Claims (60)
(1) 첫번째 피차아, 파스토리스 유전자의 프로모터 단편 및 두번째 피치아, 피스토리스 유전자의 종결암호(terminator) 단편(상기 첫번째와 두번째 유전자는 같거나 다름); 및 (2) 동물 pre-리소자임 C를 암호화 하는 DNA 단편(상기 단편은, 상기 pre- 리소자임 C- 암호와 단편 및 상기 종결암호 단편의 폴리아데닐화-신호-암호화 및 폴리아데닐화 -부위-암호화 단편의, 상기 프로모터 단편의 프로모터로부터, 피치아, 파스토리스내에서의 전사에 대해 조작적으로, 상기 프로모터와 종결암호 단편에 대하여, 배향되고 위치됨) 으로 구성되는 DNA.(1) a promoter fragment of the first pichia, the Pastoris gene and a terminator fragment of the second Peachia, the Pistoris gene (where the first and second genes are the same or different); And (2) a DNA fragment encoding animal pre-lysozyme C, wherein the fragment is a polyadenylation-signal-coding and polyadenylation-site-coding fragment of the pre-lysozyme C-coding and fragment and the termination code fragment. DNA oriented and positioned relative to the promoter and termination code fragment, operatively for transcription in Pchia, Pastoris, from the promoter of the promoter fragment.
제1항에 있어서, 상기 피치아, 파스토리스 유전자와 상기 두번째 피차아, 파스토리스 유전자가 같고 피차아, 파스토리스 AOX 1 유전자인 DNA.The DNA of claim 1, wherein the Pchia, Pastoris gene and the second Pichia, Pastoris gene are the same and are Pichia, Pastoris AOX 1 gene.
제2항에 있어서, pre- 리소자임 C-암호화 단편이 포유동물 종으로부터 얻은 pre- 리소자임 C를 암호화하는 DNA3. The DNA of claim 2 wherein the pre-lysozyme C-encoding fragment encodes pre-lysozyme C obtained from a mammalian species.
제3항에 있어서, 종이 인간인 DNA.The DNA of claim 3, wherein the species is human.
제4항에 있어서, 인간 pre- 리소자임 C-암호화 단편이, 플라스미드 pHLZ102의 pre- 리소자임 C-암호와, EcoRI-부위-종결 단편을 갖는 서열 또는 pre-리소자임 CDML 단일 펩티드의 -3위치에서 Val을 암호화하는 트리플리트(triplet) 5'-GTT-3' 및 pre-리소자임 C 의 단일 펩티드의 -2 위치에서 Gln 을 암호화는트리플리트 5'-CAA-3'을 갖도록 변경된 상기 프라스미드 pHLZ102 의 pre- 리소자임, C-암호화 EcoRI-부위-종결 단편을 갖는 서열을 갖는 DNA.5. The human pre-lysozyme C-coding fragment according to claim 4, wherein the human pre-lysozyme C-coding fragment has a Val at the −3 position of the pre-lysozyme CDML single peptide or a sequence having the pre-lysozyme C-code of plasmid pHLZ102 and the EcoRI-site-terminating fragment. Pre- of the plasmid pHLZ102 modified to have triplet 5'-CAA-3 'encoding Gln at the -2 position of a single peptide of triplet 5'-GTT-3' and pre-lysozyme C encoding Lysozyme, DNA having a sequence with a C-encoding EcoRI-site-terminating fragment.
제3항에 있어서, 종이 소인 방법.The method of claim 3 wherein the paper is a sweep.
제6항에 있어서, 상기 pre-리소자임 C-암호화 단편이 플라스미드 pBLI6C 의 pre-리소자임 C2-암호화, EcoRI-부위-종결 단편을 갖는 서열을 갖는 DNA.The DNA of claim 6, wherein said pre-lysozyme C-coding fragment has a sequence having a pre-lysozyme C 2 -coding, EcoRI-site-terminating fragment of plasmid pBLI6C.
제1항에 있어서, 상기 pre-리소자임 C를 발현시키는 피치아, 파스토리스 세포를 형질전환시킬수 있고 상기 DNA 를 포함하는 피치아, 파스토리스 세포에 대해 선택성 마아커를 제공하는 유전자로 구성되는 DNA.The DNA of claim 1, wherein said DNA is comprised of a gene capable of transforming pichia, pastoris cells expressing said pre-lysozyme C and providing a selective marker for pichia, pastoris cells comprising said DNA.
제7항에 있어서, 선택성 마아커를 제공하는 유전자가 피치아, 파스토리스 HIS4 유전자, 피치아, 파스토리스 ARG4 유전자, 사카토마이세스 세레비지애 ARG4 유전자, 및 사카로마이세스 세레비지애 HIS4유전자로 구성된 군으로부터 선택되는 DNA8. The gene according to claim 7, wherein the genes providing the selective markers are Pchia, Pastoris HIS4 gene, Pchia, Pastoris ARG4 gene, Saccharomyces cerevisiae ARG4 gene, and Saccharomyces cerevisiae HIS4 gene. DNA selected from the group consisting of
제9항에 있어서, 상기 첫번째 피치아, 파스토리스 유전자와 상기 두번째 피치아, 파스토리스 유전자가 같고 피치아, 파스토리스 AOX 1 유전자인 DNA.The DNA of claim 9, wherein the first Peachia, Pastoris gene and the second Peachia, Pastoris gene are the same and are Peachia, Pastoris AOX 1 gene.
제10항에 있어서, pre- 리소자임 C-암호화 단편이 포유동물 종으로부터 얻은 pre- 리소자임 C를 암호화 하는 DNA.The DNA of claim 10, wherein the pre-lysozyme C-encoding fragment encodes pre-lysozyme C obtained from a mammalian species.
제11항 에 있어서, 종이 인간이 DNA.The DNA of claim 11 wherein the species is DNA.
제12항에 있어서, 인간 pre-리소자임 C-암호화 단편이, 플라스미드 pHLZ102의 pre-리The method of claim 12, wherein the human pre-lysozyme C-encoding fragment is a pre-lyase of plasmid pHLZ102.
소자임 C-암호화, EcoRI-부위-종결- 단편을 갖는 서열 또는 pre-리소자임 C의 단일 팹티Sozyme C-encoding, sequences with EcoRI-site-termination-fragments, or single fabs of pre-lysozyme C
드의 -3위치에서 Val 을 암호화하는 트리프릴트 5'-GTT-3' 및 pre-리소자임 C 의 단일 펩Single peptide of triplyt 5'-GTT-3 'and pre-lysozyme C encoding Val at the -3 position of
티드의 -2위치에서 Gln을 암호화하는 트리플리트 5'-CAA-3'을 갖도록 변경된 상기 플라스The flask modified to have a triplet 5'-CAA-3 'encoding Gln at the -2 position of the teat
미드 pHLZ102의 pre-리소자일 C-암호화, EcoRI-부위-종결 단편을 갖는 서열을 갖는 DNA.DNA having a sequence with a pre-lysozyl C-coding, EcoRI-site-terminating fragment of mead pHLZ102.
제13항에 있어서, 플라스미드 pHZ103인 DNA.The DNA of claim 13, wherein the DNA is plasmid pHZ103.
제11항에 있어서, 종이 소인 방법.The method of claim 11, wherein the paper is a sweep.
제15항에 있어서, 소 pre-리소자임 C-암호화 단편이 플라스미드 pBLI6C 의 pre-리소자임 C2-암호화, EcoRI-부위-종결 단편을 갖는 서열을 갖는 DNA16. The DNA of claim 15 wherein the bovine pre-lysozyme C-coding fragment has a sequence having a pre-lysozyme C 2 -coding, EcoRI-site-terminating fragment of plasmid pBLI6C.
제16항에 있어서, p니12A 및 pBL12A 로 구성된 군으로부터 선택되는 DNAThe DNA of claim 16 selected from the group consisting of pni12A and pBL12A.
제8항에 있어서, DNAFH 형질전환 피치아, 피스토리스의 배양물.10. The culture of claim 8 wherein the DNAFH transformed Peacha, Phystoris.
제18항에 있어서, 제9항에 따른 DNAFH 형질전환시킨 피치아, 파스토리스의 배양물인 배양물.19. The culture according to claim 18 which is a culture of DNAFH transformed Peachia, Pastoris according to claim 9.
제19항에 있어서, 제10항에 따른 DNA로 형질 전환시킨 피치아, 파스토리스의 배양물인 배양물.The culture according to claim 19, which is a culture of Pchia, Pastoris transformed with DNA according to claim 10.
제20항에 있어서, 제11항에 따른 DNA로 형질 전환시킨 피치아, 파스토리스의 배양물인 배양물.The culture according to claim 20, which is a culture of Pchia, Pastoris transformed with DNA according to claim 11.
제21항에 있어서, 제12항에 따른 DNA로 형질 전환시킨 피치아, 파스토리스의 배양물인 배양물.The culture according to claim 21, which is a culture of Pchia, Pastoris transformed with DNA according to claim 12.
제22항에 있어서, 제13항에 따른 DNA로 형질 전환시킨 피치아, 파스토리스의 배양물인 배양물.The culture according to claim 22, which is a culture of Pchia, Pastoris transformed with DNA according to claim 13.
제23항에 있어서, 제14항에 따른 DNA로 형질 전환시킨 피치아, 파스토리스의 배양물인 배양물.The culture according to claim 23, which is a culture of Pchia, Pastoris transformed with DNA according to claim 14.
제24항에 있어서, 상기 배양물이 G-HLZ103S및 G+HLZ103S 로 구성된 군으로부터 선택된 피치아, 파스토리스 균주의 배양물인 배양물.The culture of claim 24 wherein said culture is a culture of a Pchia, Pastoris strain selected from the group consisting of G-HLZ103S and G + HLZ103S.
제21항에 있어서, 제15항에 따른 DNA로 형질 전환시킨 피치아, 파스토리스의 배양물인 배양물.The culture according to claim 21, which is a culture of Pchia and Pastoris transformed with DNA according to claim 15.
제26항에 있어서, 제16항에 따른 DNA로 형질 전환시킨 피치아, 파스토리스의 배양물인 배양물.27. The culture according to claim 26 which is a culture of Pchia, Pastoris transformed with the DNA according to Claim 16.
제28항에 있어서, 제17항에 따른 DNA로 형질 전환시킨 피치아, 파스토리스의 배양물인 배양물.The culture according to claim 28, which is a culture of Pchia, Pastoris transformed with the DNA according to Claim 17.
제28항에 있어서, 상기 배양물이 A37, L1, C6, CSBL11, 및 CSBL3로 구성된 군으로부터 선택된 피치아, 파스토리스 균주의 배양물인 배양물.The culture of claim 28, wherein the culture is a culture of a Pchia, Pastoris strain selected from the group consisting of A37, L1, C6, CSBL11, and CSBL3.
피치아, 파스토리스내에서 상응하는 동물 pre- 리소자임 C를 발현시킬수 있는 유전자를 갖는 피치아, 파스토리스 세포를, 상기 유전자를 상기 세포내에서 전사시키도록 하는 조건하에서, 배양하는 것으로 구성되는, 동물 리소자임 C를 제조하는 방법.An animal, consisting of culturing a Peachia, Pastoris cell having a gene capable of expressing the corresponding animal pre-lysozyme C in Peachia, Pastoris, under conditions such that said gene is transcribed in said cell Process for preparing lysozyme C.
제30항에 있어서, 세포가, 피치아, 파스토리스내에서 상응하는 pre-리소자임 C를 발현시킬수 있는 제8항에 따른 DNA 로 형질전환시킨, 배양물이나 제대 배양물내에 있는 방법.31. The method of claim 30, wherein the cells are in culture or umbilical cord culture transformed with DNA according to claim 8 capable of expressing the corresponding pre-lysozyme C in Pchia, Pastoris.
제31항에 있어서, 세포가, 피치아, 파스토리스내에서 상응하는 pre-리소자임 C를 발현시킬수 있는 제8항에 따른 DNAFH 형질전환시킨, 배양물이나 제대 배양물내에 있는 방법.32. The method of claim 31, wherein the cells are in a culture or umbilical cord cultured with DNAFH according to claim 8 capable of expressing the corresponding pre-lysozyme C in Pchia, Pastoris.
제32항에 있어서, 세포가, 피치아, 파스토리스내에서 상응하는 pre-리소자임 C를 발현시킬수 있는 제8항에 따른 DNA 로 형질전환시킨, 배양물이나 제대 배양물내에 있는 방법.33. The method of claim 32, wherein the cells are in culture or umbilical cord culture transformed with DNA according to claim 8 capable of expressing the corresponding pre-lysozyme C in Pchia, Pastoris.
제33항에 있어서, 제조될 리소자임 C가 포유동물 리소자임 C이고 세포가, 피치아, 파스토리스내에서 상응하는 pre-리소자임 C를 발현시킬수 있는 제11항에 다른 DNA 로 형질전환시킨, 배양물이나 제대 배양물내에 있는 방법.34. The culture of claim 33 wherein the lysozyme C to be produced is a mammalian lysozyme C and the cell is transformed with another DNA of claim 11 capable of expressing the corresponding pre-lysozyme C in Pchia, Pastoris. Method in Umbilical Cord Culture.
제34항에 있어서, 제조될 리소자임 C가 인간 리소자임 C이고, 세포가, 피치아, 파스토리스내에서 상응하는 pre-리소자임 C를 발현시킬수 있는 12항에 따른 DNA 로 형질전환시킨, 배양물이나 제대 배양물내에 있는 방법.35. The culture or umbilical cord of claim 34, wherein the lysozyme C to be produced is human lysozyme C and the cells are transformed with DNA according to claim 12 capable of expressing the corresponding pre-lysozyme C in Pchia, Pastoris. Method in culture.
제35항에 있어서, 제조될 리소자임 C가 인간 리소자임 C이고, 세포가, 피치아, 파스토리스내에서 상응하는 pre-리소자임 C를 발현시킬수 있는 13항에 따른 DNA 로 형질전환시킨, 배양물이나 제대 배양물내에 있는 방법.36. The culture or umbilical cord of claim 35, wherein the lysozyme C to be produced is human lysozyme C and the cells are transformed with DNA according to claim 13 capable of expressing the corresponding pre-lysozyme C in Pchia, Pastoris. Method in culture.
제36항에 있어서, 제조될 리소자임 C가 인간 리소자임 C이고, 세포가, 피치아, 파스토리스내에서 상응하는 pre-리소자임 C를 발현시킬수 있는 14항에 따른 DNA 로 형질전환시킨, 배양물이나 제대 배양물내에 있는 방법.37. The culture or umbilical cord of claim 36, wherein the lysozyme C to be produced is human lysozyme C and the cells are transformed with DNA according to claim 14 capable of expressing the corresponding pre-lysozyme C in Pchia, Pastoris. Method in culture.
제37항에 있어서, 세포가 G-HLZ103S 및 G+HLZ103S 로 구성된 군으로부터 선택된 균주의 세포인 방법.The method of claim 37, wherein the cells are cells of a strain selected from the group consisting of G-HLZ103S and G + HLZ103S.
제34항에 있어서, 제조될 리소자임 C가 소리소자임 C이고 세포가, 피치아 파스토리스내에서 상응하는 pre-리소자임 C를 발현시킬수 있는 제15항에 따른 DNA로 형질전환시킨, 배양물이나 계대 배양물내에 있는 방법.35. The culture or passage culture according to claim 34, wherein the lysozyme C to be produced is soryzyme C and the cells are transformed with the DNA according to claim 15 capable of expressing the corresponding pre-lysozyme C in Pchia pastoris. Way in water.
제39항에 있어서, 제조될 리소자임 C가 인간 리소자임 C2이고, 세포가, 피치아, 파스토리스내에서 상응하는 pre-리소자임 C2를 발현시킬수 있는 16항에 따른 DNA 로 형질전환시킨, 배양물이나 제대 배양물내에 있는 방법.40. The culture or umbilical cord of claim 39, wherein the lysozyme C to be produced is human lysozyme C2 and the cells are transformed with DNA according to claim 16 capable of expressing the corresponding pre-lysozyme C2 in Pchia, Pastoris. Method in culture.
제40항에 있어서, 제조될 리소자임 C가 인간 리소자임 C2이고, 세포가, 피치아, 파스토리스내에서 상응하는 pre-리소자임 C2를 발현시킬수 있는 17항에 따른 DNA 로 형질전환시킨, 배양물이나 제대 배양물내에 있는 방법.41. The culture or umbilical cord of claim 40, wherein the lysozyme C to be prepared is human lysozyme C2 and the cells are transformed with DNA according to claim 17 capable of expressing the corresponding pre-lysozyme C2 in Pchia, Pastoris. Method in culture.
제41항에 있어서, 세포가 A37, L1, C6, CSBL11 및 CSBL3로 구성된 군으로부터 선택된 균주의 세포인 방법.The method of claim 41, wherein the cells are cells of a strain selected from the group consisting of A37, L1, C6, CSBL11, and CSBL3.
제30항에 있어서, 상기 배양이 탄소원으로서 메탄올을 함유하는 배지내에서 수행되는 방법.31. The method of claim 30, wherein said culturing is carried out in a medium containing methanol as the carbon source.
제31항에 있어서, 상기 배양이 탄소원으로서 메탄올을 함유하는 배지내에서 수행되는 방법.32. The method of claim 31, wherein said culturing is carried out in a medium containing methanol as the carbon source.
제32항에 있어서, 상기 배양이 탄소원으로서 메탄올을 함유하는 배지내에서 수행되는 방법.33. The method of claim 32, wherein said culturing is carried out in a medium containing methanol as the carbon source.
제33항에 있어서, 상기 배양이 탄소원으로서 메탄올을 함유하는 배지내에서 수행되는 방법.34. The method of claim 33, wherein said culturing is carried out in a medium containing methanol as the carbon source.
제34항에 있어서, 상기 배양이 탄소원으로서 메탄올을 함유하는 배지내에서 수행되는 방법.35. The method of claim 34, wherein said culturing is carried out in a medium containing methanol as the carbon source.
제35항에 있어서, 상기 배양이 탄소원으로서 메탄올을 함유하는 배지내에서 수행되는 방법.36. The method of claim 35, wherein said culturing is carried out in a medium containing methanol as the carbon source.
제36항에 있어서, 상기 배양이 탄소원으로서 메탄올을 함유하는 배지내에서 수행되는 방법.37. The method of claim 36, wherein said culturing is carried out in a medium containing methanol as the carbon source.
제37항에 있어서, 상기 배양이 탄소원으로서 메탄올을 함유하는 배지내에서 수행되는 방법.38. The method of claim 37, wherein said culturing is carried out in a medium containing methanol as the carbon source.
제38항에 있어서, 상기 배양이 탄소원으로서 메탄올을 함유하는 배지내에서 수행되는 방법.The method of claim 38, wherein said culturing is carried out in a medium containing methanol as the carbon source.
제39항에 있어서, 상기 배양이 탄소원으로서 메탄올을 함유하는 배지내에서 수행되는 방법.40. The method of claim 39, wherein said culturing is carried out in a medium containing methanol as the carbon source.
제40항에 있어서, 상기 배양이 탄소원으로서 메탄올을 함유하는 배지내에서 수행되는 방법.41. The method of claim 40, wherein said culturing is carried out in a medium containing methanol as the carbon source.
제41항에 있어서, 상기 배양이 탄소원으로서 메탄올을 함유하는 배지내에서 수행되는 방법.42. The method of claim 41, wherein said culturing is carried out in a medium containing methanol as the carbon source.
제42항에 있어서, 상기 배양이 탄소원으로서 메탄올을 함유하는 배지내에서 수행되는 방법.43. The method of claim 42, wherein said culturing is carried out in a medium containing methanol as the carbon source.
서열 : MKALVILGFLFLSVAVQG 를 갖는 18-아미노산 폴리펩티드.SEQ ID NO: 18-amino acid polypeptide having MKALVILGFLFLSVAVQG.
서열 : MKALVILGFLFLSVAVQG 를 갖는 폴리펩티드를 암호화 하는 서열중 54-bpDML 단편, 서열;SEQ ID NO: 54-bpDML fragment, sequence in a sequence encoding a polypeptide having MKALVILGFLFLSVAVQG;
MKALVILGFLFLSVAVQGKVFERCE-MKALVILGFLFLSVAVQGKVFERCE-
LARTLKKLGLDGYKGVSLANWLCLT-LARTLKKLGLDGYKGVSLANWLCLT-
KWESSYNTKATNYNPSSESTDYGIF-KWESSYNTKATNYNPSSESTDYGIF-
QINSKWWCNDGKTPNAVDGCHVSCS-QINSKWWCNDGKTPNAVDGCHVSCS-
ELMENDIAKAVACAKX98IVSQGITA-ELMENDIAKAVACAKX 98 IVSQGITA-
WVAWKSHCRDHDVSSYVEGCTLWVAWKSHCRDHDVSSYVEGCTL
(여기에서, X98은 K 또는 H임) 을 갖는 폴리펩티드를 암호화하는 서열중 441-bp 의 단편 및 서열; MKALVILGFLFLSVAVQG 를 갖는 폴리펩트가 성숙한 모유 리소자임의 아미노-발단에 융합된 융합 폴리펩티드를 암호화 하는 서열중 : 444-bp 의 단편으로 구성된 군으로부터선택된 단편으로 구성되는 DNA.A fragment and a sequence of 441-bp of a sequence encoding a polypeptide having X 98 wherein X 98 is K or H; DNA consisting of a fragment selected from the group consisting of: 444-bp fragment of the sequence encoding a fusion polypeptide wherein the polypeptide having MKALVILGFLFLSVAVQG is fused to the amino-initiation of mature breast milk lysozyme.
제57항에 있어서, 서열; MKALVILGFLFLSVAVQG를 갖는 폴리펩티드를 암호화하는 사열중 54-bp의 단편으로 구성되는 DNA.59. The method of claim 57, further comprising: a sequence; DNA consisting of a 54-bp fragment in a quadrant encoding a polypeptide having MKALVILGFLFLSVAVQG.
제58항에 있어서, 서열;59. The method of claim 58, further comprising: a sequence;
MKALVILGFLFLSVAVQGKVFERCE-MKALVILGFLFLSVAVQGKVFERCE-
LARTLKKLGLDGYKGVSLANWLCLT-LARTLKKLGLDGYKGVSLANWLCLT-
KWESSYNTKATNYNPSSESTDYGIF-KWESSYNTKATNYNPSSESTDYGIF-
QINSKWWCNDGKTPNAVDGCHVSCS-QINSKWWCNDGKTPNAVDGCHVSCS-
ELMENDIAKAVACAKX98IVSQGITA-ELMENDIAKAVACAKX 98 IVSQGITA-
WVAWKSHCRDHDVSSYVEGCTLWVAWKSHCRDHDVSSYVEGCTL
를 갖는 폴리펩티드를 암호화하는 서열중 441bp 의 단편으로 구성되는 DNA.DNA consisting of a 441 bp fragment in a sequence encoding a polypeptide having:
제58항에 있어서, 서열 : MKALVILGFLFLSVAVQG를 갖는 폴리펩티드가 성숙한 모유 리소자임의 아미노-말단에 융합된 융합 폴리펩티드를 암호화 하는 서명중 444-bp 의 단편으로 구성되는 DAN .The DAN of claim 58, wherein the polypeptide having the sequence: MKALVILGFLFLSVAVQG consists of a 444-bp fragment in the signature encoding a fusion polypeptide fused to the amino-terminus of mature breastmilk lysozyme.
※ 참고사항 : 최초출원 내용에 의하여 공개하는 것임.※ Note: The disclosure is based on the initial application.