop (b) region from position 95 to 103. Variant subtilases exhibit improved wash performance in a detergent in comparison to its parent enzyme.
Description
SUBSTITUTE ENZYMES OF SUB-GROUPS I-SI AND I-S2 WHICH HAVE AN ADDITIONAL AMINO-ACID RESIDUE IN A RIPPLE REGION
OF THE ACTIVE SITE
TECHNICAL FIELD
This invention relates to the novel subtylase enzymes of subgroups I-SI and I-S2 having at least one additional amino acid residue at position 100 of region (b) of the active site loop at position 95 to 103. These proteases are useful showing excellent or improved wash performance when used in detergents; cleaning compositions and detergents. The invention further relates to genes that code for the expression of said enzymes when inserted into a suitable host cell or organism; and such host cells transformed therewith and capable of expressing said enzyme variants and methods for producing the novel enzymes.
BACKGROUND OF THE INVENTION
In the detergent industry, enzymes have been implemented in washing formulations for more than 30 years. The enzymes used in such
Ref: 130280 formulations comprise proteases, lipases, amylases, cellulases, as well as other enzymes, or mixtures thereof. The most important commercial enzymes are proteases. An increasing number of commercially used proteases are variants of genetically engineered proteins, wild type proteases of natural origin, for example DURAZYM "(Novo Nordisk A / S), RELASEβ (Novo Nordisk A / S), MAXAPEM ® (Gist-Brocades NV), PURAFECT® (Genencor International, Inc.) In addition a number of protease variants are described in the art, such as in European Patent EP 130756 (GENENTECH) (corresponding to the Reissue Patent). from US No. 34,606 (GENENCOR)), European Patent EP 214435 (HENKEL), and WO 87/04461 (AMGEN), WO 87/05050 (GENEX), EP 260105 (GENENCOR), Thomas Russell, and Fersht (1985) Nature 318 375-376, Thomas, Russell, and Fersht (1987) ". Mol. Biol. 193 803-813; Russel and Fersht Nature 328 496-500 (1987); WO 88/08028 (Genex); WO 88/08033 (Amgen); WO 95/27049 (SOLVAY S.A.); WO 95/30011 (PROCTER &GAMBLE COMPANY); WO 95/30010 (PROTECTER S GAMBLE COMPANY); WO 95/29979 (PROTER &GAMBLE COMPANY); US 5,543,302 (SOLVAY S.A.); EP 251 446 (GENENCOR); WO 89/06279 (NOVO NORDISK A / S); WO 91/00345 (NOVO NORDISK A / S); EP 525 610 Al (SOLVAY); and WO 94/02618
(GIST-BROCADES N.V.). However, even when a number of useful protease variants have been described, there is still a need for new improved proteases and protease variants for various industrial uses. Therefore, an object of the present invention is to provide improved proteases for protein-engineered protein protease variants, especially for use in the detergent industry.
BRIEF DESCRIPTION OF THE INVENTION
The present inventors have found that subtilisins in which at least one of the active site loops are longer than those currently known, show improved washing performance properties in detergent compositions. The identification thereof was carried out in the construction of the subtilisin variants, especially subtilisin 309 (BLSAVI or Savinase), showing improved washing performance properties in detergent compositions in relation to the wild-type progenitor enzyme. This has been described in our first application DK1332 / 97.
It has now been found that certain subtilases or variants thereof of the subgroups I-SI (true "subtilisins") and I-S2 (highly alkaline subtilisins) having at least one additional amino acid residue in the 100 position (or rather between positions 100 and 101) of region (b) of the curl of the active site from position 95 to 103, show surprisingly improved wash performance compared to those currently known and those described in this application. The improved proteases according to the invention can be obtained by isolation from natural resources or by introduction of at least one additional amino acid residue (one insert) into the loop (b) of the active site between positions 100 and 101 in a subtyla of wild type (for a definition of the curls of active type and the numbering of the positions, See later) . Although this finding was made in subtilisin 309, it is predicted that it will be possible to produce or isolate similar advantageous subtilases or subtylase variants. In addition, it will be possible to specifically select the natural isolates to identify the novel wild-type subtilases comprising an active site loop (b) which is longer than the corresponding active site loop in the known wild type subtilases, such as subtilisin 309, which subtilases can be considered as possessing an amino acid residue inserted between positions 100 and 101, and which exhibit excellent washing performance in a detergent as compared to its more closely related known subtilisin, such as subtilisin 309. to alignment and numbering, reference is made to figures 1, la, 2 and 2a below, which show the alignments between the subtilisin BPN '(BASBPN) (a) and subtilisin 309 (BLSAVI) (b), and the alignments between subtilisin BPN '(a) (BASPN) and subtilisin Carlsberg (g) (BLSCAR). In Figures 1 and 2, the alignments were established by using the GAP routine of the GCG package as indicated below, while the alignments of the figures la and 2a are the same as shown in WO 91/00345. These alignments are in this patent application used as a reference for the numbering of the waste. The seven active site loops (a) through (g) (including both indicated extreme amino acid residues) are defined herein to encompass the amino acid residues in the segments given below (a) the region between amino acid residue 33 and 43;
(b) the region between amino acid residue 95 and 103; (c) the region between amino acid residue 125 and 132;
(d) the region between amino acid residue 153 and 173;
(e) the region between amino acid residue 181 and 195; (f) the region between amino acid residue 202 and 204;
(g) the region between amino acid residue 218 and 219; Accordingly, in a first aspect the invention relates to an isolated subtilase enzyme (eg more than 10% pure) of the subgroups I-IF and I-S2 having at least one additional amino acid residue at position 100 of the region (b) of the curl of the active site from position 95 to 103, whereby the additional amino acid residue (s) corresponds to the insertion of at least one amino acid residue between positions 100 and 101. In a second aspect, the invention relates to an isolated DNA sequence encoding a subtyla variant of the invention. In a third aspect, the invention relates to an expression vector comprising an isolated DNA sequence encoding a subtyla variant of the invention. In a fourth aspect, the invention relates to a microbial host cell transformed by an expression vector according to the fourth aspect.
In a further aspect, the invention relates to the production of the subtilisin enzymes of the invention. The enzymes of the invention can be generally produced either by culturing a microbial strain from which the enzyme was isolated, and recovering the enzyme in substantially pure form; or by inserting an expression vector according to the fourth aspect of the invention into a suitable microbial host, culturing the host to express the desired subtylase enzyme, and recovering the enzyme product. In addition, the invention relates to a composition comprising a subtilase or subtyla variant of the invention. Additionally the invention relates to the use of the enzymes of the invention for a number of industrially relevant uses, in particular for use in cleaning compositions and cleaning compositions comprising the mutant enzymes, especially detergent compositions comprising the mutant subtilisin enzymes.
DEFINITIONS
Before discussing this invention in further detail, the following terms and conventions will be defined first.
NOMENCLATURE OF AMINO ACIDS
A Ala Alanine V Val Valine L Leu Leucine I I Isoleucine P Pro Proline F Phe Phenylalanine W Trp Tryptophan M Met Methionine G Gly Glycine S Ser Serine T Thr Threonine c Cys Cysteine Y Tyr Tyrosine N Asn Asparagine Q Gln Glutamine D Asp Aspartic acid E Glu Glutamic acid K Lys Lysine R Arg Arginine H His Histidine X Xaa Any amino acid
NOMENCLATURE OF NUCLEIC ACIDS
A Adenine G Guanine C Cytosine T Thymine (only in DNA) U Uracil (only in RNA)
NOMENCLATURE AND CONVENTIONS FOR THE DESIGNATION OF VARIANTS
In describing the various enzyme variants produced or contemplated according to the invention, they have been adapted the following nomenclatures and conventions for ease of reference: A frame of reference is first defined by aligning the enzyme isolated wild type or offspring subtilisin BPN '(BASBPN). The alignment can be obtained through the GAP routine of the GCG package, version 9.1, to number the variants using the following parameters: penalty for creation = 8 and penalty for extension of empty space = 8 and all other parameters maintained in their default values. Another method is to use recognized, known alignments between subtilases, such as the alignment indicated in WO 91/00345. In most cases, the differences will not be of any importance. Such alignments between subtilisin BPN '(BASBP) and subtilisin 309 (BLSAVI) and subtilisin Carlsberg (BLSCAR), respectively, are indicated in figures 1, 2, and 2a. These define a number of deletions and insertions in relation to BASBPN. In Figure 1, subtilisin 309 has 6 deletions at positions 36, 58, 158, 162, 163, and 164 compared to BASBPN, whereas in the figure subtilisin 309 has the same deletions at positions 36, 56 , 159, 164, 165 and 166 compared to BASBPN. In Fig. 2 the Carlsberg subtilisin has a deletion at position 58 compared to BASBPN, while in Fig. 2a the Carlsberg subtilisin has a deletion at position 56 compared to BASBPN. These deletions are in figures 1, 2, and 2a indicated by asterisks (*).
The various modifications made to a wild-type enzyme are generally indicated using three elements as follows:
Amino acid substituted at the position of the original amino acid
The notation G195E thus means a substitution of a glycine at position 195 with a glutamic acid. In the case when the original amino acid residue can be any amino acid residue, a short manual notation can sometimes be used indicating only the position and the substituted amino acid.
Amino acid substituted in position
Such notation is particularly relevant in connection with the modification (s) in the homologous subtilases (see below). Similarly when the identity of the resulting amino acid residues is not important.
Original amino acid position
When the original amino acid (s) and the substituted amino acid (s) can comprise any amino acid, then only the position is indicated, for example: 170. When the original amino acid (s) and / or the substituted amino acid (s) may comprise more than one, but Not all amino acids, then the selected amino acids are indicated inside braces. { } .
Original amino acid position (substituted amino acid!, ..., substituted amino acid
For the specific variants, the specific codes of three letters or one letter are used, including Xaa and X codes to indicate any amino acid residue.
SUBSTITUTIONS: The replacement of glutamic acid by glycine at position 195 is indicated as: Glyl95Glu or G195E or the substitution of any amino acid residue by glycine at position 195 is designated as:
Glyl95Xaa G195X
Glyl95 or G195 Substitution of serine for any amino acid residue at position 170 could be designated in this way: Xaal70Ser or X170S or 170Ser 170S. Such notation is particularly relevant in connection with the modification (s) in the homologous subtilases (see below) . 170Ser is understood in this way as comprising, for example, a modification Lysl70Ser in BASBPN and the modification Argl70Ser in BLSAVI (see figure 1). For a modification where the original amino acids and / or the substituted amino acid (s) may comprise more than one, but not all of the amino acids, the substitution of glycine, alanine, serine or threonine by arginine at position 170 could be indicated by Argl70. { Gly, Ala, Ser, Thr} or R170. { G,,?, T.}. to indicate the variants R170G, R170A, R170S, and R170T.
SUPPRESSIONS: A deletion of glycine at position 195 will be indicated by: Glyl95 * or G1 5 * Correspondingly, the deletion of more than one amino acid residue, such as deletion of glycine and leucine at positions 195 and 196 will be designated: Glyl95 * + Leul96 * or G195 * + L196 *
INSERTIONS: The insertion of an additional amino acid residue such as for example a lysine after G195 is: Glyl95GlyLys or G195GK; or when more than one amino acid residue is inserted, such as for example Lys, Ala and Ser after G195 this is: Glyl95GlyLysAlaSer or G195GKAS In such cases the inserted amino acid residue (s) is numbered by the insertion of lowercase letters to the number of position of the amino acid residue that precedes the inserted amino acid residue (s). In the previous example, sequences 194 to 196 could be as follows: 194 195 196 BLSAVI A - G - L 194 195 195a 195b 195c 196 Variant A - G - K - A - S - L In cases where a waste of amino acid identical to the existing amino acid residue is inserted, it is clear that a degeneration arises in the nomenclature. If for example a glycine is inserted after the glycine in the previous example, this could be indicated by G195GG. The same effective change could also be indicated just as A194AG by the change from: 194 195 196 BLSAVI A - G - L
194 195 195a 196 Variant A - G - G - L 194 194a 195 196 Such cases will be apparent to the person skilled in the art, and the indication G195GG and the corresponding indications for this type of insertions are understood in this way to include such indications equivalent degenerates.
FILLING AN EMPTY SPACE: When there is a deletion in an enzyme in the reference comparison with the subtilisin sequence BPN 'used for numbering, an insert in such position is indicated as: * 36Asp or * 36D for the insertion of an aspartic acid in position 36.
MULTIPLE MODIFICATIONS Variants comprising multiple modifications are separated by plus signs, for example: Argl70Tyr + Glyl95Glu or R170Y + G195E representing modifications at positions 170 and 195 substituting tyrosine and glutamic acid for arginine and glycine, respectively, or for example
Tyrl67. { Gly, Ala, Ser, Thr} + Argl70. { Gly, Ala, Ser, Thr} designates Tyrl67Gly + Argl70Gly variants, Tyrl67Gly + Argl70Ala, Tyrl67Gly + Argl70Ser, Tyrl67Gly + Argl70Thr, Tyrl67Ala + Argl70Gly, Tyrl67Ala + Argl70Ala, Tyrl67Ala + Argl70Ser, Tyrl67Ala + Arg170Thr, Tyrl67Ser + Argl70Gly, Tyrl67Ser + Argl70Ala, Tyrl67Ser + Argl70Ser, Tyrl67Ser + Argl70Thr , Tyrl67Thr + Argl70Gly, Tyrl67Thr + Argl70Ala, Tyrl67Thr + Argl70Ser, Tyr167Thr + Arg170Thr, This nomenclature is particularly relevant in relation to modifications directed to substitution, replacement, insertion or deletion of amino acid residues that have specific common properties, such as positive charge residues (K, R, H), negatively charged (D, E), or one or more conservative amino acid modifications for example from
Tyrl67. { Gly, Ala, Ser, Thr) + Argl70. { Gly, Ala, Ser, Thr} , which means the substitution of a small amino acid for another small amino acid. See section "Detailed description of the invention" for additional details.
Proteases
Enzymes that break amide bonds in protein substrates are classified as proteases, or (interchangeably) peptidases (see Walsh, 1979,
Enzimatic Reaction Mechanisms. W.H. Freeman and Company,
San Francisco, Chapter 3).
Numbering of amino acid positions / residues If nothing is mentioned, the amino acid numbering used herein corresponds to that of the BPN subtylase sequence (BASBPN). For an additional description of the BPN 'sequence, see Figures 1 and 2, or Siezen et al., Protein Engng. 4 (1991) 719-737.
Serine proteases A serine protease is an enzyme that catalyzes the hydrolysis of peptide bonds, and in which there is an essential serine residue in the active site (White, Handler and Smith, 1973 ^ Principies of Biochemistry. "Fifth Edition, McGraw-Hill Book Company, NY, pages 271-272.) Bacterial serine proteases have molecular weights in the range of 20,000 to 45,000 daltons, which are inhibited by diisopropyl fluorophosphate, which hydrolyse simple terminal esters and are similar in activity to eukaryotic chymotrypsin, also a serine protease A narrower term, alkaline protease, which covers a subgroup, reflects the high pH optimum of some of the serine proteases, from pH 9.0 to 11.0 (for review, see Priest (1977) Bacteriological Rev. 41 711-753).
Subtilases A subgroup of serine proteases tentatively designated as subtilases has been proposed by Siezen et al., Protein Engng. (1991) 719-737 and Siezen et al., Protein Science 6 (1997) 501-523. These are defined by homology analysis of more than 170 amino acid sequences of the serine proteases previously referred to as subtilisin-like proteases. A subtilisin was previously previously defined as a serine protease produced by Gram positive bacteria or fungi, and according to Siezen et al. now it is a group of subtilasas. A wide variety of subtilases have been identified, and the amino acid sequence of a number of subtilases has been determined. For a more detailed description of such subtilases and their amino acid sequences reference is made to Siezen et al. (1997). A subgroup of the subtilases, I-SI or "true" subtilisins comprise the "classical" subtilisins, such as subtilisin 168 (BSS168), subtilisin BPN ', subtilisin Carlsberg (ALCALASE®, NOVO NORDISK A / S), and subtilisin DY (BSSDY). An additional subgroup of subtilases, I-S2 or highly alkaline subtilisins, is recognized by Siezen et al. (supra) The proteases of subgroup I-S2 are described as highly alkaline subtilisins and comprise enzymes such as subtilisin PB92 (BAALKP) (MAXACAL®, Gist-Brocades NV), subtilisin 309 (SAVINASE *, NOVO NORDISK A / S), subtilisin 147 (BLS147) (ESPERASE8, NOVO NORDISK A / S), and alkaline elastase YaB (BSEYAB).
List of acronyms for subtilasas:
I-SI Subtilisin 168, BSS168 (Subtilisin amylosacchariticus), BSAPRJ (Subtilisin J), BSAPRN (Subtilisin NAT), BMSAMP (Mesentericopeptidase), Subtilisin BPN ', BASBPN, Subtilisin DY, BSSDY, Subtilisin Carlsberg, BLSCAR (BLKERA (Keratinase), BLSCA1, BLSCA2, BLSCA3), BSSPRC, Serine Protease C BSSPRD, Serine Protease D
I-S2 Subtilisin Sendai, BSAPRS Subtilisin ALP 1, BSAPRQ, Subtilisin 147, Esperase "BLS147 (BSAPRM (SubtilisinAprM),
(BAH101), Subtilisin 309, Savinase®, BLS309 / BLSAVI (BSKSMK (M-protease), BAALKP (Subtilisin PB92, Alkalophilic alkaline protease of Bacillus), BLSUBL (Subtilisin BL), Alkaline elastase YaB, BYSYAB, "SAVINASE"
"SAVINASE *" is marketed by NOVO NORDISK A / S. This is subtilisin 309 of B. Lentus and differs from BAALKP only in one position (N87S, see figure 1 herein). "SAVINASE" has the amino acid sequence designated b) in Figure 1.
Progenitor Subtilasa The term "Subtilasa progenitora" describes a subtilase defined according to Siezen et al. (1991 and 1997). For additional details see the description of "Subtilasas" immediately above. A progenitor subtilasa can also be an isolated subtyla from a natural source, where subsequent modification has been made while retaining the characteristic of a subtilase. Alternatively, the term "progenitor subtylase" can be termed "wild-type subtylase".
Modification (s) of a subtyla variant The term "modification (s)" used herein is defined to include the chemical modification of a subtyla as well as the genetic manipulation of the DNA encoding a subtyla. The or modifications may be one or more replacements of the amino acid side chain (s), substitution (s), deletion (s) and / or insertions within or in the amino acid or amino acids of interest.
Subtylase variant In the context of this invention, the term mutated subtylase or subtylase term means a subtylase that has been produced by an organism that is expressing a mutant gene derived from a parent microorganism that possessed an original or progenitor gene, and which producing a corresponding progenitor enzyme, the parent gene has been mutated in order to produce the mutant gene from which the mutated subtylase protease is produced when expressed in a suitable host.
Subtylase Homologous Sequences The curl regions of the specific active site, and the amino acid insertions in the curls of the subtilase SAVINASE * are identified for modification herein, to obtain a subtyla variant of the invention. However, the invention is not limited to modifications of this particular subtilase, but it extends to other progenitor subtilases (wild type), which have a primary structure homologous to that of SAVINASE. The homology between two amino acid sequences is in this context described by the parameter "identity". In order to determine the degree of identity between two subtilases, the GAP routine of version 9.1 of the GCG package can be applied (infra) using the same settings. The result of the routine is in addition to the alignment of the amino acids the calculation of the "Percentage Identity" between the two sequences. Based on this description, it is routine for a person skilled in the art to identify the appropriate homologous subtilases and the corresponding homologous active site loop regions, which can be modified according to the invention.
Washing performance The ability of an enzyme to catalyze the degradation of various substrates of natural origin present on objects that are to be cleaned, for example during washing or cleaning hard surfaces, is frequently referred to as its washing ability, washability, Detergency, or washing operation. Throughout this specification, the term wash operation will be used to encompass this property.
SEQUENCE OF ISOLATED DNA
The term "isolated or isolated", when applied to a DNA sequence molecule, denotes that the DNA sequence has been removed from its natural genetic environment and is thus free of other foreign or undesired coding sequences, and is in a form suitable for use within protein production systems, engineered by genetic engineering. Such isolated molecules are those that are separated from their natural environment and include cDNAs and genomic clones. The isolated DNA molecules of the present invention are free of other genes with which they are ordinarily associated, but may include the 5 'and 3' non-translated regions of natural origin such as promoters and terminators. The identification of the associated regions will be apparent to a person of ordinary skill in the art (see for example, Dynan and Tijan, Nature 316: 774-78, 1985). The term "an isolated DNA sequence" can alternatively be called "a cloned DNA sequence".
Isolated protein When applied to a protein, the term "isolated or isolated" indicates that the protein has been removed from its native environment. In a preferred form, the isolated protein is substantially free of other proteins, particularly other homologous proteins (eg, "homologous impurities" (see below)). An isolated protein is more than 10% pure, preferably more than 20% pure, more preferably more than 30% pure, as determined by SDS-PAGE. In addition, it is preferred to provide the protein in a highly purified form, for example, more than 40% pure, more than 60% pure, more than 80% pure, more preferably more than 95% pure, and even more preferably more than 99% pure, as determined by SDS-PAGE. The term "isolated protein" can alternatively be referred to as "purified protein".
Homologous impurities The term "homologous impurities" means any impurity (for example another polypeptide than the polypeptide of the invention) that originates from the homologous cell from which the polypeptide of the invention was originally obtained.
Obtained from
The term "obtained from", as used herein in connection with a specific microbial source, means that the polynucleotide and / or the polypeptide produced by the specific source, or by a cell into which a gene from a specific source has been inserted. the fountain.
Substrate The term "substrate" used in connection with a substrate for a protease should be interpreted in its broadest form as that comprising a compound containing at least one peptide bond susceptible to hydrolysis by a subtilisin protease.
Product The term "product" used in connection with a product derived from an enzymatic protease reaction should be interpreted in the context of this invention to include the products of a hydrolysis reaction involving a subtylase protease. A product can be the substrate in a subsequent hydrolysis reaction.
BRIEF DESCRIPTION OF THE DRAWINGS
Figure 1 shows an alignment between subtilisin BPN '(a) and Savinase "' using the aforementioned GAP routine.The figure shows the alignment between subtilisin BPN 'and Savinase as taken from WO 91/00345. shows an alignment between subtilisin BPN 'and Carlsberg subtilisin using the aforementioned GAP routine Figure 2a shows an alignment between subtilisin BPN' and Carlsberg subtilisin as taken from WO 91/00345. three-dimensional structure of Savinase (Protein data bank (PDB) input 1SVN) In the figure, the active site curl b) is indicated.
DETAILED DESCRIPTION OF THE INVENTION
The subtilases of the invention in a first aspect relate to an isolated subtylase enzyme (for example more than 10% pure) of subgroups I-SI and I-S2 having at least one additional amino acid residue at position 100 of the region (b) of the curl of the active site from position 95 to 103, whereby the additional amino acid residue (s) corresponds to the insertion of at least one amino acid residue between positions 100 and 101. In other words, the subtilases of the invention are characterized by comprising a region (b) of curl of active site of more than 9 amino acid residues and wherein the additional amino acid residue is or can be considered to be inserted between positions 100 and 101 relative to the parent, or to a known wild type subtyla. A subtylase of the first aspect of the invention may be a progenitor or wild type subtylase identified and isolated from nature. Such subtylase of wild type progenitor can be specifically selected by standard techniques known in the art. A preferred way to do this can be by PCR amplification specifically, of DNA regions that are known to encode the active site loops in the subtilases from a number of different microorganisms, preferably different Bacillus strains. Subtilases are a group of conserved enzymes, in the sense of their DNA and amino acid sequences that are homologous. Consequently, it is possible to construct relatively specific primers flanking the active site loops. One way to do this is by investigating an alignment of different subtilases
(see for example Siezen et al., Protein Science 6 (1997)
501-523). It is from this routine work for a person skilled in the art that PCR primers flanking the active site loop corresponding to the active site loop (b) between amino acid residue 95 to 103 can be constructed in any of the groups I-SI or I-S2 such as from BLSAVI. Using such PCR primers to amplify the DNA from a number of different microorganisms, preferably different strains of Bacillus, followed by sequencing the DNA of the amplified PCR fragments, it will be possible to identify the strains that produce the subtilases of these groups, which they comprise a region of active site longer, in comparison for example to BLSAVI, corresponding to the region of the curl of the active site of positions 95 to 103, and where it can be considered that there is an insert between positions 100 and 101. Having identified the strain and a partial DNA sequence of such subtylae of interest, it is routine work for a person skilled in the art to complete the cloning, expression and purification of such subtyla of the invention. However, it is considered that a subtylase enzyme of the invention is predominantly a variant of a progenitor subtylase. Accordingly, in one embodiment the invention relates to a subtylase enzyme isolated according to the first aspect of the invention, wherein the subtylase enzyme is a constructed variant that has a longer active site loop (b), than its enzyme progenitor, having at least one amino acid insert between the amino acid residues 100 and 101. The subtilases of the invention show excellent washing performance in a detergent, and if the enzyme is a constructed variant an improved washing operation is obtained in a detergent in comparison to its closest related subtylase, such as subtilisin 309. Different sübtilase products will show a different washing performance in different types of detergent compositions. A subtyla of the invention has improved wash performance, as compared to its closest relative in a majority of such different types of detergent compositions.
Preferably, a subtylase enzyme of the invention has improved wash performance, as compared to its closest relative in the detergent composition, shown in Example 3 herein (see below). In order to determine whether a given subtylase amino acid sequence (irrelevant if said subtylase sequence is a subtylase wild-type progenitor sequence or a subtylase variant sequence produced by any other method other than site-directed mutagenesis), it is Within the scope of the invention, the following procedure can be used: i) Align the subtylase sequence to the amino acid sequence of the subtilisin BPN '(see section "Definitions" herein (see above); ii) Based on the alignment performed in step i) identifying the active site curl (b), in the subtylase sequence corresponding to the region (b) of the active site curl of the subtilisin BPN 'comprising the region (both extreme amino acids included) between the amino acid residue of 95 to 103; iii) Determine if the curl (b) of the active site in the subtilase sequence, identified in step ii) is longer than the curl of the corresponding active site in BLSAVI and if said prolongation corresponds to the insertion of at least one residue of amino acid between positions 100 and 101. If this is the case, the subtilase investigated is a subtyla within the scope of the present invention. The alignment performed in step i) above is carried out as described above by the use of the GAP routine. Based on this description, it is routine for a person skilled in the art to identify the curl (b) of the active site in a subtyla and determine whether the subtyla in question is within the scope of the invention. If a variant is constructed by site-directed mutagenesis, it is of course known in advance whether the subtyla variant is within the scope of the invention. A subtylase variant of the invention can be constructed by standard techniques known in the art such as random / site-directed mutagenesis or by DNA shuffling in different subtylase sequences. See section "PRODUCTION OF A SUBSTITUTE VARIANT" and Material and methods herein (see below) for additional details. In the further embodiments, the invention relates to:
An isolated subtylase enzyme according to the invention, wherein at least one inserted amino acid residue is selected from the group comprising: T, G, A, and S; An isolated subtylase enzyme according to the invention, wherein at least one inserted amino acid residue is selected from the group of charged amino acid residues comprising: D, E, H, K, and R, more preferably D, E, K, and R; An isolated subtylase enzyme according to the invention, wherein at least one inserted amino acid residue is selected from the group of hydrophilic amino acid residues comprising: C, N, Q, S and T, more preferably N, Q, S and T An isolated subtylase enzyme according to the invention, wherein at least one inserted amino acid residue is selected from the group of small hydrophobic amino acid residues comprising: A, G and V; or An isolated subtylase enzyme according to the invention, wherein at least one inserted amino acid residue is selected from the group of large hydrophilic amino acid residues comprising: F, I, L, M, P, W and, most preferably F, I, L, M, and Y.
In a further embodiment, the invention relates to an isolated subtylase enzyme according to the invention, wherein said insertion between the positions
100 and 101 comprises at least two amino acids, as compared to the corresponding active site curl in
BLSAVI. In further embodiments, the invention relates to an isolated subtylase enzyme comprising at least one insert, chosen from the group comprising (in the BASBPN numbering): X100X. { T, G, A, S} X100X { D, E, K, R} X100X { H, V, C, N, Q } X100X { F, I, L, M, P, W, Y} or more specific for subtilisin 309 and the closely related subtilases, such as BAALKP, BLSUBL, and
BSKSMK G100GA G100GT G100GG G100GS
G100GD G100GE G100GK G100GR
GIOOGH GIOOGV GIOOGC GIOOGN GIOOGQ
G100GF G100GI G100GL G100GM G100GP G100GW G100GY
or any of the following combinations A98G + G100GA + S101A + S103T S99G + G100GGT + S101T
It is well known in the art that a so-called conservative substitution of an amino acid residue to a similar amino acid residue is expected to produce only a minor change in the characteristic of the enzyme.
Table III below lists the groups of conservative amino acid substitutions.
TABLE III
Conservative amino acid substitutions
Common property Amino acid Basic (positive charge) K = Lysine H = histidine Acids (negative charge) E = Glutamic acid D = Aspartic acid
Polar Q = Glutamine N = Hydrophobic Asparagine L = Leucine I = Isoleucine V = Valine M = Methionine Aromatics F = Phenylalanine W = Tryptophan Y = Tyrosine Small G = Glycine A = Ala iña S = Serine T = Threonine According to this principle, variants of subtilases comprising conservative substitutions, such as G97A + A98AS + S99G, G97S + A98AT + S99A are expected to exhibit characteristics that are not drastically different from one another. Based on the subtilase variants described and / or exemplified herein, it is routine work for a person skilled in the art to identify one or several conservative modifications suitable for these variants, in order to obtain other subtyla variants that show functioning similarly improved wash. According to the invention, the subtilases of the invention belong to subgroups I-SI and 1-52, especially subgroup 1-S2, to isolate the novel enzymes of the invention from nature or from the artificial creation of diversity, and to design and produce variants from a progenitor subtilasa. Regarding variants "of subgroup I-SI, it is preferred to choose a progenitor subtilasa of the group comprising BSS168 (BSSAS, BSAPRJ, BSAPRN, BMSAMP), BASBPN, BSSDY, BLSCAR (BLKERA, BLSCA1, BLSCA2, BLSCA3), BSSPRC, and BSSPRD, or the functional variants thereof which have retained the characteristic of subgroup I-SI.
Regarding the variants of subgroup I-S2 it is preferred to choose a progenitor subtilasa from the group comprising BSAPRRQ, BLS147 (BSAPRM, BAH101), BLSAVI (BSKSMK, BAALKP, BLSUBL), BISYAB, and BSAPRS, or the functional variants thereof. which have retained the characteristic of subgroup I-S2. In particular, the parent subtyla is BLSAVI
(SAVINASE® NOVO NORDISK A / S), and a preferred subtylase variant of the invention is consequently a variant of SAVINASE®. The present invention also comprises any of the aforementioned subtilases of the invention in combination with any other modification to the amino acid sequence thereof. Especially, they are considered combinations with other modifications known in the art, to provide improved properties to the enzyme. The art describes a number of subtilase variants with different improved properties and a number of those are mentioned in the "Background of the invention" section herein (see above). These references are described herein as references for identifying a subtyla variant, which can be advantageously combined with a subtyla variant of the invention.
Such combinations comprise the positions: 222 (improve oxidation stability), 218 (improve thermal stability), substitutions at Ca binding sites that stabilize the enzyme, for example, position 76, and many others apparent to from the prior art. In additional embodiments, a subtilase variant of the invention can be advantageously combined with one or more modifications at any of the positions: 27, 36, 57, 76, 87, 97, 101, 104, 120, 123, 167, 170, 206, 218, 222, 224, 235 and 274. Specifically, the following variants are considered suitable for combination: BLSAVI, BLSUBL, BSKSMK, and BAALKP: K27R, * 36D, S57P, N76D, S87N, G97N, S101G, S103A, V104A, V104I, V104N, V104Y, H120D, H123S, Y167, R170, Q206E, N218S, M222S, M222A, T224S, K235L and T274A. Additional variants comprising any of the variants S101G + V104N, S87N + S101G + V104N, K27R + V104Y + N123S + T274A, N76D + S103A + V104I or N76D + V104A or other combinations of these mutations (V104N, S101G, K27R, V104Y , N123S, T274A, N76D, V104A) in combination with one or more of the modifications mentioned above, show improved properties.
Still further subtylase variants of the main aspects of the invention are preferably combined with one or more modifications in any of positions 129, 131, 133 and 194, preferably as modifications 129K, 131H, 133P, 133D and 194P, and more preferably as modifications P129K, P131H, A133P, A133D and A194P. Any of these modifications are expected to provide a higher level of expression of a subtyla variant of the invention in the production thereof. Accordingly, a further embodiment of the invention relates to a variant according to the invention, wherein the modification is chosen from the group comprising:
THE PRODUCTION OF A SUBTYASE VARIANT
Many methods for the cloning of a subtyla of the invention and for the insertion insertion within the genes (for example subtyla genes) are well known in the art, see references cited in the section of "BACKGROUND OF THE INVENTION" . In general, standard procedures for the cloning of genes and the introduction of inserts (random and / or site-directed) into said genes can be used in order to obtain a subtyla variant of the invention. For further description of suitable techniques, reference is made to the Examples herein (see below) and (Sambrook et al. (1989) Molecular cloning: A laboratory manual, Cold Spring Harbor lab., Cold Spring Harbor, NY; Ausubel, FM et al. (Eds.) "Current protocols in Molecular Biology" John Wiley and Sons, 1995; Harwood, CR, and Cutting, SM (eds.) "Molecular Biological Methods for Bacillus." John Wiley and Sons, 1990); and WO 96/34946. In addition, a subtyla variant of the invention can be constructed by standard techniques for the artificial creation of diversity, such as by DNA shuffling of different subtylase genes (WO 95/22625; Stemmer WPC, Nature 370: 389-91 ( 1994)). The DNA scrambling, for example of the gene coding for Savinase®, with one or more partial subtylase sequences identified in nature, comprising an active site (b), the curl regions longer than the active site (b) of the Savinase® curl, after subsequent selection for variants with improved wash performance, will provide subtyla variants according to the invention.
VECTORS OF EXPRESSION
A recombinant expression vector comprising a DNA construct encoding the enzyme of the invention can be any vector that can be conveniently subjected to recombinant DNA procedures. The choice of vector will often depend on the host cell into which it will be introd. Thus, the vector can be a self-replicating vector, for example a vector that exists as an extrachromosomal entity, the replication of which is independent of chromosomal replication, for example, a plasmid. Alternatively, the vector may be one that after introduction into a host cell is integrated into the genome of the host cell in part or in its entirety and replicated together with the chromosome (s) into which it has been integrated. The vector is preferably an expression vector in which the DNA sequence encoding the enzyme of the invention is operably linked to the additional segments required for DNA transcription. In general, the expression vector is derived from plasmid or viral DNA, or it may contain elements of both. The term, "operably linked" indicates that the segments are arranged so that they function in unison for their intended purposes, for example, transcription starts in a promoter and proceeds through the DNA sequence encoding the enzyme. The promoter can be any DNA sequence that shows the transcriptional activity in the host cell of choice and can be derived from the genes encoding the proteins either homologous or heterologous to the host cell. Examples of suitable promoters for use in bacterial host cells include the promoter of the maltogenic amylase gene of Bacillus stearothermophilus, the alpha-amylase gene of Bacillus licheniformis, the alpha-amylase gene of Bacillus amyloliquefaciens, the gene of the alkaline protease of Bacillus subtilis, or the gene of the xylosidase of Bacillus pumilus, or the PR O PL promoters of phage Lambda or the lac, trp or tac promoters of E. coli. The DNA sequence encoding the enzyme of the invention can also, if "necessary, be operably linked to a suitable terminator." The recombinant vector of the invention can further comprise a DNA sequence that makes it possible for the vector to replicate in the host cell in question The vector can also comprise a selectable marker, for example, a gene, the product of which complements a defect in the host cell, or a gene that codes for resistance, for example for antibiotics such as kanamycin, chloramphenicol , erythromycin, tetracycline, eepectinomycin, or the like, or resistance to heavy metals or herbicides To direct an enzyme of the present invention toward the secretory pathway of host cells, a secretory signal sequence (also known as a leader sequence, prepro sequence). or pre sequence) can be provided in the recombinant vector.The secretory signal sequence is linked to the sec uencia DNA encoding the enzyme in the structure of correct reading. Secretory signal sequences are commonly placed 5 'to the DNA sequence encoding the enzyme. The secretory signal sequence may be that normally associated with the enzyme or it may be from a gene encoding another secreted protein. The methods used to ligate the DNA sequences encoding the present enzyme, the promoter and optionally the terminator and / or secretory signal sequence, respectively, or to assemble these sequences by suitable PCR amplification schemes, and to insert them into Suitable vectors containing the information necessary for replication or integration are well known to those of ordinary skill in the art (see, for example, Sambrook et al., cited reference).
HOST CELL
The DNA sequence encoding the present enzyme introduced into the host cell can be either homologous or heterologous to the host in question. If it is homologous to the host cell, for example, produced by the host cell in nature, it will typically be operably connected to another promoter sequence or, if applicable, to another secretory signal sequence and / or terminator sequence, which in its natural environment. The term "homologue" is intended to include a DNA sequence that encodes a native enzyme for the host organism in question. The term "heterologous" is intended to include a DNA sequence not expressed by the host cell in nature. In this way, the DNA sequence can be from another organism, or it can be a synthetic sequence. The host cell into which the DNA construct or the recombinant vector of the invention is introduced can be any cell that is capable of producing the present enzyme and includes bacteria, yeasts, fungi and higher eukaryotic cells including plants. Examples of bacterial host cells which, with the culture, are capable of producing the enzyme of the invention are gram-positive bacteria such as Bacillus strains, such as strains of B. subtilis, B. licheniformie, B. lentus, B. brevis, B. stearo hermophilus,
B. alkalophilus, B. amyloliquefaciens, B. coagulans, B. circulans, B. lautus, B. megaterium or B. thuringiensis, or strains of Streptomyces, such as S. Lividans or S.
Murinus, or gram-negative bacteria such as
Escherichia coli The transformation of the bacterium can be effected by protoplast transformation, electroporation, conjugation, or by the use of competent cells in a manner known per se (see Sambrook et al., Supra). When the enzyme is expressed in bacteria such as E. coli, the enzyme can be "retained in the cytoplasm, typically as insoluble grains (known as the inclusion body), or it can be directed into the periplasmic space by a sequence of bacterial secretion. In the first case, the cells are lysed and the granules are recovered and denatured after which the enzyme is refolded by diluting the denaturing agent.In the latter case, the enzyme can be recovered from the periplasmic space by disintegrating the cells, for example by sonication or osmotic shock, to release the contents of the periplasmic space and recover the enzyme When the enzyme is expressed in gram-positive bacteria such as strains of Bacillus or Streptomyces, the enzyme can be retained in the cytoplasm, or it can be directed towards the extracellular medium by a sequence of bacterial secretion, in the latter case, enzi ma can be recovered from the medium as described below.
METHOD TO PRODUCE SUBTILASA
The present invention provides a method for producing an isolated enzyme according to the invention, wherein a suitable host cell, which has been transformed with a DNA sequence encoding the enzyme, is cultured under conditions that allow the production of the enzyme , and the resulting enzyme is recovered from the culture. When an expression vector comprising a DNA sequence encoding the enzyme is transformed into a heterologous host cell, it is possible to carry out the heterologous recombinant production of the enzyme of the invention.
With this it is possible to produce a highly purified subtyla composition, characterized in that it is free of homologous impurities. In this context, homologous impurities mean any impurities (for example other polypeptides than the enzyme of the invention) that originate from the homologous cell from which the enzyme of the invention is originally obtained. The medium used for the culture of the transformed host cells can be any conventional means suitable for the development of the host cells in question. The expressed subtylase can be conveniently secreted into the culture medium and. it can be recovered from it by well-known procedures which include the separation of the cells from the medium by centrifugation or filtration, precipitation of the protein components of the medium, by means of a salt such as ammonium sulfate, followed by chromatographic procedures such as ion exchange chromatography, affinity chromatography, or the like.
USE OF A SUBTILASE VARIANT OF THE INVENTION
A variant of the subtyla protease of the invention can be used for a number of industrial applications, in particular within the detergent industry. In addition, the invention relates to an enzymatic composition, which comprises a subtyla variant of the invention. A summary of the preferred industrial applications and the corresponding preferred enzyme compositions are described below. This summary is not intended to be in any way a complete list of suitable applications of a subtyla variant of the invention. A subtyla variant of the invention can be used in other industrial applications known in the art to include the use of a protease, in particular a subtylase.
DETERGENT COMPOSITIONS THAT COMPRISE MUTATING ENZYMES
The present invention comprises the use of the mutant enzymes of the invention in cleaning compositions and detergents and compositions such as the mutant subtilisin enzymes. Such cleaning compositions and detergents are also described in the art and reference is made to WO 96/24946; WO 97/07202; WO 95/30011 for further description of suitable cleaning compositions and detergents. In addition, the following example (s) demonstrate improvements in the operation of the wash for a number of subtilase variants of the invention.
Compositions Detergents
The enzyme of the invention can be added to and thus become a component of a detergent composition. The detergent composition of the invention can for example be formulated as a detergent composition for hand or machine washing, including an additive laundry composition, suitable for pretreatment of the dyed fabrics and a fabric softening composition, added to the rinse, or be formulated as a detergent composition for use in general domestic hard surface cleaning operations, or be formulated for manual or machine dishwashing operations.
In a specific aspect, the invention provides a detergent additive comprising the enzyme of the invention. The detergent additive as well as the detergent composition may comprise one or more other enzymes such as a protease, a lipase, a cutinase, an amylase, a carbohydrase, a cellulase, a pectinase, a mannanase, an arabinase, a galactanase, a xylanase, an oxidase, for example, a laccase and / or a peroxidase. In general, the properties of the enzyme or enzymes chosen must be compatible with the selected detergent (eg, the optimum pH, compatibility with other enzymatic and non-enzymatic ingredients, etc.), and the enzyme (s) must be present in effective amounts .
Proteases: Suitable proteases include those of animal, plant or microbial origin. The microbial origin is preferred. Mutants engineered by proteins or chemically modified are also included. The protease can also be a serine protease or a metalloprotease, preferably an alkaline microbial protease or a trypsin-like protease. Examples of alkaline proteases are subtilisins, especially those derived from Bacillus, for example, subtilisin Novo, subtilisin Carlsberg, subtilisin 309, subtilisin 147 and subtilisin 168 (described in WO 89/06279). Examples of trypsin-like proteases are trypsin (for example of porcine or bovine origin) and Fusarium protease described in WO 89/06270 and WO 94/25583. Examples of useful proteases are the variants described in WO 92/19729, WO 98/20115, WO 98/20116, and WO 98/34946, especially variants with substitutions in one or more of the following positions: 27, 36 , 57, 76, 87, 97, 101, 104, 120, 123, 167, 170, 194, 206, 218, 222, 224, 235 and 274. Preferred commercially available protease enzymes include Alcalase ™, Savinase ™, Primase ™, Duralase "12, Wait" ", and Kannase ™ (Novo Nordisk A / S), Maxatase ™, Maxacal ™, Maxapem ™, Properase ™, Purafect ™, Purafect OxP ™ *, FN2 ™, and FN3 ™ (Genencor International Inc.)
Lipases: Suitable lipases include those of bacterial or fungal origin. Mutants engineered by proteins or chemically modified are also included. Examples of such lipases include lipases from Humicola (synonym Thermoces), for example from H. lanuginosa (T. lanuginosus) as described in European patent EP 258 068 and EP 305 216 or from H. Insolens as described in WO 96/13580, a lipase from Pseudomonas, for example from P. Alcaligenes or P. pseudoalcaligenes
(European Patent EP 218 272), P. cepacia (European Patent EP 331 376), P. stutzeri (GB 1,372,034), P. Fluorescens, Pseudomonas sp. strain SD 705 (WO 95/06720 and WO 96/27002), P. wisconsinensis (WO 96/12012), a Bacillus lipase, for example from B. subtilis (Dartois et al. (1993), Biochemica et Biophysica Acta, 1131, 253-360), B. stearo thermophilus
(JP 64/744992), or B. pumilus (WO 91/16422). Other examples are variants of lipases, such as those described in WO 92/05249, WO 94/01541, EP 407 225, EP 260 105, WO 95/35381, WO 96/00292, WO 95/30744, WO 94 / 25578, WO 95/14783, WO 95/22615, WO 97/04079 and WO 97/07202. Preferred commercially available lipase enzymes include Lipolase ™ or Lipolase Ultra ™ (Novo Nordisk A / S).
Amylases: Suitable amylases ~ (a and / or ß) include those of bacterial or fungal origin. Mutants engineered by proteins or chemically modified are also included. Amylases include, for example, α-amylases obtained from Bacillus, for example, a special strain of B. licheniformis, described in more detail in British patent GB 1,296,839.
Examples of useful amylases are the variants described in WO 94/02597, WO 94/18314, WO 96/23873, and WO 97/43424, especially variants with substitutions in one or more of the following positions: 15, 23 , 105, 106, 124, 128, 133, 154, 156, 181, 188, 190, 197, 202, 208, 209, 243, 264, 304, 305, 391, 408, and 444. The commercially available amylases are Duramyl ™ , Termamyl ™, Fungamyl ™ and BANTM (Novo Nordisk A / S), Rapidase ™ and Purastar ™ (from Genencor International Inc.)
Cellulases: Suitable cellulases include those of bacterial or fungal origin. Mutants engineered by protein engineering or chemically modified are also included. Suitable cellulases include cellulases of the genera Bacillus, Pseudomonas, Humicola, Fusarium, Thielavia, Acremonium, for example the fungal cellulases produced by Humicola insolens, Myceliophthora thermophila and Fusarium oxysporum described in US 4,435,307, US 5,648,263, US 5,691,178, US 5,776,757 and WO 89/09259. Especially suitable cellulases are alkaline or neutral cellulases that have color care benefits. Examples of such cellulases are the cellulases described in EP 0 495 257, EP 0 531 372, WO 96/11262, WO 96/29397, WO 98/08940. Other examples are cellulase variants such as those described in the documents in WO 94/07998, EP 0 531 315, US 5,457,046, US 5,686,593, US 5,763,254, WO 95/24471, WO 98/12307 and PCT / DK98 / 00299. Commercially available cellulases include Celluzyme, and Carezyme ™ (Novo Nordisk A / S), Clazinase ™, and Puradax HAMR (Genencor International Inc.) and KAC-500 (B) MR (Kao Corporation).
Peroxidases / Oxidases: Suitable peroxidases / oxidases include those of plant, bacterial or fungal origin. Also included are mutants engineered by proteins, or chemically modified. Examples of useful peroxidases include peroxidases from Coprinus, for example from C. cinereus, and variants thereof such as those described in WO 93/24618, WO 95/10602, and WO 98/15257. Commercially available peroxidases include Guardzyme ™ (Novo Nordisk A / S "). The detergent enzyme (s) can be included in a detergent composition by the addition of separate additives containing one or more enzymes., or by the addition of a combined additive comprising all these enzymes. A detergent additive of the invention, for example, a separate additive or a combined additive, can be formulated, for example, as a granulate, a liquid, a suspension, etc. Preferred additive formulations for detergents are granules, in particular granules which do not release dust, liquids, in particular stabilized liquids, or suspensions. Non-dusting granulates can be produced, for example, as described in US Pat. Nos. 4,106,991 and 4,661,452 and can optionally be coated by methods known in the art. Examples of coating materials
• Waxy products are poly (ethylene oxide)
(polyethylene glycol, PEG) with average molar weights of 1,000 to
,000; ethoxylated nonylphenols having from 16 to 50 ethylene oxide units; ethoxylated fatty alcohols in which the alcohol contains from 12 to 20 carbon atoms and in which there are from 15 to 80 ethylene oxide units; fatty alcohols; fatty acids; and mono-, and di-, and tri-glycerides of fatty acids. Examples of film-forming coating materials, suitable for application by fluidized bed techniques, are given in British patent GB 1483591. Liquid enzyme preparations can, for example, be stabilized by the addition of a polyol such as propylene glycol, a sugar or sugar alcohol, lactic acid or boric acid according to established methods. Protected enzymes can be prepared according to the method described in European Patent EP 238,216. The detergent composition of the invention may be in any convenient form, for example, a stick, a tablet, a powder, a granule, a paste or a liquid. A liquid detergent can be aqueous, typically containing up to 70% water and 0-30% organic solvent, or non-aqueous solvent. The detergent composition comprises one or more surfactants, which may be nonionic, including semi-polar and / or anionic and / or cationic and / or amphoteric. Surfactants are typically present at a level of 0.1% to 60% by weight. When included herein, the detergent will usually contain from about 1% to about 40% of an anionic surfactant such as linear alkylbenzenesulfonate, alpha-olefinsulfonate, alkyl sulfate (fatty alcohol sulfate), alcohol ethoxysulfate, secondary alkan sulfonate, ester methyl of alpha-sulfograso acid, alkyl- or alkenyl-succinic acid or abon. . When included herein, the detergent will usually contain from about 0.2% to about 40% of a nonionic surfactant such as alcohol ethoxylate, nonylphenol ethoxylate, alkyl polyglycoside, alkyldimethylaminoxide, ethoxylated fatty acid monoethanolamide, fatty acid monoethanolamide, amide. of polyhydroxyalkyl acid, or N-acyl derivatives or N-alkyl glucosamine ("glucamides"). The detergent may contain 0-65% of a detergent additive or complexing agent, such as zeolite, diphosphate, triphosphate, phosphonate, carbonate, citrate, nitrilotriacetic acid, ethylenediaminetetraacetic acid, diethylenetriaminpentaacetic acid, alkyl- or alkenyl-succinic acid, soluble silicates or layered silicates (for example SKS-6 from Hoechst). The detergent may comprise one or more polymers. Examples are carboxymethylcellulose, poly (vinylpyrrolidone), poly (ethylene glycol), poly (vinyl alcohol), poly (vinylpyridine-N-oxide) ", poly (vinylimidazole), polycarboxylates such as polyacrylates, maleic / acrylic acid copolymers, and copolymers of lauryl methacrylate / acrylic acid The detergent may contain a bleach system which may comprise a source of H202 such as perborate or percarbonate, which may be combined with a peracid-forming bleach activator, such as tetraacetylethylenediamine or nonanoyloxybenzenesulfonate. Bleach system may comprise peroxyacids for example of the amide, imide, or sulfone type The enzyme (s) of the detergent composition of the invention may be stabilized using conventional stabilizing agents, for example, a polyol such as propylene glycol or glycerol, a sugar or alcohol of sugar, lactic acid, boric acid, or a derivative of boric acid, for example, an aromatic borate ester, or a phenylboronic acid derivative, such as 4-formylpheniiboronic acid, and the composition can be formulated as described for example in WO 92/19709 and WO 92/19708. The detergent may also contain other conventional detergent ingredients such as for example fabric conditioners including clays, foam triggers, soapy water suppressors, anti-corrosion agents, dirt suspending agents, anti-dirt redeposicon agents, dyes, bactericides, optical brighteners, hydrotropes, mist inhibitors, or perfumes. It is contemplated to date that in the detergent compositions any enzyme, in particular the enzyme of the invention, can be added in an amount corresponding to 0.01-100 mg of enzyme protein per liter of wash liquor, preferably 0.05-5 mg of protein enzymatic per liter of wash liquor, in particular 0.1-1 mg of enzyme protein per liter of wash liquor. The enzyme of the invention can be further incorporated into the detergent formulations described in WO 97/07202 which is incorporated by reference herein.
APPLICATIONS IN THE LEATHER INDUSTRY
A subtyla of the invention can be used in the leather industry, in particular for use in hair removal. In said application, a subtyla variant of the invention is preferably used in an enzymatic composition, which further comprises another protease. For a more detailed description of other suitable proteases, see the section related to enzymes suitable for use in a detergent composition (see above).
APPLICATIONS IN THE USE OF WOOL
A subtyla of the invention can be used in the wool industry, in particular for use in cleaning garments containing wool. In said application, a subtyla variant of the invention is preferably used in an enzymatic composition, which further comprises another protease. For a more detailed description of other suitable proteases, see the section related to enzymes suitable for use in the detergent composition (see above). The invention is described in greater detail in the following examples, which are not in any way limiting the scope of the invention, as claimed.
MATERIALS AND METHODS
CEPAS:
B. sutilis DN1885 (Diderichsen et al., 1990). B. lentus 309 and 147 are specific strains of Bacillus lentus, deposited with the NCIB and assigned with accession numbers NCIB 10309 and 10147, and described in U.S. Patent No. 3,723,250 incorporated by reference herein. E. coli MC 1000 (C. Casadaban and S.N. Cohen)
(1980); J. Mol. Biol. 138 179-207), was made r ", m + by conventional methods, and is also described in
United States Patent Application Serial No.
039,298.
PLASMID:
pJS3: shuttle vector of E. coli - B. subtilis containing a synthetic gene coding for subtylase 309. (Described by Jacob Schi0dt et al in Protein and Peptide letters 3: 39-44 (1996)). pSX222: subtilis expression vector (Described in WO 96/34946).
GENERAL METHODS OF MOLECULAR BIOLOGY:
Unless otherwise mentioned, DNA manipulations and transformations were performed using standard methods of molecular biology (Sambrook et al. (1989) Molecular cloning: A laboratory manual, Cold Spring Harbor lab., Cold Spring Harbor, NY; Ausubel, FM et al. (Eds.) "Current protocols in Molecular Biology." John Wiley and Sons, 1995; Harwood, CR, and Cutting, SM (eds.) "Molecular Biological Methods for Bacillus." John Wiley and Sons, 1990). Enzymes for DNA manipulations were used according to the specifications of the suppliers.
ENZYMES FOR DNA HANDLING
Unless otherwise mentioned, all enzymes for DNA manipulations, such as for example restriction endonucleases, ligases, etc. are obtained from New England Biolabs, Inc.
PROTEOLITIC ACTIVITY
In the context of this invention, the proteolytic activity is expressed in Kilo NOVO Protease Units
(KNPU). The activity is determined relatively to an enzyme standard (SAVINASE®), and the determination is based on the digestion of a dimethylcasein (DMC) in solution by the proteolytic enzyme under standard conditions, for example 50 ° C, pH 8.3, 9 minutes of reaction time, 3 minutes of measurement time. An AF 220/1 folder is available at the request of Novo Nordisk A / S, Denmark, a folder that is incorporated by reference herein. A GU is a Glycine Unit, defined as the activity of proteolytic enzyme, which, under standard conditions, during a 15-minute incubation at 40 ° C, with N-acetylcasein as a substrate, produces an amount of NH2 group equivalent to 1 mmol of glycine. Enzymatic activity can also be measured using the PNA assay, according to the reaction with the soluble substrate succinyl-alanine-alanine-proline-phenyl-alanine-para-nitrophenol, which is described in the Journal of the American Oil Chemists Society, Rothgeb, TM, Goodlander, BD, Garrison, PH, and Smith, LA, (1988).
FERMENTATION
The fermentations for the production of subtylase enzymes were carried out at 30 ° C on a rotary shaking table (300 r.p.m.) in buffered 500 ml Erlenmeyer flasks, containing 100 ml of BPX medium for 5 days. Consequently, in order to make, for example, a 2-liter broth, 20 Erlenmeyer flasks were fermented simultaneously.
Media
Composition of BPX Medium (per liter)
Potato starch 100 g Milled barley 50 g Soy flour 20 g Na2HP04 x 12 H20 9 g Pluronic 0.1 g Sodium caseinate 10 g
The starch in the medium is liquefied with an α-amylase and the medium is sterilized by heating at 120 ° C for 45 minutes. After sterilization, the pH of the medium is adjusted to 9 by the addition of 0.1 M NaHCO3.
EXAMPLE 1 CONSTRUCTION AND EXPRESSION OF ENZYMATIC VARIANTS: MUTAGENESIS DIRECTED TO THE SITE:
The variants directed to the subtylase site 309 of the invention, which comprise specific insertions in the curl of the active site (b) between positions 100 and 101 were made by traditional cloning of the DNA fragments (Sambrook et al., Molecular Cloning: A Laboratory Manual, 2 *. Ed., Cold Spring Harbor, 1989) produced by PCR of the oligos containing the desired inserts (see below). The plasmid DNA template was pJS3, or an analog thereof containing a variant of subtylase 309. The insertions were introduced by oligo-directed mutagenesis to the construction of the G100GX insertion variants (X = any amino acid residue inserted between the positions 100 and 101) which result in the S101SX variants of subtylase 309. Subtylase variants 309 were transformed into E. coli. The purified DNA from an overnight culture of these transformants was transformed into B. subtilis by restriction endonuclease digestion, purification of the DNA fragments, ligation, transformation of B. subtilis. The transformation of B. subtilis was performed as described by Dubnau et al., 1971, J. Mol. Biol. 56, pp. 209-221.
RANDOMIZED MUTAGENESIS LOCATED IN ORDER TO INSERT RANDOM INSERTS IN THE LOCALIZED REGION:
The complete strategy used to perform the localized random mutagenesis was: a mutagenic primer (oligonucleotide) was synthesized, which corresponds to the DNA sequence flanking the insertion site, separated by the base pairs of DNA that define the insertion. Subsequently, the resulting mutagenic primer was used in a PCR reaction with a suitable opposite primer. The resulting PCR fragment was purified and spread in a second PCR reaction, before being digested with the endonucleases and cloned into the shuttle vector of E. coli-B. subtilis (see below). Alternatively, and if necessary, the resulting PCR fragment is used in a second PCR reaction. as a primer with a second opposite primer suitable for allowing digestion and cloning of the mutagenized region within the shuttle vector. PCR reactions are performed under normal conditions. Following this strategy, a random library located in SAVINASE was built, where insertions were introduced in the region of active site curl between positions 100 and 101. Mutations were introduced by mutagenic primers (see below), so that the 20 amino acids are represented (N = '25% of A, T, C, and G, while S = 50% of C and G. The PCR fragment produced was extended towards the N-terminus of Savinase by another round of PCR , by combining a sequence of overlap with a PCR fragment produced by the PCR amplification with the primers; 5 'CTA AAT ATT CGT GGTGGC GC 3' (sense) and 5 'GAC TTT AAC AGC GTA TAG CTC AGC 3' ( antisense.) The extended DNA fragments were cloned into the Hind III- and Mlu I- sites of the modified plasmid pJS3 (see above)., and ten randomly chosen E. coli colonies were sequenced, to confirm the designated mutations. The mutagenic primer (5 'GTT AAA GTC CTA GGG GCG AGC GGT NNS TCA GGT TCG GTC AGC ATT G3' (sense) was used in a PCR reaction with a suitable anti-sense opposite primer, located downstream or 3 'from the site Mlu I in pJS3 (eg, 5 '- CCC TTT AAC CGC AC GCG TTT-3' (anti-sense)) and plasmid pJS3 as template This resulting PCR product was cloned into the shuttle vector pJS3 by the use of the restriction enzymes Hind III and Mlu "I. The random library was transformed into E. coli by well-known techniques.The library prepared contained approximately 100,000 individual clones / library.Ten randomly selected colonies were sequenced to confirm the designated mutations.
In order to purify a subtyla variant of the invention, the expression plasmid pJS3 of B. subtilis comprising a variant of the invention was transformed into a competent strain of B. subtilis and fermented as described above in a medium containing 10 μg / ml chloramphenicol (CAM).
EXAMPLE 2 PURIFICATION OF ENZYMATIC VARIANTS:
This process relates to the purification of a 2-liter fermentation for the production of the subtilases of the invention in a Bacillus host cell. Approximately 1.6 liters of the fermentation broth were centrifuged at 5000 rpm for 35 minutes in 1 liter containers. The supernatants were adjusted to pH 6.5 using 10% acetic acid and filtered on Seitz Supra S100 filter plates. The filtrates were concentrated to approximately 400 ml using an Amicon CH2A UF unit equipped with an Amicon S1Y10 UF cartridge. The UF concentrate was centrifuged and filtered before absorption at room temperature on an affinity column of Bacitracin at pH 7. The protease was eluted from the Bacitracin column at room temperature using 25% 2-propanol and sodium chloride 1 M in a buffer solution with 0.01 M dimethylglutaric acid, 0.1 M boric acid and 0.002 M calcium chloride adjusted to pH 7. The protease activity fractions from the purification step with Bacitracin were combined and applied to a Sephadex G25 column of 750 ml (5 cm in diameter) balanced with a buffer containing 0.01 M dimethylglutaric acid, 0.2 M boric acid, and 0.002 M calcium chloride adjusted to pH 6.5. The fractions with proteolytic activity of the Sephadex G25 column were combined and applied to a cation exchange column of 150 ml CM Sepharose CL 6B (5 cm diameter), equilibrated with a buffer containing 0.01 M dimethylglutaric acid, 0.2 M boric acid , and 0.002 M calcium chloride adjusted to pH 6.5. The protease was eluted using a linear gradient of sodium chloride 0 - 0.1 M "in 2 liters of the same buffer (sodium chloride 0 - 0.2 M in the case of Subtilisin 147) In a final purification step, the fractions that containing a protease from the CM Sepharose column were combined and concentrated in an Amicon ultrafiltration cell equipped with a GR81PP membrane (from the Danish Sugar Factories Inc.) by using the techniques of Example 1 for the construction and fermentation, and the previous isolation procedure, the following variants of subtilisin 309 were produced and isolated: G100GT G100GT GLOGS G100GD G100GP G100GG G100GG G100GG G100GT G100GT + Y167A S99G + G100GT + S101T A98G + G100GA + S101A + S103T
These variants showed better washing performance than Savinase in a preliminary trial.
EXAMPLE 3 OPERATION OF WASHING OF DETERGENT COMPOSITIONS COMPRISING ENZYMATIC VARIANTS
The following examples provide the results of a number of wash tests that were conducted under the indicated conditions.
MINI WASHING
WASHING CONDITIONS:
DETERGENTS:
The detergents used were either a detergent model, called Detergent 95 or obtained from supermarkets in Denmark (OMO, data sheet ED-9745105) and the United States (Wisk, data sheet ED-9711893), respectively. Before use, all enzymatic activity in the detergents was inactivated by the microwave treatment. The detergent 95 is a simple model formulation. The pH is adjusted to 10.5 which is within the normal range for a powder detergent. The composition of the model detergent 95 is as follows:
% STP (Na5P3O? 0) 25% Na2S04 10% Na2C03 20% LAS (Nansa 8OS) 5.0% non-ionic tenside (Dobanol 25-7) 5.0% Na2Si205 0.5% Carboxymethylcellulose (CMC) 9.5% Water SAMPLES:
The samples used were EMPA116 and EMPA117, obtained from EMPA Testmaterialen, Movenstrasse 12, CH-9015 St. Gall, Switzerland.
REFLECTANCE
The measurement of the reflectance (R) on the test material was made at 460 nm using a Macbeth ColorEye 7000 photometer. The measurements are made according to the manufacturer's protocol.
EVALUATION
The evaluation of the washing performance of a subtyla is determined either by the improvement factor or the operating factor for the subtilase investigated. The improvement factor, IFDosis / RespueSta, is identified as the ratio between the slopes of the washing performance curves for a detergent containing the subtilase investigated and the same detergent that contains a subtyla of reference to the asymptotic concentration of the subtilas goes to zero.
IFDosis / Answer = s / aref
The washing operation is calculated according to formula I:
a «? Rma» c R = RD +? Rmax + a.C (I);
where R is the washing operation in reflectance units; R0 is the intercept of the curve fitted with the y axis (blind); a is the slope of the curve set as c - > 0; c is the enzyme concentration; and? Rmax is the theoretical maximum wash effect as c - > 8. The operating factor, P, is calculated according to formula II
Rvariant - R-White • Rsavinase - White (ID
where Rariante is the reflectance of the washed test material with the 10 nM variant; Rsavmase is the reflectance of the test material washed with Savinase 10 nM; bianco is the reflectance of the washed test material without enzyme.
US (detergent: Us Wisk, Test: EMPA117)
* P calculated at [E] = 5 nM
It is thus observed that the subtilases of the invention show improved wash performance in comparison to Savinase.
It is noted that in relation to this date, the best method known to the applicant to carry out the aforementioned invention, is that which is clear from the present description of the invention.
Claims (34)
1. A subtylase enzyme of subgroups I -SI and I-S2, characterized in that it has at least one additional amino acid residue at position 100 of the active site curl region (b) from position 95 to 103, whereby the or the additional amino acid residues correspond to the insertion of at least one amino acid residue between positions 100 and 101.
2. The isolated subtylase enzyme according to claim 1, characterized in that the subtylase enzyme is a constructed variant that has at least an amino acid residue inserted between positions 100 and 101 of a precursor subtylase.
3. The subtylase enzyme isolated according to claim 1 or 2, characterized in that it is selected from the group comprising X100X. { A, T, G, S} , X100X. { D, E, K, R} , X100X. { H, V, C, N, Q } , and X100X. { F, I, L, M, P, W, Y}
4. The isolated subtylase enzyme according to claim 3, characterized in that at least one additional or inserted amino acid residue is selected from the group comprising: T, G, A, and S.
5. The subtylase enzyme isolated in accordance with claim 3, characterized in that at least one additional or inserted amino acid residue is chosen from the group of charged amino acid residues comprising: D, E, H, K, and R, more preferably D, E, K and R.
6. The isolated subtylase enzyme according to claim 3, characterized in that at least one additional or inserted amino acid residue is chosen from the group of hydrophilic amino acid residues comprising: C, N, Q, S and T, more preferably N, Q, S and T.
7. The subtylase enzyme isolated according to claim 3, characterized in that at least one additional or inserted amino acid residue is chosen from the group of small hydrophobic amino acid residues comprising: A, G and V.
The subtylase enzyme isolated according to claim 3, characterized in that at least one additional or inserted amino acid residue is chosen from the group of large hydrophobic amino acid residues comprising: F, I, L, M, P, W and Y, more preferably F, I, L, M, and Y.
9. The subtylase enzyme isolated according to any of the preceding claims, characterized in that at least one additional or inserted amino acid residue comprises more than one residue of additional amino acid or inserted into the active site loop (b).
10. The subtilase variant according to any of the preceding claims, characterized in that the insert (s) between the positions 100 and 101 are combined with one or more additional modifications in any other or other positions.
11. The subtilase variant according to claim 15, characterized in that the one or more modifications are in one or more of the positions 27, 36, 57, 76, 87, 97, 101, 104, 120, 123, 167, 170, 206, 218, 222, 224, 235 and 274.
12. The subtilase variant according to any of the preceding claims, characterized in that the modification (s) is / are combined with one or more modifications in one or more of the positions 129, 131, 133 and 194.
13. The subtilase according to any of the preceding claims, characterized in that the subtilase, or if the subtilase is a variant, the progenitor subtilasa belongs to the subgroup I -SI.
14. The subtilase according to claim 13, characterized in that the parent subtylase is chosen from the group comprising ABSS168, BASBPN, BSSDY, and BLSCAR, or functional variants thereof which have retained the characteristic of subgroup I-SI.
15. The subtilase according to any of claims 1-14, characterized in that the subtilase, or if the subtilases is a variant, the progenitor subtilasa belongs to the subgroup I-S2.
16. The subtilase according to claim 15, characterized in that the progenitor subtylase is chosen from the group comprising BLS147, BLS309, BAPB92, TVTHER and BYSYAB, or functional variants thereof which have the characteristic of subgroup I-S2 retained.
17. The isolated subtylase enzyme according to any of claims 3, 15 or 16, characterized in that it is selected from the group comprising G100GA, G100GT, G100GG, GIOOGS, GIOOGD GIOOGE, GIOOGK, GIOOGR, GIOOGH, GIOOGV, GIOOGC, G100GN, G100GQ, G100GF, G100GI, G100GL, G100GM, G100GP, G100GW, and G100GY.
18. The subtyle variant according to any of claims 15 to 17, characterized in that the one or more modifications are chosen from the group comprising K27R, * 36D, S57P, N76D, S87N, G97N, S101G, V104A, V104N, V104Y, H120D, N123S, Y167X, R170X, Q206E, N218S, M222S, M222A, T224S, K235L and T274A.
19. The subtilase variant according to any of claims 15 to 17, characterized in that the one or more modifications are chosen from the group comprising S101G + V104N, S87N + S101G + V104N, K27R + V104Y + N123S + T274A, N76D + S103A + V104I or N76D + V104A; or combinations of these mutations (V104N, S101G, K27R, V104Y, N123S, T274A, N76D, V104A), in combination with any one or more of the substitutions, deletions and / or insertions mentioned in any of claims 1 to 14.
20. The subtilase variant according to any of claims 15 to 17, characterized in that the one or more modifications are chosen from the group further comprising P129K, P131H, A133P, A133D and A194P.
21. The variant according to any of the preceding claims, characterized in that it comprises the chosen modification of the group comprising: A98G + G100GA + S101A + S103T, and S99G + G100GGT + S101T.
22. A subtyla belonging to subgroup I-Sl, characterized by having the amino acid sequence: 20 Oct. 30 AQTVPYGI -PLI- LDTGIQA KADKVQAQGFKGANVKVAV 40 50 60 - - HPD- -NVVGGASFVAGEA - * - 70 80 90 YNTD GNGHGTHVAGTVAALDNTTGV-LGVAPSVSL YAVKVLNSSGXSGTYSGIVSG-100a 110 120 130 140 150 VINMS- IEWATTNGMD -GGPSGSTAMKQAVDNAYARGV-VVV 160 170 180 AAAGNSGSSGNTNTIGYPAKY-DSVIAVGAV 190 200 210 DSNSNRASFSSVGAELEVMAP-GAGVYSTYP 220 230 240 TSTYAT- -NGTSMASPHVAGAAA- -I- -SKHPN 250 260 270 LSASQVRNRLSSTATYLGSSF-YYGKG- -INV 275 EAAAQ or a homologous subtylase having an amino acid sequence comprising an amino acid residue at position 100a and that shows an identity of more than 70%, 75%, 80%, 85%, 90% or 95% with it.
23. A subtyla belonging to the subgroup I-S2, characterized because it has the amino acid sequence: 1 10 20 30 AQSVPWGISRVQAPAAHNRGL-TGSGVKVAV- 40 50 60 -DTGI - * - STHPD- -NIRGGASFVPGEP - * - S ~ TQD 70 80 90 GNGHGTHVAGTIAALNNSIGV- -GVAPSAEL- 100a 110 120 YAVKVLGASGSXGSVSSIAQG-LE- -AGNNGMH- 130 '140 150 VANLSLGSPSPSAT- -EQAVNSATSRGVLVV- 160 170 180 .AASGNSGA - * - GSIS - * - * - * - YPARYANAMAVGAT- 190 200 210 DQNNNRASFSQYGAGLDIVAP-GVNVQSTYP- 220 230 240 GSTYASLNGTSMATPHVAGAA-ALVKQKNPS- 250 260 270 WSNVQIRNHLKNTATSLGSTN- -YGSGLVNA- 275 .EAATR or a homologous subtylase having an amino acid sequence comprising an amino acid residue at position 100a, and showing an identity of more than 70%, 75%, 80%, 85%, 90% or 95% with it.
24. The subtilase variant according to claim 22 or 23, characterized in that X at position 100a is chosen from the group comprising T, A, G, S and P.
25. An isolated DNA sequence, characterized in that it encodes for a subtyla or subtyla variant according to any one of claims 1 to 24.
26. An expression vector, characterized in that it comprises an isolated DNA sequence according to claim 25.
27. A microbial host cell, characterized in that it is transformed with an expression vector according to claim 26.
28. The microbial host according to claim 27, characterized in that it is a bacterium, preferably a Bacillus, especially B. lentus
29. The microbial host according to claim 27, characterized in that it is a fungus or yeast, preferably a filamentous fungus, especially an Aspergillus.
30. A method for producing a subtilase or subtyla variant according to any of claims 1 to 24, characterized in that a host according to any of claims 27 to 29 is cultured under the conditions that lead to expression and secretion. of said variant, and the variant is recovered.
31. A composition, characterized in that it comprises a subtilase or subtyla variant according to any of claims 1 to 24.
32. The composition according to claim 31, characterized in that it also comprises a cellulase, lipase, cutinase, oxidoreductase, another protease, or an amylase.
33. The composition according to claim 31 or 32, characterized in that the composition is a detergent composition.
34. The use of a subtilase or subtyla variant according to any one of claims 1 to 24, or an enzymatic composition according to claims 31 or 32 in a laundry detergent and / or for dish washing. AN ADDITIONAL AMINO ACID RESIDUE IN A CURRENT REGION OF THE ACTIVE SITE SUMMARY OF THE INVENTION The subtilases enzymes of subgroups I-SI and I-S2 having an additional amino acid residue at position 100 of the active site loop region (b) from position 95 to 103 are described. Variant subtilases show functioning of Improved washing in a detergent compared to its parent enzyme.
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
PAPA199801673 | 1998-12-18 |
Publications (1)
Publication Number | Publication Date |
---|---|
MXPA01006221A true MXPA01006221A (en) | 2002-05-09 |
Family
ID=
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU773066B2 (en) | Subtilase enzymes of the I-S1 and I-S2 sub-groups having an additional amino acid residue in an active site loop region | |
AU771078B2 (en) | Subtilase enzymes of the I-S1 and I-S2 sub-groups having an additional amino acid residue in the active site loop region | |
AU772347B2 (en) | Subtilase enzymes of the I-S1 and I-S2 sub-groups having an additional amino acid residue in an active site loop region | |
EP1183343A1 (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having at least one additional amino acid residue between positions 125 and 126 | |
MXPA01011836A (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having at least one additional amino acid residue between positions 97 and 98. | |
KR100649901B1 (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having an additional amino acid residue in an active site loop region | |
KR100660742B1 (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having an additional amino acid residue in an active site loop region | |
KR100660799B1 (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having an additional amino acid residue in an active site loop region | |
EP1141258A1 (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having an additional amino acid residue in an active site loop region | |
EP1183335A1 (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having at least one additional amino acid residue between positions 130 and 131 | |
AU771154B2 (en) | Subtilase enzymes of the I-S1 and I-S2 sub-groups having at least one additional amino acid residue between positions 97 and 98 | |
EP1141260A1 (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having an additional amino acid residue in an active site loop region | |
MXPA01006221A (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having an additional amino acid residue in an active site loop region | |
MXPA01006220A (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having an additional amino acid residue in the active site loop region | |
MXPA01006234A (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having an additional amino acid residue in an active site loop region | |
MXPA01006219A (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having an additional amino acid residue in an active site loop region | |
MXPA01006223A (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having an additional amino acid residue in an active site loop region | |
EP1183336A1 (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having at least one additional amino acid residue between positions 131 and 132 | |
MXPA01006222A (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having an additional amino acid residue in an active site loop region | |
EP1183339A1 (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having at least one additional amino acid residue between positions 129 and 130 | |
EP1183340A1 (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having at least one additional amino acid residue between positions 126 and 127 | |
EP1183341A1 (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having at least one additional amino acid residue between positions 127 and 128 | |
EP1183337A1 (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having at least one additional amino acid residue between positions 132 and 133 | |
EP1141259A1 (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having an additional amino acid residue in an active site loop region | |
MXPA01006047A (en) | Subtilase enzymes of the i-s1 and i-s2 sub-groups having an additional amino acid residue in an active site loop region |