KR20240057515A - Antibody for binding SARS coronavirus 2 spike antigen and uses thereof - Google Patents
Antibody for binding SARS coronavirus 2 spike antigen and uses thereof Download PDFInfo
- Publication number
- KR20240057515A KR20240057515A KR1020220137585A KR20220137585A KR20240057515A KR 20240057515 A KR20240057515 A KR 20240057515A KR 1020220137585 A KR1020220137585 A KR 1020220137585A KR 20220137585 A KR20220137585 A KR 20220137585A KR 20240057515 A KR20240057515 A KR 20240057515A
- Authority
- KR
- South Korea
- Prior art keywords
- sars coronavirus
- antibody
- seq
- antigen
- composition
- Prior art date
Links
- 241001678559 COVID-19 virus Species 0.000 title claims abstract description 64
- 239000000427 antigen Substances 0.000 title claims abstract description 45
- 102000036639 antigens Human genes 0.000 title claims abstract description 45
- 108091007433 antigens Proteins 0.000 title claims abstract description 45
- 239000000203 mixture Substances 0.000 claims description 22
- 208000015181 infectious disease Diseases 0.000 claims description 17
- 238000000034 method Methods 0.000 claims description 17
- 208000035473 Communicable disease Diseases 0.000 claims description 15
- 239000012530 fluid Substances 0.000 claims description 6
- 210000004369 blood Anatomy 0.000 claims description 5
- 239000008280 blood Substances 0.000 claims description 5
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 4
- 206010068319 Oropharyngeal pain Diseases 0.000 claims description 4
- 201000007100 Pharyngitis Diseases 0.000 claims description 4
- 206010035664 Pneumonia Diseases 0.000 claims description 4
- 206010006451 bronchitis Diseases 0.000 claims description 4
- 238000009007 Diagnostic Kit Methods 0.000 claims description 3
- 206010036790 Productive cough Diseases 0.000 claims description 3
- 210000001124 body fluid Anatomy 0.000 claims description 3
- 239000010839 body fluid Substances 0.000 claims description 3
- 210000004910 pleural fluid Anatomy 0.000 claims description 3
- 210000003296 saliva Anatomy 0.000 claims description 3
- 210000003802 sputum Anatomy 0.000 claims description 3
- 208000024794 sputum Diseases 0.000 claims description 3
- 239000012503 blood component Substances 0.000 claims 1
- 238000001514 detection method Methods 0.000 description 19
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 9
- 230000004083 survival effect Effects 0.000 description 9
- 230000035772 mutation Effects 0.000 description 7
- 230000003472 neutralizing effect Effects 0.000 description 7
- 108090000623 proteins and genes Proteins 0.000 description 6
- 208000025721 COVID-19 Diseases 0.000 description 5
- 229940096437 Protein S Drugs 0.000 description 5
- 101710198474 Spike protein Proteins 0.000 description 5
- 241000700605 Viruses Species 0.000 description 5
- 238000004458 analytical method Methods 0.000 description 5
- 239000003153 chemical reaction reagent Substances 0.000 description 5
- 238000002965 ELISA Methods 0.000 description 4
- 241000699670 Mus sp. Species 0.000 description 4
- 125000003275 alpha amino acid group Chemical group 0.000 description 4
- 239000012634 fragment Substances 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- 241000711573 Coronaviridae Species 0.000 description 3
- 238000010171 animal model Methods 0.000 description 3
- 238000003556 assay Methods 0.000 description 3
- 238000003745 diagnosis Methods 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 238000011156 evaluation Methods 0.000 description 3
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 3
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 210000004027 cell Anatomy 0.000 description 2
- 230000005859 cell recognition Effects 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 230000034994 death Effects 0.000 description 2
- 231100000517 death Toxicity 0.000 description 2
- 238000010185 immunofluorescence analysis Methods 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 238000002372 labelling Methods 0.000 description 2
- 210000001806 memory b lymphocyte Anatomy 0.000 description 2
- 239000000941 radioactive substance Substances 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 238000011084 recovery Methods 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 1
- 108010061994 Coronavirus Spike Glycoprotein Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 1
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 102100034343 Integrase Human genes 0.000 description 1
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- 102000008300 Mutant Proteins Human genes 0.000 description 1
- 108010021466 Mutant Proteins Proteins 0.000 description 1
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102000044437 S1 domains Human genes 0.000 description 1
- 108700036684 S1 domains Proteins 0.000 description 1
- 101000629318 Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein Proteins 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 238000003491 array Methods 0.000 description 1
- 230000005540 biological transmission Effects 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 238000004040 coloring Methods 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 230000017188 evasion or tolerance of host immune response Effects 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 230000002934 lysing effect Effects 0.000 description 1
- 239000006249 magnetic particle Substances 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 102000004169 proteins and genes Human genes 0.000 description 1
- 238000004451 qualitative analysis Methods 0.000 description 1
- 238000004445 quantitative analysis Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000003998 size exclusion chromatography high performance liquid chromatography Methods 0.000 description 1
- 238000001542 size-exclusion chromatography Methods 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 238000000844 transformation Methods 0.000 description 1
- 238000011830 transgenic mouse model Methods 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 230000004580 weight loss Effects 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/08—RNA viruses
- G01N2333/165—Coronaviridae, e.g. avian infectious bronchitis virus
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Oncology (AREA)
- Veterinary Medicine (AREA)
- Tropical Medicine & Parasitology (AREA)
- Communicable Diseases (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Cell Biology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Microbiology (AREA)
- Public Health (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Chemical & Material Sciences (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
본 발명은 사스 코로나바이러스 2를 효과적으로 검출, 진단, 예방 또는 치료하기 위해 사용되는 사스 코로나바이러스 2 스파이크 항원에 특이적으로 결합하는 항체 및 이의 용도에 관한 것이다.The present invention relates to an antibody specifically binding to the SARS coronavirus 2 spike antigen used to effectively detect, diagnose, prevent or treat SARS coronavirus 2 and its use.
Description
본 발명은 사스 코로나바이러스 2 스파이크 항원에 특이적으로 결합하는 항체 및 이의 용도에 관한 것이다. The present invention relates to antibodies that specifically bind to SARS coronavirus 2 spike antigen and uses thereof.
2019년 12월 중국 우한에서 첫 코로나 발생이후 전염성이 매우 강하여 빠르게 전세계적으로 5억7909만명 확진 및 640만명 사망에 이르고 있다('22년 8월 5일 기준). 국내에서도 2,027만명 확진, 2.5만명 사망으로 약 0.12% 치사율을 보였다('22년 8월 6일 기준).Since the first coronavirus outbreak in Wuhan, China in December 2019, the contagious disease has become very contagious, quickly reaching 579.09 million confirmed cases and 6.4 million deaths worldwide (as of August 5, 2022). In Korea, there were 20.27 million confirmed cases and 25,000 deaths, showing a fatality rate of about 0.12% (as of August 6, 2022).
코로나바이러스는 알파 베타, 감마, 델타, 오미크론 변이(스파이크 단백질 부위의 32개 변이)등 증식과 전파과정에서 지속적으로 변이 발생한다. 변이로 인한 전파속도 증가, 면역 회피 등의 가능성 있다.Coronaviruses continuously undergo mutations during proliferation and spread, including alpha beta, gamma, delta, and omicron mutations (32 mutations in the spike protein region). There is a possibility of increased transmission speed and immune evasion due to mutation.
한국등록특허 제2233689호는 SARS-CoV-2 스파이크 단백질의 수용체-결합 도메인에 특이적으로 결합하는 항체 및 이의 이용에 관한 것으로, SARS-CoV-2 스파이크 단백질의 수용체-결합 도메인에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 개시하고 있고, 한국등록특허 제2351653호는 사스 코로나바이러스 2 스파이크 단백질과 결합하는 수용체와 항체를 포함하는 사스 코로나바이러스 2 진단 키트에 관한 것으로, 사스 코로나바이러스 2 스파이크 단백질에 결합하는 항체를 포함하는 사스 코로나바이러스 2 검출용 조성물을 개시하고 있다. Korean Patent No. 2233689 relates to an antibody that specifically binds to the receptor-binding domain of the SARS-CoV-2 spike protein and its use. discloses an antibody or antigen-binding fragment thereof, and Korean Patent No. 2351653 relates to a SARS coronavirus 2 diagnostic kit comprising a receptor and an antibody that binds to the SARS coronavirus 2 spike protein. A composition for detecting SARS coronavirus 2 comprising an antibody that binds to is disclosed.
그러나, 본 발명의 특정 에피토프를 포함하는 사스 코로나바이러스 2 스파이크 항원에 특이적으로 결합하는 항체 및 이의 용도에 관한 내용은 개시된 바 없다. However, there has been no disclosure regarding an antibody specifically binding to the SARS coronavirus 2 spike antigen containing a specific epitope of the present invention and its use.
상기의 문제점을 해결하기 위해, 본 발명은 사스 코로나바이러스 2 스파이크 항원에 특이적으로 결합하는 항체 및 이의 용도 제공을 목적으로 한다.In order to solve the above problems, the purpose of the present invention is to provide an antibody that specifically binds to the SARS coronavirus 2 spike antigen and its use.
상기 과제를 해결하기 위하여, 본 발명은 서열번호 1의 중쇄 CDR1; 서열번호 2의 중쇄 CDR2; 및 서열번호 3의 중쇄 CDR3를 포함하는 중쇄 가변영역과, 서열번호 4의 경쇄 CDR1; 서열번호 5의 경쇄 CDR2; 및 서열번호 6의 경쇄 CDR3를 포함하는 경쇄 가변영역을 포함하는 사스 코로나바이러스 2 스파이크 항원에 특이적으로 결합하는 항체를 제공한다.In order to solve the above problem, the present invention provides the heavy chain CDR1 of SEQ ID NO: 1; Heavy chain CDR2 of SEQ ID NO: 2; And a heavy chain variable region comprising the heavy chain CDR3 of SEQ ID NO: 3, and the light chain CDR1 of SEQ ID NO: 4; Light chain CDR2 of SEQ ID NO: 5; and a light chain variable region including light chain CDR3 of SEQ ID NO: 6. It provides an antibody that specifically binds to the SARS coronavirus 2 spike antigen.
상기 사스 코로나바이러스 2 스파이크 항원에 특이적으로 결합하는 항체는 중쇄 가변영역인 서열번호 7 및 경쇄 가변영역인 서열번호 8일 수 있다.The antibody that specifically binds to the SARS coronavirus 2 spike antigen may be the heavy chain variable region of SEQ ID NO: 7 and the light chain variable region of SEQ ID NO: 8.
본 발명의 일 예에서, 상기 사스 코로나바이러스 2 스파이크 항원에 특이적으로 결합하는 항체를 포함하는 사스 코로나바이러스 2 검출용 조성물을 제공한다.In one example of the present invention, a composition for detecting SARS coronavirus 2 comprising an antibody that specifically binds to the SARS coronavirus 2 spike antigen is provided.
본 발명의 다른 예에서, 상기 사스 코로나바이러스 2 스파이크 항원에 특이적으로 결합하는 항체를 포함하는 사스 코로나바이러스 2 감염질환 진단용 조성물을 제공한다.In another example of the present invention, a composition for diagnosing SARS coronavirus 2 infectious disease is provided, comprising an antibody that specifically binds to the SARS coronavirus 2 spike antigen.
본 발명의 다른 예에서, 상기 사스 코로나바이러스 2 스파이크 항원에 특이적으로 결합하는 항체를 포함하는 사스 코로나바이러스 2 감염질환 예방 또는 치료용 조성물을 제공한다.In another example of the present invention, a composition for preventing or treating SARS coronavirus 2 infectious disease is provided, comprising an antibody that specifically binds to the SARS coronavirus 2 spike antigen.
상기 사스 코로나바이러스 2 감염질환은 독감, 감기, 인후염, 기관지염, 폐렴 및 이들의 조합으로 이루어진 군에서 선택된 하나 이상을 포함하는 것일 수 있다. The SARS coronavirus 2 infectious disease may include one or more selected from the group consisting of flu, cold, sore throat, bronchitis, pneumonia, and combinations thereof.
본 발명의 또 다른 예에서, 본 발명은 사스 코로나바이러스 2 스파이크 항원에 특이적으로 결합하는 항체를 분리된 시료에 반응시키는 단계를 포함하는 사스 코로나바이러스 2를 검출하는 방법을 제공한다.In another example of the present invention, the present invention provides a method for detecting SARS coronavirus 2, comprising reacting an isolated sample with an antibody that specifically binds to the SARS coronavirus 2 spike antigen.
상기 검출용 또는 진단용 조성물은 사용설명서를 추가적으로 포함하는 검출용 키트의 형태로 제공될 수 있다.The detection or diagnostic composition may be provided in the form of a detection kit that additionally includes instructions for use.
상기 검출용 조성물, 진단용 조성물, 키트 또는 검출하는 방법에서, 시료는 비강 면봉, 비인두 세척액, 기관지폐포세척액, 흉수, 비강 도말, 비강 흡인액, 비인두 도말, 비인두흡인액, 혈액, 혈액 구성성분, 체액, 타액, 가래 및 이들의 조합으로 이루어진 군에서 선택된 하나 이상일 수 있다.In the detection composition, diagnostic composition, kit, or method for detection, the sample is a nasal swab, nasopharyngeal lavage fluid, bronchoalveolar lavage fluid, pleural fluid, nasal smear, nasal aspirate, nasopharyngeal smear, nasopharyngeal aspirate, blood, blood composition. It may be one or more selected from the group consisting of ingredients, body fluids, saliva, sputum, and combinations thereof.
본 발명은 사스 코로나바이러스 2 스파이크 항원에 특이적으로 결합하는 항체 및 이의 용도에 관한 것으로, 본 발명의 항체는 사스 코로나바이러스 2를 조기에 신속하게 진단하여 대응하고 분류함으로써 추가 확산을 방지하여 궁극적으로 발병률을 낮추고 나아가 국민의 안전과 경제 손실을 줄일 수 있는 기반을 마련하는데 유용하게 활용될 수 있다.The present invention relates to an antibody that specifically binds to the SARS coronavirus 2 spike antigen and its use. The antibody of the present invention prevents further spread by early and rapid diagnosis, response, and classification of SARS coronavirus 2, ultimately preventing further spread. It can be usefully used to lower the incidence rate and further lay the foundation for reducing public safety and economic losses.
또한, 본 발명의 항체는 다양한 사스 코로나바이러스 2의 변이에 대한 중화능을 기반으로 사스 코로나바이러스 2 감염질환 예방 또는 치료제로 활용될 수 있을 뿐 아니라 바이러스 변이 대응에 기여할 수 있다. In addition, the antibody of the present invention can be used as a preventive or therapeutic agent for SARS coronavirus 2 infectious disease based on its neutralizing ability against various SARS coronavirus 2 mutations, and can also contribute to responding to virus mutations.
도 1은 항체(3종) 중쇄 유전자의 유사성 비교를 나타낸 것이다.
도 2는 항체(3종) 경쇄 유전자의 유사성 비교를 나타낸 것이다.
도 3은 항체(3종)의 순도 분석을 나타낸 것이다.
도 4는 항체(3종)의 CDR 3차 구조 분석을 나타낸 것이다.
도 5는 Octet을 이용하여 S type 항원 S1과 항체(3종)의 결합력 측정 그래프를 나타낸 것이다.
도 6은 SPR assay를 이용한 변이 항원 RBD와 항체(3종)의 결합력 측정 그래프를 나타낸 것이다.
도 7은 SPR assay를 이용한 변이 항원 S1와 항체(3종)의 결합력 측정 그래프를 나타낸 것이다.
도 8은 코로나19 변이 바이러스에 대한 항체(3종)의 중화능 측정 그래프를 나타낸 것이다.
도 9는 동물모델에서의 항체 치료능 평가를 나타낸 것이다.
Figure 1 shows a comparison of the similarity of heavy chain genes of antibodies (3 types).
Figure 2 shows a comparison of the similarity of light chain genes of antibodies (3 types).
Figure 3 shows the purity analysis of antibodies (3 types).
Figure 4 shows CDR tertiary structure analysis of antibodies (3 types).
Figure 5 shows a graph measuring the binding force of S type antigen S1 and antibodies (3 types) using Octet.
Figure 6 shows a graph measuring the binding force of mutant antigen RBD and antibodies (3 types) using SPR assay.
Figure 7 shows a graph measuring the binding force of mutant antigen S1 and antibodies (3 types) using SPR assay.
Figure 8 shows a graph measuring the neutralizing ability of antibodies (3 types) against the COVID-19 mutant virus.
Figure 9 shows the evaluation of antibody therapeutic activity in animal models.
본 발명은 다양한 변환을 가할 수 있고 여러 가지 실시예를 가질 수 있는 바, 이하 특정 실시예들을 도면에 예시하고 상세한 설명에 상세하게 설명하고자 한다. 그러나, 이는 본 발명을 특정한 실시 형태에 대해 한정하려는 것이 아니며, 본 발명의 사상 및 기술 범위에 포함되는 모든 변환, 균등물 내지 대체물을 포함하는 것으로 이해되어야 한다. 본 발명을 설명함에 있어서 관련된 공지 기술에 대한 구체적인 설명이 본 발명의 요지를 흐릴 수 있다고 판단되는 경우 그 상세한 설명을 생략한다.Since the present invention can be modified in various ways and can have various embodiments, specific embodiments will be illustrated in the drawings and explained in detail in the detailed description below. However, this is not intended to limit the present invention to specific embodiments, and should be understood to include all transformations, equivalents, and substitutes included in the spirit and technical scope of the present invention. In describing the present invention, if it is determined that a detailed description of related known technologies may obscure the gist of the present invention, the detailed description will be omitted.
본 발명은 서열번호 1의 중쇄 CDR1; 서열번호 2의 중쇄 CDR2; 및 서열번호 3의 중쇄 CDR3를 포함하는 중쇄 가변영역과, 서열번호 4의 경쇄 CDR1; 서열번호 5의 경쇄 CDR2; 및 서열번호 6의 경쇄 CDR3를 포함하는 경쇄 가변영역을 포함하는 사스 코로나바이러스 2 스파이크 항원에 특이적으로 결합하는 항체를 제공한다.The present invention provides the heavy chain CDR1 of SEQ ID NO: 1; Heavy chain CDR2 of SEQ ID NO: 2; and a heavy chain variable region comprising the heavy chain CDR3 of SEQ ID NO: 3, and the light chain CDR1 of SEQ ID NO: 4; Light chain CDR2 of SEQ ID NO: 5; and an antibody that specifically binds to the SARS coronavirus 2 spike antigen comprising a light chain variable region including light chain CDR3 of SEQ ID NO: 6.
상기 사스 코로나바이러스 2 스파이크 항원에 특이적으로 결합하는 항체는 중쇄 가변영역인 서열번호 7 및 경쇄 가변영역인 서열번호 8일 수 있다.The antibody that specifically binds to the SARS coronavirus 2 spike antigen may be the heavy chain variable region of SEQ ID NO: 7 and the light chain variable region of SEQ ID NO: 8.
본 발명에서 "항체"는 면역계 내에서 항원의 자극에 의하여 만들어지는 물질을 의미하는 것으로서 그 종류는 특별히 제한되지 않는다. 또한 본 명세서에서 항체란 항원 결합능을 보유한 항체의 단편 예컨대, Fab, Fab', F(ab')2, Fv 및 Nanobody 등을 포함하나, 이에 제한되는 것은 아니다. In the present invention, “antibody” refers to a substance produced by antigen stimulation within the immune system, and its type is not particularly limited. Additionally, as used herein, antibodies include, but are not limited to, antibody fragments having antigen-binding ability such as Fab, Fab', F(ab')2, Fv, and Nanobody.
본 발명에서 "중쇄(heavy chain)"는 항원의 특이성을 부여하기 위한 충분한 가변 영역 서열을 갖는 아미노산 서열을 포함하는 가변 영역 도메인 VH 및 3개의 불변 영역 도메인을 포함하는 전체길이 중쇄 및 이의 단편을 모두 의미한다.In the present invention, "heavy chain" refers to both a full-length heavy chain and fragments thereof including a variable region domain VH and three constant region domains containing an amino acid sequence with sufficient variable region sequence to confer antigen specificity. it means.
본 발명에서 "경쇄(light chain, VL; kappa light chain, Vk)"는 항원에 특이성을 부여하기 위한 충분한 가변영역 서열을 갖는 아미노산 서열을 포함하는 가변영역 도메인 VL(Vk) 및 불변영역 도메인을 포함하는 전체길이 경쇄 및 이의 단편을 모두 의미한다. In the present invention, "light chain (VL; kappa light chain, Vk)" includes a variable region domain VL (Vk) and a constant region domain containing an amino acid sequence with sufficient variable region sequence to confer specificity to the antigen. refers to both the full-length light chain and fragments thereof.
본 발명에서 "상보성 결정 부위(complementarity-determining region, CDR)"는 항체의 중쇄 및 경쇄에서 고가변 영역(hypervariable region)의 아미노산 서열을 의미한다. 중쇄 및 경쇄에는 각각 3개의 CDR이 포함되어 있으며, CDR은 항체가 항원 또는 에피토프에 결합하는데 중요한 역할을 하는 접촉 잔기를 제공한다. In the present invention, “complementarity-determining region (CDR)” refers to the amino acid sequence of the hypervariable region in the heavy and light chains of an antibody. The heavy and light chains each contain three CDRs, which provide contact residues that play an important role in the binding of the antibody to the antigen or epitope.
본 발명의 일 예에서, 상기 사스 코로나바이러스 2 스파이크 항원에 특이적으로 결합하는 항체를 포함하는 사스 코로나바이러스 2 검출용 조성물을 제공한다.In one example of the present invention, a composition for detecting SARS coronavirus 2 comprising an antibody that specifically binds to the SARS coronavirus 2 spike antigen is provided.
본 발명의 다른 예에서, 상기 사스 코로나바이러스 2 스파이크 항원에 특이적으로 결합하는 항체를 포함하는 사스 코로나바이러스 2 감염질환 진단용 조성물을 제공한다.In another example of the present invention, a composition for diagnosing SARS coronavirus 2 infectious disease is provided, comprising an antibody that specifically binds to the SARS coronavirus 2 spike antigen.
상기 사스 코로나바이러스 2 감염질환은 독감, 감기, 인후염, 기관지염, 폐렴 및 이들의 조합으로 이루어진 군에서 선택된 하나 이상을 포함하는 것일 수 있다. The SARS coronavirus 2 infectious disease may include one or more selected from the group consisting of flu, cold, sore throat, bronchitis, pneumonia, and combinations thereof.
본 발명에 있어서, 사스 코로나바이러스 2의 진단의 검출 또는 진단은 항원-항체의 복합체를 검출하는 방사면역분석, 웨스턴블랏, ELISA(Enzyme linked immunosorbent assay) 또는 면역형광분석 등을 통해 검출될 수 있다. 본 발명에 있어서, 항원은 방사능 물질, 효소 또는 형광물질 등의 표지로 표지될 수 있다.In the present invention, detection or diagnosis of SARS coronavirus 2 can be detected through radioimmunoassay, Western blot, ELISA (Enzyme linked immunosorbent assay), or immunofluorescence analysis that detects an antigen-antibody complex. In the present invention, the antigen may be labeled with a label such as a radioactive substance, an enzyme, or a fluorescent substance.
상기 검출 또는 진단용 조성물은 사용설명서를 추가적으로 포함하는 검출 또는 진단 키트의 형태로 제공될 수 있다. 상기 키트는 상기 언급된 항체의 어느 하나 이상 및 항원-항체 복합체 검출용 시약을 포함할 수 있다. 상기 항원-항체 복합체 검출용 시약은 방사면역분석, ELISA (Enzyme linked immunosorbent assay) 또는 면역형광분석 등에 사용되는 시약이 사용될 수 있다.The detection or diagnostic composition may be provided in the form of a detection or diagnostic kit that additionally includes instructions for use. The kit may include any one or more of the above-mentioned antibodies and a reagent for detecting antigen-antibody complexes. The reagent for detecting the antigen-antibody complex may be a reagent used in radioimmunoassay, ELISA (Enzyme linked immunosorbent assay), or immunofluorescence analysis.
예를 들어, 상기 면역 반응의 검출을 위해 검출시약은 검출을 위해 직접적 또는 샌드위치 형태로 간접적으로 표지될 수 있다. 직접적 표지방법의 경우, 어레이 등에 사용되는 혈청 시료는 Cy3 또는 Cy5와 같은 형광 표지로 표지될 수 있다. 샌드위치 방식의 경우, 표지되지 않은 혈청 시료를 먼저 검출시약이 부착된 어레이와 반응시켜 결합시킨 후, 표적 단백질을 표지된 검출 항체와 결합시켜 검출할 수 있다. 샌드위치 방식의 경우, 민감도와 특이성을 높일 수 있어, pg/mL 수준까지 검출이 가능하다. 그 외 방사능 물질, 발색물질, 자기성입자 또는 고밀도 전자입자 등이 표지물질로 사용될 수 있다. 형광 광도는 스캐닝 콘포칼 현미경이 사용될 수 있으며, 예를 들어 Affymetrix, Inc 또는 Agilent Technologies, Inc 등에서 입수할 수 있다.For example, for detection of the immune response, the detection reagent may be labeled directly or indirectly in a sandwich form for detection. In the case of a direct labeling method, serum samples used in arrays, etc. may be labeled with a fluorescent label such as Cy3 or Cy5. In the case of the sandwich method, an unlabeled serum sample is first reacted with an array to which a detection reagent is attached, and then the target protein can be detected by binding it with a labeled detection antibody. In the case of the sandwich method, sensitivity and specificity can be increased, enabling detection up to the pg/mL level. Other radioactive substances, coloring substances, magnetic particles, or high-density electronic particles can be used as labeling substances. The fluorescence intensity can be measured using a scanning confocal microscope, available from, for example, Affymetrix, Inc. or Agilent Technologies, Inc.
상기 조성물은 사스 코로나바이러스 2를 진단하기에 적합한 1종 이상의 다른 제제를 추가로 함유할 수 있다. 또한, 본 발명은 본 발명의 항체를 사용하여 사스 코로나바이러스 2를 진단하는 방법을 제공한다. 상기 방법은 사스 코로나바이러스 2의 정량적 또는 정성적 검출 또는 진단하는데 사용될 수 있다. 본 발명에 있어서, 검출은 정량 및/또는 정성 분석을 포함하는 것으로, 존재, 부존재의 검출 및 바이러스 양(titer)의 검출을 포함하는 것으로 이러한 방법은 당업계에 공지되어 있으며, 당업자라면 본원의 실시를 위해 적절한 방법을 선택할 수 있다.The composition may further contain one or more other agents suitable for diagnosing SARS coronavirus 2. Additionally, the present invention provides a method for diagnosing SARS coronavirus 2 using the antibody of the present invention. The method can be used for quantitative or qualitative detection or diagnosis of SARS coronavirus 2. In the present invention, detection includes quantitative and/or qualitative analysis, including detection of presence, absence, and detection of viral titer. Such methods are known in the art, and those skilled in the art will be able to perform the present application. You can choose an appropriate method for this.
본 발명의 또 다른 예에서, 본 발명은 사스 코로나바이러스 2 스파이크 항원에 특이적으로 결합하는 항체를 분리된 시료에 반응시키는 단계를 포함하는 사스 코로나바이러스 2를 검출하는 방법을 제공한다.In another example of the present invention, the present invention provides a method for detecting SARS coronavirus 2, comprising reacting an isolated sample with an antibody that specifically binds to the SARS coronavirus 2 spike antigen.
상기 검출용 조성물, 진단용 조성물, 키트 또는 검출하는 방법에서, 시료는 비강 면봉, 비인두 세척액, 기관지폐포세척액, 흉수, 비강 도말, 비강 흡인액, 비인두 도말, 비인두흡인액, 혈액, 혈액 구성성분, 체액, 타액, 가래 및 이들의 조합으로 이루어진 군에서 선택된 하나 이상일 수 있다.In the detection composition, diagnostic composition, kit, or method for detection, the sample is a nasal swab, nasopharyngeal lavage fluid, bronchoalveolar lavage fluid, pleural fluid, nasal smear, nasal aspirate, nasopharyngeal smear, nasopharyngeal aspirate, blood, blood composition. It may be one or more selected from the group consisting of ingredients, body fluids, saliva, sputum, and combinations thereof.
본 발명의 다른 예에서, 상기 사스 코로나바이러스 2 스파이크 항원에 특이적으로 결합하는 항체를 포함하는 사스 코로나바이러스 2 감염질환 예방 또는 치료용 조성물을 제공한다.In another example of the present invention, a composition for preventing or treating SARS coronavirus 2 infectious disease is provided, comprising an antibody that specifically binds to the SARS coronavirus 2 spike antigen.
또한, 본 발명은 상기 사스 코로나바이러스 2 스파이크 항원에 특이적으로 결합하는 항체를 투여하는 단계를 포함하는 사스 코로나바이러스 2 감염질환 예방 또는 치료방법을 제공한다. Additionally, the present invention provides a method for preventing or treating SARS coronavirus 2 infectious disease, comprising administering an antibody that specifically binds to the SARS coronavirus 2 spike antigen.
이하, 실시예를 통하여 본 발명을 보다 상세히 설명한다. 다만, 하기의 실시예는 본 발명을 예시하기 위한 것으로서 본 발명의 범위가 하기의 실시예에 한정되는 것은 아니다.Hereinafter, the present invention will be described in more detail through examples. However, the following examples are for illustrating the present invention and the scope of the present invention is not limited to the following examples.
<실시예 1> 코로나19 완치자의 PBMC로부터 항체 유전자 발굴<Example 1> Discovery of antibody genes from PBMC of recovered COVID-19 patients
코로나19 완치자의 PBMC로부터 코로나19 항원 특이적인 메모리 B세포를 분리함. PBMC에 형광으로 염색된 T세포 인지 항체(BV421-Anti CD3, BV421-Anti CD4, BV421-Anti CD8, BV421-Anti CD14)와 반응하여 결합하지 않는 세포에 형광으로 염색된 B 세포 인지 항체(PerCP Cy5-Anti CD20, FITC-Anti IgG )와 코로나 항원(RBD-PE, S1-PE 또는 S1(D614G)-PE)을 반응하여 결합한 메모리 B세포를 FACS를 이용하여 단일세포로 96 well PCR plate에 분리함.Isolation of COVID-19 antigen-specific memory B cells from PBMC of recovered COVID-19 patients. Fluorescently stained B cell recognition antibodies (PerCP Cy5) reacted with fluorescently stained T cell recognition antibodies (BV421-Anti CD3, BV421-Anti CD4, BV421-Anti CD8, BV421-Anti CD14) to PBMCs and did not bind to cells. -Memory B cells that reacted with Anti CD20, FITC-Anti IgG) and coronavirus antigen (RBD-PE, S1-PE or S1(D614G)-PE) were separated into single cells on a 96 well PCR plate using FACS. .
상용화 항원 3종 : ① SARS-CoV-2 (209-nCoV) Spike Protein (HPLC-verified, RBD, His Tag), Sino Biological, ② SARS-CoV-2 (209-nCoV) Spike S1-His Recombinant Protein (HPLC-verified), Sino Biological, ③ Recombinant Human Novel Coronavirus Spike glycoprotein(S) (D614G), partial, CUSABIO3 types of commercialized antigens: ① SARS-CoV-2 (209-nCoV) Spike Protein (HPLC-verified, RBD, His Tag), Sino Biological, ② SARS-CoV-2 (209-nCoV) Spike S1-His Recombinant Protein ( HPLC-verified), Sino Biological, ③ Recombinant Human Novel Coronavirus Spike glycoprotein(S) (D614G), partial, CUSABIO
분리된 메모리 B세포를 용해하여 RNA를 수득하고, 역전사 효소 반응으로 항체 cDNA를 합성한 뒤 1차, 2차 PCR 반응으로 항체(3종) 중쇄/경쇄유전자를 각각 증폭함. 증폭된 유전자는 항체 발현 벡터(pcDNA3.1)에 삽입하고, 클론의 DNA 시퀀싱하여 서열을 확보하고 IMGT 프로그램을 이용하여 93.75~100%의 발현 가능성을 확인함(표 1-3).RNA was obtained by lysing isolated memory B cells, antibody cDNA was synthesized through reverse transcriptase reaction, and heavy and light chain genes of the antibodies (3 types) were amplified through first and second PCR reactions, respectively. The amplified gene was inserted into an antibody expression vector (pcDNA3.1), the DNA of the clone was sequenced to secure the sequence, and the expression possibility of 93.75 to 100% was confirmed using the IMGT program (Table 1-3).
서열번호 1 (SR-23 VH CDR1) : GFTVSSNYMSSEQ ID NO: 1 (SR-23 VH CDR1): GFTVSSNYMS
서열번호 2 (SR-23 VH CDR2) : VIFAGGSTFYADSVKGSEQ ID NO: 2 (SR-23 VH CDR2): VIFAGGSTFYADSVKG
서열번호 3 (SR-23 VH CDR3) : EAILRGTFDSEQ ID NO: 3 (SR-23 VH CDR3): EAILRGTFD
서열번호 4 (SR-23 VL CDR1) : RASQSVSSNLASEQ ID NO: 4 (SR-23 VL CDR1): RASQSVSSNLA
서열번호 5 (SR-23 VL CDR2) : GASTRATSEQ ID NO: 5 (SR-23 VL CDR2): GASTRAT
서열번호 6 (SR-23 VL CDR3) : QQYNNWPPGYTSEQ ID NO: 6 (SR-23 VL CDR3): QQYNNWPPGYT
서열번호 7 (SR-23 VH) : SEQ ID NO: 7 (SR-23 VH):
EVQLVESGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIFAGGSTFYADSVKGRFTISRDNSKNTLFLQLNSLRAEDTAVYYCAREAILRGTFDWGQGTLVTVSSEVQLVESGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIFAGGSTFYADSVKGRFTISRDNSKNTLFLQLNSLRAEDTAVYYCAREAILRGTFDWGQGTLVTVSS
서열번호 8 (SR-23 VL) : SEQ ID NO: 8 (SR-23 VL):
EIVLTQSPVTLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPGYTFGQGTKLEIK EIVLTQSPVTLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPGYTFGQGTKLEIK
Clustal 0(1.2.4) multiple sequence alignment 프로그램 이용하여 항체(3종)의 아미노산 서열의 유사성을 비교함. 항체(3종)의 항원 결합 부위인 CDR의 서열 유사성이 매우 낮으며, CDR 규칙에 부합하는 것 확인함(도 1-2).Compare the similarity of amino acid sequences of antibodies (3 types) using the Clustal 0 (1.2.4) multiple sequence alignment program. The sequence similarity of the CDR, which is the antigen binding site of the antibodies (3 types), was very low, and it was confirmed that it complied with the CDR rules (Figure 1-2).
<실시예 2> 항체의 물리화학적 특성 분석<Example 2> Analysis of physicochemical properties of antibodies
크기 배제 크로마토그래피(Size Exclusion Chromatography, SEC-HPLC)를 통해 항체들의 순도를 분석하고, 비정상적인 파편 또는 응집 발생의 유무를 확인함(도 3). The purity of the antibodies was analyzed through size exclusion chromatography (SEC-HPLC), and the presence or absence of abnormal fragments or aggregation was confirmed (Figure 3).
항체(3종)이 93.84~98.48%로 monomer를 형성함을 확인하였으며, 안정적인 항체가 생산 및 정제됨을 확인함(표 4).It was confirmed that the antibodies (3 types) formed monomers at a rate of 93.84 to 98.48%, and it was confirmed that stable antibodies were produced and purified (Table 4).
<실시예 3> 항체의 CDR 3차 구조 분석<Example 3> CDR tertiary structure analysis of antibody
항체의 상보성결정지역(Complementarity Determining Region, CDR)은 가변영역 내에서 가장 변화가 큰 지역으로 실제 항원이 결합하는 부위임. Abymod 프로그램을 이용하여 CDR의 3차 구조를 분석함(도 4). The complementarity determining region (CDR) of an antibody is the region with the greatest change within the variable region and is the site where the actual antigen binds. The tertiary structure of CDR was analyzed using the Abymod program (Figure 4).
<실시예 4> 항원-항체의 친화도 분석<Example 4> Antigen-antibody affinity analysis
항체 분리 시 사용한 스파이크 단백질(S1)에 대한 항체의 결합력을 조사하기 위해 RBD 변이 단백질과 항체간의 결합력을 Octet 기기를 이용하여 확인함. 3종의 항체 kD가 0.3 nM~362 nM로 매우 강한 결합력을 보임(도 5, 표 5).To investigate the binding affinity of the antibody to the spike protein (S1) used for antibody isolation, the binding affinity between the RBD mutant protein and the antibody was confirmed using an Octet device. The three types of antibodies showed very strong binding affinity, with k D ranging from 0.3 nM to 362 nM (Figure 5, Table 5).
항체가 스파이크 단백질의 변이에 대해서 결합력 차이가 발생하는지 여부를 조사하기 위해 변이 항원(RBD)과 항체간의 결합력을 플라스몬 공명 기술(Surface Plasmon Resonance, SPR assay)를 이용하여 확인함.To investigate whether there is a difference in binding ability of antibodies to mutations in the spike protein, the binding affinity between the mutant antigen (RBD) and the antibody was confirmed using plasmon resonance technology (Surface Plasmon Resonance, SPR assay).
SR-23 항체는 알파, 베타, 감마, 델타, 오미크론(BA.2) RBD에 결합하며, SS1-24 항체는 알파, 베타, 감마, 델타에 결합하고, CS-42 항체는 모든 변이주에 결합함을 확인함. 항원(RBD)-항체 결합력(KD)은 0.26 pM~2.66 μM로 매우 강한 결합력으로 측정됨(도 6, 표 6).SR-23 antibody binds to alpha, beta, gamma, delta, and omicron (BA.2) RBD, SS1-24 antibody binds to alpha, beta, gamma, and delta, and CS-42 antibody binds to all mutant strains. Confirmed. Antigen (RBD)-antibody binding force (K D ) was measured to be very strong, ranging from 0.26 pM to 2.66 μM (Figure 6, Table 6).
같은 방법으로 변이 항원(S1)과 항체간의 결합력을 확인함. 결과는 변이항원(RBD)와 매우 유사하며, 항체 3종 모두 S1 도메인 중 RBD에 결합함을 확인함. 항원(S1)-항체 결합력(KD)은 0.08 pM~383 nM로 매우 강한 결합력으로 측정됨(도 7, 표 7).The binding force between the mutant antigen (S1) and the antibody was confirmed using the same method. The results are very similar to the variant antigen (RBD), and it was confirmed that all three antibodies bind to RBD in the S1 domain. Antigen (S1)-antibody binding force (K D ) was measured to be very strong, ranging from 0.08 pM to 383 nM (Figure 7, Table 7).
<실시예 5> 코로나19 변이 바이러스에 대한 중화능 평가<Example 5> Evaluation of neutralization ability for COVID-19 mutant virus
코로나19 바이러스에 대한 항체(5종)의 중화능을 확인하기 위해 플라크감소중화시험법(Plaque Reduction Neutralizing Test, PRNT)를 이용하여 IC50값(바이러스 감염력 50%의 저해능을 보이는 농도)를 측정함.To confirm the neutralizing ability of antibodies (5 types) against the COVID-19 virus, the IC50 value (concentration showing 50% inhibition of virus infectivity) was measured using the Plaque Reduction Neutralizing Test (PRNT).
SR-23, SS1-24 항체의 경우 야생형 S, GR type과 VBM(알파, 베타, 감마, 델타)에 중화효능 있으며, CS-42 항체의 경우 야생형(S, GR type), 알파, 베타, 감마 변이주 및 VOC 2종(오미크론)에 중화효능 있음(도 8, 표 8). In the case of SR-23 and SS1-24 antibodies, it has neutralizing effect on wild type S, GR type and VBM (alpha, beta, gamma, delta), and in the case of CS-42 antibody, it has neutralizing effect on wild type (S, GR type), alpha, beta, and gamma. Has neutralizing effect on mutant strain and 2 types of VOC (Omicron) (Figure 8, Table 8).
<실시예 6> 동물모델에서의 항체 치료능 평가<Example 6> Evaluation of antibody therapeutic activity in animal models
코로나19 바이러스에 대한 감수성 동물모델로 알려진 hACE2 형질전환 마우스를 이용하여 항체(2종)에 대해 코로나19 바이러스 3종에 대한 치료능을 평가함.Using hACE2 transgenic mice, which are known to be a sensitive animal model for the COVID-19 virus, the therapeutic ability of antibodies (2 types) against 3 types of COVID-19 virus was evaluated.
hACE2 마우스에 코로나19 바이러스를 비강 접종하였고, 8시간 뒤 항체를 복강 주사함. 14일간 체중 변화 및 생존률을 확인함.hACE2 mice were inoculated intranasally with the COVID-19 virus, and 8 hours later, antibodies were injected intraperitoneally. Weight change and survival rate were checked for 14 days.
GR 바이러스 감염된 마우스에 대해서 항체 비처리군(대조군)은 감염 직 후 체중이 감소하다가 9일 차에 0%(0/5)의 생존률을 보이나, 항체 투여군은 체중이 감소하다가 6일 차부터 회복하여 SR-23는 80%(4/5), CS-42는 100%(5/5)의 생존률을 확인함(도 9). For GR virus-infected mice, the antibody-untreated group (control group) lost weight immediately after infection and showed a survival rate of 0% (0/5) on the 9th day, but the antibody-treated group lost weight and recovered from the 6th day. SR-23 had a survival rate of 80% (4/5), and CS-42 had a survival rate of 100% (5/5) (Figure 9).
Delta 바이러스 감염된 마우스에 대해서 대조군은 감염 직 후 체중이 감소하다가 8일차에 0%(0/5)의 생존률을 보이나, 항체 투여군은 2종 모두 100%(5/5)의 생존률을 확인함(도 9). For Delta virus-infected mice, the control group lost weight immediately after infection and showed a survival rate of 0% (0/5) on the 8th day, but the antibody-administered group showed a survival rate of 100% (5/5) for both types (Figure 9).
Omicron(BA.2) 바이러스 감염된 마우스에 대해서 대조군은 40%(2/5)의 생존률을 보이나, 항체 투여 군은 2종 모두 100%(5/5)의 생존률을 확인하였고, 체중 감소 및 회복시 항체처리군에서 체종 감소가 적고 회복도 잘 되는 것을 확인함(도 9).For Omicron (BA.2) virus-infected mice, the control group showed a survival rate of 40% (2/5), but the antibody-administered group showed a survival rate of 100% (5/5) in both types, and the survival rate was 100% (5/5) during weight loss and recovery. It was confirmed that there was less body mass reduction and good recovery in the antibody-treated group (Figure 9).
마우스모델에서의 3종 바이러스(GR, Delta, Omicron(BA.2))에 대한 항체의 치료 효능을 확인함(도 9).The therapeutic efficacy of antibodies against three viruses (GR, Delta, and Omicron (BA.2)) was confirmed in a mouse model (Figure 9).
이상으로 본 발명 내용의 특정한 부분을 상세히 기술하였는바, 당업계의 통상의 지식을 가진 자에게 있어서, 이러한 구체적 기술은 단지 바람직한 실시 양태일 뿐이며, 이에 의해 본 발명의 범위가 제한되는 것이 아닌 점은 명백할 것이다. 따라서 본 발명의 실질적인 범위는 첨부된 청구항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.As the specific parts of the present invention have been described in detail above, it is clear to those skilled in the art that these specific techniques are merely preferred embodiments and do not limit the scope of the present invention. something to do. Accordingly, the actual scope of the present invention will be defined by the appended claims and their equivalents.
Claims (10)
서열번호 4의 경쇄 CDR1; 서열번호 5의 경쇄 CDR2; 및 서열번호 6의 경쇄 CDR3를 포함하는 경쇄 가변영역을 포함하는 사스 코로나바이러스 2 스파이크 항원에 특이적으로 결합하는 항체Heavy chain CDR1 of SEQ ID NO: 1; Heavy chain CDR2 of SEQ ID NO: 2; And a heavy chain variable region comprising the heavy chain CDR3 of SEQ ID NO: 3,
Light chain CDR1 of SEQ ID NO: 4; Light chain CDR2 of SEQ ID NO: 5; and an antibody that specifically binds to the SARS coronavirus 2 spike antigen comprising a light chain variable region including the light chain CDR3 of SEQ ID NO: 6.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020220137585A KR20240057515A (en) | 2022-10-24 | 2022-10-24 | Antibody for binding SARS coronavirus 2 spike antigen and uses thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020220137585A KR20240057515A (en) | 2022-10-24 | 2022-10-24 | Antibody for binding SARS coronavirus 2 spike antigen and uses thereof |
Publications (1)
Publication Number | Publication Date |
---|---|
KR20240057515A true KR20240057515A (en) | 2024-05-03 |
Family
ID=91077360
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020220137585A KR20240057515A (en) | 2022-10-24 | 2022-10-24 | Antibody for binding SARS coronavirus 2 spike antigen and uses thereof |
Country Status (1)
Country | Link |
---|---|
KR (1) | KR20240057515A (en) |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR102233689B1 (en) | 2020-11-26 | 2021-03-30 | 재단법인 오송첨단의료산업진흥재단 | Antibodies specifically binding to receptor-binding domain of SARS-CoV-2 spike protein and use thereof |
KR102351653B1 (en) | 2020-04-29 | 2022-01-14 | 한국화학연구원 | Diagonstic kits for SARS coronavirus 2 comprising the receptor and the antibody binding to SARS coronavirus 2 spike protein |
-
2022
- 2022-10-24 KR KR1020220137585A patent/KR20240057515A/en unknown
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR102351653B1 (en) | 2020-04-29 | 2022-01-14 | 한국화학연구원 | Diagonstic kits for SARS coronavirus 2 comprising the receptor and the antibody binding to SARS coronavirus 2 spike protein |
KR102233689B1 (en) | 2020-11-26 | 2021-03-30 | 재단법인 오송첨단의료산업진흥재단 | Antibodies specifically binding to receptor-binding domain of SARS-CoV-2 spike protein and use thereof |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
KR102205028B1 (en) | A binding molecules able to neutralize SARS-CoV-2 | |
JP5597128B2 (en) | H5 subtype-specific binding protein useful for diagnosis and monitoring of H5 avian influenza | |
KR102679351B1 (en) | Monoclonal antibody specific for phosphoprotein of human respiratory syncytial virus and method of use | |
KR101952332B1 (en) | Method for detecting microorganisms belonging to mycoplasma pneumoniae and/or mycoplasma genitalium | |
US11644465B2 (en) | Assays, sensing platforms, and methods for diagnosis of coronavirus infection and re-infection | |
CN112979795A (en) | Antibody combination product and application thereof in detection of new coronary pneumonia | |
JP3886518B2 (en) | Assays for detecting HCV receptor binding | |
WO2013043125A1 (en) | Enterovirus 71 specific antibodies and uses thereof | |
WO2021195385A1 (en) | HUMAN MONOCLONAL ANTIBODIES TO SEVERE ACUTE RESPIRATORY SYNDROME CORONAVIRUS 2 (SARS-GoV-2) | |
EP3406262B1 (en) | Monoclonal antibodies specific for the piii antigen of human adenovirus (adv), produced and secreted by cell hybridomas, useful for detection and diagnosis of adv infection | |
WO2023040026A1 (en) | Immunochromatographic detection reagent strip and kit comprising same, and applications of both | |
JPWO2019225639A1 (en) | Diagnosis of Helicobacter Swiss infection | |
CN113189333A (en) | Kit containing quantum dot immunofluorescence detection reagent strip and application of kit | |
CN116769021A (en) | Monoclonal antibody for Vp7 protein of African horse sickness virus and application | |
EP4365195A1 (en) | Antibody against nucleocapsid protein of sars-cov-2 | |
CN114935649B (en) | HPV virus detection kit | |
KR20240057515A (en) | Antibody for binding SARS coronavirus 2 spike antigen and uses thereof | |
KR20240057516A (en) | Antibody for binding SARS coronavirus 2 spike antigen and uses thereof | |
KR20240057517A (en) | Antibody for binding SARS coronavirus 2 spike antigen and uses thereof | |
CA3125206A1 (en) | Specific monoclonal antibodies for the hepatitis pb2 of the influenza humana (flu), nucleic acid sequences; method and kit of inprol produced by flu | |
CN112745387A (en) | Anti-porcine seneca valley virus monoclonal antibody and application thereof | |
KR102339334B1 (en) | Specific monoclonal antibodies of the antigen m of the human metapneumovirus (hmpv) and use thereof in a diagnostic method | |
WO2022102744A1 (en) | Antibody against spike protein of sars-cov-2 | |
CN112912394B (en) | Monoclonal antibodies directed against the N antigen of HRSV useful for the treatment of infections, detection and diagnosis thereof | |
EP4139491A2 (en) | Specificity enhancing reagents for covid-19 antibody testing |