KR20240015800A - The bispecific antibody and the conjugate that can cross the BBB to treat brain nervous disease - Google Patents
The bispecific antibody and the conjugate that can cross the BBB to treat brain nervous disease Download PDFInfo
- Publication number
- KR20240015800A KR20240015800A KR1020220093341A KR20220093341A KR20240015800A KR 20240015800 A KR20240015800 A KR 20240015800A KR 1020220093341 A KR1020220093341 A KR 1020220093341A KR 20220093341 A KR20220093341 A KR 20220093341A KR 20240015800 A KR20240015800 A KR 20240015800A
- Authority
- KR
- South Korea
- Prior art keywords
- seq
- amino acid
- acid sequence
- sequence shown
- antibody
- Prior art date
Links
- 210000004556 brain Anatomy 0.000 title claims abstract description 27
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 title claims abstract description 17
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 99
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 97
- 230000008499 blood brain barrier function Effects 0.000 claims abstract description 78
- 210000001218 blood-brain barrier Anatomy 0.000 claims abstract description 71
- 210000003289 regulatory T cell Anatomy 0.000 claims abstract description 53
- 239000012634 fragment Substances 0.000 claims abstract description 48
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 46
- 102000005962 receptors Human genes 0.000 claims abstract description 30
- 108020003175 receptors Proteins 0.000 claims abstract description 30
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 claims abstract description 19
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 claims abstract description 19
- 208000012902 Nervous system disease Diseases 0.000 claims abstract description 19
- 102000016844 Immunoglobulin-like domains Human genes 0.000 claims abstract description 18
- 108050006430 Immunoglobulin-like domains Proteins 0.000 claims abstract description 18
- 101710184277 Insulin-like growth factor 1 receptor Proteins 0.000 claims description 77
- 102100039688 Insulin-like growth factor 1 receptor Human genes 0.000 claims description 77
- 239000000427 antigen Substances 0.000 claims description 63
- 108091007433 antigens Proteins 0.000 claims description 63
- 102000036639 antigens Human genes 0.000 claims description 63
- 150000001413 amino acids Chemical group 0.000 claims description 54
- 239000008194 pharmaceutical composition Substances 0.000 claims description 22
- 206010012289 Dementia Diseases 0.000 claims description 11
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 11
- 208000036110 Neuroinflammatory disease Diseases 0.000 claims description 9
- 230000004770 neurodegeneration Effects 0.000 claims description 9
- 208000015122 neurodegenerative disease Diseases 0.000 claims description 9
- 208000024827 Alzheimer disease Diseases 0.000 claims description 8
- 208000024777 Prion disease Diseases 0.000 claims description 7
- 102000004584 Somatomedin Receptors Human genes 0.000 claims description 7
- 108010017622 Somatomedin Receptors Proteins 0.000 claims description 7
- 208000018737 Parkinson disease Diseases 0.000 claims description 6
- 208000006011 Stroke Diseases 0.000 claims description 6
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 claims description 6
- 208000020431 spinal cord injury Diseases 0.000 claims description 6
- 102000014461 Ataxins Human genes 0.000 claims description 5
- 108010078286 Ataxins Proteins 0.000 claims description 5
- 206010008025 Cerebellar ataxia Diseases 0.000 claims description 5
- 208000011990 Corticobasal Degeneration Diseases 0.000 claims description 5
- 208000020406 Creutzfeldt Jacob disease Diseases 0.000 claims description 5
- 208000003407 Creutzfeldt-Jakob Syndrome Diseases 0.000 claims description 5
- 208000010859 Creutzfeldt-Jakob disease Diseases 0.000 claims description 5
- 201000011240 Frontotemporal dementia Diseases 0.000 claims description 5
- 208000023105 Huntington disease Diseases 0.000 claims description 5
- 206010065390 Inflammatory pain Diseases 0.000 claims description 5
- 208000001089 Multiple system atrophy Diseases 0.000 claims description 5
- 208000014060 Niemann-Pick disease Diseases 0.000 claims description 5
- 208000009415 Spinocerebellar Ataxias Diseases 0.000 claims description 5
- 208000034799 Tauopathies Diseases 0.000 claims description 5
- 206010002026 amyotrophic lateral sclerosis Diseases 0.000 claims description 5
- 201000004562 autosomal dominant cerebellar ataxia Diseases 0.000 claims description 5
- 208000026106 cerebrovascular disease Diseases 0.000 claims description 5
- 230000002757 inflammatory effect Effects 0.000 claims description 5
- 201000006417 multiple sclerosis Diseases 0.000 claims description 5
- 208000004296 neuralgia Diseases 0.000 claims description 5
- 208000021722 neuropathic pain Diseases 0.000 claims description 5
- 208000012111 paraneoplastic syndrome Diseases 0.000 claims description 5
- 108010064942 Angiopep-2 Proteins 0.000 claims description 4
- 108010027006 Apolipoproteins B Proteins 0.000 claims description 4
- 102000018616 Apolipoproteins B Human genes 0.000 claims description 4
- 102000013918 Apolipoproteins E Human genes 0.000 claims description 4
- 108010025628 Apolipoproteins E Proteins 0.000 claims description 4
- 208000023345 Autoimmune Diseases of the Nervous System Diseases 0.000 claims description 4
- 102000003746 Insulin Receptor Human genes 0.000 claims description 4
- 108010001127 Insulin Receptor Proteins 0.000 claims description 4
- 206010033799 Paralysis Diseases 0.000 claims description 4
- 108010045108 Receptor for Advanced Glycation End Products Proteins 0.000 claims description 4
- 102000005622 Receptor for Advanced Glycation End Products Human genes 0.000 claims description 4
- 108010033576 Transferrin Receptors Proteins 0.000 claims description 4
- 102000007238 Transferrin Receptors Human genes 0.000 claims description 4
- 230000000750 progressive effect Effects 0.000 claims description 4
- 101710126338 Apamin Proteins 0.000 claims description 3
- 108010045489 Calcium-Activated Potassium Channels Proteins 0.000 claims description 3
- 102000005702 Calcium-Activated Potassium Channels Human genes 0.000 claims description 3
- 102000016267 Leptin Human genes 0.000 claims description 3
- 108010092277 Leptin Proteins 0.000 claims description 3
- 102100031775 Leptin receptor Human genes 0.000 claims description 3
- 108010015340 Low Density Lipoprotein Receptor-Related Protein-1 Proteins 0.000 claims description 3
- 108050006807 Nicotinic acetylcholine receptors Proteins 0.000 claims description 3
- 102000019315 Nicotinic acetylcholine receptors Human genes 0.000 claims description 3
- 102100021923 Prolow-density lipoprotein receptor-related protein 1 Human genes 0.000 claims description 3
- 229960003180 glutathione Drugs 0.000 claims description 3
- 108010062890 glutathione transporter Proteins 0.000 claims description 3
- 239000003102 growth factor Substances 0.000 claims description 3
- NRYBAZVQPHGZNS-ZSOCWYAHSA-N leptin Chemical compound O=C([C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC(C)C)CCSC)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CS)C(O)=O NRYBAZVQPHGZNS-ZSOCWYAHSA-N 0.000 claims description 3
- 229940039781 leptin Drugs 0.000 claims description 3
- 108010019813 leptin receptors Proteins 0.000 claims description 3
- YVIIHEKJCKCXOB-STYWVVQQSA-N molport-023-276-178 Chemical compound C([C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CSSC[C@H]2C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N3CCC[C@H]3C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@H](C(N[C@@H](CSSC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N2)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1)=O)CC(C)C)[C@@H](C)O)C(N)=O)C1=CNC=N1 YVIIHEKJCKCXOB-STYWVVQQSA-N 0.000 claims description 3
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 claims description 2
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 claims description 2
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 claims description 2
- 101710172064 Low-density lipoprotein receptor-related protein Proteins 0.000 claims description 2
- 230000010005 growth-factor like effect Effects 0.000 claims description 2
- 229920000669 heparin Polymers 0.000 claims description 2
- 229960002897 heparin Drugs 0.000 claims description 2
- 238000011282 treatment Methods 0.000 abstract description 14
- 201000010099 disease Diseases 0.000 abstract description 11
- 230000000694 effects Effects 0.000 abstract description 11
- 208000014644 Brain disease Diseases 0.000 abstract description 10
- 230000001965 increasing effect Effects 0.000 abstract description 7
- 210000004369 blood Anatomy 0.000 abstract description 5
- 239000008280 blood Substances 0.000 abstract description 5
- 238000001727 in vivo Methods 0.000 abstract 1
- 230000001766 physiological effect Effects 0.000 abstract 1
- 235000018102 proteins Nutrition 0.000 description 80
- 125000003275 alpha amino acid group Chemical group 0.000 description 54
- 210000004027 cell Anatomy 0.000 description 44
- 230000014509 gene expression Effects 0.000 description 26
- 241000699670 Mus sp. Species 0.000 description 19
- 235000001014 amino acid Nutrition 0.000 description 18
- 125000000539 amino acid group Chemical group 0.000 description 18
- 229940024606 amino acid Drugs 0.000 description 17
- 239000000203 mixture Substances 0.000 description 16
- 235000005772 leucine Nutrition 0.000 description 14
- 239000000126 substance Substances 0.000 description 14
- 241000699666 Mus <mouse, genus> Species 0.000 description 13
- 238000000034 method Methods 0.000 description 13
- 238000002474 experimental method Methods 0.000 description 12
- 238000011818 5xFAD mouse Methods 0.000 description 11
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 11
- 210000001744 T-lymphocyte Anatomy 0.000 description 10
- 108060003951 Immunoglobulin Proteins 0.000 description 9
- 102000018358 immunoglobulin Human genes 0.000 description 9
- 108020004999 messenger RNA Proteins 0.000 description 9
- 235000013305 food Nutrition 0.000 description 8
- 239000003446 ligand Substances 0.000 description 8
- 229920001184 polypeptide Polymers 0.000 description 8
- 238000002360 preparation method Methods 0.000 description 8
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 7
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 7
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 7
- 230000006240 deamidation Effects 0.000 description 7
- 230000011664 signaling Effects 0.000 description 7
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 6
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 6
- 230000000890 antigenic effect Effects 0.000 description 6
- 239000002775 capsule Substances 0.000 description 6
- 239000003814 drug Substances 0.000 description 6
- 239000000796 flavoring agent Substances 0.000 description 6
- 230000015654 memory Effects 0.000 description 6
- 230000035772 mutation Effects 0.000 description 6
- 230000001105 regulatory effect Effects 0.000 description 6
- 230000002269 spontaneous effect Effects 0.000 description 6
- 238000006467 substitution reaction Methods 0.000 description 6
- 230000031998 transcytosis Effects 0.000 description 6
- 101001034652 Homo sapiens Insulin-like growth factor 1 receptor Proteins 0.000 description 5
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 5
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 5
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 description 5
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 5
- 241000700159 Rattus Species 0.000 description 5
- 230000009824 affinity maturation Effects 0.000 description 5
- 235000004279 alanine Nutrition 0.000 description 5
- 230000004888 barrier function Effects 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 210000002889 endothelial cell Anatomy 0.000 description 5
- 235000013355 food flavoring agent Nutrition 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 102000045648 human IGF1R Human genes 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 238000004519 manufacturing process Methods 0.000 description 5
- 210000005036 nerve Anatomy 0.000 description 5
- 108010054624 red fluorescent protein Proteins 0.000 description 5
- 230000002441 reversible effect Effects 0.000 description 5
- 239000004475 Arginine Substances 0.000 description 4
- 239000004471 Glycine Substances 0.000 description 4
- 101000619640 Homo sapiens Leucine-rich repeats and immunoglobulin-like domains protein 1 Proteins 0.000 description 4
- 125000003412 L-alanyl group Chemical group [H]N([H])[C@@](C([H])([H])[H])(C(=O)[*])[H] 0.000 description 4
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 4
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 4
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 4
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 4
- 102100022170 Leucine-rich repeats and immunoglobulin-like domains protein 1 Human genes 0.000 description 4
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 4
- 239000004472 Lysine Substances 0.000 description 4
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 4
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 4
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 4
- 239000004480 active ingredient Substances 0.000 description 4
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 4
- 238000002869 basic local alignment search tool Methods 0.000 description 4
- 235000013361 beverage Nutrition 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 239000003937 drug carrier Substances 0.000 description 4
- -1 for example Proteins 0.000 description 4
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 4
- 230000028993 immune response Effects 0.000 description 4
- 210000002602 induced regulatory T cell Anatomy 0.000 description 4
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 4
- 230000001404 mediated effect Effects 0.000 description 4
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 4
- 239000003755 preservative agent Substances 0.000 description 4
- 239000003826 tablet Substances 0.000 description 4
- 238000012360 testing method Methods 0.000 description 4
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 4
- 108010090849 Amyloid beta-Peptides Proteins 0.000 description 3
- 102000013455 Amyloid beta-Peptides Human genes 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- 108091092584 GDNA Proteins 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical group OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 3
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 3
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 3
- 108010006444 Leucine-Rich Repeat Proteins Proteins 0.000 description 3
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 3
- 230000009471 action Effects 0.000 description 3
- 230000004075 alteration Effects 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 210000002469 basement membrane Anatomy 0.000 description 3
- 230000000975 bioactive effect Effects 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 238000012790 confirmation Methods 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 230000004069 differentiation Effects 0.000 description 3
- 230000009977 dual effect Effects 0.000 description 3
- 229940088598 enzyme Drugs 0.000 description 3
- 108020001507 fusion proteins Proteins 0.000 description 3
- 102000037865 fusion proteins Human genes 0.000 description 3
- 239000008187 granular material Substances 0.000 description 3
- 230000002209 hydrophobic effect Effects 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 210000004901 leucine-rich repeat Anatomy 0.000 description 3
- 239000000314 lubricant Substances 0.000 description 3
- 210000004379 membrane Anatomy 0.000 description 3
- 210000002569 neuron Anatomy 0.000 description 3
- 238000011302 passive avoidance test Methods 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 230000002265 prevention Effects 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 238000003753 real-time PCR Methods 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 210000000952 spleen Anatomy 0.000 description 3
- 239000003381 stabilizer Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 230000032258 transport Effects 0.000 description 3
- JWDFQMWEFLOOED-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(pyridin-2-yldisulfanyl)propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCSSC1=CC=CC=N1 JWDFQMWEFLOOED-UHFFFAOYSA-N 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 230000007082 Aβ accumulation Effects 0.000 description 2
- 108010069514 Cyclic Peptides Proteins 0.000 description 2
- 102000001189 Cyclic Peptides Human genes 0.000 description 2
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 2
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 2
- 239000004386 Erythritol Substances 0.000 description 2
- UNXHWFMMPAWVPI-UHFFFAOYSA-N Erythritol Natural products OCC(O)C(O)CO UNXHWFMMPAWVPI-UHFFFAOYSA-N 0.000 description 2
- 102100027581 Forkhead box protein P3 Human genes 0.000 description 2
- 108010072051 Glatiramer Acetate Proteins 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 2
- 102000009465 Growth Factor Receptors Human genes 0.000 description 2
- 108010009202 Growth Factor Receptors Proteins 0.000 description 2
- 101000861452 Homo sapiens Forkhead box protein P3 Proteins 0.000 description 2
- 102000004877 Insulin Human genes 0.000 description 2
- 108090001061 Insulin Proteins 0.000 description 2
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 2
- 102000004218 Insulin-Like Growth Factor I Human genes 0.000 description 2
- 102000048143 Insulin-Like Growth Factor II Human genes 0.000 description 2
- 108090001117 Insulin-Like Growth Factor II Proteins 0.000 description 2
- 125000000570 L-alpha-aspartyl group Chemical group [H]OC(=O)C([H])([H])[C@]([H])(N([H])[H])C(*)=O 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- 125000003440 L-leucyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C(C([H])([H])[H])([H])C([H])([H])[H] 0.000 description 2
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- 125000002842 L-seryl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])O[H] 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 108010001831 LDL receptors Proteins 0.000 description 2
- 102000000853 LDL receptors Human genes 0.000 description 2
- 102100040705 Low-density lipoprotein receptor-related protein 8 Human genes 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 2
- 102100030742 Transforming growth factor beta-1 proprotein Human genes 0.000 description 2
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 2
- NIXOWILDQLNWCW-UHFFFAOYSA-N acrylic acid group Chemical group C(C=C)(=O)O NIXOWILDQLNWCW-UHFFFAOYSA-N 0.000 description 2
- 235000010443 alginic acid Nutrition 0.000 description 2
- 229920000615 alginic acid Polymers 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 2
- 102000025171 antigen binding proteins Human genes 0.000 description 2
- 108091000831 antigen binding proteins Proteins 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 239000002585 base Substances 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 230000003542 behavioural effect Effects 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 210000003169 central nervous system Anatomy 0.000 description 2
- 239000003086 colorant Substances 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 238000000354 decomposition reaction Methods 0.000 description 2
- 239000002552 dosage form Substances 0.000 description 2
- UNXHWFMMPAWVPI-ZXZARUISSA-N erythritol Chemical compound OC[C@H](O)[C@H](O)CO UNXHWFMMPAWVPI-ZXZARUISSA-N 0.000 description 2
- 235000019414 erythritol Nutrition 0.000 description 2
- 229940009714 erythritol Drugs 0.000 description 2
- 239000012091 fetal bovine serum Substances 0.000 description 2
- 229930195712 glutamate Natural products 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 229940125396 insulin Drugs 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000007913 intrathecal administration Methods 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 108010031117 low density lipoprotein receptor-related protein 8 Proteins 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 230000014759 maintenance of location Effects 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 210000000274 microglia Anatomy 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 235000015097 nutrients Nutrition 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 230000002093 peripheral effect Effects 0.000 description 2
- HELXLJCILKEWJH-NCGAPWICSA-N rebaudioside A Chemical compound O([C@H]1[C@H](O)[C@@H](CO)O[C@H]([C@@H]1O[C@H]1[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O1)O)O[C@]12C(=C)C[C@@]3(C1)CC[C@@H]1[C@@](C)(CCC[C@]1([C@@H]3CC2)C)C(=O)O[C@H]1[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O1)O)[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O HELXLJCILKEWJH-NCGAPWICSA-N 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 239000000600 sorbitol Substances 0.000 description 2
- 235000010356 sorbitol Nutrition 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 239000006188 syrup Substances 0.000 description 2
- 235000020357 syrup Nutrition 0.000 description 2
- 230000001988 toxicity Effects 0.000 description 2
- 231100000419 toxicity Toxicity 0.000 description 2
- 239000003053 toxin Substances 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 235000013343 vitamin Nutrition 0.000 description 2
- 239000011782 vitamin Substances 0.000 description 2
- 229940088594 vitamin Drugs 0.000 description 2
- 229930003231 vitamin Natural products 0.000 description 2
- 239000000811 xylitol Substances 0.000 description 2
- 235000010447 xylitol Nutrition 0.000 description 2
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 2
- 229960002675 xylitol Drugs 0.000 description 2
- ZZMSDLWVAMNVOD-JTQLQIEISA-N (2s)-1-phenylpyrrolidine-2-carboxylic acid Chemical compound OC(=O)[C@@H]1CCCN1C1=CC=CC=C1 ZZMSDLWVAMNVOD-JTQLQIEISA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- PECYZEOJVXMISF-REOHCLBHSA-N 3-amino-L-alanine Chemical compound [NH3+]C[C@H](N)C([O-])=O PECYZEOJVXMISF-REOHCLBHSA-N 0.000 description 1
- PECYZEOJVXMISF-UHFFFAOYSA-N 3-aminoalanine Chemical compound [NH3+]CC(N)C([O-])=O PECYZEOJVXMISF-UHFFFAOYSA-N 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- 244000215068 Acacia senegal Species 0.000 description 1
- 235000006491 Acacia senegal Nutrition 0.000 description 1
- 102100030374 Actin, cytoplasmic 2 Human genes 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 108010011485 Aspartame Proteins 0.000 description 1
- 206010003694 Atrophy Diseases 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 108091007381 CBL proteins Proteins 0.000 description 1
- 101100476210 Caenorhabditis elegans rnt-1 gene Proteins 0.000 description 1
- 102000004091 Caspase-8 Human genes 0.000 description 1
- 108090000538 Caspase-8 Proteins 0.000 description 1
- 102000011727 Caspases Human genes 0.000 description 1
- 108010076667 Caspases Proteins 0.000 description 1
- PTHCMJGKKRQCBF-UHFFFAOYSA-N Cellulose, microcrystalline Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC)C(CO)O1 PTHCMJGKKRQCBF-UHFFFAOYSA-N 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 208000005145 Cerebral amyloid angiopathy Diseases 0.000 description 1
- 208000019736 Cranial nerve disease Diseases 0.000 description 1
- 208000037845 Cutaneous squamous cell carcinoma Diseases 0.000 description 1
- 229920000858 Cyclodextrin Polymers 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- 229920001353 Dextrin Polymers 0.000 description 1
- 239000004375 Dextrin Substances 0.000 description 1
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 1
- 239000001512 FEMA 4601 Substances 0.000 description 1
- 229930091371 Fructose Natural products 0.000 description 1
- 239000005715 Fructose Substances 0.000 description 1
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 239000004378 Glycyrrhizin Substances 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- 101000773237 Homo sapiens Actin, cytoplasmic 2 Proteins 0.000 description 1
- 101100455496 Homo sapiens LRIG1 gene Proteins 0.000 description 1
- 101001038321 Homo sapiens Leucine-rich repeat protein 1 Proteins 0.000 description 1
- 101000619642 Homo sapiens Leucine-rich repeats and immunoglobulin-like domains protein 2 Proteins 0.000 description 1
- 101001017855 Homo sapiens Leucine-rich repeats and immunoglobulin-like domains protein 3 Proteins 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 102000018251 Hypoxanthine Phosphoribosyltransferase Human genes 0.000 description 1
- 108010091358 Hypoxanthine Phosphoribosyltransferase Proteins 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 241000712431 Influenza A virus Species 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 102220618489 Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial_N54Q_mutation Human genes 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- 125000003338 L-glutaminyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C([H])([H])C(=O)N([H])[H] 0.000 description 1
- 125000001176 L-lysyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C([H])([H])C([H])([H])C([H])([H])C(N([H])[H])([H])[H] 0.000 description 1
- 125000000769 L-threonyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])[C@](O[H])(C([H])([H])[H])[H] 0.000 description 1
- 125000003798 L-tyrosyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C([H])([H])C1=C([H])C([H])=C(O[H])C([H])=C1[H] 0.000 description 1
- 125000003580 L-valyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(C([H])([H])[H])(C([H])([H])[H])[H] 0.000 description 1
- 101150032178 LRIG1 gene Proteins 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 101150030213 Lag3 gene Proteins 0.000 description 1
- 102100040249 Leucine-rich repeat protein 1 Human genes 0.000 description 1
- 102100022173 Leucine-rich repeats and immunoglobulin-like domains protein 2 Human genes 0.000 description 1
- 102100033284 Leucine-rich repeats and immunoglobulin-like domains protein 3 Human genes 0.000 description 1
- 208000009829 Lewy Body Disease Diseases 0.000 description 1
- 201000002832 Lewy body dementia Diseases 0.000 description 1
- 102000011965 Lipoprotein Receptors Human genes 0.000 description 1
- 108010061306 Lipoprotein Receptors Proteins 0.000 description 1
- 102000043136 MAP kinase family Human genes 0.000 description 1
- 108091054455 MAP kinase family Proteins 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 101100340618 Mus musculus Igf1r gene Proteins 0.000 description 1
- 201000002481 Myositis Diseases 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 229920002230 Pectic acid Polymers 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 1
- 102220620245 Pituitary-specific positive transcription factor 1_N51D_mutation Human genes 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102000055251 Proto-Oncogene Proteins c-cbl Human genes 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 101100340620 Rattus norvegicus Igf1r gene Proteins 0.000 description 1
- HELXLJCILKEWJH-SEAGSNCFSA-N Rebaudioside A Natural products O=C(O[C@H]1[C@@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1)[C@@]1(C)[C@@H]2[C@](C)([C@H]3[C@@]4(CC(=C)[C@@](O[C@H]5[C@H](O[C@H]6[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O6)[C@@H](O[C@H]6[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O6)[C@H](O)[C@@H](CO)O5)(C4)CC3)CC2)CCC1 HELXLJCILKEWJH-SEAGSNCFSA-N 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 244000061458 Solanum melongena Species 0.000 description 1
- 235000002597 Solanum melongena Nutrition 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 244000228451 Stevia rebaudiana Species 0.000 description 1
- 210000000662 T-lymphocyte subset Anatomy 0.000 description 1
- 210000000447 Th1 cell Anatomy 0.000 description 1
- 210000000068 Th17 cell Anatomy 0.000 description 1
- 210000004241 Th2 cell Anatomy 0.000 description 1
- 244000269722 Thea sinensis Species 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- FHEAIOHRHQGZPC-KIWGSFCNSA-N acetic acid;(2s)-2-amino-3-(4-hydroxyphenyl)propanoic acid;(2s)-2-aminopentanedioic acid;(2s)-2-aminopropanoic acid;(2s)-2,6-diaminohexanoic acid Chemical compound CC(O)=O.C[C@H](N)C(O)=O.NCCCC[C@H](N)C(O)=O.OC(=O)[C@@H](N)CCC(O)=O.OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 FHEAIOHRHQGZPC-KIWGSFCNSA-N 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 108010064539 amyloid beta-protein (1-42) Proteins 0.000 description 1
- 229940035676 analgesics Drugs 0.000 description 1
- 239000000730 antalgic agent Substances 0.000 description 1
- 239000003146 anticoagulant agent Substances 0.000 description 1
- 229940127219 anticoagulant drug Drugs 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 239000007900 aqueous suspension Substances 0.000 description 1
- 239000000605 aspartame Substances 0.000 description 1
- 235000010357 aspartame Nutrition 0.000 description 1
- IAOZJIPTCAWIRG-QWRGUYRKSA-N aspartame Chemical compound OC(=O)C[C@H](N)C(=O)N[C@H](C(=O)OC)CC1=CC=CC=C1 IAOZJIPTCAWIRG-QWRGUYRKSA-N 0.000 description 1
- 229960003438 aspartame Drugs 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 210000001130 astrocyte Anatomy 0.000 description 1
- 230000037444 atrophy Effects 0.000 description 1
- 230000003935 attention Effects 0.000 description 1
- 208000035362 autoimmune disorder of the nervous system Diseases 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 210000000270 basal cell Anatomy 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 235000008429 bread Nutrition 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 238000010805 cDNA synthesis kit Methods 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 239000000378 calcium silicate Substances 0.000 description 1
- 229910052918 calcium silicate Inorganic materials 0.000 description 1
- 235000012241 calcium silicate Nutrition 0.000 description 1
- OYACROKNLOSFPA-UHFFFAOYSA-N calcium;dioxido(oxo)silane Chemical compound [Ca+2].[O-][Si]([O-])=O OYACROKNLOSFPA-UHFFFAOYSA-N 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 235000014171 carbonated beverage Nutrition 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 238000002659 cell therapy Methods 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 238000010382 chemical cross-linking Methods 0.000 description 1
- 238000004182 chemical digestion Methods 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 230000003930 cognitive ability Effects 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 210000002808 connective tissue Anatomy 0.000 description 1
- 229940038717 copaxone Drugs 0.000 description 1
- 238000002425 crystallisation Methods 0.000 description 1
- 230000008025 crystallization Effects 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 210000005220 cytoplasmic tail Anatomy 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 230000003412 degenerative effect Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 239000003405 delayed action preparation Substances 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 230000006866 deterioration Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 235000019425 dextrin Nutrition 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- 238000000375 direct analysis in real time Methods 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 208000037765 diseases and disorders Diseases 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 239000008298 dragée Substances 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 239000013583 drug formulation Substances 0.000 description 1
- 238000012063 dual-affinity re-targeting Methods 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 230000002996 emotional effect Effects 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- HELXLJCILKEWJH-UHFFFAOYSA-N entered according to Sigma 01432 Natural products C1CC2C3(C)CCCC(C)(C(=O)OC4C(C(O)C(O)C(CO)O4)O)C3CCC2(C2)CC(=C)C21OC(C1OC2C(C(O)C(O)C(CO)O2)O)OC(CO)C(O)C1OC1OC(CO)C(O)C(O)C1O HELXLJCILKEWJH-UHFFFAOYSA-N 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 238000013401 experimental design Methods 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 235000019634 flavors Nutrition 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 239000003205 fragrance Substances 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 229960003776 glatiramer acetate Drugs 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 235000011187 glycerol Nutrition 0.000 description 1
- LPLVUJXQOOQHMX-UHFFFAOYSA-N glycyrrhetinic acid glycoside Natural products C1CC(C2C(C3(CCC4(C)CCC(C)(CC4C3=CC2=O)C(O)=O)C)(C)CC2)(C)C2C(C)(C)C1OC1OC(C(O)=O)C(O)C(O)C1OC1OC(C(O)=O)C(O)C(O)C1O LPLVUJXQOOQHMX-UHFFFAOYSA-N 0.000 description 1
- 229960004949 glycyrrhizic acid Drugs 0.000 description 1
- UYRUBYNTXSDKQT-UHFFFAOYSA-N glycyrrhizic acid Natural products CC1(C)C(CCC2(C)C1CCC3(C)C2C(=O)C=C4C5CC(C)(CCC5(C)CCC34C)C(=O)O)OC6OC(C(O)C(O)C6OC7OC(O)C(O)C(O)C7C(=O)O)C(=O)O UYRUBYNTXSDKQT-UHFFFAOYSA-N 0.000 description 1
- 235000019410 glycyrrhizin Nutrition 0.000 description 1
- LPLVUJXQOOQHMX-QWBHMCJMSA-N glycyrrhizinic acid Chemical compound O([C@@H]1[C@@H](O)[C@H](O)[C@H](O[C@@H]1O[C@@H]1C([C@H]2[C@]([C@@H]3[C@@]([C@@]4(CC[C@@]5(C)CC[C@@](C)(C[C@H]5C4=CC3=O)C(O)=O)C)(C)CC2)(C)CC1)(C)C)C(O)=O)[C@@H]1O[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@H]1O LPLVUJXQOOQHMX-QWBHMCJMSA-N 0.000 description 1
- 210000000442 hair follicle cell Anatomy 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 230000013632 homeostatic process Effects 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 229940127121 immunoconjugate Drugs 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000007919 intrasynovial administration Methods 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 150000002614 leucines Chemical class 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 230000002025 microglial effect Effects 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 235000010755 mineral Nutrition 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 239000003068 molecular probe Substances 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- COCAUCFPFHUGAA-MGNBDDOMSA-N n-[3-[(1s,7s)-5-amino-4-thia-6-azabicyclo[5.1.0]oct-5-en-7-yl]-4-fluorophenyl]-5-chloropyridine-2-carboxamide Chemical compound C=1C=C(F)C([C@@]23N=C(SCC[C@@H]2C3)N)=CC=1NC(=O)C1=CC=C(Cl)C=N1 COCAUCFPFHUGAA-MGNBDDOMSA-N 0.000 description 1
- 210000002501 natural regulatory T cell Anatomy 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 230000037311 normal skin Effects 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 239000006186 oral dosage form Substances 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000009057 passive transport Effects 0.000 description 1
- LCLHHZYHLXDRQG-ZNKJPWOQSA-N pectic acid Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)O[C@H](C(O)=O)[C@@H]1OC1[C@H](O)[C@@H](O)[C@@H](OC2[C@@H]([C@@H](O)[C@@H](O)[C@H](O2)C(O)=O)O)[C@@H](C(O)=O)O1 LCLHHZYHLXDRQG-ZNKJPWOQSA-N 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 210000003668 pericyte Anatomy 0.000 description 1
- 238000011458 pharmacological treatment Methods 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 239000011574 phosphorus Substances 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 239000000419 plant extract Substances 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 239000010318 polygalacturonic acid Substances 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 150000004804 polysaccharides Chemical class 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 238000003825 pressing Methods 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 238000011165 process development Methods 0.000 description 1
- 201000002212 progressive supranuclear palsy Diseases 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 235000019203 rebaudioside A Nutrition 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- 102200050406 rs121918361 Human genes 0.000 description 1
- 235000019204 saccharin Nutrition 0.000 description 1
- CVHZOJJKTDOEJC-UHFFFAOYSA-N saccharin Chemical compound C1=CC=C2C(=O)NS(=O)(=O)C2=C1 CVHZOJJKTDOEJC-UHFFFAOYSA-N 0.000 description 1
- 229940081974 saccharin Drugs 0.000 description 1
- 239000000901 saccharin and its Na,K and Ca salt Substances 0.000 description 1
- HFHDHCJBZVLPGP-UHFFFAOYSA-N schardinger α-dextrin Chemical compound O1C(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(O)C2O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC2C(O)C(O)C1OC2CO HFHDHCJBZVLPGP-UHFFFAOYSA-N 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 230000029091 signal transduction by phosphorylation Effects 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 201000010106 skin squamous cell carcinoma Diseases 0.000 description 1
- 239000002002 slurry Substances 0.000 description 1
- 235000011888 snacks Nutrition 0.000 description 1
- 229960002920 sorbitol Drugs 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 238000012916 structural analysis Methods 0.000 description 1
- 150000005846 sugar alcohols Chemical class 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 230000001839 systemic circulation Effects 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 102000013498 tau Proteins Human genes 0.000 description 1
- 108010026424 tau Proteins Proteins 0.000 description 1
- 239000000892 thaumatin Substances 0.000 description 1
- 235000010436 thaumatin Nutrition 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 210000001578 tight junction Anatomy 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 230000034512 ubiquitination Effects 0.000 description 1
- 238000010798 ubiquitination Methods 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 238000012795 verification Methods 0.000 description 1
- 150000003722 vitamin derivatives Chemical class 0.000 description 1
- 235000012431 wafers Nutrition 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Neurology (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Neurosurgery (AREA)
- Genetics & Genomics (AREA)
- Hospice & Palliative Care (AREA)
- Psychiatry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Peptides Or Proteins (AREA)
Abstract
본 발명은 혈관뇌장벽(brood-brain barrier, BBB)을 효과적으로 통과하여 뇌신경계 질환을 예방 또는 치료할 수 있는 이중특이적 항체 또는 항체와 펩타이드의 결합체에 관한 것이다.
본 발명에서 제공하는 조절 T 세포(regulatory T cells, Treg cells)에 존재하는 Lrig-1(leucine-rich and immunoglobulin-like domains 1) 단백질에 특이적으로 결합하는 결합 분자와 혈액-뇌 장벽 수용체 항체(blood-brain barrier receptor antibody)의 이중 특이적 항체를 통하여 혈액뇌장벽(BBB)를 효과적으로 통과하여 뇌신경계 질환을 효과적으로 예방 또는 치료할 수 있다.
또한 조절 T 세포(regulatory T cells, Treg cells)에 존재하는 Lrig-1(leucine-rich and immunoglobulin-like domains 1) 단백질에 특이적으로 결합하는 결합 분자 또는 이의 결합 단편; 및 펩타이드를 포함하는, Lrig-1 단백질에 특이적으로 결합하는 결합 분자와 펩타이드의 결합체를 통하여 혈액뇌장벽(BBB)를 효과적으로 통과하여 뇌신경계 질환을 효과적으로 예방 또는 치료할 수 있다.
본 발명의 이중특이적 항체와 결합체는 생체 내에서 뇌혈관 장벽을 통과하고, 생리활성을 유지하고, 혈중 반감기가 현저히 증가되는 효과가 있다. 상기 이중특이적 항체와 결합체는 안정성 역시 개선되어, 뇌 관련 질환의 치료제로 이용될 수 있다. The present invention relates to a bispecific antibody or a conjugate of an antibody and a peptide that can effectively pass through the blood-brain barrier (BBB) and prevent or treat cranial nervous system diseases.
A binding molecule that specifically binds to the Lrig-1 (leucine-rich and immunoglobulin-like domains 1) protein present in regulatory T cells (Treg cells) provided by the present invention and a blood-brain barrier receptor antibody ( Bispecific antibodies (blood-brain barrier receptor antibodies) can effectively penetrate the blood-brain barrier (BBB) to effectively prevent or treat brain and nervous system diseases.
Additionally, a binding molecule or binding fragment thereof that specifically binds to the Lrig-1 (leucine-rich and immunoglobulin-like domains 1) protein present in regulatory T cells (Treg cells); and a peptide, through a conjugate of a binding molecule that specifically binds to the Lrig-1 protein and a peptide, it is possible to effectively prevent or treat brain and nervous system diseases by effectively passing through the blood brain barrier (BBB).
The bispecific antibody and conjugate of the present invention have the effect of passing the blood-brain barrier in vivo, maintaining physiological activity, and significantly increasing blood half-life. The stability of the bispecific antibody and conjugate is also improved, so it can be used as a treatment for brain-related diseases.
Description
본 발명은 혈관뇌장벽(brood-brain barrier, BBB)을 효과적으로 통과하여 뇌신경계 질환을 예방 또는 치료할 수 있는 이중특이적 항체 또는 항체와 펩타이드의 결합체에 관한 것이다. The present invention relates to a bispecific antibody or a conjugate of an antibody and a peptide that can effectively pass through the blood-brain barrier (BBB) and prevent or treat cranial nervous system diseases.
뇌졸중, 치매, 알츠하이머병 등의 퇴행성 뇌신경질환에서 기억력, 주의력, 인지능력, 감정조절 등의 저하가 관찰되며 이는 신경세포의 사멸 및 신경 분지의 위축에 의한 결과이다. 신경세포의 신경분지의 신장은 신경 가소성을 증대함으로써 신경회로의 기억, 학습 기능에 중요한 역할을 하고 있다. 이에 신경세포의 신경분지 신장과 신경 재생을 촉진하는 유효성분은 뇌신경계 질환의 새로운 치료제로 개발 가능성이 있다고 예측된다.Deterioration in memory, attention, cognitive ability, and emotional control is observed in degenerative cranial nerve diseases such as stroke, dementia, and Alzheimer's disease. This is the result of death of nerve cells and atrophy of nerve branches. The elongation of nerve branches of nerve cells plays an important role in the memory and learning functions of neural circuits by increasing nerve plasticity. Accordingly, it is predicted that active ingredients that promote nerve branch elongation and nerve regeneration have the potential to be developed as new treatments for brain and nervous system diseases.
그러나 이와 같은 뇌신경계 질환의 치료에 있어서 혈관 뇌 장벽(blood-brain barrier, 이하 BBB라고 한다.)은 뇌 실질을 전신 순환으로부터 분리하는 물리적 및 기능적 장애물로 작용함으로써 순환 독소로부터 뇌를 효과적으로 보호하지만, 알츠하이머 질환, 파킨슨 질환 및 뇌암과 같은 뇌 질환의 약리학적 치료에 있어서 주요 장애가 된다. However, in the treatment of such brain and nervous system diseases, the blood-brain barrier (hereinafter referred to as BBB) effectively protects the brain from circulating toxins by acting as a physical and functional barrier that separates the brain parenchyma from systemic circulation. It represents a major obstacle in the pharmacological treatment of brain diseases such as Alzheimer's disease, Parkinson's disease, and brain cancer.
BBB의 구성물질은 대부분 인지질(phospholipid)로 돼 있기 때문에 지용성 물질은 통과하나 수용성 물질은 대부분 통과하지 못한다.Since most of the components of the BBB are phospholipids, fat-soluble substances pass through it, but most water-soluble substances do not.
그러므로 하전된 분자 및 크기가 700돌턴을 초과하는 분자는 대부분 혈관 뇌 장벽을 통과할 수 없다. 뇌 및 CNS의 질환 및 장애를 치료하기 위한 많은 치료제는 BBB를 직접 통과하지 못할 정도로 친수성이다. 또한, 이들 약제 및 제 제는 혈액 및 말초 조직에서 분해되기 쉽기 때문에 유효한 혈청 농도를 성취하는데 필요한 양이 증가한다.Therefore, most charged molecules and molecules exceeding 700 daltons in size cannot cross the blood-brain barrier. Many therapeutic agents for treating diseases and disorders of the brain and CNS are so hydrophilic that they do not pass directly through the BBB. Additionally, these drugs and preparations are prone to decomposition in the blood and peripheral tissues, increasing the amount required to achieve effective serum concentrations.
이렇게 BBB가 뇌질환 환자의 치료를 위한 약물의 전달을 차단하기 때문에 BBB를 뚫고 뇌까지 약물을 전달하는 방법은 오랫동안 과학자들의 숙제였다. Since the BBB blocks the delivery of drugs for the treatment of brain disease patients, how to deliver drugs through the BBB to the brain has been a problem for scientists for a long time.
본 발명의 목적은 조절 T 세포(regulatory T cells, Treg cells)에 존재하는 Lrig-1(leucine-rich and immunoglobulin-like domains 1) 단백질에 특이적으로 결합하는 결합 분자 또는 이의 결합 단편; 및 혈액-뇌 장벽 수용체 항체(blood-brain barrier receptor antibody) 또는 이의 항원 결합 단편을 포함하는, Lrig-1 단백질에 특이적으로 결합하는 결합 분자/혈액-뇌 장벽 수용체 항체(blood-brain barrier receptor antibody)의 이중 특이적 항체를 제공하는 것이다.An object of the present invention is to provide a binding molecule or binding fragment thereof that specifically binds to the Lrig-1 (leucine-rich and immunoglobulin-like domains 1) protein present in regulatory T cells (Treg cells); and a binding molecule/blood-brain barrier receptor antibody that specifically binds to the Lrig-1 protein, including a blood-brain barrier receptor antibody or an antigen-binding fragment thereof. ) to provide a dual specific antibody.
본 발명의 다른 목적은 조절 T 세포(regulatory T cells, Treg cells)에 존재하는 Lrig-1(leucine-rich and immunoglobulin-like domains 1) 단백질에 특이적으로 결합하는 결합 분자 또는 이의 결합 단편; 및 펩타이드를 포함하는, Lrig-1 단백질에 특이적으로 결합하는 결합 분자와 펩타이드의 결합체를 제공하는 것이다.Another object of the present invention is to provide a binding molecule or binding fragment thereof that specifically binds to the Lrig-1 (leucine-rich and immunoglobulin-like domains 1) protein present in regulatory T cells (Treg cells); And to provide a conjugate of a peptide and a binding molecule that specifically binds to the Lrig-1 protein, including a peptide.
그러나 본 발명이 이루고자 하는 기술적 과제는 이상에서 언급한 과제에 제한되지 않으며, 언급되지 않은 또 다른 과제들은 아래의 기재로부터 당 업계에서 통상의 지식을 가진 자에게 명확하게 이해될 수 있을 것이다. However, the technical problem to be achieved by the present invention is not limited to the problems mentioned above, and other problems not mentioned will be clearly understood by those skilled in the art from the description below.
본 발명에 따른 Lrig-1 단백질에 특이적으로 결합하는 결합 분자/혈액-뇌 장벽 수용체 항체(blood-brain barrier receptor antibody)의 이중특이적 항체는, 항- 인슐린 유사 성장 인자 수용체 (Insulin-like Growth Factor 1 Receptor, 이하 IGF1R이라 함.) 항체 또는 이의 항원 결합 단편을 포함하여, Lrig-1 단백질에 특이적으로 결합하는 결합 분자 또는 이의 항원결합단편을 혈액뇌장벽을 통과할 수 있게 하여 뇌에서 그 작용을 발휘할 수 있도록 하며, 반감기를 연장하여 약효를 장기간 유지할 수 있도록 한다. The bispecific antibody of the binding molecule/blood-brain barrier receptor antibody that specifically binds to the Lrig-1 protein according to the present invention is an anti-insulin-like growth factor receptor (Insulin-like Growth Factor Receptor). Factor 1 Receptor (hereinafter referred to as IGF1R)) allows binding molecules or antigen-binding fragments thereof, including antibodies or antigen-binding fragments thereof, that specifically bind to the Lrig-1 protein to pass through the blood-brain barrier, thereby allowing them to enter the brain. It allows the drug to exert its action and extends its half-life to maintain its effectiveness for a long period of time.
더욱이, 본 발명에 따른 Lrig-1 단백질에 특이적으로 결합하는 결합 분자/혈액-뇌 장벽 수용체 항체(blood-brain barrier receptor antibody)의 이중 특이적 항체는 세포 표면의 인슐린 유사 성장 인자 수용체 (Insulin-like Growth Factor 1 Receptor, IGF1R)에 결합하지만 IGF1R의 리간드인 IGF-1, IGF-2, 및/또는 인슐린이 IGF1R에 결합하는 것을 방해하지 않는다. 구체적으로, 상기 항 IGF1R 항체 또는 항원결합 단편은 IGF1R을 발현하는 세포에서 IGF1R의 리간드가 세포막에 위치하는 상기 IGF1R에 결합하는 것을 방해하지 않고 IGF1R를 통한 신호전달을 억제하지 않으며, 또한 세포 표면의 IGF1R 발현에도 영향을 미치지 않는 장점이 있다. 이에, 본 발명에 따른 항 IGF1R 항체 또는 항원 결합 단편은, 트랜스사이토시스를 통해 혈액 뇌 장벽을 통과하는 데 효과적으로 사용될 수 있다. IGF1R은 현재까지 주로 사용되는 BBB 통과능 향상을 위한, 뇌의 내피세포에서 그 발현된다고 알려진 다른 트랜스사이토시스 표적과 비교하여 IGF1R의 발현은 뇌에 상대적으로 높은 발현양을 보이는 것으로 나타났다. 일 구현예에서, IGF1R은 치료 항체의 BBB 통과능 향상 용도로 현재 개발되고 있는 다른 표적, 예를 들면, 트랜스페린 수용체(transferrin receptor), 인슐린 수용체(insulin receptor) 등과 비교하였을 때, 말초조직(peripheral tissue), 예를 들면 간, 폐, 대장 등에 상대적으로 낮은 발현양을 보이는 것으로 나타났다.Moreover, the dual specific antibody of the binding molecule/blood-brain barrier receptor antibody that specifically binds to the Lrig-1 protein according to the present invention is the insulin-like growth factor receptor on the cell surface. Like Growth Factor 1 Receptor, IGF1R), but does not interfere with the binding of IGF1R's ligands, IGF-1, IGF-2, and/or insulin, to IGF1R. Specifically, the anti-IGF1R antibody or antigen-binding fragment does not prevent the IGF1R ligand from binding to the IGF1R located on the cell membrane in cells expressing IGF1R and does not inhibit signaling through IGF1R, and also does not inhibit IGF1R signaling on the cell surface. It has the advantage of not affecting expression. Accordingly, the anti-IGF1R antibody or antigen-binding fragment according to the present invention can be effectively used to pass through the blood brain barrier through transcytosis. Compared to other transcytosis targets known to be expressed in endothelial cells of the brain, which are mainly used to improve BBB passage ability, IGF1R was found to have a relatively high expression level in the brain. In one embodiment, IGF1R is a target of peripheral tissue compared to other targets currently being developed for improving the BBB crossing ability of therapeutic antibodies, such as transferrin receptor, insulin receptor, etc. ), for example, it was found to have a relatively low expression level in the liver, lung, and colon.
IGF1R은 혈액뇌장벽(Blood-Brain Barrier, BBB)을 통과하여 유용한 물질을 뇌의 내부로 전달할 수 있는 RMT(Receptor Mediated Transcytosis)의 표적이 되고 있다. 하지만 혈액 뇌 장벽 통과를 위한 약물 전달 표적으로 사용되기 위해서는, 세포 표면의 IGF1R에 결합하지만 리간드의 결합에 영향을 주지 않으며, IGF1R을 통한 신호전달 경로에는 영향을 미치지 않는 특성을 가져야 바람직하다. 따라서, 본 발명에 따른 항-IGF1R 항체 및 이의 항원 결합 단편은, IGF1R와 이의 리간드 결합 및 IGF1R를 통한 신호전달을 억제하지 않으므로 혈액 뇌 장벽을 통과하는 셔틀 수단으로 사용될 수 있다. IGF1R is a target of RMT (Receptor Mediated Transcytosis), which can deliver useful substances into the brain by passing through the blood-brain barrier (BBB). However, in order to be used as a drug delivery target for crossing the blood brain barrier, it is desirable to have the properties of binding to IGF1R on the cell surface but not affecting the binding of the ligand and not affecting the signaling pathway through IGF1R. Therefore, the anti-IGF1R antibody and antigen-binding fragment thereof according to the present invention do not inhibit IGF1R and its ligand binding and signaling through IGF1R, and therefore can be used as a shuttle means to pass through the blood brain barrier.
본 발명에 따른 항-IGF1R 항체 또는 그 항원 결합 단편은 트랜스사이토시스(transcytosis)가 가능하며, 뇌의 내피세포를 통과할 수 있다. 또한 본 발명에 따른 항체는 마우스에 혈관 주사한 경우, 마우스의 뇌혈관과 동일 자리에 위치한다. 이러한 결과는 본 발명에 따른 항체 또는 항원결합 단편이 혈액 뇌장벽을 통과하는 약물 전달체로서 효과적으로 사용될 수 있음을 나타내는 것이다. The anti-IGF1R antibody or antigen-binding fragment thereof according to the present invention is capable of transcytosis and can pass through brain endothelial cells. Additionally, when the antibody according to the present invention is intravascularly injected into a mouse, it is located at the same location as the mouse's brain blood vessel. These results indicate that the antibody or antigen-binding fragment according to the present invention can be effectively used as a drug carrier that passes through the blood brain barrier.
따라서, 본 발명에 따른 항-IGF1R 항체 또는 그 항원 결합 단편은, 뇌에서 작용하는 생리활성물질이 혈액뇌장벽을 통과할 수 있게 한다. 본 발명에서 생물학적 장벽은 세포, 조직, 막 또는 생물학적 분자의 효과적인 통과, 확산 또는 전달을 막는 세포, 막, 또는 구조를 말한다. 이러한 생물학적 장벽은 신경세포/조직, 결합조직, 근육, 막 또는 상피(예를 들면 점막 또는 혈관)세포를 포함한다. 대표적인 예로 혈액뇌장벽을 들 수 있다.Therefore, the anti-IGF1R antibody or antigen-binding fragment thereof according to the present invention allows bioactive substances acting in the brain to pass through the blood-brain barrier. As used herein, a biological barrier refers to a cell, membrane, or structure that prevents the effective passage, diffusion, or transfer of cells, tissues, membranes, or biological molecules. These biological barriers include nerve cells/tissue, connective tissue, muscle, membrane or epithelial (e.g. mucosal or vascular) cells. A representative example is the blood brain barrier.
특히, 본 발명에 따른 항-IGF1R 항체 또는 항원결합 단편은, IGF1R (Insulin-like Growth Factor 1 Receptor)을 특이적으로 인식하며, IGF1R, 특히 인간 IGF1R, 마우스 IGF1R, 랫트 IGF1R, 및 원숭이 IGF1R에 인식 및 결합하며, IGF1R의 리간드인 IGF-1, IGF-2, 및/또는 인슐린이 IGF1R에 결합하는 것을 방해하지 않고, IGF1R을 통한 신호전달을 저해하지 않으며, 트랜스사이토시스에 사용될 수 있어 혈액 내 장벽 통과능을 가지며, ADCC(Antibody-dependent cell-mediated cytotoxicity)를 갖지 않아 동물에 반복 투여했을 경우에도 뇌의 IGF1R 수준을 감소시키지 않아, 독성을 가지지 않는다. In particular, the anti-IGF1R antibody or antigen-binding fragment according to the present invention specifically recognizes IGF1R (Insulin-like Growth Factor 1 Receptor) and recognizes IGF1R, especially human IGF1R, mouse IGF1R, rat IGF1R, and monkey IGF1R. and binds to it, does not interfere with the binding of IGF1R's ligands, IGF-1, IGF-2, and/or insulin to IGF1R, does not inhibit signaling through IGF1R, and can be used for transcytosis to form a barrier in the blood. It has the ability to pass through and does not have ADCC (Antibody-dependent cell-mediated cytotoxicity), so it does not reduce the level of IGF1R in the brain even when administered repeatedly to animals, so it is not toxic.
특히, 본 발명에 따른 항-IGF1R 항체는, BBB를 구성하는 뇌 내피세포 (brain endothelial cell)의 표면에 존재하는 IGF1R에 결합하여 세포 내부로 내재화(Internalization)된다.In particular, the anti-IGF1R antibody according to the present invention binds to IGF1R present on the surface of brain endothelial cells constituting the BBB and is internalized into the cells.
예를 들어, 본 발명에 따른 항-IGF1R 항체는 scFv 형태를 가질 수 있고, 다양한 방식으로 치료용 항체에 결합하여 제작될 수 있다. 예를 들면, 항-IGF1R 항체의 scFv는 치료용 항체, 예를 들면 α-syn 항체의 C-말단에 두 개가 결합한 이중특이항체, 즉 2가 (bivalent) 형태 이중특이적 항체로, 혹은 한 개가 결합한 이중특이항체, 즉 1가(monovalent) 형태 이중특이항체로 제작될 수 있으며, 해당 이중특이항체들은 모두 IGF1R을 발현하는 세포 안으로 내재화된다. 세포 표면의 항원에 대한 IGF1R 항체의 높은 결합력이 내재화 효과를 높이며, 이는 BBB 통과능으로 이어질 수 있다. 해당 항체가 BBB 통과능을 가지면서 IGF1R의 시그널링에 간섭을 줄 경우 부작용을 야기할 수 있는데, 본 발명에 따른 항-IGF1R 항체는 BBB 셔틀로서 기능할 수 있는 결합력을 가지면서 동시에 IGF1R 시그널에 대해 방해하지 않는 항체이다. For example, the anti-IGF1R antibody according to the present invention may have an scFv form and may be produced by binding to a therapeutic antibody in various ways. For example, the scFv of the anti-IGF1R antibody is a bispecific antibody in which two are bound to the C-terminus of a therapeutic antibody, e.g., an α-syn antibody, or one is It can be produced as a combined bispecific antibody, that is, a monovalent form of bispecific antibody, and all of the bispecific antibodies are internalized into cells expressing IGF1R. The high binding affinity of IGF1R antibodies to antigens on the cell surface increases the internalization effect, which may lead to the ability to pass the BBB. If the antibody has the ability to pass through the BBB and interferes with IGF1R signaling, it may cause side effects. The anti-IGF1R antibody according to the present invention has the binding ability to function as a BBB shuttle and at the same time interferes with IGF1R signaling. It is an antibody that does not do this.
상기 항-IGF1R 항체 또는 항원결합 단편은 우수한 개발 용이성을 가진다. 이와 관련하여 상기 항-IGF1R 항체의 CDR 영역에 발생하여 항체의 안정성과 효능을 감소시키는 번역 후 변형 (post-translational modification), 예를 들면 탈아미드화(deamidation)을 제거하고자 하였다. 대안적으로, 상기 항체의 deamidation site 양 옆에 위치하는 아미노산 중 적어도 하나를 치환할 수 있고, 바람직하게는 항체의 deamidation site의 C 말단쪽 바로 옆 아미노산을 치환할 수 있다. 예를 들어 항체의 deamidation site에 위치하는 Asn의 옆에 위치한 G을 A로 또는 Asn 옆에 위치한 S을 V으로 치환함으로써, parental 항-IGF1R 항체와 유사한 결합력을 가짐과 동시에 우수한 안정성과 BBB 통과능을 가지는 탈아미드화 항체를 제조할 수 있다.The anti-IGF1R antibody or antigen-binding fragment has excellent ease of development. In this regard, an attempt was made to remove post-translational modifications, such as deamidation, that occur in the CDR region of the anti-IGF1R antibody and reduce the stability and efficacy of the antibody. Alternatively, at least one of the amino acids located on both sides of the deamidation site of the antibody may be substituted, preferably the amino acid immediately next to the C-terminus of the deamidation site of the antibody. For example, by substituting G next to Asn located at the deamidation site of the antibody with A or S next to Asn with V, it has a binding affinity similar to that of the parental anti-IGF1R antibody and at the same time has excellent stability and BBB passage ability. Eggplant can produce deamidated antibodies.
본 발명의 일 구현 예에서, 상기 항 IGF1R 항체 내 아미노산의 Deamidation 발생의 제거로, 항원인 IGF1R의 ECD에 대한 결합력에 변화가 없으면서 공정 개발, 보관 등에 불리한 항체의 분해 (degradation) 위험성이 감소된다. 항 IGF1R 항체에서 deamidation이 제거되는 아미노산 위치는, 예를 들어 1564 (IgG), 1564 (scFv), 또는 1564-3에서 경쇄 LCDR2의 N51D, N51Q, S52V, LCDR3의 N95aK, N95aH, N95aR, N95aD, G95bA 또는 중쇄의 HCDR2에서 N54D, N54Q 또는 G55A일 수 있다. deamidation 제거는 위에서 언급된 클론에만 한정되지 않는다.In one embodiment of the present invention, by eliminating deamidation of amino acids in the anti-IGF1R antibody, there is no change in the binding ability of the antigen, IGF1R, to ECD, and the risk of antibody degradation, which is disadvantageous for process development, storage, etc., is reduced. Amino acid positions where deamidation is eliminated in anti-IGF1R antibodies include, for example, N51D, N51Q, S52V of light chain LCDR2 at 1564 (IgG), 1564 (scFv), or 1564-3, N95aK, N95aH, N95aR, N95aD, G95bA of LCDR3. or N54D, N54Q or G55A in HCDR2 of the heavy chain. Deamidation removal is not limited to the clones mentioned above.
54sequence number
54
57sequence number
57
58sequence number
58
59sequence number
59
61sequence number
61
55sequence number
55
57sequence number
57
58sequence number
58
60sequence number
60
62sequence number
62
56sequence number
56
57sequence number
57
58sequence number
58
60sequence number
60
62sequence number
62
55sequence number
55
57sequence number
57
58sequence number
58
60sequence number
60
62sequence number
62
추가적으로, 본 발명에 따른 항-IGF1R 항체는 뇌에서 작용하는 생리활성물질과 연결되었을 때, 상기 생리활성물질 단독에 비하여 향상된 BBB 통과능 및 효능을 유도할 수 있다. 본 발명에 따른 항 IGF1R 항체 또는 항원결합 단편은 해리 상수(dissociation constant, KD)가 ≤ 1x10-6 M의 친화도로 결합할 때, 항원과 같은 이의 표적에 "특이적으로 결합한다" 라고 일컬어진다. 항체는 KD가 ≤ 1x10-6 M일 때 혹은 EC50 (effective concentration 50)이 2 nM 이하일 때, 높은 친화성으로 표적에 특이적으로 결합한다. 일 구현예에서, 항체 또는 이의 항원 결합 단편은 KD가 ≤ 1x10-8 M 로 IGF1R 또는 인간 IGF1R에 결합할 수 있다.Additionally, when the anti-IGF1R antibody according to the present invention is linked to a bioactive substance that acts in the brain, it can induce improved BBB passage ability and efficacy compared to the bioactive substance alone. An anti-IGF1R antibody or antigen-binding fragment according to the present invention is said to “specifically bind” to its target, such as an antigen, when it binds with an affinity with a dissociation constant (K D) of ≤ 1x10 -6 M. . Antibodies specifically bind to the target with high affinity when K D is ≤ 1x10 -6 M or EC50 (effective concentration 50) is 2 nM or less. In one embodiment, the antibody or antigen-binding fragment thereof is capable of binding IGF1R or human IGF1R with a K D of ≤ 1x10 -8 M.
본원 발명에서, 용어 "에피토프(epitope)"는 항원 결정 부위(antigenic determinant)로서, 항체에 의해 인지되는 항원의 일부분을 의미하는 것으로 해석된다. 일 구체예에 따르면, 본 발명에 따른 항-IGF1R 항체의 결합 부위는 IGF1R 단백질, 예를 들면 인간 IGF1R 단백질의 세포 외 도메인(extracellular domain)일 수 있다. 더욱 구체적으로, 본 발명에 따른 항-IGF1R 항체, 예를 들면 1564 클론 항체의 인간 IGF1R 단백질에 대한 결합 부위는, 인간 IGF1R 단백질에서, 결합부위 1은 Y775, P776, F778, R650, S791, L798 및 Glu779을 포함하고, 결합부위 2는 L641, H808, E809 및 L813을 포함하고, 결합부위 3은 V397, D435, W434, Y460 및 C488을 포함한다.In the present invention, the term “epitope” is interpreted as an antigenic determinant, meaning a portion of an antigen recognized by an antibody. According to one embodiment, the binding site of the anti-IGF1R antibody according to the present invention may be the extracellular domain of IGF1R protein, for example, human IGF1R protein. More specifically, the binding site of the anti-IGF1R antibody according to the present invention, such as the 1564 clone antibody, to the human IGF1R protein is: In the human IGF1R protein, binding site 1 is Y775, P776, F778, R650, S791, L798 and Contains Glu779, binding site 2 includes L641, H808, E809 and L813, and binding site 3 includes V397, D435, W434, Y460 and C488.
이에, 본 발명에 따른 IGF1R 항체의 에피토프는 구조적 에피토프(conformational epitope)로서 상기의 3개 결합부위를 모두 혹은 일부를 포함하는 것일 수 있다.Accordingly, the epitope of the IGF1R antibody according to the present invention is a conformational epitope and may include all or part of the three binding sites above.
본 발명의 "뇌혈관 장벽(Blood Brain Barrier, BBB)"이란 기저막(basement membrane), 미세아교세포(microglia), 주피세포(pericytes), 성상교세포(astrocytes), 내피세포(endothelial cell)를 기반으로 밀착 연접(tight junction)을 형성하고 있고 기저막은 내피세포를 감싸고 보호하고 있고, 미세아교세포는 중추신경계의 면역 반응을 유발하는데 주요 역할을 하며, 주피세포는 혈액 모세혈관의 20% 이상을 차지하면서 기저막의 구성 요소를 생산하고 있어 뇌 내 이온 균형 조절 및 세포 외 독성으로부터 뇌를 보호하는 역할을 하는 장벽을 말한다.The "Blood Brain Barrier (BBB)" of the present invention is based on basement membrane, microglia, pericytes, astrocytes, and endothelial cells. They form tight junctions, and the basement membrane surrounds and protects endothelial cells. Microglia play a major role in inducing immune responses in the central nervous system, and periepithelial cells account for more than 20% of blood capillaries. It produces components of the basement membrane, which is a barrier that regulates ionic balance within the brain and protects the brain from extracellular toxicity.
본원발명에 따른 이중특이적 항체 또는 결합체에서, 상기 이중특이적 항체 또는 펩타이드는 수동전달(passive transport)에 의한 경로 또는 수용체 매개 전달(receptor-mediated transport)에 의한 경로를 통해 뇌 혈관 장벽을 통과하는 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.In the bispecific antibody or conjugate according to the present invention, the bispecific antibody or peptide passes through the blood-brain barrier through a passive transport route or a receptor-mediated transport route. It may be characterized by, but is not limited to, this.
본원발명에서 상기 수용체 매개 전달(receptor-mediated transport)에 의한 경로는 인슐린 수용체(insulin receptor), 트랜스페린 수용체(transferrin receptor), 저밀도 지질단백질 수용체(low density lipoprotein receptor), 저밀도 지질단백질 수용체 관련 단백질(low density lipoprotein receptor-related protein), 렙틴 수용체(leptin receptor), 니코틴성 아세틸콜린 수용체(nicotinic acetylcholine receptor), 글루타티온 수송체(Glutathione transporter), 칼슘의존성 칼륨통로(calcium-activated potassium channel), 및 RAGE(receptor for advanced glycation endproducts), 및 상기 수용체들의 리간드 및 상기 수용체 또는 리간드에 결합하는 항체로 이루어진 군으로부터 선택된 어느 하나를 통하여 수용체 매개 전달 경로에 의해 뇌 혈관 장벽을 통과하는 것을 특징으로 하나, 이에 제한되지 않는다.In the present invention, the pathway by receptor-mediated transport includes insulin receptor, transferrin receptor, low density lipoprotein receptor, and low density lipoprotein receptor-related protein (low density lipoprotein receptor). density lipoprotein receptor-related protein, leptin receptor, nicotinic acetylcholine receptor, glutathione transporter, calcium-activated potassium channel, and RAGE (receptor for advanced glycation endproducts), and a ligand of the receptor and an antibody that binds to the receptor or ligand, and passes through the blood-brain barrier by a receptor-mediated transport pathway, but is not limited thereto. .
본원 발명에서 상기 펩타이드는 이러한 경로를 통해 뇌혈관 장벽을 통과하는 펩타이드, 단백질, 항체로 이루어진 군에서 선택된 것일 수 있으며, 또는, 상기 펩타이드, 단백질, 또는 항체로부터 분리된 일부 펩타이드 서열일 수 있으나, 이에 제한되지 않는다. 그 예로, 서열번호 64의 HAITYPRH 펩타이드, 서열번호 65의 THR 펩타이드, 서열번호 66의 Angiopep-2 펩타이드, 서열번호 68의 ApoB 펩타이드, 서열번호 67의 ApoE 펩타이드 등의 펩타이드가 이용될 수 있으나, 본 발명의 결합체에 포함되어, 결합된 Lrig-1 단백질에 특이적으로 결합하는 항체를 BBB를 통과하여 뇌 내로 전달시킬 수 있는 펩타이드는 제한 없이 포함된다.In the present invention, the peptide may be selected from the group consisting of peptides, proteins, and antibodies that pass through the blood-brain barrier through this route, or may be a partial peptide sequence separated from the peptide, protein, or antibody. Not limited. For example, peptides such as HAITYPRH peptide of SEQ ID NO: 64, THR peptide of SEQ ID NO: 65, Angiopep-2 peptide of SEQ ID NO: 66, ApoB peptide of SEQ ID NO: 68, and ApoE peptide of SEQ ID NO: 67 may be used, but the present invention Peptides that are included in the conjugate and can deliver an antibody that specifically binds to the bound Lrig-1 protein through the BBB and into the brain are included without limitation.
또 하나의 구체예로서, 펩타이드는As another embodiment, the peptide is
(1) Angiopep-2 : TFFYGGSRGKRNNFKTEEYOH (서열번호: 66),(1) Angiopep-2: TFFYGGSRGKRNNFKTEEYOH (SEQ ID NO: 66),
(2) ApoB(3371-3409) : SVIDALQYKLEGTTRLTRKRGLKLATALSLSNKFVEGS (서열번호: 68),(2) ApoB (3371-3409): SVIDALQYKLEGTTRLTRKRGLKLATALSLSNKFVEGS (SEQ ID NO: 68),
(3) ApoE(159-167)2 : (LRKLRKRLL)2 (서열번호: 67),(3) ApoE(159-167) 2 : (LRKLRKRLL) 2 (SEQ ID NO: 67),
(4) 펩타이드-22 : Ac-C(&)MPRLRGC(&)-NH 2 (서열번호: 69),(4) Peptide-22: Ac-C(&)MPLRRGC(&)- NH 2 (SEQ ID NO: 69),
(5) THR : THRPPMWSPVWP-NH 2 (서열번호: 65),(5) THR: THRPPMWSPVWP- NH 2 (SEQ ID NO: 65),
(6) THR retro-enantio : pwvpswmpprht- NH 2 (서열번호: 70),(6) THR retro-enantio : pwvpswmpprht- NH 2 (SEQ ID NO: 70),
(7) CRT : C(&)RTIGPSVC(&)(서열번호: 71),(7) CRT: C(&)RTIGPSVC(&) (SEQ ID NO: 71),
(8) Leptin 30 : YQQILTSMPSRNVIQISNDLENLRDLLHVL (서열번호: 72),(8) Leptin 30: YQQILTSMPSRRNVIQISNDLENLRDLLHVL (SEQ ID NO: 72),
(9) RVG29 : YTIWMPENPRPGTPCDIFTNSRGKRASNGOH (서열번호:73)(9) RVG29: YTIWMPENRPGTPCDIFTNSRGKRASNGOH (SEQ ID NO: 73)
(10) DCDX : GreirtGraerwsekf-OH (서열번호: 74)(10) D CDX: GreirtGraerwsekf-OH (SEQ ID NO: 74)
(11) Apamin : C(&1)NC(&2)KAPETALC(&1)-ARRC(&2)QQH-NH 2 (서열번호: 75),(11) Apamin: C(& 1 )NC(& 2 )KAPETALC(& 1 )-ARRC(& 2 )QQH- NH 2 (SEQ ID NO: 75),
(12) MiniAp-4 : [Dap](&)KAPETALD(&) (서열번호: 76),(12) MiniAp-4: [Dap](&)KAPETALD(&) (SEQ ID NO: 76),
(13) GSH : γ-L-glutamyl-CG-OH(13) GSH: γ-L-glutamyl-CG-OH
(14) G23 : HLNILSTLWKYRC(서열번호: 77),(14) G23: HLNILSTLWKYRC (SEQ ID NO: 77),
(15) g7 : GFtGFLS(O-β-Glc)-NH 2 (서열번호: 78),(15) g7: GFtGFLS(O-β-Glc) -NH 2 (SEQ ID NO: 78),
(16) TGN : TGNYKALHPHNG (서열번호: 79),(16) TGN: TGNYKALHPHNG (SEQ ID NO: 79),
(17) TAT(47-57) : YGRKKRRQRRR-NH 2 (서열번호: 80),(17) TAT(47-57): YGRKKRRQRRR- NH 2 (SEQ ID NO: 80),
(18) SynB1 : RGGRLSYSRRRFSTSTGR (서열번호: 81),(18) SynB1: RGGRLSYSRRRFSTSTGR (SEQ ID NO: 81),
(19) Diketopiperazines : &(N-MePhe)-(N-MePhe)Diketopiperazines, 또는(19) Diketopiperazines: &(N-MePhe)-(N-MePhe)Diketopiperazines, or
(20) PhPro : (Phenylproline)4 -NH 2 (서열번호: 82)일 수 있으나, 이에 제한되지 않는다.(20) PhPro: It may be (Phenylproline) 4 -NH 2 (SEQ ID NO: 82), but is not limited thereto.
상기 서열에서 &은 J. Pept. Res., 2005, 65, 550-555 (J.Spengler et al.)에 기재된 고리형 펩타이드에 대한 명명법에 따른 기호로서, '&'은 연결 위치(connecting point)를 말한다. 예를 들어, 단일 쇄에서 첫 번째로 기재된 '&'은 화학 결합의 일 말단의 위치를, 두 번째로 기재된 '&'은 상기 화학 결합이 부착되는 부위를 말한다. 예컨대, "&Ala-Ala-Phe-Leu-Pro&"은 알라닌과 프롤린 간에 화학 결합이 형성되어 고리형 펩타이드를 형성함을 나타낸다. 2 이상의 화학 결합이 존재할 경우, 해당 화학 결합이 형성되는 위치를 나타내기 위하여 &1, &2와 같은 기호를 사용할 수 있다. 예를 들어, &1Asp(&2)-Trp-Phe-Dpr(&2)-Leu-Met&1과 같이 표시된 경우, Asp 및 Met 간에 화학 결합이 형성되고, Asp 및 Dpr 간에 화학 결합이 형성되는 것을 말한다. 한편, [Dap]은 다이아미노프로피오닉산(diaminopropionic acid)을 나타낸다.In the above sequence, & refers to J. Pept. As a symbol according to the nomenclature for cyclic peptides described in Res., 2005, 65, 550-555 (J. Spengler et al.), '&' refers to the connecting point. For example, in a single chain, '&' written first refers to the position of one end of a chemical bond, and '&' written second refers to the site to which the chemical bond is attached. For example, “&Ala-Ala-Phe-Leu-Pro&” indicates that a chemical bond is formed between alanine and proline to form a cyclic peptide. If two or more chemical bonds exist, symbols such as &1, &2 can be used to indicate the position where the chemical bond is formed. For example, if it is expressed as &1Asp(&2)-Trp-Phe-Dpr(&2)-Leu-Met&1, it means that a chemical bond is formed between Asp and Met, and a chemical bond is formed between Asp and Dpr. Meanwhile, [Dap] represents diaminopropionic acid.
본 발명의 일 구현 예는 IGF1R (Insulin-like Growth Factor 1 Receptor)을 특이적으로 인식하면서도, IGF1R 리간드의 결합에 영향이 없으며, IGF1R 수용체를 통한 신호전달을 억제하지 않으며 트랜스사이토시스가 가능한 이중특이적 항체 또는 이의 항원 결합 단편을 제공한다.One embodiment of the present invention is a bispecific device that specifically recognizes IGF1R (Insulin-like Growth Factor 1 Receptor), but has no effect on the binding of IGF1R ligand, does not inhibit signaling through the IGF1R receptor, and is capable of transcytosis. An antibody or antigen-binding fragment thereof is provided.
본 발명의 일 구현예는 Lrig-1 단백질에 대한 항원 결합 부위 및 IGF1R에 대한 항원 결합 부위를 포함하는 항체, 구체적으로는 Lrig-1 단백질에 특이적으로 결합하는 항체 및 IGF1R에 대한 이중특이적 항체에 관한 것이다. 이에, 본 발명에 따른 이중특이적 항체는, Lrig-1 단백질과 IGF1R를 모두 항원으로 인식 및 결합할 수 있다. One embodiment of the present invention is an antibody comprising an antigen binding site for Lrig-1 protein and an antigen binding site for IGF1R, specifically an antibody specifically binding to Lrig-1 protein and a bispecific antibody for IGF1R. It's about. Accordingly, the bispecific antibody according to the present invention can recognize and bind to both Lrig-1 protein and IGF1R as antigens.
본 발명에 따른 Lrig-1 단백질에 특이적으로 결합하는 항체 및 IGF1R에 대한 이중특이적 항체는, 상기 Lrig-1 단백질에 특이적으로 결합하는 항체 또는 이의 항원결합단편을 포함하며, Lrig-1 단백질을 특이적으로 인식하고 결합할 수 있으며, 뇌신경계 질환 예방, 치료 및/또는 진단 용도로 사용될 수 있다. The antibody specifically binding to the Lrig-1 protein and the bispecific antibody against IGF1R according to the present invention include an antibody or antigen-binding fragment thereof that specifically binds to the Lrig-1 protein. It can specifically recognize and bind, and can be used for the prevention, treatment and/or diagnosis of brain and nervous system diseases.
본원에서 "2가의 항원 결합 단백질" 또는 "2가 항체"는 2개의 항원 결합 부위를 포함한다. 이러한 2가 항체에 포함된 2개의 항원 결합 부위는 동일한 항원 특이성을 갖거나, 또는 각각 상이한 항원에 결합하는 이중특이적 항체일 수 있다. 본원에서 "다중 특이적 항원 결합 단백질" 또는 "다중 특이적 항체"는 두 개 이상의 항원 또는 에피토프를 표적으로 하는 것이다.As used herein, a “bivalent antigen binding protein” or “bivalent antibody” contains two antigen binding sites. The two antigen binding sites included in such a bivalent antibody may have the same antigen specificity, or may be bispecific antibodies that each bind to different antigens. As used herein, a “multispecific antigen binding protein” or “multispecific antibody” is one that targets two or more antigens or epitopes.
본 발명의 일 구현 예에서는 조절 T 세포(regulatory T cells, Treg cells)에 존재하는 Lrig-1(leucine-rich and immunoglobulin-like domains 1) 단백질에 특이적으로 결합하는 결합 분자를 유효 성분으로 포함하는, 뇌신경계 질환의 예방 또는 치료를 위한 병용 투여용 약학 조성물을 제공한다. 본 발명의 목적상 상기 조절 T 세포는 CD4+ T 세포일 수 있으나, 이에 제한되는 것은 아니다.In one embodiment of the present invention, the active ingredient contains a binding molecule that specifically binds to the Lrig-1 (leucine-rich and immunoglobulin-like domains 1) protein present in regulatory T cells (Treg cells). , and provides a pharmaceutical composition for combined administration for the prevention or treatment of cranial nervous system diseases. For the purposes of the present invention, the regulatory T cells may be CD4+ T cells, but are not limited thereto.
본 발명에서 상기 Lrig-1 단백질은 서열번호 19 또는 21으로 표시되는 아미노산 서열을 포함할 수 있으나, 이에 제한되는 것은 아니다.In the present invention, the Lrig-1 protein may include the amino acid sequence represented by SEQ ID NO: 19 or 21, but is not limited thereto.
또한, 본 발명에서 상기 Lrig-1 단백질은 서열번호 20 또는 22로 표시되는 유전자에 의해 코딩될 수 있으나, 이에 제한되는 것은 아니다.Additionally, in the present invention, the Lrig-1 protein may be encoded by the gene represented by SEQ ID NO: 20 or 22, but is not limited thereto.
본 발명에서, 상기 Lrig-1 단백질은 면역세포, 특히 조절 T 세포의 표면에 존재하는 1091개의 아미노산으로 이루어진 막관통 단백질로서, 세포 외 혹은 루멘 쪽의 루신 반복 서열(Leucine-rich repeat(LRR))과 세개의 면역 체 유사 도메인(Immunoglobulin-Like Domains), 세포막 관통 서열 및 세포질 꼬리부분으로 구성되어 있다. LRIG 유전자 패밀리는 LRIG1, LRIG2와 LRIG3이 존재하며, 이들 간의 아미노산들은 매우 보전적으로 구성되어 있다. 상기 LRIG1 유전자는 정상 피부에서 높게 발현하고 있으며, 기저와 모낭 세포에 발현하여 상피 줄기세포의 증식을 조절할 수 있다. 따라서, 표피의 항상성 유지에 중요한 역할을 하며, 부존재 시 건선이나 피부암으로 발전할 수 있다. LRIG1이 위치한 염색체 3p14.3 부분이 잘리는 경우에는 암세포로 발전할 가능성이 많은 것으로 보고되어 있으며, 실제로 신장암(Renal cell Carcinoma)과 편평상피암(Cutaneous Squamous Cell Carcinoma)에서는 LRIG1의 발현이 매우 감소되어 있는 것으로 확인되었다. 현재, LRIG1은 c-Cbl을 통해 EGFR(Epidermarl growth factor receptor)의 유비퀴틴화를 통해 단백질 분해시킴으로써 그 하위에 존재하고 세포 증식에 관여하는 MAPK 및 AKT의 인산화에 의한 신호전달을 차단하고, 카스파아제(Caspase)-8의 분비를 증가시켜 세포사멸(Apoptosis)을 일으킴으로써 암 억제제로써의 가능성이 제기되고 있다. 본 발명의 목적상 상기 Lrig-1 단백질은 인간 또는 쥐에 존재하는 단백질 일 수 있으나, 이에 제한되는 것은 아니다.In the present invention, the Lrig-1 protein is a transmembrane protein consisting of 1091 amino acids present on the surface of immune cells, especially regulatory T cells, and contains a leucine-rich repeat (LRR) sequence on the extracellular or lumen side. It consists of three immunoglobulin-like domains, a transmembrane sequence, and a cytoplasmic tail. The LRIG gene family includes LRIG1, LRIG2, and LRIG3, and the amino acids among them are highly conserved. The LRIG1 gene is highly expressed in normal skin, and can regulate the proliferation of epithelial stem cells by expressing it in basal and hair follicle cells. Therefore, it plays an important role in maintaining epidermal homeostasis, and its absence can lead to psoriasis or skin cancer. It has been reported that if the chromosome 3p14.3 part where LRIG1 is located is cut, there is a high possibility of developing into cancer cells. In fact, the expression of LRIG1 is greatly reduced in renal cell carcinoma and cutaneous squamous cell carcinoma. It was confirmed that Currently, LRIG1 degrades proteins through ubiquitination of EGFR (Epidermarl growth factor receptor) through c-Cbl, thereby blocking signal transduction by phosphorylation of MAPK and AKT, which exist downstream and are involved in cell proliferation, and caspase ( It has the potential to be a cancer inhibitor by increasing the secretion of Caspase-8, causing apoptosis. For the purpose of the present invention, the Lrig-1 protein may be a protein existing in humans or mice, but is not limited thereto.
본 발명에서 사용되는 "결합 분자"는 키메라, 인간화 또는 인간 단일클론 항체와 같은 단일클론 항체를 포함하는 온전한(intact) 이뮤노글로블린(immunoglobulin), 또는 항원에 결합하는 이뮤노글로믈린, 예를 들면 인플루엔자 A 바이러스의 단량체 HA 또는 삼량체 HA와의 결합을 위해 온전한(intact) 이뮤노글로블린과 경쟁하는 이뮤노글로블린 단편을 포함하는 가변성 도메인을 뜻한다. 구조와는 상관없이 항원-결합 단편은 온전한(intact) 이뮤노글로블린에 의해 인식된 동일한 항원과 결합된다. 항원-결합 단편은 결합 분자의 아미노산 서열의 2개 이상의 연속기, 20개 이상의 연속 아미노산 잔기, 25개 이상의 연속 아미노산 잔기, 30개 이상의 연속 아미노산 잔기, 35개 이상의 연속 아미노산 잔기, 40개 이상의 연속 아미노산 잔기, 50개 이상의 연속 아미노산 잔기, 60개 이상의 연속 아미노산 잔기, 70개 이상의 연속 아미노산 잔기, 80개 이상의 연속 아미노산 잔기, 90개 이상의 연속 아미노산 잔기, 100개 이상의 연속 아미노산 잔기, 125개 이상의 연속 아미노산 잔기, 150개 이상의 연속 아미노산 잔기, 175개 이상 연속 아미노산 잔기, 200개 이상의 연속 아미노산 잔기, 또는 250개 이상의 연속 아미노산 잔기의 아미노산 서열을 포함하는 펩티드 또는 폴리펩티드를 포함할 수 있다. "항원-결합 단편"은 특히 Fab, F(ab'), F(ab')2, Fv, dAb, Fd, 상보성 결정 영역(CDR) 단편, 단일-쇄 항체(scFv), 2가(bivalent) 단일-쇄 항체, 단일-쇄 파지 항체, 디아바디(diabody), 트리아바디, 테트라바디, 폴리펩티드로의 특정 항원에 결합하기에 충분한 이뮤노글로브린의 하나 이상의 단편을 함유하는 폴리펩티드 등을 포함한다. 상기 단편은 합성으로 또는 완전한 이뮤노글로블린의 효소적 또는 화학적 분해에 의해 생성되거나, 재조합 DNA 기술에 의해 유전공학적으로 생성될 수 있다. 생성 방법은 당업계에 잘 알려져 있다.“Binding molecule” as used in the present invention refers to an intact immunoglobulin, including a monoclonal antibody such as a chimeric, humanized or human monoclonal antibody, or an immunoglobulin that binds to an antigen, e.g. It refers to a variable domain containing an immunoglobulin fragment that competes with intact immunoglobulin for binding to the monomeric HA or trimeric HA of the influenza A virus. Regardless of structure, the antigen-binding fragment binds the same antigen recognized by the intact immunoglobulin. An antigen-binding fragment is a sequence of two or more consecutive amino acid residues, at least 20 consecutive amino acid residues, at least 25 consecutive amino acid residues, at least 30 consecutive amino acid residues, at least 35 consecutive amino acid residues, or at least 40 consecutive amino acid residues of the amino acid sequence of the binding molecule. , 50 or more consecutive amino acid residues, 60 or more consecutive amino acid residues, 70 or more consecutive amino acid residues, 80 or more consecutive amino acid residues, 90 or more consecutive amino acid residues, 100 or more consecutive amino acid residues, 125 or more consecutive amino acid residues, It may comprise a peptide or polypeptide comprising an amino acid sequence of at least 150 consecutive amino acid residues, at least 175 consecutive amino acid residues, at least 200 consecutive amino acid residues, or at least 250 consecutive amino acid residues. “Antigen-binding fragment” refers specifically to Fab, F(ab'), F(ab')2, Fv, dAb, Fd, complementarity determining region (CDR) fragment, single-chain antibody (scFv), bivalent Single-chain antibodies, single-chain phage antibodies, diabodies, triabodies, tetrabodies, polypeptides containing one or more fragments of an immunoglobulin sufficient to bind to a specific antigen as a polypeptide, and the like. The fragments may be produced synthetically or by enzymatic or chemical digestion of intact immunoglobulins, or may be genetically engineered by recombinant DNA techniques. Methods of production are well known in the art.
본 발명에서 상기 결합 분자는 Fc 영역(Fragment crystallization region) 또는 불변 영역(constant region)을 더 포함할 수 있다. 이때 상기 Fc 영역은 IgA, IgD, IgE, IgM, IgG1, IgG2, IgG3 또는 IgG4 항체의 Fc 영역이거나, 그로부터 유래된 것일 수 있고, 혹은 하이브리드 Fc(hybrid Fc) 영역일 수 있다.In the present invention, the binding molecule may further include an Fc region (Fragment crystallization region) or a constant region. At this time, the Fc region may be the Fc region of an IgA, IgD, IgE, IgM, IgG1, IgG2, IgG3 or IgG4 antibody, may be derived therefrom, or may be a hybrid Fc (hybrid Fc) region.
본 발명에서 상기 Fc 영역은 포유동물 유래 IgA, IgD, IgE, IgM, IgG1, IgG2, IgG3 또는 IgG4 항체의 Fc 영역일 수 있고, 바람직하게는 인간 유래 IgA, IgD, IgE, IgM, IgG1, IgG2, IgG3 또는 IgG4 항체의 Fc 영역일 수 있으나, 이에 제한되는 것은 아니다. In the present invention, the Fc region may be the Fc region of a mammalian IgA, IgD, IgE, IgM, IgG1, IgG2, IgG3 or IgG4 antibody, preferably a human-derived IgA, IgD, IgE, IgM, IgG1, IgG2, It may be the Fc region of an IgG3 or IgG4 antibody, but is not limited thereto.
본 발명의 일 예시로서, 상기 Fc 영역은 인간 유래 면역글로불린 람다(lambda) 불변 영역일 수 있으나, 이에 제한되는 것은 아니다.As an example of the present invention, the Fc region may be a human-derived immunoglobulin lambda constant region, but is not limited thereto.
본 발명에서 상기 "하이브리드 Fc"는 인간 IgG 서브클래스의 조합 또는 인간 IgD 및 IgG의 조합으로부터 유도될 수 있다. 상기 하이브리드 Fc는 생물학적 활성 분자, 폴리펩티드 등에 결합하는 경우, 생물학적 활성 분자의 혈청 반감기를 증가시킬 뿐만 아니라 Fc-폴리펩타이드 융합 단백질을 코딩하는 뉴클레오티드가 발현될 때 폴리펩타이드의 발현 수준을 높이는 효과가 있다. In the present invention, the “hybrid Fc” may be derived from a combination of human IgG subclasses or a combination of human IgD and IgG. When the hybrid Fc binds to a biologically active molecule, polypeptide, etc., it not only increases the serum half-life of the biologically active molecule, but also has the effect of increasing the expression level of the polypeptide when the nucleotide encoding the Fc-polypeptide fusion protein is expressed.
본 발명의 상기 결합 분자에서 상기 Fc 또는 불변 영역은 상기 가변 영역에 링커(linker)로 연결될 수 있다. 이때 상기 Fc 또는 불변 영역의 C-말단에 링커가 연결되며, 상기 링커에 본 발명의 결합 분자의 N-말단이 연결될 수 있으나, 이에 제한되는 것은 아니다.In the binding molecule of the present invention, the Fc or constant region may be connected to the variable region with a linker. At this time, a linker is connected to the C-terminus of the Fc or constant region, and the N-terminus of the binding molecule of the present invention may be connected to the linker, but is not limited thereto.
본 발명에서 상기 "링커(linker)"는 목적하는 질환의 조직 또는 세포 내에서 과발현되는 효소에 의해 절단될 수 있는 서열을 포함할 수 있다. 상기와 같이 과발현되는 효소에 의해 절단될 수 있는 경우에는 Fc 또는 불변 영역으로 인하여 폴리펩티드의 활성이 저하되는 것을 효과적으로 방지할 수 있다. 본 발명에서는 링커의 바람직한 예로, 혈액 내에 가장 많이 존재하는 인간 알부민의 282번 내지 314번째 부분에 위치한 33개의 아미노산으로 이루어진 펩티드 링커, 보다 바람직하게는 292번 내지 304번째 부분에 위치한 13개의 아미노산으로 이루어진 펩티드 링커일 수 있으며, 이러한 부분은 3차원적인 구조상 대부분 외부에 노출된 부분으로서 체내에서 면역반응을 유도할 가능성이 최소화된 부분이다. 단, 이에 제한되는 것은 아니다. In the present invention, the “linker” may include a sequence that can be cleaved by an enzyme overexpressed in the tissue or cell of the desired disease. If it can be cleaved by an overexpressed enzyme as described above, it can effectively prevent the activity of the polypeptide from being reduced due to the Fc or constant region. In the present invention, a preferred example of a linker is a peptide linker consisting of 33 amino acids located at positions 282 to 314 of human albumin, which is most abundant in the blood, more preferably a peptide linker consisting of 13 amino acids located at positions 292 to 304. It may be a peptide linker, and this part is mostly exposed to the outside due to its three-dimensional structure and has a minimal possibility of inducing an immune response in the body. However, it is not limited to this.
본 발명의 결합 분자는 항체 또는 이의 단편인 것을 특징으로 하나 이에 한정되는 것은 아니다. 상기 항체는 단일클론항체(monoclonal antibody), 전장 항체 (full-length antibody) 또는 항체의 일부분으로서 Lrig-1 단백질에 결합할 능력을 가지며 본 발명의 결합 분자와 경쟁적으로 Lrig-1 항원 결정 부위에 결합할 수 있는 항체 단편 모두를 포함한다. The binding molecule of the present invention is characterized as being an antibody or a fragment thereof, but is not limited thereto. The antibody has the ability to bind to the Lrig-1 protein as a monoclonal antibody, full-length antibody, or part of an antibody, and binds to the Lrig-1 antigenic determining site competitively with the binding molecule of the present invention. Includes all possible antibody fragments.
본 발명에 있어서, 상기 "항체"는 면역학적으로 특정 항원과 반응성을 갖는 면역글로블린 분자를 포함하는, 항원을 특이적으로 인식하는 수용체 역할을 하는 단백질 분자를 의미한다. 본 발명의 목적상 상기 항원은 조절 T 세포(regulatory T cell)의 표면에 존재하는 Lrig-1 단백질일 수 있다. 바람직하게는 상기 Lrig-1 단백질의 류신 리치 구역(Leucine Rich Region) 또는 면역글로블린 유사 도메인을 특이적으로 인식하는 것일 수 있으나, 이에 제한되지 아니한다.In the present invention, the “antibody” refers to a protein molecule that serves as a receptor that specifically recognizes an antigen, including immunoglobulin molecules that are immunologically reactive with a specific antigen. For the purposes of the present invention, the antigen may be the Lrig-1 protein present on the surface of regulatory T cells. Preferably, it may specifically recognize the leucine rich region or immunoglobulin-like domain of the Lrig-1 protein, but is not limited thereto.
본 발명에서 상기 "면역글로불린"은 중쇄 및 경쇄를 가지며 각각의 중쇄 및 경쇄는 불변 영역 및 가변 영역을 포함한다. 경쇄 및 중쇄의 가변 영역은, 상보성 결정 영역(complementarity determining region, 이하 "CDR"이라 함)이라 불리우는 3개의 다변 가능한 영역 및 4개의 구조 영역(Framework region)을 포함한다. 상기 CDR은 주로 항원의 항원 결정기(Epitope)에 결합하는 역할을 한다. 각각의 사슬의 CDR은 전형적으로 N-말단으로부터 시작하여 순차적으로 CDR1, CDR2 및 CDR3로 지칭하고, 또한 특정 CDR이 위치하고 있는 사슬에 의해서 식별된다.In the present invention, the “immunoglobulin” has a heavy chain and a light chain, and each heavy chain and light chain includes a constant region and a variable region. The variable regions of the light and heavy chains include three variable regions called complementarity determining regions (hereinafter referred to as “CDRs”) and four framework regions. The CDR mainly functions to bind to the epitope of the antigen. The CDRs of each chain are typically referred to sequentially, starting from the N-terminus, as CDR1, CDR2, and CDR3, and are also identified by the chain on which a particular CDR is located.
또한, 본 발명에서 상기 "단일클론항체"는, 실질적으로 동일한 항체 집단에서 수득한 단일 분자 조성의 항체 분자를 일컫는 말로, 특정 항원 결정기(Epitope)에 대해 단일 결합 특이성 및 친화도를 나타낸다.In addition, in the present invention, the “monoclonal antibody” refers to an antibody molecule with a single molecule composition obtained from a substantially identical antibody population, and exhibits single binding specificity and affinity for a specific epitope.
본 발명에서 상기 "전장 항체"는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는 구조이며, 각각의 경쇄는 중쇄와 다이설파이드(Disulfide) 결합으로 연결되어 있으며, IgA, IgD, IgE, IgM, 및 IgG를 포함한다. 상기 IgG는 그 아형(subtype)으로, IgG1, IgG2, IgG3 및 IgG4를 포함한다.In the present invention, the "full-length antibody" has a structure having two full-length light chains and two full-length heavy chains, and each light chain is connected to the heavy chain by a disulfide bond, and includes IgA, IgD, IgE, Includes IgM, and IgG. The IgG subtypes include IgG1, IgG2, IgG3, and IgG4.
또한, 본 발명에서 상기 "항체의 단편"은 항원 결합 기능을 보유하고 있는 단편을 의미하며, Fab, Fab', F(ab')2 및 Fv 등을 포함한다. 상기 Fab는 경쇄 및 중쇄의 가변 영역과 경쇄의 불변 영역 및 중쇄의 첫 번째 불변 영역(CH1 도메인)을 가지는 구조로 1개의 항원 결합 부위를 가진다. 또한, Fab'는 중쇄 CH1 도메인의 C 말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 영역(hinge region)을 가진다는 점에서 Fab와 차이가 있다. F(ab')2 항체는 Fab'의 힌지 영역의 시스테인 잔기가 다이설파이드 결합을 이루면서 생성된다. Fv(Variable fragment)는 중쇄 가변 영역 및 경쇄 가변 영역만을 가지고 있는 최소의 항체 조각을 의미한다. 이중쇄 Fv(dsFv)는 다이설파이드 결합으로 중쇄 가변 영역과 경쇄 가변 영역이 연결되어 있고 단쇄 Fv(scFv)는 일반적으로 펩타이드 링커를 통하여 중쇄의 가변 영역과 경쇄의 가변 영역이 공유 결합으로 연결되어 있다. 상기 항체 단편은 단백질 가수분해 효소, 예를 들면 파파인 또는 펩신을 이용하는 경우 Fab 또는 F(ab')2의 단편을 얻을 수 있으며, 유전자 재조합 기술을 통하여 제작할 수 있다.Additionally, in the present invention, the “antibody fragment” refers to a fragment that possesses an antigen-binding function and includes Fab, Fab', F(ab')2, and Fv. The Fab has a structure that includes the variable regions of the light and heavy chains, the constant region of the light chain, and the first constant region (CH1 domain) of the heavy chain, and has one antigen binding site. Additionally, Fab' differs from Fab in that it has a hinge region containing one or more cysteine residues at the C terminus of the heavy chain CH1 domain. F(ab')2 antibody is produced when the cysteine residue in the hinge region of Fab' forms a disulfide bond. Fv (Variable fragment) refers to the minimum antibody fragment containing only the heavy chain variable region and light chain variable region. In double-chain Fv (dsFv), the heavy chain variable region and light chain variable region are connected by a disulfide bond, and in single-chain Fv (scFv), the heavy chain variable region and light chain variable region are generally covalently connected through a peptide linker. . The antibody fragment can be obtained as a Fab or F(ab')2 fragment using a proteolytic enzyme, for example, papain or pepsin, and can be produced through genetic recombination technology.
또한, 본 발명에서 상기 항체는 키메라 항체, 인간화 항체(humanized antibody), 이가(bivalent), 양특이성 분자, 미니바디(minibody), 도메인 항체, 이중특이적 항체(bispecific antibody), 항체 모방체, 유니바디(unibody) 디아바디(diabody), 트리아바디(triabody), 테트라바디(tetrabody), 또는 이의 단편일 수 있으나, 이에 제한되는 것은 아니다. In addition, in the present invention, the antibody is a chimeric antibody, humanized antibody, bivalent, bispecific molecule, minibody, domain antibody, bispecific antibody, antibody mimetic, and unispecific antibody. The body (unibody) may be a diabody, triabody, tetrabody, or a fragment thereof, but is not limited thereto.
본 발명에서 상기 "키메라 항체"는, 생쥐 항체의 가변 영역 및 인간 항체의 불변 영역을 재조합 시킨 항체로서, 생쥐 항체에 비하여 면역 반응이 크게 개선된 항체이다.In the present invention, the "chimeric antibody" is an antibody in which the variable region of a mouse antibody and the constant region of a human antibody are recombined, and the immune response is greatly improved compared to the mouse antibody.
또한, 본 발명에서 상기 "인간화 항체"는 인간이 아닌 종에서 유래한 항체의 단백질 서열을 인간에서 자연적으로 생산된 항체 변이체와 유사하도록 변형시킨 항체를 의미한다. 그 예로 상기 인간화 항체는 생쥐 유래의 CDR을 인간 항체 유래의 FR과 재조합시켜 인간화 가변 영역을 제조하고, 이를 바람직한 인간 항체의 불변 영역과 재조합시켜 인간화 항체를 제조할 수 있다.Additionally, in the present invention, the “humanized antibody” refers to an antibody in which the protein sequence of an antibody derived from a non-human species has been modified to be similar to an antibody variant naturally produced in humans. For example, the humanized antibody can be manufactured by recombining mouse-derived CDRs with FRs derived from a human antibody to prepare a humanized variable region, and then recombining this with the constant region of a desired human antibody.
본 발명에서 상기 결합 분자는 Lrig-1 단백질에 결합할 수 있고, 그 외의 다른 단백질에도 결합할 수 있는 이중특이적 항체 또는 이중특이적 항원 결합 단편으로도 제공될 수 있다. In the present invention, the binding molecule can bind to the Lrig-1 protein and can also be provided as a bispecific antibody or bispecific antigen-binding fragment that can bind to other proteins.
본 발명에서 상기 이중특이적 항체 및 이중특이적 항원 결합 단편은 본 발명에 따르는 결합 분자를 포함할 수 있다. 본 발명에서 일 예시로, 상기 이중특이적 항체 및 이중특이적 항원 결합 단편은 Lrig-1 단백질에 결합할 수 있는 항원 결합 도메인을 포함하고, 여기서 Lrig-1 단백질에 결합할 수 있는 항원 결합 도메인은 본 발명에 따르는 결합 분자를 포함하거나 이로 구성될 수 있으며, 혈액-뇌 장벽 수용체(blood-brain barrier receptor)에 결합할 수 있는 항원 결합 도메인을 포함할 수 있다.In the present invention, the bispecific antibody and bispecific antigen binding fragment may include a binding molecule according to the present invention. As an example in the present invention, the bispecific antibody and the bispecific antigen binding fragment include an antigen binding domain capable of binding to the Lrig-1 protein, wherein the antigen binding domain capable of binding to the Lrig-1 protein is It may comprise or consist of a binding molecule according to the present invention and may comprise an antigen binding domain capable of binding to a blood-brain barrier receptor.
본 발명에서 제공하는 이중특이적 항체 및 이중특이적 항원 결합 단편은 본 발명에 따른 Lrig-1 단백질에 결합할 수 있는 결합 분자인 항원 결합 도메인, 및 혈액-뇌 장벽 수용체(blood-brain barrier receptor)에 결합할 수 있는 항원 결합 도메인을 포함한다. The bispecific antibodies and bispecific antigen-binding fragments provided by the present invention include an antigen-binding domain, which is a binding molecule capable of binding to the Lrig-1 protein according to the present invention, and a blood-brain barrier receptor. Contains an antigen binding domain capable of binding to.
본 발명에 따르는 이중특이적 항체 및 이중특이적 항원 결합 단편은 임의의 적합한 포맷, 예를 들면, 전문이 본원에 참조로 인용된 문헌에 기재된 포맷으로 제공될 수 있다. 예를 들면, 이중특이적 항체 또는 이중특이적 항원 결합 단편은 이중특이적 항체 접합체(예: IgG2, F(ab')2 또는 CovX-바디), 이중특이적 IgG 또는 IgG-형 분자(예: IgG, scFv4-Ig, IgG-scFv, scFv-IgG, DVD-Ig, IgG-sVD, sVD-IgG, 또는 2 인(in) 1-IgG, mAb2, 또는 Tandemab common LC), 비대칭성 이중특이적 IgG 또는 IgG-형 분자(예: kih IgG, kih IgG common LC, CrossMab, kih IgG-scFab, mAb-Fv, 전하쌍 또는 SEED-바디), 소형 이중특이적 항체 분자(예: 디아바디(Db), dsDb, DART, scDb, tandAbs, 탠덤 scFv (taFv), 탠덤 dAb/VHH, 트리플 바디, 트리플 헤드, Fab-scFv, 또는 F(ab')2-scFv2), 이중특이적 Fc 및 CH3 융합 단백질(예: taFv-Fc, 디-디아바디, scDb-CH3, scFv-Fc-scFv, HCAb-VHH, scFv-kih-Fc, 또는 scFv-kih-CH3), 또는 이중특이적 융합 단백질(예: scFv2-알부민, scDb-알부민, taFv-독소, DNL-Fab3, DNL-Fab4-IgG, DNL-Fab4-IgG-사이토카인2)일 수 있다. 당업자는 본 발명에 따르는 이중특이적 항체 및 이중특이적 항원 결합 단편을 설계하고 제조할 수 있다.Bispecific antibodies and bispecific antigen binding fragments according to the invention may be provided in any suitable format, for example, those described in the literature incorporated herein by reference in their entirety. For example, a bispecific antibody or bispecific antigen binding fragment may be a bispecific antibody conjugate (e.g. an IgG2, F(ab')2 or CovX-body), a bispecific IgG or an IgG-type molecule (e.g. IgG, scFv4-Ig, IgG-scFv, scFv-IgG, DVD-Ig, IgG-sVD, sVD-IgG, or 2 in 1-IgG, mAb2, or Tandemab common LC), asymmetric bispecific IgG or IgG-type molecules (e.g. kih IgG, kih IgG common LC, CrossMab, kih IgG-scFab, mAb-Fv, charge pair or SEED-body), small bispecific antibody molecules (e.g. diabody (Db), dsDb, DART, scDb, tandAbs, tandem scFv (taFv), tandem dAb/VHH, triple body, triple head, Fab-scFv, or F(ab')2-scFv2), bispecific Fc and CH3 fusion proteins (e.g. : taFv-Fc, di-diabody, scDb-CH3, scFv-Fc-scFv, HCAb-VHH, scFv-kih-Fc, or scFv-kih-CH3), or bispecific fusion protein (e.g. scFv2-albumin , scDb-albumin, taFv-toxin, DNL-Fab3, DNL-Fab4-IgG, DNL-Fab4-IgG-cytokine2). Those skilled in the art can design and prepare bispecific antibodies and bispecific antigen binding fragments according to the present invention.
본 발명에서 상기 이중특이적 항체를 생산하는 방법은, 환원성 디설파이드 또는 비환원성 티오에테르 결합과 항체 또는 항체 단편의 화학적 가교결합을 포함한다. 예를 들면, N-석신이미딜-3-(-2-피리딜디티오)-프로피오네이트(SPDP)는 디설파이드 연결된 이중특이적 F(ab)2 헤테로다이머를 생성하기 위해, 예를 들면, 힌지 영역 SH- 그룹을 통해 Fab 단편을 화학적으로 가교결합시키는데 사용될 수 있다.The method for producing the bispecific antibody in the present invention includes chemical cross-linking of an antibody or antibody fragment with a reducing disulfide or non-reducing thioether bond. For example, N-succinimidyl-3-(-2-pyridyldithio)-propionate (SPDP) can be used to generate disulfide-linked bispecific F(ab)2 heterodimers, e.g. It can be used to chemically cross-link Fab fragments through the hinge region SH- group.
또한, 본 발명에서 상기 이중특이적 항체를 생산하기 위한 다른 방법은 이중특이적 항체를 분비할 수 있는 쿼드로마 세포를 생성하기 위해 항체-생산 하이브리도마를, 예를 들면, 폴리에틸렌 글리콜과 융합시킴을 포함한다.In addition, another method for producing the bispecific antibody in the present invention is to fuse the antibody-producing hybridoma with, for example, polyethylene glycol to generate quadroma cells capable of secreting the bispecific antibody. Includes.
본 발명에 따르는 이중특이적 항체 및 이중특이적 항원 결합 단편은 예를 들면, 항원 결합 분자를 위한 폴리펩티드를 코딩하는 핵산 작제물로부터 발현에 의해 재조합으로 생산될 수 있다.Bispecific antibodies and bispecific antigen-binding fragments according to the invention can be produced recombinantly, for example, by expression from a nucleic acid construct encoding a polypeptide for the antigen-binding molecule.
예를 들면, 2개의 항원 결합 도메인(즉, PD-1 등에 결합할 수 있는 항원 결합 도메인을 위한 경쇄 및 중쇄 가변 도메인, 및 다른 표적 단백질에 결합할 수 있는 항원 결합 도메인을 위한 경쇄 및 중쇄 가변 도메인)을 위한 경쇄 및 중쇄 가변 도메인을 코딩하고, 항원 결합 도메인 사이의 적합한 링커 또는 이량체화 도메인을 코딩하는 서열을 포함하는 DNA 작제물은 분자 클로닝 기술에 의해 제조될 수 있다. 재조합 이중특이적 항체는 이후 적합한 숙주 세포(예: 포유류 숙주 세포) 중에서 작제물의 발현(예: 시험관 내)에 의해 생산될 수 있고, 이어서 발현된 재조합 이중특이적 항체는 임의로 정제될 수 있다.For example, two antigen binding domains (i.e., light and heavy chain variable domains for an antigen binding domain capable of binding PD-1, etc., and light and heavy chain variable domains for an antigen binding domain capable of binding other target proteins). A DNA construct encoding light and heavy chain variable domains for ) and comprising sequences encoding a suitable linker or dimerization domain between the antigen binding domains can be prepared by molecular cloning techniques. The recombinant bispecific antibody can then be produced by expression (e.g., in vitro) of the construct in a suitable host cell (e.g., a mammalian host cell), and the expressed recombinant bispecific antibody can then optionally be purified.
항체는, 비변형된 부모 항체와 비교하여 항원에 대한 항체의 친화도가 개선된 변형된 항체가 생성되는 친화도 성숙 공정에 의해 생성될 수 있다. 친화도 성숙 항체는 당해 기술 분야에 공지된 절차로 생산될 수 있다.Antibodies may be produced by an affinity maturation process in which modified antibodies are produced with improved affinity of the antibody for the antigen compared to the unmodified parent antibody. Affinity mature antibodies can be produced by procedures known in the art.
아울러, 본 발명에서 제공하는 결합 분자는, Lrig-1 단백질에 특이적으로 결합할 수 있는 한, 상기 아미노산 서열의 변이체를 포함할 수 있다. 예를 들면, 항체의 결합 친화도 및/또는 기타 생물학적 특성을 개선시키기 위하여 항체의 아미노산 서열에 변화를 줄 수 있다. 이러한 변형은, 예를 들어 항체의 아미노산 서열 잔기의 결실, 삽입 및/또는 치환을 포함한다.In addition, the binding molecule provided by the present invention may include a variant of the above amino acid sequence as long as it can specifically bind to the Lrig-1 protein. For example, changes can be made to the amino acid sequence of an antibody to improve its binding affinity and/or other biological properties. Such modifications include, for example, deletions, insertions and/or substitutions of amino acid sequence residues of the antibody.
이러한 아미노산 변이는 아미노산 곁사슬 치환체의 상대적 유사성, 예컨대, 소수성, 친수성, 전하, 크기 등에 기초하여 이루어진다. 아미노산 곁사슬 치환체의 크기, 모양 및 종류에 대한 분석에 의하여, 아르기닌, 라이신과 히스티딘은 모두 양전하를 띤 잔기이고; 알라닌, 글라이신과 세린은 유사한 크기를 갖으며; 페닐알라닌, 트립토판과 타이로신은 유사한 모양을 갖는다는 것을 알 수 있다. 따라서 이러한 고려 사항에 기초하여, 아르기닌, 라이신 및 히스티딘; 알라닌, 글라이신 및 세린; 그리고 페닐알라닌, 트립토판 및 타이로신은 생물학적으로 기능 균등물이라 할 수 있다.These amino acid mutations are made based on the relative similarity of amino acid side chain substitutions, such as hydrophobicity, hydrophilicity, charge, size, etc. Analysis of the size, shape and type of amino acid side chain substitutions shows that arginine, lysine and histidine are all positively charged residues; Alanine, glycine and serine have similar sizes; It can be seen that phenylalanine, tryptophan and tyrosine have similar shapes. Therefore, based on these considerations, arginine, lysine and histidine; alanine, glycine, and serine; And phenylalanine, tryptophan, and tyrosine can be said to be biologically equivalent in function.
변이를 도입하는 데 있어서, 아미노산의 소수성 인덱스 (hydropathic index)가 고려될 수 있다. 각각의 아미노산은 소수성과 전하에 따라 소수성 인덱스가 부여되어 있다: 아이소루이신(+4.5); 발린(+4.2); 루이신(+3.8); 페닐알라닌(+2.8); 시스테인/시스타인(+2.5); 메티오닌(+1.9); 알라닌(+1.8); 글라이신(-0.4); 쓰레오닌(-0.7); 세린(-0.8); 트립토판(-0.9); 타이로신(-1.3); 프롤린(-1.6); 히스티딘(-3.2); 글루타메이트(-3.5); 글루타민(-3.5); 아스파르테이트(-3.5); 아스파라긴(-3.5); 라이신(-3.9); 및 아르기닌(-4.5). 단백질의 상호적인 생물학적 기능(interactive biological function)을 부여하는 데 있어서 소수성 아미노산 인덱스는 매우 중요하다. 유사한 소수성 인덱스를 가지는 아미노산으로 치환하여야 유사한 생물학적 활성을 보유할 수 있다는 것은 공지된 사실이다. 소수성 인덱스를 참조하여 변이를 도입시키는 경우, 바람직하게는 ±2 이내, 보다 바람직하게는 ± 1 이내, 보다 더 바람직하게는 ± 0.5 이내의 소수성 인덱스 차이를 나타내는 아미노산 사이에 치환을 한다.In introducing mutations, the hydrophobic index of the amino acid may be considered. Each amino acid is assigned a hydrophobicity index based on its hydrophobicity and charge: isoleucine (+4.5); Valine (+4.2); leucine (+3.8); phenylalanine (+2.8); Cysteine/Cysteine (+2.5); Methionine (+1.9); Alanine (+1.8); Glycine (-0.4); Threonine (-0.7); Serine (-0.8); tryptophan (-0.9); Tyrosine (-1.3); Proline (-1.6); histidine (-3.2); glutamate (-3.5); glutamine (-3.5); Aspartate (-3.5); Asparagine (-3.5); Lysine (-3.9); and arginine (-4.5). The hydrophobic amino acid index is very important in imparting interactive biological functions to proteins. It is a known fact that similar biological activity can be maintained only when substituted with an amino acid having a similar hydrophobic index. When introducing a mutation with reference to the hydrophobicity index, substitution is made between amino acids showing a difference in the hydrophobicity index, preferably within ±2, more preferably within ±1, and even more preferably within ±0.5.
한편, 유사한 친수성 값(hydrophilicity value)을 가지는 아미노산 사이의 치환이 균등한 생물학적 활성을 갖는 단백질을 초래한다는 것도 잘 알려져 있다. 이미 공지된 것과 같이, 다음의 친수성 값이 각각의 아미노산 잔기에 부여되어 있다: 아르기닌(+3.0); 라이신(+3.0); 아스팔테이트(+3.0± 1); 글루타메이트(+3.0±1); 세린(+0.3); 아스파라긴(+0.2); 글루타민(+0.2); 글라이신(0); 쓰레오닌(-0.4); 프롤린(-0.5±1); 알라닌(-0.5); 히스티딘(-0.5); 시스테인(-1.0); 메티오닌(-1.3); 발린(-1.5); 루이신(-1.8); 아이소루이신(-1.8); 타이로신(-2.3); 페닐알라닌(-2.5); 트립토판(-3.4). 친수성 값을 참조하여 변이를 도입시키는 경우, 바람직하게는 ± 2 이내, 보다 바람직하게는 ± 1 이내, 보다 더 바람직하게는 ± 0.5 이내의 친수성 값 차이를 나타내는 아미노산 사이에서 치환을 수행할 수 있다.Meanwhile, it is also well known that substitution between amino acids with similar hydrophilicity values results in proteins with equal biological activity. As already known, the following hydrophilicity values are assigned to each amino acid residue: arginine (+3.0); Lysine (+3.0); Asphaltate (+3.0± 1); glutamate (+3.0±1); serine (+0.3); Asparagine (+0.2); Glutamine (+0.2); Glycine (0); Threonine (-0.4); Proline (-0.5±1); Alanine (-0.5); histidine (-0.5); Cysteine (-1.0); Methionine (-1.3); Valine (-1.5); leucine (-1.8); isoleucine (-1.8); Tyrosine (-2.3); Phenylalanine (-2.5); Tryptophan (-3.4). When introducing a mutation with reference to the hydrophilicity value, substitution can be made between amino acids showing a difference in hydrophilicity value, preferably within ±2, more preferably within ±1, and even more preferably within ±0.5.
분자의 활성을 전체적으로 변경시키지 않는 단백질에서의 아미노산 교환은 당해 분야에 공지되어 있다. 가장 통상적으로 일어나는 교환은 아미노산 잔기 Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Tyr/Phe, Ala/Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Gln/Glu 간의 교환이다.Amino acid exchanges in proteins that do not overall alter the activity of the molecule are known in the art. The most common exchanges are amino acid residues Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Tyr/Phe, Ala/ It is an exchange between Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, and Gln/Glu.
상술한 생물학적 균등 활성을 갖는 변이를 고려한다면, 본 발명의 결합 분자는 서열목록에 기재된 서열과 실질적인 동일성(substantial identity)을 나타내는 서열도 포함하는 것으로 해석된다.Considering the mutations with bioequivalent activity described above, the binding molecule of the present invention is interpreted to also include sequences showing substantial identity with the sequences listed in the sequence listing.
본 발명에서 용어 "실질적인 동일성"이란, 본 발명의 서열과 임의의 다른 서열을 최대한 대응되도록 병렬하고, 당업계에서 통상적으로 이용되는 알고리즘을 이용하여 병렬된 서열을 분석한 경우에, 최소 61%의 상동성, 보다 바람직하게는 70%의 상동성, 보다 더 바람직하게는 80%의 상동성, 가장 바람직하게는 90%의 상동성을 나타내는 서열을 의미한다. 서열 비교를 위한 얼라인먼트 방법은 당업계에 공지되어 있다. 얼라인먼트에 대한 다양한 방법 및 알고리즘은 NCBI Basic Local Alignment Search Tool (BLAST), NBCI (National Center for Biological Information) 등에서 접근 가능하며, 인터넷상에서 blastp, blasm, blastx, tblastn and tblastx와 같은 서열 분석 프로그램과 연동되어 이용할 수 있다. BLSAT는 이 주소에서 접속 가능하다(www.ncbi.nlm.nih.gov/BLAST/). 이 프로그램을 이용한 서열 상동성 비교 방법은 온라인(www.ncbi.nlm.nih.gov/BLAST/blast_help.html)을 통해 확인할 수 있다.In the present invention, the term "substantial identity" means that the sequence of the present invention and any other sequence are paralleled to the maximum extent possible, and when the parallel sequences are analyzed using an algorithm commonly used in the art, the identity of the sequence is at least 61%. It means a sequence showing homology, more preferably 70% homology, even more preferably 80% homology, and most preferably 90% homology. Alignment methods for sequence comparison are known in the art. Various methods and algorithms for alignment are accessible from NCBI Basic Local Alignment Search Tool (BLAST), NBCI (National Center for Biological Information), etc., and are linked to sequence analysis programs such as blastp, blasm, blastx, tblastn and tblastx on the Internet. Available. BLSAT can be accessed at this address (www.ncbi.nlm.nih.gov/BLAST/). The sequence homology comparison method using this program can be checked online (www.ncbi.nlm.nih.gov/BLAST/blast_help.html).
본 발명에서 상기 결합 분자, 바람직하게 상기 항체는, 항체를 생산하는 통상의 방법에 의해 생성될 수 있지만, 친화도 성숙(Affinity maturation)에 의해 생성될 수 있다.In the present invention, the binding molecule, preferably the antibody, may be produced by a conventional method for producing antibodies, but may also be produced by affinity maturation.
본 발명에서 상기 "친화도 성숙(Affinity maturation)"은, 활성화된 B 세포가 면역 반응 과정에서 항원에 대한 친화도가 증가된 항체를 생산하는 과정을 의미한다. 본 발명의 목적상 상기 친화도 성숙은 자연에서 일어나는 과정과 동일하게, 돌연변이와 선택의 원리에 기초하여 친화도 성숙으로 인해 생성된 항체 또는 항체 단편을 생성할 수 있다.In the present invention, “affinity maturation” refers to the process by which activated B cells produce antibodies with increased affinity for an antigen during an immune response. For the purposes of the present invention, the affinity maturation can produce antibodies or antibody fragments produced by affinity maturation based on the principles of mutation and selection, identical to the process that occurs in nature.
본 발명의 약학적 조성물에 있어서, 본원발명의 유효성분은 뇌의 미세아교세포(microglial cell)에서 베타 아밀로이드의 내 포화(endocytosys) 및 내포화된 베타 아밀로이드의 분해를 촉진함으로써 베타 아밀로이드 축적으로 인해 발병하는 질병을 치료 및 개선할 수 있다.In the pharmaceutical composition of the present invention, the active ingredient of the present invention promotes endocytosys of beta amyloid and decomposition of endocytosed beta amyloid in microglial cells of the brain, thereby causing beta amyloid accumulation. Diseases can be treated and improved.
상기 약학적 조성물에 있어서, 상기 베타 아밀로이드 축적으로 인해 발병하는 질병은 알츠하이머병(Alzheimer's disease), 루위체 치매(Lewy body dementia), 근염(myositis), 또는 대뇌 밀로이드 맥관병증(cerebral amyloid angiopathy)일 수 있다.In the pharmaceutical composition, the disease caused by beta amyloid accumulation is Alzheimer's disease, Lewy body dementia, myositis, or cerebral amyloid angiopathy. You can.
또한, 본 발명에서 제공하는 조성물은 약학 조성물 또는 식품 조성물로 사용될 수 있으나, 이에 제한되는 것은 아니다. Additionally, the composition provided by the present invention can be used as a pharmaceutical composition or a food composition, but is not limited thereto.
본 발명의 상기 "예방"은 본 발명의 상기 조성물을 이용하여 뇌신경계 질환에 의해 기인된 증상을 차단하거나, 그 증상을 억제 또는 지연시킬 수 있는 모든 행위라면 제한없이 포함될 수 있다.The "prevention" of the present invention may include, without limitation, any action that can block, suppress or delay symptoms caused by a brain nervous system disease using the composition of the present invention.
본 발명의 상기 "치료" 및 "개선"은 본 발명의 상기 조성물을 이용하여 뇌신경계 질환에 의해 기인된 증상이 호전될 수 있도록 하거나, 이롭게 될 수 있도록 하는 모든 행위라면 제한없이 포함될 수 있다.The “treatment” and “improvement” of the present invention may include, without limitation, any action that improves symptoms caused by a cranial nervous system disease or provides benefits by using the composition of the present invention.
본 발명에 있어서, 상기 약학 조성물은 캡슐, 정제, 과립, 주사제, 연고제, 분말 또는 음료 형태임을 특징으로 할 수 있으며, 상기 약학 조성물은 인간을 대상으로 하는 것을 특징으로 할 수 있다. In the present invention, the pharmaceutical composition may be in the form of a capsule, tablet, granule, injection, ointment, powder, or beverage, and the pharmaceutical composition may be intended for human subjects.
본 발명의 약학 조성물은 이들로 한정되는 것은 아니지만, 각각 통상의 방법에 따라 산제, 과립제, 캡슐, 정제, 수성 현탁액 등의 경구형 제형, 외용제, 좌제 및 멸균 주사용액의 형태로 제형화하여 사용될 수 있다. 본 발명의 약학 조성물은 약제적으로 허용 가능한 담체를 포함할 수 있다. 약제학적으로 허용되는 담체는 경구 투여 시에는 결합제, 활탁제, 붕해제, 부형제, 가용화제, 분산제, 안정화제, 현탁화제, 색소, 향료 등을 사용할 수 있으며, 주사제의 경우에는 완충제, 보존제, 무통화제, 가용화제, 등장제, 안정화제 등을 혼합하여 사용할 수 있으며, 국소투여용의 경우에는 기제, 부형제, 윤활제, 보존제 등을 사용할 수 있다. 본 발명의 약제학적 조성물의 제형은 상술한 바와 같은 약제학적으로 허용되는 담체와 혼합하여 다양하게 제조될 수 있다. 예를 들어, 경구 투여시에는 정제, 트로키, 캡슐, 엘릭서(elixir), 서스펜션, 시럽, 웨이퍼 등의 형태로 제조할 수 있으며, 주사제의 경우에는 단위 투약 앰플 또는 다수회 투약 형태로 제조할 수 있다. 기타, 용액, 현탁액, 정제, 캡슐, 서방형 제제 등으로 제형할 수 있다.The pharmaceutical composition of the present invention is not limited to these, but can be formulated and used in the form of oral dosage forms such as powders, granules, capsules, tablets, and aqueous suspensions, external preparations, suppositories, and sterile injection solutions according to conventional methods. there is. The pharmaceutical composition of the present invention may include a pharmaceutically acceptable carrier. Pharmaceutically acceptable carriers include binders, lubricants, disintegrants, excipients, solubilizers, dispersants, stabilizers, suspending agents, colorants, flavorings, etc. for oral administration, and buffers, preservatives, and analgesics for injections. Topics, solubilizers, isotonic agents, stabilizers, etc. can be mixed and used, and for topical administration, bases, excipients, lubricants, preservatives, etc. can be used. The dosage form of the pharmaceutical composition of the present invention can be prepared in various ways by mixing it with a pharmaceutically acceptable carrier as described above. For example, for oral administration, it can be manufactured in the form of tablets, troches, capsules, elixirs, suspensions, syrups, wafers, etc., and for injections, it can be manufactured in the form of unit dosage ampoules or multiple dosage forms. there is. In addition, it can be formulated as a solution, suspension, tablet, capsule, sustained-release preparation, etc.
한편, 제제화에 적합한 담체, 부형제 및 희석제의 예로는, 락토즈, 덱스트로즈, 수크로즈, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말디톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 미정질 셀룰로즈, 폴리비닐피롤리돈, 물, 메틸하이드록시벤조에이트, 프로필하이드록시벤조에이트, 탈크, 마그네슘 스테아레이트 또는 광물유 등이 사용될 수 있다. 또한, 충진제, 항응집제, 윤활제, 습윤제, 향료, 유화제, 방부제 등을 추가로 포함할 수 있다.Meanwhile, examples of carriers, excipients and diluents suitable for formulation include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, malditol, starch, gum acacia, alginate, gelatin, calcium phosphate, calcium silicate, Cellulose, methyl cellulose, microcrystalline cellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, or mineral oil may be used. In addition, fillers, anti-coagulants, lubricants, wetting agents, fragrances, emulsifiers, preservatives, etc. may be additionally included.
본 발명에 따른 약학 조성물의 투여 경로는 이들로 한정되는 것은 아니지만 구강, 정맥내, 근육내, 동맥내, 골수내, 경막내, 심장내, 경피, 피하, 복강내, 비강내, 장관, 국소, 설하 또는 직장이 포함된다. 경구 또는 비경구 투하가 바람직하다. The route of administration of the pharmaceutical composition according to the present invention is not limited to these, but is oral, intravenous, intramuscular, intraarterial, intramedullary, intrathecal, intracardiac, transdermal, subcutaneous, intraperitoneal, intranasal, enteral, topical, Includes sublingual or rectal areas. Oral or parenteral administration is preferred.
본 발명에서, "비경구"는 피하, 피내, 정맥내, 근육내, 관절내, 활액낭내, 흉골내, 경막내, 병소내 및 두개골내 주사 또는 주입기술을 포함한다. 본 발명의 약학 조성물은 또한 직장 투여를 위한 좌제의 형태로 투여될 수 있다.As used herein, “parenteral” includes subcutaneous, intradermal, intravenous, intramuscular, intraarticular, intrasynovial, intrasternal, intrathecal, intralesional and intracranial injection or infusion techniques. The pharmaceutical composition of the present invention can also be administered in the form of a suppository for rectal administration.
본 발명의 약학 조성물은 사용된 특정 화합물의 활성, 연령, 체중, 일반적인 건강, 성별, 정식, 투여시간, 투여경로, 배출율, 약물 배합 및 예방 또는 치료될 특정 질환의 중증을 포함한 여러 요인에 따라 다양하게 변할 수 있고, 상기 약학 조성물의 투여량은 환자의 상태, 체중, 질병의 정도, 약물 형태, 투여경로 및 기간에 따라 다르지만 당업자에 의해 적절하게 선택될 수 있고, 1일 0.0001 내지 50mg/kg 또는 0.001 내지 50mg/kg으로 투여할 수 있다. 상기 투여는 하루에 한번 또는 수회 나누어 투여할 수도 있다. 상기 투여량은 어떠한 면으로든 본 발명의 범위를 한정하는 것은 아니다. 본 발명에 따른 의약 조성물은 환제, 당의정, 캡슐, 액제, 겔, 시럽, 슬러리, 현탁제로 제형될 수 있다.The pharmaceutical composition of the present invention varies depending on several factors, including the activity of the specific compound used, age, body weight, general health, gender, diet, administration time, administration route, excretion rate, drug formulation, and the severity of the specific disease to be prevented or treated. The dosage of the pharmaceutical composition may vary depending on the patient's condition, body weight, degree of disease, drug form, administration route and period, but may be appropriately selected by a person skilled in the art, and may range from 0.0001 to 50 mg/kg per day. It can be administered at 0.001 to 50 mg/kg. The above administration may be administered once a day or in divided doses. The above dosage does not limit the scope of the present invention in any way. The pharmaceutical composition according to the present invention may be formulated as pills, dragees, capsules, solutions, gels, syrups, slurries, and suspensions.
본 발명의 조성물을 유효성분으로 포함하는 식품 조성물은 각종 식품류, 예를 들어, 음료, 껌, 차, 비타민 복합제, 분말, 과립, 정제, 캡슐, 과자, 떡, 빵 등의 형태로 제조될 수 있다. 본 발명의 식품 조성물은 독성 및 부작용이 거의 없는 식물추출물로 구성된 것이므로 예방 목적으로 장기간 복용 시에도 안심하고 사용할 수 있다.Food compositions containing the composition of the present invention as an active ingredient can be manufactured in the form of various foods, such as beverages, gum, tea, vitamin complexes, powders, granules, tablets, capsules, snacks, rice cakes, bread, etc. . The food composition of the present invention is composed of plant extracts with little toxicity and side effects, so it can be used safely even when taken for long periods of time for preventive purposes.
본 발명의 조성물이 식품 조성물에 포함될 때 그 양은 전체 중량의 0.1 내지 50%의 비율로 첨가할 수 있다.When the composition of the present invention is included in a food composition, it can be added in an amount of 0.1 to 50% of the total weight.
여기서, 상기 식품 조성물이 음료 형태로 제조되는 경우 지시된 비율로 상기 식품 조성물을 함유하는 것 외에 특별한 제한점은 없으며 통상의 음료와 같이 여러가지 향미제 또는 천연 탄수화물 등을 추가 성분으로서 함유할 수 있다. 즉, 천연 탄수화물로서 포도당 등의 모노사카라이드, 과당 등의 디사카라이드, 슈크로스 등의 및 폴리사카라이드, 덱스트린, 시클로덱스트린 등과 같은 통상적인 당 및 자일리톨, 소르비톨, 에리트리톨 등의 당알콜 등을 포함할 수 있다. 상기 향미제로서는 천연 향미제(타우마틴, 스테비아 추출물(예를 들어 레바우디오시드 A, 글리시르히진등) 및 합성 향미제(사카린, 아스파르탐 등) 등을 들 수 있다. Here, when the food composition is manufactured in the form of a beverage, there are no particular limitations other than containing the food composition in the indicated ratio, and various flavoring agents or natural carbohydrates can be contained as additional ingredients like ordinary beverages. That is, natural carbohydrates include monosaccharides such as glucose, disaccharides such as fructose, polysaccharides such as sucrose, dextrin, cyclodextrin, etc., and sugar alcohols such as xylitol, sorbitol, and erythritol. can do. Examples of the flavoring agent include natural flavoring agents (thaumatin, stevia extract (e.g., rebaudioside A, glycyrrhizin, etc.)) and synthetic flavoring agents (saccharin, aspartame, etc.).
그 외 본 발명의 식품 조성물은 여러 가지 영양제, 비타민, 광물(전해질), 합성 풍미제 및 천연 풍미제 등의 풍미제, 착색제, 펙트산 및 그의 염, 알긴산 및 그의 염, 유기산, 보호성 콜로이드 증점제, pH 조절제, 안정화제, 방부제, 글리세린, 알콜, 탄산 음료에 사용되는 탄산화제 등을 함유할 수 있다.In addition, the food composition of the present invention contains various nutrients, vitamins, minerals (electrolytes), flavoring agents such as synthetic and natural flavors, colorants, pectic acid and its salts, alginic acid and its salts, organic acids, and protective colloidal thickeners. , pH adjusters, stabilizers, preservatives, glycerin, alcohol, carbonating agents used in carbonated beverages, etc.
이러한 성분은 독립적으로 또는 조합하여 사용할 수 있다. 이러한 첨가제의 비율은 그렇게 중요하진 않지만 본 발명의 조성물 100 중량부 당 0.1 내지 약 50 중량부의 범위에서 선택되는 것이 일반적이다.These ingredients can be used independently or in combination. The proportion of these additives is not critical, but is generally selected in the range of 0.1 to about 50 parts by weight per 100 parts by weight of the composition of the present invention.
본 발명에서 상기 "개체"는 뇌신경계 질환의 발병이 의심되는 개체로서, 상기 질환 발병의 의심 개체는 해당 질환이 발병하였거나 발병할 수 있는 인간을 포함한 쥐, 가축 등을 포함하는 포유동물을 의미하나, 본 발명에서 제공하는 유효 물질로 치료 가능한 개체는 제한 없이 포함된다.In the present invention, the “individual” refers to an individual suspected of having a brain nervous system disease, and the subject suspected of having the disease refers to a mammal, including humans, rats, livestock, etc., that has or may develop the disease. , subjects that can be treated with the effective substance provided by the present invention are included without limitation.
본 발명의 방법을 통해 치료되는 뇌신경계 질환은 신경 퇴행성 질환 또는 신경 염증성 질환일 수 있고, 그 구체적인 예시로는 뇌졸중, 치매, 알츠하이머병(Alzheimer's disease), 파킨슨병(Parkinson's disease), 헌팅턴병(Huntington's disease), 니만-피크병(Niemann-Pick disease), 다발성 경화증, 프리온병(prion disease), 크로이펠츠-야콥병(Creutzfeldt-Jakob disease), 전두측두치매, 루이치매, 근위축성 측삭경화증(AlzAmyotrophic lateral sclerosis), 부신생물증후군(Paraneoplastic syndrome), 피질기저퇴행증, 다계통위축병, 진행성핵상마비, 신경계 자가면역질환, 척수 소뇌 실조(spinocerebellar ataxia), 염증성 및 신경병증성 통증, 뇌혈관 질환, 척수 손상(spinal cord injury) 및 타우병증(tauopathy)으로 이루어진 군에서 선택될 수 있으나, 이에 제한되는 것은 아니다.The brain nervous system disease treated through the method of the present invention may be a neurodegenerative disease or a neuroinflammatory disease, and specific examples include stroke, dementia, Alzheimer's disease, Parkinson's disease, and Huntington's disease. ), Niemann-Pick disease, multiple sclerosis, prion disease, Creutzfeldt-Jakob disease, frontotemporal dementia, Lewy dementia, amyotrophic lateral sclerosis , Paraneoplastic syndrome, corticobasal degeneration, multiple system atrophy disease, progressive supranuclear palsy, nervous system autoimmune disease, spinocerebellar ataxia, inflammatory and neuropathic pain, cerebrovascular disease, spinal cord injury ( It may be selected from the group consisting of spinal cord injury and tauopathy, but is not limited thereto.
본 발명의 일 구현예에서는, 조절 T 세포(regulatory T cells, Treg cells)에 존재하는 Lrig-1(leucine-rich and immunoglobulin-like domains 1) 단백질에 특이적으로 결합하는 결합 분자 또는 이의 결합 단편; 및 혈액-뇌 장벽 수용체 항체(blood-brain barrier receptor antibody) 또는 이의 항원 결합 단편을 포함하는, Lrig-1 단백질에 특이적으로 결합하는 결합 분자/혈액-뇌 장벽 수용체 항체(blood-brain barrier receptor antibody)의 이중 특이적 항체를 제공한다.In one embodiment of the present invention, a binding molecule or binding fragment thereof that specifically binds to the Lrig-1 (leucine-rich and immunoglobulin-like domains 1) protein present in regulatory T cells (Treg cells); and a binding molecule/blood-brain barrier receptor antibody that specifically binds to the Lrig-1 protein, including a blood-brain barrier receptor antibody or an antigen-binding fragment thereof. ) provides a dual specific antibody.
본 발명의 다른 구현예에서는, 상기 혈액-뇌 장벽 수용체는 트랜스페린 수용체(transferrin receptor), 인슐린 수용체(insulin receptor), 인슐린 유사 성장 인자 수용체(insulin-like growth factor receptor), 저밀도 지질단백질 수용체 관련 단백질 8(low density lipoprotein receptor-related protein 8), 저밀도 지질단백질 수용체 관련 단백질 1(low density lipoprotein receptor-related protein 1), 헤파린 결합성 표피 유래 성정인자 유사 성장인자(heparin-binding epidermal growth factor-like growth factor), 렙틴 수용체(leptin receptor), 니코틴성 아세틸콜린 수용체(nicotinic acetylcholine receptor), 글루타티온 수송체(Glutathione transporter), 칼슘의존성 칼륨통로(calcium-activated potassium channel), 및 RAGE(receptor for advanced glycation endproducts) 중에서 선택되는 이중 특이적 항체를 제공한다.In another embodiment of the present invention, the blood-brain barrier receptor is transferrin receptor, insulin receptor, insulin-like growth factor receptor, low-density lipoprotein receptor-related protein 8. (low density lipoprotein receptor-related protein 8), low density lipoprotein receptor-related protein 1 (low density lipoprotein receptor-related protein 1), heparin-binding epidermal growth factor-like growth factor ), leptin receptor, nicotinic acetylcholine receptor, glutathione transporter, calcium-activated potassium channel, and RAGE (receptor for advanced glycation endproducts). A bispecific antibody of choice is provided.
본 발명의 다른 구현예에서는, 상기 인슐린 유사 성장 인자 수용체(insulin-like growth factor receptor)는 인슐린 유사 성장 인자 1 수용체(insulin-like growth factor1 receptor, IGF1R)인 Lrig-1 단백질에 특이적으로 결합하는 결합 분자/혈액-뇌 장벽 수용체 항체(blood-brain barrier receptor antibody)의 이중 특이적 항체를 제공한다.In another embodiment of the present invention, the insulin-like growth factor receptor (insulin-like growth factor receptor) specifically binds to the Lrig-1 protein, which is the insulin-like growth factor 1 receptor (IGF1R). Bispecific antibodies of binding molecules/blood-brain barrier receptor antibodies are provided.
본 발명의 다른 구현예에서는, 상기 인슐린 유사 성장 인자 1 수용체(insulin-like growth factor1 receptor, IGF1R) 항체의 항원 결합 단편은 scFv, (scFv)2, scFv-Fc, Fab, Fab' 및 F(ab')2로 이루어지는 것인, Lrig-1 단백질에 특이적으로 결합하는 결합 분자/혈액-뇌 장벽 수용체 항체(blood-brain barrier receptor antibody)의 이중 특이적 항체를 제공한다.In another embodiment of the present invention, the antigen-binding fragment of the insulin-like growth factor 1 receptor (IGF1R) antibody includes scFv, (scFv)2, scFv-Fc, Fab, Fab', and F(ab) ') It provides a bispecific antibody of a binding molecule/blood-brain barrier receptor antibody that specifically binds to the Lrig-1 protein.
본 발명의 다른 구현예에서는, 상기 Lrig-1 단백질에 특이적으로 결합하는 결합 분자는 완전한 결합분자이고, 인슐린 유사 성장 인자 1 수용체(insulin-like growth factor1 receptor, IGF1R) 항체는 항체의 Fv-단편인, 이중 특이적 항체를 제공한다.In another embodiment of the present invention, the binding molecule that specifically binds to the Lrig-1 protein is a complete binding molecule, and the insulin-like growth factor 1 receptor (IGF1R) antibody is an Fv-fragment of the antibody. phosphorus, provides a bispecific antibody.
본 발명의 다른 구현예에서는, 상기 Lrig-1 단백질에 특이적으로 결합하는 결합 분자의 완전한 결합 분자는 IgG1, IgG2, IgG3 또는 IgG4 형태인 이중 특이적 항체를 제공한다.In another embodiment of the present invention, a bispecific antibody is provided in which the complete binding molecule that specifically binds to the Lrig-1 protein is in the form of IgG1, IgG2, IgG3, or IgG4.
본 발명의 다른 구현예에서는, 상기 인슐린 유사 성장 인자 1 수용체(insulin-like growth factor1 receptor, IGF1R) 항체의 한 분자가 Lrig-1 단백질에 특이적으로 결합하는 결합 분자의 하나의 중쇄 CH3에 결합한 단가(monovalent) 이중 특이적 항체인 이중 특이적 항체를 제공한다.In another embodiment of the present invention, the unit price of one molecule of the insulin-like growth factor 1 receptor (IGF1R) antibody bound to one heavy chain CH3 of a binding molecule that specifically binds to the Lrig-1 protein Provides a bispecific antibody, which is a (monovalent) bispecific antibody.
본 발명의 다른 구현예에서는, 상기 조절 T 세포(regulatory T cells, Treg cells)에 존재하는 Lrig-1(leucine-rich and immunoglobulin-like domains 1) 단백질에 특이적으로 결합하는 결합 분자는, 서열번호 33으로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR1, 서열번호 34로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR2, 및 서열번호 35으로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR3를 포함하는 중쇄 가변 영역; 및 서열번호 36으로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR1, 서열번호 37으로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR2, 서열번호 38로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR3을 포함하는 경쇄 가변 영역을 포함하는 것인, 이중특이적 항체를 제공한다.In another embodiment of the present invention, the binding molecule that specifically binds to the Lrig-1 (leucine-rich and immunoglobulin-like domains 1) protein present in the regulatory T cells (Treg cells) is SEQ ID NO: A heavy chain variable region comprising a heavy chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 33, a heavy chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 34, and a heavy chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 35; And a light chain variable region comprising a light chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 36, a light chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 37, and a light chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 38. , provides bispecific antibodies.
본 발명의 다른 구현예에서는, 상기 인슐린 유사 성장 인자 1 수용체(insulin-like growth factor1 receptor, IGF1R) 항체는, (a) 서열번호 53으로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR1, 서열번호 54로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR2, 및 서열번호 57로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR3를 포함하는 중쇄 가변 영역; 및 서열번호 58로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR1, 서열번호 59로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR2, 서열번호 61로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR3을 포함하는 경쇄 가변 영역을 포함하는 것인, 인슐린 유사 성장 인자 1 수용체(insulin-like growth factor1 receptor, IGF1R) 항체; (b) 서열번호 53으로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR1, 서열번호 55로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR2, 및 서열번호 57로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR3를 포함하는 중쇄 가변 영역; 및 서열번호 58로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR1, 서열번호 60으로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR2, 서열번호 62로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR3을 포함하는 경쇄 가변 영역을 포함하는 것인, 인슐린 유사 성장 인자 1 수용체(insulin-like growth factor1 receptor, IGF1R) 항체; (c) 서열번호 53으로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR1, 서열번호 56로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR2, 및 서열번호 57로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR3를 포함하는 중쇄 가변 영역; 및 서열번호 58로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR1, 서열번호 60으로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR2, 서열번호 63로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR3을 포함하는 경쇄 가변 영역을 포함하는 것인, 인슐린 유사 성장 인자 1 수용체(insulin-like growth factor1 receptor, IGF1R) 항체; (d) 서열번호 53으로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR1, 서열번호 555로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR2, 및 서열번호 57로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR3를 포함하는 중쇄 가변 영역; 및 서열번호 58로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR1, 서열번호 60으로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR2, 서열번호 63로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR3을 포함하는 경쇄 가변 영역을 포함하는 것인, 인슐린 유사 성장 인자 1 수용체(insulin-like growth factor1 receptor, IGF1R) 항체;로 이루어진 군에서 선택되는 이중특이적 항체를 제공한다.In another embodiment of the present invention, the insulin-like growth factor 1 receptor (IGF1R) antibody includes (a) a heavy chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 53, and a heavy chain CDR1 shown in SEQ ID NO: 54. A heavy chain variable region comprising a heavy chain CDR2 consisting of an amino acid sequence, and a heavy chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 57; And a light chain variable region comprising a light chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 58, a light chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 59, and a light chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 61. , insulin-like growth factor 1 receptor (IGF1R) antibody; (b) a heavy chain variable region comprising a heavy chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 53, a heavy chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 55, and a heavy chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 57; And a light chain variable region comprising a light chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 58, a light chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 60, and a light chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 62. , insulin-like growth factor 1 receptor (IGF1R) antibody; (c) a heavy chain variable region comprising a heavy chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 53, a heavy chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 56, and a heavy chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 57; And a light chain variable region comprising a light chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 58, a light chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 60, and a light chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 63. , insulin-like growth factor 1 receptor (IGF1R) antibody; (d) a heavy chain variable region comprising heavy chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 53, heavy chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 555, and heavy chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 57; And a light chain variable region comprising a light chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 58, a light chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 60, and a light chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 63. It provides a bispecific antibody selected from the group consisting of an insulin-like growth factor 1 receptor (IGF1R) antibody.
본 발명의 다른 구현예에서는, 상기 뇌신경계 질환은 신경 퇴행성 질환 또는 신경 염증성 질환인, 약학 조성물을 제공한다.In another embodiment of the present invention, a pharmaceutical composition is provided wherein the brain nervous system disease is a neurodegenerative disease or a neuroinflammatory disease.
본 발명의 다른 구현예에서는, 상기 신경 퇴행성 질환 또는 신경 염증성 질환은 뇌졸중, 치매, 알츠하이머병(Alzheimer's disease), 파킨슨병(Parkinson's disease), 헌팅턴병(Huntington's disease), 니만-피크병(Niemann-Pick disease), 다발성 경화증, 프리온병(prion disease), 크로이펠츠-야콥병(Creutzfeldt-Jakob disease), 전두측두치매, 루이치매, 근위축성 측삭경화증(AlzAmyotrophic lateral sclerosis), 부신생물증후군(Paraneoplastic syndrome), 피질기저퇴행증, 다계통위축병, 진행성핵상마비, 신경계 자가면역질환, 척수 소뇌 실조(spinocerebellar ataxia), 염증성 및 신경병증성 통증, 뇌혈관 질환, 척수 손상(spinal cord injury) 및 타우병증(tauopathy)으로 이루어진 군에서 선택되는, 약학 조성물을 제공한다.In another embodiment of the present invention, the neurodegenerative disease or neuroinflammatory disease includes stroke, dementia, Alzheimer's disease, Parkinson's disease, Huntington's disease, and Niemann-Pick disease. ), multiple sclerosis, prion disease, Creutzfeldt-Jakob disease, frontotemporal dementia, Lewy dementia, amyotrophic lateral sclerosis, paraneoplastic syndrome, corticobasal Degeneration, multiple system atrophy disease, progressive supranuclear paralysis, autoimmune diseases of the nervous system, spinocerebellar ataxia, inflammatory and neuropathic pain, cerebrovascular disease, spinal cord injury and tauopathy. Provided is a pharmaceutical composition selected from the group consisting of:
본 발명의 또 다른 구현예에서는, 조절 T 세포(regulatory T cells, Treg cells)에 존재하는 Lrig-1(leucine-rich and immunoglobulin-like domains 1) 단백질에 특이적으로 결합하는 결합 분자 또는 이의 결합 단편; 및 BBB 셔틀 펩타이드를 포함하는, Lrig-1 단백질에 특이적으로 결합하는 결합 분자와 BBB 셔틀 펩타이드의 결합체를 제공한다.In another embodiment of the present invention, a binding molecule or binding fragment thereof that specifically binds to the Lrig-1 (leucine-rich and immunoglobulin-like domains 1) protein present in regulatory T cells (Treg cells). ; and a BBB shuttle peptide, and a conjugate of a binding molecule that specifically binds to the Lrig-1 protein and a BBB shuttle peptide.
본 발명의 다른 구현예에서는, 상기 조절 T 세포(regulatory T cells, Treg cells)에 존재하는 Lrig-1(leucine-rich and immunoglobulin-like domains 1) 단백질에 특이적으로 결합하는 결합 분자는, 서열번호 33으로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR1, 서열번호 34로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR2, 및 서열번호 25으로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR3를 포함하는 중쇄 가변 영역; 및 서열번호 36으로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR1, 서열번호 37으로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR2, 서열번호 38로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR3을 포함하는 경쇄 가변 영역을 포함하는 것인, Lrig-1 단백질에 특이적으로 결합하는 결합 분자와 BBB 셔틀 펩타이드의 결합체를 제공한다.In another embodiment of the present invention, the binding molecule that specifically binds to the Lrig-1 (leucine-rich and immunoglobulin-like domains 1) protein present in the regulatory T cells (Treg cells) is SEQ ID NO: A heavy chain variable region comprising a heavy chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 33, a heavy chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 34, and a heavy chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 25; And a light chain variable region comprising a light chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 36, a light chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 37, and a light chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 38. , provides a conjugate of a binding molecule that specifically binds to the Lrig-1 protein and a BBB shuttle peptide.
본 발명의 다른 구현예에서는, 상기 BBB 셔틀 펩타이드는 Angiopep-2, ApoB(3371-3409), ApoE(159-167)2, Peptide-22, THR, THR retro-enatio, CRT, Leptin 30, RVG29, DCDX, Apamin, MiniAp-4, GSH, G23, g7, TGN, TAT(47-57), SynB1, Diketopiperazines, PhPro으로 이루어진 그룹에서 선택되는, Lrig-1 단백질에 특이적으로 결합하는 결합 분자와 BBB 셔틀 펩타이드의 결합체를 제공한다.In another embodiment of the present invention, the BBB shuttle peptide is Angiopep-2, ApoB (3371-3409), ApoE (159-167) 2, Peptide-22, THR, THR retro-enatio , CRT, Leptin 30, RVG29, D A binding molecule that specifically binds to the Lrig-1 protein and the BBB, selected from the group consisting of CDX, Apamin, MiniAp-4, GSH, G23, g7, TGN, TAT (47-57), SynB1, Diketopiperazines, and PhPro. A conjugate of shuttle peptide is provided.
본 발명의 다른 구현예에서는, 상기 BBB 셔틀 펩타이드는 서열번호 64 내지 81로 이루어진 군에서 선택되는 아미노산 서열을 포함하는, Lrig-1 단백질에 특이적으로 결합하는 결합 분자와 BBB 셔틀 펩타이드의 결합체를 제공한다.In another embodiment of the present invention, the BBB shuttle peptide provides a conjugate of a BBB shuttle peptide and a binding molecule that specifically binds to the Lrig-1 protein, including an amino acid sequence selected from the group consisting of SEQ ID NOs: 64 to 81. do.
본 발명의 다른 구현예에서는, 상기 뇌신경계 질환은 신경 퇴행성 질환 또는 신경 염증성 질환인, 약학 조성물을 제공한다.In another embodiment of the present invention, a pharmaceutical composition is provided wherein the brain nervous system disease is a neurodegenerative disease or a neuroinflammatory disease.
본 발명의 다른 구현예에서는, 상기 신경 퇴행성 질환 또는 신경 염증성 질환은 뇌졸중, 치매, 알츠하이머병(Alzheimer's disease), 파킨슨병(Parkinson's disease), 헌팅턴병(Huntington's disease), 니만-피크병(Niemann-Pick disease), 다발성 경화증, 프리온병(prion disease), 크로이펠츠-야콥병(Creutzfeldt-Jakob disease), 전두측두치매, 루이치매, 근위축성 측삭경화증(AlzAmyotrophic lateral sclerosis), 부신생물증후군(Paraneoplastic syndrome), 피질기저퇴행증, 다계통위축병, 진행성핵상마비, 신경계 자가면역질환, 척수 소뇌 실조(spinocerebellar ataxia), 염증성 및 신경병증성 통증, 뇌혈관 질환, 척수 손상(spinal cord injury) 및 타우병증(tauopathy)으로 이루어진 군에서 선택되는, 약학 조성물을 제공한다.In another embodiment of the present invention, the neurodegenerative disease or neuroinflammatory disease includes stroke, dementia, Alzheimer's disease, Parkinson's disease, Huntington's disease, and Niemann-Pick disease. ), multiple sclerosis, prion disease, Creutzfeldt-Jakob disease, frontotemporal dementia, Lewy dementia, amyotrophic lateral sclerosis, paraneoplastic syndrome, corticobasal Degeneration, multiple system atrophy disease, progressive supranuclear paralysis, autoimmune diseases of the nervous system, spinocerebellar ataxia, inflammatory and neuropathic pain, cerebrovascular disease, spinal cord injury and tauopathy. Provided is a pharmaceutical composition selected from the group consisting of:
본 발명에서 제공하는 조절 T 세포(regulatory T cells, Treg cells)에 존재하는 Lrig-1(leucine-rich and immunoglobulin-like domains 1) 단백질에 특이적으로 결합하는 결합 분자와 혈액-뇌 장벽 수용체 항체(blood-brain barrier receptor antibody)의 이중 특이적 항체를 통하여 혈액뇌장벽(BBB)를 효과적으로 통과하여 뇌신경계 질환을 효과적으로 예방 또는 치료할 수 있다.A binding molecule that specifically binds to the Lrig-1 (leucine-rich and immunoglobulin-like domains 1) protein present in regulatory T cells (Treg cells) provided by the present invention and a blood-brain barrier receptor antibody ( Bispecific antibodies (blood-brain barrier receptor antibodies) can effectively penetrate the blood-brain barrier (BBB) to effectively prevent or treat brain and nervous system diseases.
또한 조절 T 세포(regulatory T cells, Treg cells)에 존재하는 Lrig-1(leucine-rich and immunoglobulin-like domains 1) 단백질에 특이적으로 결합하는 결합 분자 또는 이의 결합 단편; 및 펩타이드를 포함하는, Lrig-1 단백질에 특이적으로 결합하는 결합 분자와 펩타이드의 결합체를 통하여 혈액뇌장벽(BBB)를 효과적으로 통과하여 뇌신경계 질환을 효과적으로 예방 또는 치료할 수 있다.Additionally, a binding molecule or binding fragment thereof that specifically binds to the Lrig-1 (leucine-rich and immunoglobulin-like domains 1) protein present in regulatory T cells (Treg cells); and a peptide, through a conjugate of a binding molecule that specifically binds to the Lrig-1 protein and a peptide, it is possible to effectively prevent or treat brain and nervous system diseases by effectively passing through the blood brain barrier (BBB).
도 1은 본 발명의 일 실시예에 따른 Lrig-1 단백질의 구조를 나타낸 것이다.
도 2는 본 발명의 일 실시예에 따른 Lrig-1 단백질의 구조를 나타낸 것이다.
도 3는 본 발명의 일 실시예에 따른 Lrig-1 mRNA의 발현 정도를 나타낸 것이다.
도 4은 본 발명의 일 실시예에 따른 Lrig-1 mRNA의 발현 정도를 나타낸 것이다.
도 5은 본 발명의 일 실시예에 따른 Lrig-1 mRNA의 발현 정도를 나타낸 것이다.
도 6은 본 발명의 일 실시예에 따른 Lrig-1, Lrig-2 및 Lrig-3 mRNA의 발현 정도를 나타낸 것이다.
도 7는 본 발명의 일 실시예에 따른 조절 T 세포와 비 조절 T 세포 내 Lrig-1 단백질의 발현량 비교 결과를 나타낸 것이다.
도 8은 본 발명의 일 실시예에 따른 조절 T 세포의 표면에 Lrig-1 단백질의 발현을 나타낸 것이다.
도 9는 본 발명의 일 실시예에 따른 단일클론항체의 알츠하이머 치료 효과를 확인하기 위한 알츠하이머 유도 마우스인 5xFAD 마우스와 6xTg 마우스의 실험 설계도를 나타낸 것이다.
도 10은 알츠하이머 유도 마우스인 5xFAD 마우스와 6xTg 마우스에 본 발명의 일 실시예에 따른 단일클론항체를 포함한 각 처리 후 Y자 미로 실험 결과 자발적 교대(spontaneous alteration)(%) 값의 변화를 그래프로 나타낸 것이다.
도 11는 알츠하이머 유도 마우스인 6xTg 마우스에 본 발명의 일 실시예에 따른 단일클론항체를 포함한 각 처리 후 신규 물체 인식 실험 결과 선호도 수치의 변화를 그래프로 나타낸 것이다.
도 12는 알츠하이머 유도 마우스인 5xFAD 마우스와 6xTg 마우스에 본 발명의 일 실시예에 따른 단일클론항체를 포함한 각 처리 후 수동 회피 실험 결과 머무름 시간 변화를 그래프로 나타낸 것이다.Figure 1 shows the structure of Lrig-1 protein according to an embodiment of the present invention.
Figure 2 shows the structure of Lrig-1 protein according to an embodiment of the present invention.
Figure 3 shows the expression level of Lrig-1 mRNA according to an embodiment of the present invention.
Figure 4 shows the expression level of Lrig-1 mRNA according to an embodiment of the present invention.
Figure 5 shows the expression level of Lrig-1 mRNA according to an embodiment of the present invention.
Figure 6 shows the expression levels of Lrig-1, Lrig-2, and Lrig-3 mRNA according to an embodiment of the present invention.
Figure 7 shows the results of comparing the expression level of Lrig-1 protein in regulatory T cells and non-regulatory T cells according to an embodiment of the present invention.
Figure 8 shows the expression of Lrig-1 protein on the surface of regulatory T cells according to an embodiment of the present invention.
Figure 9 shows an experimental design of 5xFAD mice and 6xTg mice, which are Alzheimer's induction mice, to confirm the Alzheimer's treatment effect of a monoclonal antibody according to an embodiment of the present invention.
Figure 10 is a graph showing the change in spontaneous alteration (%) values as a result of the Y-maze experiment after treatment of 5xFAD mice and 6xTg mice, which are Alzheimer's-induced mice, with a monoclonal antibody according to an embodiment of the present invention. will be.
Figure 11 is a graph showing the change in preference values as a result of a novel object recognition experiment after treatment of 6xTg mice, which are Alzheimer's-induced mice, with a monoclonal antibody according to an embodiment of the present invention.
Figure 12 is a graph showing the change in retention time as a result of a passive avoidance test in 5xFAD mice and 6xTg mice, which are Alzheimer's-induced mice, after treatment with a monoclonal antibody according to an embodiment of the present invention.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로서, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에게 있어서 자명할 것이다.Hereinafter, the present invention will be described in more detail through examples. These examples are only for illustrating the present invention in more detail, and it will be apparent to those skilled in the art that the scope of the present invention is not limited by these examples according to the gist of the present invention. .
실시예 Example
[준비예 1] T 세포 아형 세포 배양[Preparation Example 1] T cell subtype cell culture
조절 T 세포(Treg)에서만 Lrig-1 단백질이 발현되는지 확인하기 위하여, T 세포의 아형(subset)인 Th0, Th1, Th2, Th17 및 iTreg을 준비하였다. 상기 iTreg은 자연적으로 분리한 nTreg과는 달리하기 조성을 포함하는 배지에서 분화를 인공적으로 유도한 세포를 의미한다.To confirm that Lrig-1 protein is expressed only in regulatory T cells (Treg), T cell subsets Th0, Th1, Th2, Th17, and iTreg were prepared. The iTreg, unlike naturally isolated nTreg, refers to cells whose differentiation is artificially induced in a medium containing the following composition.
T 세포의 아형은 우선, 쥐의 비장으로부터 얻은 나이브(naive) T 세포를 분리한 뒤, 우태아혈청(FBS; hyclone, logan, UT) 10%를 포함하는 RPMI1640(Invitrogen Gibco, Grand Island, NY) 영양 배지에 하기 표 1의 성분을 각각 더 포함하도록 하여, 37℃, 5 % CO2 배양기 내에서 72시간 배양을 통해 각각의 세포로 분화 유도하였다.T cell subtypes were first isolated from naïve T cells obtained from the spleen of mice, and then RPMI1640 (Invitrogen Gibco, Grand Island, NY) containing 10% fetal bovine serum (FBS; hyclone, logan, UT). The nutrient medium was further included with the ingredients listed in Table 1 below, and differentiation into each cell was induced through culturing for 72 hours in an incubator at 37°C and 5% CO 2 .
[실시예 1] Lrig-1 구조 분석[Example 1] Lrig-1 structural analysis
조절 T 세포의 표면 단백질인 Lrig-1 단백질에 특이적인 항체를 제작하기 위하여 Lrig-1 단백질의 세포외 도메인의 3차원 입체 구조를 예측하였다.In order to produce a specific antibody against the Lrig-1 protein, a surface protein of regulatory T cells, the three-dimensional structure of the extracellular domain of the Lrig-1 protein was predicted.
우선, 항원 결정기(Epitope) 염기서열 예측을 위해 Lrig-1 단백질의 세포외 도메인(Extracellular domain; ECD)의 구조를 확인하기 위하여 Uniprot(www.uniprot.org)과 RCSB Protein Data Bank (www.rcsb.org/pdb)툴을 이용하여 3차원 입체 구조를 예측한 뒤, 그 결과를 도 1 및 2에 나타내었다.First, in order to predict the epitope sequence, Uniprot (www.uniprot.org) and RCSB Protein Data Bank (www.rcsb. org/pdb) tool was used to predict the three-dimensional structure, and the results are shown in Figures 1 and 2.
도 1에서 보는 바와 같이, Lrig-1 단백질의 세포외 도메인 중 Lrig-LRR 도메인(아미노산 서열 41 ~ 494번) 내에는 LRR1 내지 LRR15의 총 15개의 류신 리치 부위(Leucine rich region)가 존재하였다. 상기 LRR 도메인 각각은 23 내지 27개의 아미노산으로 구성되고, 류신은 3 내지 5개가 존재하였다.As shown in Figure 1, a total of 15 leucine rich regions from LRR1 to LRR15 were present within the Lrig-LRR domain (amino acid sequence numbers 41 to 494) of the extracellular domain of the Lrig-1 protein. Each of the LRR domains consisted of 23 to 27 amino acids and contained 3 to 5 leucines.
또한, 도 2에서 보는 바와 같이, Lrig-1 단백질의 세포외 도메인 중 Lrig-1 단백질의 아미노산 서열 494 내지 781번에는 면역글로블린 유사 도메인(Immunoglobulin-like domain)이 3개 존재하였다.Additionally, as shown in Figure 2, among the extracellular domains of the Lrig-1 protein, three immunoglobulin-like domains were present at amino acid sequence numbers 494 to 781 of the Lrig-1 protein.
[실시예 2] Lrig-1 항원 결정기(epitope) 아미노산 서열 예측[Example 2] Lrig-1 epitope amino acid sequence prediction
상기 염기서열의 예측은 Lrig-1 단백질의 구조를 기반으로 하는 항원 결정기 예측 소프트웨어(epitope prediction software)인 Ellipro 서버(tools.iedb.org/ellipro/)를 이용하였다. 상기 Ellipro 검색 엔진은 현존하는 항원 결정기를 예측하는 알고리즘 중에서 가장 신뢰도가 높다고 알려진 검색엔진에 해당하여 이를 이용하였다.The base sequence was predicted using the Ellipro server (tools.iedb.org/ellipro/), an epitope prediction software based on the structure of the Lrig-1 protein. The Ellipro search engine was used because it is known to be the most reliable among existing antigenic determinant prediction algorithms.
항원 결정기 예측 소프트웨어에 상기 실시예 1에서 분석된 세포외 도메인을 입력한 뒤, 예측된 항원 결정기의 예측된 연속 또는 불연속 아미노산 서열을 예측하였다.After inputting the extracellular domain analyzed in Example 1 into the antigenic determinant prediction software, the predicted continuous or discontinuous amino acid sequence of the predicted antigenic determinant was predicted.
연속된 항원 결정기 아미노산 서열은 총 22개가 예측되었고, 불연속된 항원 결정기 아미노산 서열은 총 8개가 예측되었다.A total of 22 consecutive epitope amino acid sequences were predicted, and a total of 8 discontinuous epitope amino acid sequences were predicted.
[제조예 1 내지 2] Lrig-1 항체의 제조[Preparation Examples 1 to 2] Preparation of Lrig-1 antibody
본 발명에 따른 Lrig-1 단백질에 특이적인 항체를 제작하였다. 본 항체는 특정 항원 결정기를 정하여 생산하지 않고, Lrig-1 단백질에 어느 부위든지 결합할 수 있는 항체를 생산하였다.An antibody specific to the Lrig-1 protein according to the present invention was produced. This antibody was not produced with a specific antigenic determinant, but was produced as an antibody that can bind to any site on the Lrig-1 protein.
상기 항체를 제작하기 위하여 Lrig-1 단백질이 발현되는 세포를 제작하였다. 서열번호 20에 해당하는 DNA 단편 및 pcDNA(hygro)를 절단 효소로 절단한 뒤, 37도씨에서 배양하여 라이게이션(Lrigation) 하여, Lrig-1 단백질의 DNA 서열이 삽입(insert) 되어 있는 pcDNA를 제작하였다. 상기 제작된 서열번호 20이 삽입된 pcDNA는 L세포에 형질주입(transfection)을 통해 도입되어 L 세포의 표면에 Lrig-1 단백질이 발현될 수 있도록 하였다.To produce the antibody, cells expressing Lrig-1 protein were produced. The DNA fragment corresponding to SEQ ID NO: 20 and pcDNA (hygro) were cut with a cutting enzyme, then cultured at 37 degrees Celsius for ligation to produce pcDNA in which the DNA sequence of the Lrig-1 protein was inserted. did. The prepared pcDNA inserted with SEQ ID NO: 20 was introduced into L cells through transfection, allowing Lrig-1 protein to be expressed on the surface of L cells.
상기 세포 표면에 발현되는 Lrig-1에 결합할 수 있는 경쇄(Lright chain) 및 중쇄(heavy chain) 아미노산의 서열을 Human scFv library에서 선별하여, 총 8개의 중쇄 및 경쇄를 선별하였다.The light chain and heavy chain amino acid sequences capable of binding to Lrig-1 expressed on the cell surface were selected from the Human scFv library, and a total of eight heavy and light chains were selected.
상기 선별된 중쇄 및 경쇄 아미노산 서열을 mlgG2a Fc region과 융합하여 단일 클론(mono clonal) 항체를 제작하였다. 상기 단일 클론 항체의 서열번호는 하기 표 2와 같다.A monoclonal antibody was produced by fusing the selected heavy and light chain amino acid sequences with the mlgG2a Fc region. The sequence numbers of the monoclonal antibodies are shown in Table 2 below.
[실시예 3] Lrig-1 mRNA의 조절 T 세포에서의 특이적 발현 확인[Example 3] Confirmation of specific expression of Lrig-1 mRNA in regulatory T cells
Lrig-1 단백질이 조절 T 세포에 특이적인 바이오마커(biomarker)로 작용할 수 있는지 검증하였다.We verified whether Lrig-1 protein can act as a specific biomarker for regulatory T cells.
상기 검증을 위하여, 쥐의 비장으로부터 CD4 비드를 통해 자석 활성 세포 분류기(magnet-activated cell sorting; MACS)를 이용하여 CD4+ T 세포를 분리하였다. 이후, CD25 항체를 이용하여 형광 활성 세포 분류기(FACS)를 이용해 조절 T (CD4+CD25+ T)세포 및 비 조절 T (CD4+CD25- T)세포를 분리하였다. 각각의 세포 및 상기 준비예 1에서 분화된 세포는 트리졸(Trizol)을 이용하여 mRNA를 추출한 뒤, 게노믹 RNA는 gDNA 추출 키트(Qiagen)를 이용하여 업체에서 제공한 프로토콜에 의해 gDNA를 제거하였다. gDNA가 제거된 mRNA는 BDsprint cDNA 합성 키트 (Clonetech)를 통해 cDNA로 합성하였다.For the above verification, CD4 + T cells were isolated from the spleen of mice using magnet-activated cell sorting (MACS) using CD4 beads. Afterwards, regulatory T (CD4 + CD25 + T) cells and non-regulatory T (CD4 + CD25 - T) cells were separated using fluorescence activated cell sorter (FACS) using CD25 antibody. After extracting mRNA from each cell and the cells differentiated in Preparation Example 1 using Trizol, gDNA was removed from genomic RNA using a gDNA extraction kit (Qiagen) according to the protocol provided by the company. . The mRNA from which gDNA was removed was synthesized into cDNA using the BDsprint cDNA synthesis kit (Clonetech).
상기 cDRNA에서 Lrig-1 mRNA의 발현량을 정량적으로 확인하기 위하여 실시간 중합효소연쇄반응(real time PCR)을 수행하였다.To quantitatively confirm the expression level of Lrig-1 mRNA in the cDRNA, real-time polymerase chain reaction (real time PCR) was performed.
상기 실시간 중합효소연쇄반응은 SYBR Green (Molecular Probes)을 이용하여 업체에서 제공한 프로토콜에 의해 95에서 3분, 61에서 15초, 72에서 30초씩 40 사이클의 조건으로, 하기 표 3의 프라이머를 이용하여 수행하였고, 상대적인 유전자 발현량은 ΔCT 방법을 이용하여 계산하였으며, HPRT를 이용하여 일반화(normalization) 하여, 그 결과를 도 5 내지 8에 나타내었다.The real-time polymerase chain reaction was conducted using SYBR Green (Molecular Probes), using the primers in Table 3 below under the conditions of 40 cycles of 3 minutes at 95, 15 seconds at 61, and 30 seconds at 72 according to the protocol provided by the company. The relative gene expression level was calculated using the ΔCT method, normalized using HPRT, and the results are shown in Figures 5 to 8.
도 5에서 보는 바와 같이, 비 조절 T (CD4+CD25- T)세포에 비하여 조절 T((CD4+CD25+ T) 세포에서 Lrig-1의 발현이 18.1배 높은 것을 알 수 있다. 이는, 기존에 알려져 있는 조절 T 세포의 마커인 Lag3 및 Ikzf4와 비교하였을 때 약 10배 정도 발현양이 높은 수준이었다.As shown in Figure 5, it can be seen that the expression of Lrig-1 is 18.1 times higher in regulatory T ((CD4 + CD25 + T) cells than in non-regulatory T (CD4 + CD25 - T) cells. Compared to Lag3 and Ikzf4, known regulatory T cell markers, the expression level was approximately 10 times higher.
또한, 도 6에서 보는 바와 같이, Lrig 패밀리에 해당하는 Lrig-1, Lrig-2 및 Lrig-3 중에서 Lrig-1의 발현이 가장 높았다.Additionally, as shown in Figure 6, the expression of Lrig-1 was the highest among Lrig-1, Lrig-2, and Lrig-3 corresponding to the Lrig family.
상기 결과를 통해 본 발명에 따른 Lrig-1 단백질은 조절 T 세포, 특히 자연적으로 존재하는 조절 T 세포에서 특이적으로 발현하는 것을 알 수 있다.From the above results, it can be seen that the Lrig-1 protein according to the present invention is specifically expressed in regulatory T cells, especially naturally occurring regulatory T cells.
[실시예 4] Lrig-1 단백질의 조절 T 세포에서의 특이적 발현 확인[Example 4] Confirmation of specific expression of Lrig-1 protein in regulatory T cells
Lrig-1 mRNA로부터 발현된 Lrig-1 단백질이 조절 T 세포에서만 특이적으로 발현되는지 확인하였다.It was confirmed whether Lrig-1 protein expressed from Lrig-1 mRNA was specifically expressed only in regulatory T cells.
조절 T 세포 특이적인 전사인자인 FOXP3 프로모터에 RFP(Red fluorescence protein)이 결합된 FOXP3-RFP 주입(Knock-in) 쥐를 이용하여, 상기 쥐의 비장으로부터 CD4 비드로 자석 활성 세포 분류기(magnet-activated cell sorting; MACS)를 이용하여 CD4+ T 세포를 분리하였다. 이후, RFP 단백질을 이용하여, 형광 활성 세포 분류기(FACS)를 통해 조절 T (CD4+RFP+ T)세포 및 비 조절 T(CD4+RFP- T)를 분리하여 얻었다. 각각의 상기 세포는 구입한 Lrig-1 항체 및 음성 대조군은 아이소타입(isotype)을 통해 염색하여 형광 활성 세포 분류기로 Lrig-1의 발현량을 측정하여, 그 결과를 도 7에 나타내었다.Using FOXP3-RFP-injected (knock-in) mice in which RFP (Red fluorescent protein) was bound to the FOXP3 promoter, a transcription factor specific for regulatory T cells, a magnet-activated cell sorter (magnet-activated cell sorter) was performed using CD4 beads from the spleens of the mice. CD4 + T cells were isolated using cell sorting (MACS). Afterwards, using RFP protein, regulatory T (CD4 + RFP + T) cells and non-regulatory T (CD4 + RFP - T) cells were separated and obtained through fluorescence-activated cell sorter (FACS). Each of the above cells was stained with the purchased Lrig-1 antibody and the negative control was isotype, and the expression level of Lrig-1 was measured using a fluorescence-activated cell sorter, and the results are shown in Figure 7.
도 7에서 보는 바와 같이, 점선으로 표시되는 비 조절 T 세포의 경우 음성 대조군과 거의 동일한 Lrig-1의 발현 수준을 보였지만, 조절 T 세포의 경우 Lrig-1의 발현 수준이 높은 세포가 다수 존재하였다.As shown in Figure 7, non-regulatory T cells indicated by a dotted line showed an expression level of Lrig-1 that was almost the same as that of the negative control, but in the case of regulatory T cells, there were many cells with a high expression level of Lrig-1.
상기 결과를 통해 본 발명에 따른 Lrig-1 단백질은 조절 T 세포에서 특이적으로 발현하는 것을 알 수 있다.The above results show that the Lrig-1 protein according to the present invention is specifically expressed in regulatory T cells.
[실시예 5] 조절 T 세포 표면에서의 Lrig-1 단백질 특이적 발현 확인[Example 5] Confirmation of specific expression of Lrig-1 protein on the surface of regulatory T cells
Lrig-1 단백질이 세포 치료의 타겟이 되기 위해서는 조절 T 세포의 표면에 발현되어야 더욱 효과적으로 타겟 치료를 할 수 있으므로, Lrig-1 단백질이 표면에서의 발현 여부를 확인하였다.In order for the Lrig-1 protein to be a target for cell therapy, it must be expressed on the surface of regulatory T cells for more effective target treatment. Therefore, we confirmed whether the Lrig-1 protein was expressed on the surface.
상기 준비예 1의 각각의 분화된 T 세포 아형을 항-CD4-APC 및 항 Lrig-1-PE 항체로 염색하고, 형광 이용 세포 분류기(Fluorescence-Activated Cell Sorter; FACS)를 이용하여 각각의 세포 표면에서 Lrig-1의 발현량을 측정하여, 그 결과를 도 8에 나타내었다.Each differentiated T cell subtype in Preparation Example 1 was stained with anti-CD4-APC and anti-Lrig-1-PE antibodies, and the surface of each cell was sorted using a fluorescence-activated cell sorter (FACS). The expression level of Lrig-1 was measured, and the results are shown in Figure 8.
도 8에서 보는 바와 같이, 활성화된 T 세포(activated T cell), Th1 세포, Th2 세포, Th17 세포 및 나이브(Naive) T 세포에서는 Lrig-1의 발현이 0.77 내지 15.3의 양으로 발현되는 반면, 분화가 유도된 T 세포(iTreg)에서는 83.9로 높게 발현되었다.As shown in Figure 8, the expression of Lrig-1 is expressed in an amount of 0.77 to 15.3 in activated T cells, Th1 cells, Th2 cells, Th17 cells, and naive T cells, while differentiation was highly expressed at 83.9 in induced T cells (iTreg).
상기 결과를 통해 본 발명에 따른 Lrig-1 단백질은 조절 T 세포(Treg) 세포에서 특이적으로 발현될 뿐만 아니라, 특히 Treg 세포의 표면에서 더욱 높게 발현되는 것을 알 수 있다.The above results show that the Lrig-1 protein according to the present invention is not only specifically expressed in regulatory T cells (Treg) cells, but is especially highly expressed on the surface of Treg cells.
[실시예 6] 본 발명에 따른 항체의 알츠하이머 치료능 평가 - 6xTg 마우스[Example 6] Evaluation of the Alzheimer's treatment ability of the antibody according to the present invention - 6xTg mice
본 발명에 따른 항체의 알츠하이머 치료능을 평가하기 위하여, 도 9와 같이 군을 설계하고 실험을 진행하였다. 구체적으로, 4.5개월 동안 적응 기간을 거친 암컷의 알츠하이머 유도 5xFAD 마우스와 암컷의 6xTg 마우스에 상기 제조예 1의 GTC310-01 항체를 10 mpk의 양으로 2달간 격주로 정맥에 주사하였다. 다만, 비교를 위하여 양성 대조군으로 글라티라머 아세테이트(glatiramer acetate, GA, Copaxone®)을 100 ug의 양으로 2달간 격주로 정맥에 주사하였다. 2달 후 Y자 미로 실험, 신규 물체 인식 실험, 수동회피실험을 진행하였다.In order to evaluate the Alzheimer's treatment ability of the antibody according to the present invention, groups were designed and experiments were conducted as shown in Figure 9. Specifically, the GTC310-01 antibody of Preparation Example 1 was injected intravenously every other week for 2 months in an amount of 10 mpk into female Alzheimer's-induced 5xFAD mice and female 6xTg mice that had undergone an adaptation period for 4.5 months. However, for comparison, glatiramer acetate (GA, Copaxone®) was injected intravenously every other week for 2 months in an amount of 100 ug as a positive control. Two months later, a Y-maze experiment, a new object recognition experiment, and a passive avoidance experiment were conducted.
1. 6xTg 마우스의 특징1. Characteristics of 6xTg mice
5xFAD 마우스는 알츠하이머 유도 모델로서 많이 사용되고 있으나 하기 실험에 사용된 6xTg 마우스는 아밀로이드-β(Aβ42) 뿐만 아니라, tau 단백질(MAPT)가 돌연변이되어 축적된 마우스 모델로서 5xFAD 마우스보다 인간 질병 모델에 더욱 가까운 모델이므로 알츠하이머를 포함한 뇌신경계 질환 모델로서 이상적인 동물 모델에 해당한다.The 5xFAD mouse is widely used as an Alzheimer's induction model, but the 6xTg mouse used in the experiment below is a mouse model in which not only amyloid-β (Aβ42) but also tau protein (MAPT) is mutated and accumulated, and is a model closer to the human disease model than the 5xFAD mouse. Therefore, it is an ideal animal model as a model for brain and nervous system diseases, including Alzheimer's.
2. Y자 미로 실험(Y-maze test)2. Y-maze test
Y자 미로 실험은 40 cm의 길이(벽의 높이 15cm)의 동일한 3개의 암(arm)을 120도의 각도로 배치하여 만든 미로틀을 이용하였다. 이 실험은 설치류의 본능적인 탐색 습성을 이용한 행동 실험이며, 새로운 영역을 탐색할 가능성이 높은 것에 착안한 방법이었다. 바로 전에 탐색한 암(arm)을 기억하여 동일한 암(arm)에 들어가지 않을 수록 높은 기억력의 수치를 나타내었다. 개체당 8분의 탐색 시간을 제공하며, 최종 결과는 도 10에 자발적 교대(spontaneous alteration)(%) 값으로 표현하였다. 자발적 교대(spontaneous alteration)(%) 값은 다음과 같은 식 1로 계산하였다. 여기서 행동 패턴의 분석은 SMART VIDEO TRACKING Software (Panlab, USA)을 이용하여 실시하였다.The Y-maze experiment used a maze frame made by arranging three identical arms of 40 cm in length (wall height 15 cm) at an angle of 120 degrees. This experiment was a behavioral experiment that utilized the instinctive exploration habits of rodents, and was based on the high possibility of exploring new areas. By remembering the arm searched just before and not entering the same arm, the higher the memory value. An exploration time of 8 minutes is provided per object, and the final results are expressed as spontaneous alteration (%) values in Figure 10. The spontaneous alteration (%) value was calculated using Equation 1 below. Here, analysis of behavioral patterns was conducted using SMART VIDEO TRACKING Software (Panlab, USA).
[식 1] [Equation 1]
Spontaneous alternation (%) = The number of triplet / (total arm entry-2)Spontaneous alternation (%) = The number of triplet / (total arm entry-2)
도 10에서 보는 바와 같이, 실험 동물이 주변의 단서를 파악하여 순차적으로 미로를 들어가는 상대적 빈도를 측정한 본 실험에 있어서, 알츠하이머 유도 마우스에 본 발명에 따른 GTC310-01 항체를 투여한 경우, 정상 대조군과 유사한 수준으로 자발적 교대 값을 갖는 것을 확인할 수 있었다. 더 나아가 좀 더 인간 질병 모델과 더욱 가까운 6xTg 모델 마우스에서 5xFAD 마우스보다 좀 더 정상 대조군과 유사한 수준으로 자발적 교대 값을 갖는 것을 확인할 수 있었다.As shown in Figure 10, in this experiment in which the relative frequency of experimental animals identifying surrounding clues and sequentially entering the maze was measured, when the GTC310-01 antibody according to the present invention was administered to Alzheimer's-induced mice, the normal control group It was confirmed that the spontaneous shift value was at a similar level to . Furthermore, it was confirmed that the 6xTg model mouse, which is closer to the human disease model, had spontaneous alternation values at a level more similar to the normal control group than the 5xFAD mouse.
3. 신규 물체 인식 실험(Novel Object Recognition)3. Novel Object Recognition
신규 물체 인식 실험은 40 cm x 40 cm의 아크릴 케이지에 상이한 2개의 물체를 이용하여 기억력을 평가하였다. 아크릴 케이지 내를 익숙하게 한 후, 2개의 물체를 일정한 위치에 위치하여 자유롭게 인지하게 한 후, 각 물체를 탐색한 시간을 측정하였다. 24 시간의 지연 시간을 개체별로 주고 다시 동일한 위치에 한 가지 물체만 다른 물체로 변경하였다. 이 때 변경한 물체를 신규 물체로 인식하여 탐색 시간이 길수록 기억력이 좋은 것으로 판단할 수 있다. 24 시간 전의 물체를 기억하지 못한다면 신규 물체와 기존 물체를 구분하지 못하고 양쪽 물체 모두 균일하게 탐색할 가능성이 있다. 총 10분간 자유롭게 탐색하도록 하며, 결과는 선호도 수치(preference index = Novel object exploring time/total exploring time)로 도 19에 나타내었다. 이때 분석은 SMART VIDEO TRACKING Software (Panlab, USA)을 이용하여 실시하였다.The novel object recognition experiment evaluated memory using two different objects in an acrylic cage of 40 cm x 40 cm. After becoming familiar with the acrylic cage, two objects were positioned at a certain location and freely recognized, and the time spent exploring each object was measured. A delay time of 24 hours was given to each object, and then only one object was replaced with another object in the same location. At this time, the changed object is recognized as a new object, and the longer the search time, the better the memory. If you cannot remember an object from 24 hours ago, it is possible that you will not be able to distinguish between a new object and an old object and will search for both objects equally. You are allowed to explore freely for a total of 10 minutes, and the results are shown in Figure 19 as a preference index (preference index = Novel object exploring time/total exploring time). At this time, the analysis was conducted using SMART VIDEO TRACKING Software (Panlab, USA).
도 11에서 보는 바와 같이, 새로운 물체에 대한 선호도 수치(Preference Index)에서 정상 대조군에 비하여 알츠하이머 유도 군에서 선호도 수치가 낮게 관찰되었다. 그런데 본 발명에 따른 GTC310-01 항체를 투여한 경우 인간 질병 모델과 더욱 가까운 6xTg 모델에서 정상 대조군 이상으로 선호도 수치가 증가한 것을 확인할 수 있었다. As shown in Figure 11, the preference index for new objects was observed to be lower in the Alzheimer's induced group compared to the normal control group. However, when the GTC310-01 antibody according to the present invention was administered, it was confirmed that the affinity value increased above the normal control group in the 6xTg model, which is closer to the human disease model.
4. 수동회피실험(Passive Avoidance Test)4. Passive Avoidance Test
Passive avoidance test 실험기구는 조명이 있는 밝은 챔버와 어두운 챔버, 2개의 구역으로 구분되어 있으며, 바닥은 철망으로 이루어져 있다. 먼저 첫째 날에는 마우스를 자유롭게 이동시켜서 적응시켰다. 다음 날 각각의 5xFAD 마우스와 6xTg 마우스는 조명이 있는 챔버에서 조명을 켜지 않은 채 1분 동안 적응시킨 후 조명을 켜고, 2분 동안 적응시킨 후 마우스가 어두운 챔버로 이동하자마자 전기충격을 0.5 mA, 1초 동안 가하여 학습 시험을 실시하였다. 이와 같이 학습 시험을 시킨 다음날 각 마우스들을 대상으로 기억 시험(teat trial)을 실시하였다 조명을 켠 챔버에 5xFAD 마우스와 6xTg 마우스를 놓고 5xFAD 마우스와 6xTg 마우스의 네 발이 다 들어가는데 걸리는 시간(latency time: 머무름 시간)을 300초 이내로 지정하고 실행하였다. 그 결과 도 12에서 보는 것과 같이 5xFAD 마우스뿐 만 아니라 6xTg 마우스에서도 GTC310-01 항체를 투여한 경우 정상 대조군에 근접할 정도로 회복되는 것을 알 수 있었다.The passive avoidance test experimental equipment is divided into two areas, a bright chamber with lighting and a dark chamber, and the floor is made of wire mesh. First, on the first day, the mouse was allowed to move freely and get used to it. The next day, each 5xFAD mouse and 6xTg mouse were acclimatized in a lighted chamber for 1 min without the light on, then turned on the light, acclimatized for 2 min, and then received an electric shock at 0.5 mA, 1 as soon as the mouse was moved to the dark chamber. A learning test was conducted by applying pressure for seconds. The day after the learning test, a memory test (teat trial) was conducted for each mouse. 5xFAD mice and 6xTg mice were placed in a lighted chamber, and the time taken for all four paws of the 5xFAD mouse and 6xTg mouse to enter (latency time: retention) time) was set to within 300 seconds and executed. As a result, as shown in Figure 12, it was found that not only 5xFAD mice but also 6xTg mice recovered to a level close to the normal control group when the GTC310-01 antibody was administered.
이상에서 본 발명에 대하여 상세하게 설명하였지만 본 발명의 권리범위는 이에 한정되는 것은 아니고, 청구범위에 기재된 본 발명의 기술적 사상을 벗어나지 않는 범위 내에서 다양한 수정 및 변형이 가능하다는 것은 당 기술분야의 통상의 지식을 가진 자에게는 자명할 것이다. Although the present invention has been described in detail above, the scope of the present invention is not limited thereto, and it is known in the art that various modifications and variations are possible without departing from the technical spirit of the present invention as set forth in the claims. It will be self-evident to those with knowledge.
Claims (17)
상기 혈액-뇌 장벽 수용체는 트랜스페린 수용체(transferrin receptor), 인슐린 수용체(insulin receptor), 인슐린 유사 성장 인자 수용체(insulin-like growth factor receptor), 저밀도 지질단백질 수용체 관련 단백질 8(low density lipoprotein receptor-related protein 8), 저밀도 지질단백질 수용체 관련 단백질 1(low density lipoprotein receptor-related protein 1), 헤파린 결합성 표피 유래 성정인자 유사 성장인자(heparin-binding epidermal growth factor-like growth factor), 렙틴 수용체(leptin receptor), 니코틴성 아세틸콜린 수용체(nicotinic acetylcholine receptor), 글루타티온 수송체(Glutathione transporter), 칼슘의존성 칼륨통로(calcium-activated potassium channel), 및 RAGE(receptor for advanced glycation endproducts) 중에서 선택되는 이중 특이적 항체.According to clause 1,
The blood-brain barrier receptors include transferrin receptor, insulin receptor, insulin-like growth factor receptor, and low density lipoprotein receptor-related protein. 8), low density lipoprotein receptor-related protein 1, heparin-binding epidermal growth factor-like growth factor, leptin receptor , a bispecific antibody selected from nicotinic acetylcholine receptor, glutathione transporter, calcium-activated potassium channel, and receptor for advanced glycation endproducts (RAGE).
상기 인슐린 유사 성장 인자 수용체(insulin-like growth factor receptor)는 인슐린 유사 성장 인자 1 수용체(insulin-like growth factor1 receptor, IGF1R)인 Lrig-1 단백질에 특이적으로 결합하는 결합 분자/혈액-뇌 장벽 수용체 항체(blood-brain barrier receptor antibody)의 이중 특이적 항체.According to clause 2,
The insulin-like growth factor receptor is a binding molecule/blood-brain barrier receptor that specifically binds to the Lrig-1 protein, which is the insulin-like growth factor 1 receptor (IGF1R). Bispecific antibody (blood-brain barrier receptor antibody).
상기 인슐린 유사 성장 인자 1 수용체(insulin-like growth factor1 receptor, IGF1R) 항체의 항원 결합 단편은 scFv, (scFv)2, scFv-Fc, Fab, Fab' 및 F(ab')2로 이루어지는 것인, Lrig-1 단백질에 특이적으로 결합하는 결합 분자/혈액-뇌 장벽 수용체 항체(blood-brain barrier receptor antibody)의 이중 특이적 항체.According to clause 3,
The antigen-binding fragment of the insulin-like growth factor 1 receptor (IGF1R) antibody consists of scFv, (scFv)2, scFv-Fc, Fab, Fab', and F(ab')2, Bispecific antibody of a binding molecule/blood-brain barrier receptor antibody that specifically binds to the Lrig-1 protein.
상기 Lrig-1 단백질에 특이적으로 결합하는 결합 분자는 완전한 결합분자이고, 인슐린 유사 성장 인자 1 수용체(insulin-like growth factor1 receptor, IGF1R) 항체는 항체의 Fv-단편인, 이중 특이적 항체.According to clause 3,
The binding molecule that specifically binds to the Lrig-1 protein is a complete binding molecule, and the insulin-like growth factor 1 receptor (IGF1R) antibody is a bispecific antibody that is an Fv-fragment of the antibody.
상기 Lrig-1 단백질에 특이적으로 결합하는 결합 분자의 완전한 결합 분자는 IgG1, IgG2, IgG3 또는 IgG4 형태인 이중 특이적 항체.According to clause 5,
The complete binding molecule that specifically binds to the Lrig-1 protein is a bispecific antibody in the form of IgG1, IgG2, IgG3, or IgG4.
상기 인슐린 유사 성장 인자 1 수용체(insulin-like growth factor1 receptor, IGF1R) 항체의 한 분자가 Lrig-1 단백질에 특이적으로 결합하는 결합 분자의 하나의 중쇄 CH3에 결합한 단가(monovalent) 이중 특이적 항체인 이중 특이적 항체.According to clause 5,
A monovalent bispecific antibody in which one molecule of the insulin-like growth factor 1 receptor (IGF1R) antibody binds to one heavy chain CH3 of a binding molecule that specifically binds to the Lrig-1 protein. Bispecific antibodies.
상기 조절 T 세포(regulatory T cells, Treg cells)에 존재하는 Lrig-1(leucine-rich and immunoglobulin-like domains 1) 단백질에 특이적으로 결합하는 결합 분자는,
서열번호 33으로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR1, 서열번호 34로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR2, 및 서열번호 35으로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR3를 포함하는 중쇄 가변 영역; 및
서열번호 36으로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR1, 서열번호 37으로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR2, 서열번호 38로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR3을 포함하는 경쇄 가변 영역을 포함하는 것인, 이중특이적 항체.According to clause 1,
The binding molecule that specifically binds to the Lrig-1 (leucine-rich and immunoglobulin-like domains 1) protein present in the regulatory T cells (Treg cells) is,
A heavy chain variable region comprising a heavy chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 33, a heavy chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 34, and a heavy chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 35; and
A light chain variable region comprising a light chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 36, a light chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 37, and a light chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 38, Bispecific antibodies.
상기 인슐린 유사 성장 인자 1 수용체(insulin-like growth factor1 receptor, IGF1R) 항체는,
(a) 서열번호 53으로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR1, 서열번호 54로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR2, 및 서열번호 57로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR3를 포함하는 중쇄 가변 영역; 및
서열번호 58로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR1, 서열번호 59로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR2, 서열번호 61로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR3을 포함하는 경쇄 가변 영역을 포함하는 것인, 인슐린 유사 성장 인자 1 수용체(insulin-like growth factor1 receptor, IGF1R) 항체;
(b) 서열번호 53으로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR1, 서열번호 55로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR2, 및 서열번호 57로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR3를 포함하는 중쇄 가변 영역; 및
서열번호 58로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR1, 서열번호 60으로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR2, 서열번호 62로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR3을 포함하는 경쇄 가변 영역을 포함하는 것인, 인슐린 유사 성장 인자 1 수용체(insulin-like growth factor1 receptor, IGF1R) 항체;
(c) 서열번호 53으로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR1, 서열번호 56로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR2, 및 서열번호 57로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR3를 포함하는 중쇄 가변 영역; 및
서열번호 58로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR1, 서열번호 60으로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR2, 서열번호 63로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR3을 포함하는 경쇄 가변 영역을 포함하는 것인, 인슐린 유사 성장 인자 1 수용체(insulin-like growth factor1 receptor, IGF1R) 항체;
(d) 서열번호 53으로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR1, 서열번호 555로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR2, 및 서열번호 57로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR3를 포함하는 중쇄 가변 영역; 및
서열번호 58로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR1, 서열번호 60으로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR2, 서열번호 63로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR3을 포함하는 경쇄 가변 영역을 포함하는 것인, 인슐린 유사 성장 인자 1 수용체(insulin-like growth factor1 receptor, IGF1R) 항체;로 이루어진 군에서 선택되는 이중특이적 항체.According to clause 3,
The insulin-like growth factor 1 receptor (IGF1R) antibody,
(a) a heavy chain variable region comprising a heavy chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 53, a heavy chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 54, and a heavy chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 57; and
A light chain variable region comprising a light chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 58, a light chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 59, and a light chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 61, Insulin-like growth factor 1 receptor (IGF1R) antibody;
(b) a heavy chain variable region comprising a heavy chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 53, a heavy chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 55, and a heavy chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 57; and
A light chain variable region comprising a light chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 58, a light chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 60, and a light chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 62, Insulin-like growth factor 1 receptor (IGF1R) antibody;
(c) a heavy chain variable region comprising a heavy chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 53, a heavy chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 56, and a heavy chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 57; and
A light chain variable region comprising a light chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 58, a light chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 60, and a light chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 63, Insulin-like growth factor 1 receptor (IGF1R) antibody;
(d) a heavy chain variable region comprising heavy chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 53, heavy chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 555, and heavy chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 57; and
A light chain variable region comprising a light chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 58, a light chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 60, and a light chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 63, A bispecific antibody selected from the group consisting of an insulin-like growth factor 1 receptor (IGF1R) antibody.
상기 뇌신경계 질환은 신경 퇴행성 질환 또는 신경 염증성 질환인, 약학 조성물. According to any one of claims 1 to 9,
A pharmaceutical composition, wherein the brain nervous system disease is a neurodegenerative disease or a neuroinflammatory disease.
상기 신경 퇴행성 질환 또는 신경 염증성 질환은 뇌졸중, 치매, 알츠하이머병(Alzheimer's disease), 파킨슨병(Parkinson's disease), 헌팅턴병(Huntington's disease), 니만-피크병(Niemann-Pick disease), 다발성 경화증, 프리온병(prion disease), 크로이펠츠-야콥병(Creutzfeldt-Jakob disease), 전두측두치매, 루이치매, 근위축성 측삭경화증(AlzAmyotrophic lateral sclerosis), 부신생물증후군(Paraneoplastic syndrome), 피질기저퇴행증, 다계통위축병, 진행성핵상마비, 신경계 자가면역질환, 척수 소뇌 실조(spinocerebellar ataxia), 염증성 및 신경병증성 통증, 뇌혈관 질환, 척수 손상(spinal cord injury) 및 타우병증(tauopathy)으로 이루어진 군에서 선택되는, 약학 조성물.According to clause 10,
The neurodegenerative disease or neuroinflammatory disease includes stroke, dementia, Alzheimer's disease, Parkinson's disease, Huntington's disease, Niemann-Pick disease, multiple sclerosis, prion disease ( prion disease), Creutzfeldt-Jakob disease, frontotemporal dementia, Lewy dementia, Amyotrophic lateral sclerosis, Paraneoplastic syndrome, corticobasal degeneration, multiple system atrophy disease, A pharmaceutical composition selected from the group consisting of progressive supranuclear paralysis, autoimmune diseases of the nervous system, spinocerebellar ataxia, inflammatory and neuropathic pain, cerebrovascular diseases, spinal cord injury and tauopathy. .
상기 조절 T 세포(regulatory T cells, Treg cells)에 존재하는 Lrig-1(leucine-rich and immunoglobulin-like domains 1) 단백질에 특이적으로 결합하는 결합 분자는,
서열번호 33으로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR1, 서열번호 34로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR2, 및 서열번호 25으로 표시되는 아미노산 서열로 이루어지는 중쇄 CDR3를 포함하는 중쇄 가변 영역; 및
서열번호 36으로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR1, 서열번호 37으로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR2, 서열번호 38로 표시되는 아미노산 서열로 이루어지는 경쇄 CDR3을 포함하는 경쇄 가변 영역을 포함하는 것인, Lrig-1 단백질에 특이적으로 결합하는 결합 분자와 BBB 셔틀 펩타이드의 결합체.According to clause 12,
The binding molecule that specifically binds to the Lrig-1 (leucine-rich and immunoglobulin-like domains 1) protein present in the regulatory T cells (Treg cells) is,
A heavy chain variable region comprising a heavy chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 33, a heavy chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 34, and a heavy chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 25; and
A light chain variable region comprising a light chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 36, a light chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 37, and a light chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 38, A conjugate of a binding molecule that specifically binds to the Lrig-1 protein and a BBB shuttle peptide.
상기 BBB 셔틀 펩타이드는 Angiopep-2, ApoB(3371-3409), ApoE(159-167)2, Peptide-22, THR, THR retro-enatio, CRT, Leptin 30, RVG29, DCDX, Apamin, MiniAp-4, GSH, G23, g7, TGN, TAT(47-57), SynB1, Diketopiperazines, PhPro으로 이루어진 그룹에서 선택되는, Lrig-1 단백질에 특이적으로 결합하는 결합 분자와 BBB 셔틀 펩타이드의 결합체.According to clause 13,
The BBB shuttle peptides are Angiopep-2, ApoB (3371-3409), ApoE (159-167) 2, Peptide-22, THR, THR retro-enatio , CRT, Leptin 30, RVG29, D CDX, Apamin, MiniAp-4 , GSH, G23, g7, TGN, TAT (47-57), SynB1, Diketopiperazines, and PhPro, a conjugate of a binding molecule that specifically binds to the Lrig-1 protein and a BBB shuttle peptide.
상기 BBB 셔틀 펩타이드는 서열번호 64 내지 81로 이루어진 군에서 선택되는 아미노산 서열을 포함하는, Lrig-1 단백질에 특이적으로 결합하는 결합 분자와 BBB 셔틀 펩타이드의 결합체.According to clause 13,
The BBB shuttle peptide is a conjugate of a BBB shuttle peptide and a binding molecule that specifically binds to the Lrig-1 protein, comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 64 to 81.
상기 뇌신경계 질환은 신경 퇴행성 질환 또는 신경 염증성 질환인, 약학 조성물. According to any one of claims 13 to 15,
A pharmaceutical composition, wherein the brain nervous system disease is a neurodegenerative disease or a neuroinflammatory disease.
상기 신경 퇴행성 질환 또는 신경 염증성 질환은 뇌졸중, 치매, 알츠하이머병(Alzheimer's disease), 파킨슨병(Parkinson's disease), 헌팅턴병(Huntington's disease), 니만-피크병(Niemann-Pick disease), 다발성 경화증, 프리온병(prion disease), 크로이펠츠-야콥병(Creutzfeldt-Jakob disease), 전두측두치매, 루이치매, 근위축성 측삭경화증(AlzAmyotrophic lateral sclerosis), 부신생물증후군(Paraneoplastic syndrome), 피질기저퇴행증, 다계통위축병, 진행성핵상마비, 신경계 자가면역질환, 척수 소뇌 실조(spinocerebellar ataxia), 염증성 및 신경병증성 통증, 뇌혈관 질환, 척수 손상(spinal cord injury) 및 타우병증(tauopathy)으로 이루어진 군에서 선택되는, 약학 조성물.According to clause 16,
The neurodegenerative disease or neuroinflammatory disease includes stroke, dementia, Alzheimer's disease, Parkinson's disease, Huntington's disease, Niemann-Pick disease, multiple sclerosis, prion disease ( prion disease), Creutzfeldt-Jakob disease, frontotemporal dementia, Lewy dementia, Amyotrophic lateral sclerosis, Paraneoplastic syndrome, corticobasal degeneration, multiple system atrophy disease, A pharmaceutical composition selected from the group consisting of progressive supranuclear paralysis, autoimmune diseases of the nervous system, spinocerebellar ataxia, inflammatory and neuropathic pain, cerebrovascular diseases, spinal cord injury and tauopathy. .
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020220093341A KR20240015800A (en) | 2022-07-27 | 2022-07-27 | The bispecific antibody and the conjugate that can cross the BBB to treat brain nervous disease |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020220093341A KR20240015800A (en) | 2022-07-27 | 2022-07-27 | The bispecific antibody and the conjugate that can cross the BBB to treat brain nervous disease |
Publications (1)
Publication Number | Publication Date |
---|---|
KR20240015800A true KR20240015800A (en) | 2024-02-06 |
Family
ID=89858652
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020220093341A KR20240015800A (en) | 2022-07-27 | 2022-07-27 | The bispecific antibody and the conjugate that can cross the BBB to treat brain nervous disease |
Country Status (1)
Country | Link |
---|---|
KR (1) | KR20240015800A (en) |
-
2022
- 2022-07-27 KR KR1020220093341A patent/KR20240015800A/en unknown
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11155617B2 (en) | LAG-3 antibody, antigen-binding fragment thereof, and pharmaceutical application thereof | |
US11014983B2 (en) | Anti-Tim-3 antibodies, compositions comprising anti-Tim-3 antibodies and methods of making and using anti-Tim-3 antibodies | |
JP6955721B2 (en) | RGMa binding protein and its use | |
TW201902933A (en) | Antibodies specific for FLT3 and uses thereof | |
JP2021525082A (en) | Anti-SIRPA antibody and its usage | |
KR102166083B1 (en) | Antibodies to bradykinin b1 receptor ligands | |
US20230183345A1 (en) | Anti-tigit antibody and preparation method and application thereof | |
JP7352973B2 (en) | Bispecific antibodies and their uses | |
JP7039468B2 (en) | Binding agonists for the treatment of nerve and other disorders | |
RU2771384C2 (en) | Pharmaceutical composition containing antibody to lag-3 and its use | |
CN110790839A (en) | anti-PD-1 antibody, antigen binding fragment thereof and medical application | |
US20200223915A1 (en) | Claudin 5 ANTIBODY, AND MEDICINE CONTAINING SAID ANTIBODY | |
US20210009706A1 (en) | Anti-CD27 Antibody, Antigen-binding Fragment Thereof, and Medical Use Thereof | |
WO2019076277A1 (en) | Uses of anti-pd-1 antibody and anti-lag-3 antibody jointly in preparing medicament for treating tumor | |
CN110662768B (en) | Therapeutic anti-CD 40 ligand antibodies | |
JP2022505330A (en) | Lrig-1 protein-specific binding molecule and its uses | |
CN109689870A (en) | For treating the antibody of autoimmune disease | |
EP3848049A1 (en) | Anti-tim3 antibody pharmaceutical composition and use thereof | |
WO2021190582A1 (en) | Anti-ox40 antibody pharmaceutical composition and use thereof | |
KR20240015800A (en) | The bispecific antibody and the conjugate that can cross the BBB to treat brain nervous disease | |
IL308395A (en) | Bispecific antibody specifically binding to cd47 and pd-l1 | |
US20220002438A1 (en) | Musk inhibition | |
KR20220117267A (en) | TGF-beta-RII binding protein | |
KR20220088428A (en) | Antibodies specific for glycosylated CTLA-4 and methods of use thereof | |
US20220380446A1 (en) | Antibodies for treating alpha-synucleinopathies |