KR20230116455A - Novel antibody with excellent binding affinity to human prion protein, and use thereof - Google Patents

Novel antibody with excellent binding affinity to human prion protein, and use thereof Download PDF

Info

Publication number
KR20230116455A
KR20230116455A KR1020220013413A KR20220013413A KR20230116455A KR 20230116455 A KR20230116455 A KR 20230116455A KR 1020220013413 A KR1020220013413 A KR 1020220013413A KR 20220013413 A KR20220013413 A KR 20220013413A KR 20230116455 A KR20230116455 A KR 20230116455A
Authority
KR
South Korea
Prior art keywords
prion protein
cancer
antibody
present
cells
Prior art date
Application number
KR1020220013413A
Other languages
Korean (ko)
Inventor
이상훈
Original Assignee
주식회사 스템바이오
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 스템바이오 filed Critical 주식회사 스템바이오
Priority to KR1020220013413A priority Critical patent/KR20230116455A/en
Priority to PCT/KR2022/007914 priority patent/WO2023146035A1/en
Publication of KR20230116455A publication Critical patent/KR20230116455A/en

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2872—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against prion molecules, e.g. CD230
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
    • A23L33/10—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
    • A23L33/17—Amino acids, peptides or proteins
    • A23L33/18—Peptides; Protein hydrolysates
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6854—Immunoglobulins
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
    • A23V2002/00—Food compositions, function of food ingredients or processes for food or foodstuffs
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
    • A23V2200/00—Function of food ingredients
    • A23V2200/30—Foods, ingredients or supplements having a functional effect on health
    • A23V2200/308—Foods, ingredients or supplements having a functional effect on health having an effect on cancer prevention
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biomedical Technology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Organic Chemistry (AREA)
  • Food Science & Technology (AREA)
  • Biochemistry (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Cell Biology (AREA)
  • Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Hospice & Palliative Care (AREA)
  • Oncology (AREA)
  • Biophysics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Genetics & Genomics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Mycology (AREA)
  • Nutrition Science (AREA)
  • Polymers & Plastics (AREA)
  • Peptides Or Proteins (AREA)

Abstract

본 발명은 프리온 단백질에 결합하는 신규한 항체에 관한 것으로, 본 발명에 따르면 상기 항체는 프리온 단백질 자체 및 프리온 단백질을 발현하는 암세포에 고특이적으로 결합할 수 있고, 저농도의 프리온 단백질에 대해서도 우수한 친화도를 보여주었으며, 특히 인간 프리온 단백질에 대해 우수한 결합 반응성을 보여주었다. 더불어 암 세포 및 항암제 내성암의 증식을 억제하는 효과 및 세포사멸을 유도하는 효과를 보였을 뿐만 아니라 암 세포에 대해서 세포내 유입이 가능한 것을 확인한 바, 이를 프리온 단백질 검출, 프리온 단백질을 과발현하는 암의 진단 및 치료와 항체-약물 접합체(Antibody drug conjugat, ADC) 등 다양한 용도로 유용하게 활용할 수 있다.The present invention relates to a novel antibody that binds to a prion protein. According to the present invention, the antibody can bind with high specificity to the prion protein itself and to cancer cells expressing the prion protein, and has excellent affinity even to low concentrations of the prion protein. In particular, it showed excellent binding reactivity to human prion protein. In addition, it showed the effect of inhibiting the proliferation of cancer cells and anticancer drug-resistant cancer and inducing apoptosis, as well as confirming that it was possible to enter the cells into cancer cells. And it can be usefully used for various purposes such as treatment and antibody-drug conjugates (Antibody drug conjugat, ADC).

Description

인간 프리온 단백질에 우수한 결합력을 가진 신규한 항체 및 이의 용도{Novel antibody with excellent binding affinity to human prion protein, and use thereof}Novel antibody with excellent binding affinity to human prion protein, and use thereof {Novel antibody with excellent binding affinity to human prion protein, and use thereof}

본 발명은 프리온 단백질 및 이를 발현하는 암 세포에 고특이적으로 결합하는 신규한 항체 및 이의 용도에 대한 것이다.The present invention relates to a novel antibody that highly specifically binds to a prion protein and cancer cells expressing the same, and uses thereof.

암은 비정상적으로 증식하는 세포로 인해 유발되는 질병으로 발병된 신체의 장기 이외에도 다른 장기를 침범하거나 퍼질 가능성을 지닌 악성종양을 말한다. 암 세포는 정상세포와 다르게 성장인자가 제대로 공급되지 않아도 자기 스스로 성장인자를 공급하여 성장할 수 있으며, 성장에 대한 억제 신호에 대한 저항성을 가지게 되어 지속적인 성장과 분열이 가능한 특성을 가진다. 또한, 정상적인 세포사멸에 대한 저항성 및 회피할 수 있는 능력을 가지고 있어 쉽게 제거되지 않는다. 더불어 암 세포는 종양 주위에 혈관 생성을 촉진시켜 암 세포 주변에 혈관 생성을 유도하여 생존에 필요로 하는 영양분을 계속해서 공급받아 생존에 유리하게 하는 경향이 있다.Cancer is a disease caused by abnormally proliferating cells and refers to a malignant tumor that has the possibility of invading or spreading to other organs in addition to the organ in which it is developed. Unlike normal cells, cancer cells can grow by supplying growth factors on their own, even if growth factors are not properly supplied, and have resistance to growth inhibitory signals, thereby enabling continuous growth and division. In addition, it has resistance to normal cell death and the ability to evade it, so it is not easily removed. In addition, cancer cells tend to promote the formation of blood vessels around the tumor to induce the formation of blood vessels around the cancer cells to continuously receive nutrients necessary for survival, giving an advantage to survival.

질병으로 인한 사망률을 보았을 때 암은 우리나라의 사망률 1위를 차지하고 있으며, 그 중 대장암(Colorectal cancer)는 전체 암 중 3번째로 높은 발생 빈도를 차지하며, 연간 암 발생 증가율은 6.7%에 달한다. When looking at the mortality rate due to disease, cancer ranks first in Korea's mortality rate, and among them, colorectal cancer occupies the third highest incidence among all cancers, with an annual cancer incidence rate of 6.7%.

대장암 치료에 있어서 치료방법의 결정은 종양의 크기가 아니라 종양의 조직 침투 정도에 따라 달라지며 현재의 치료법으로는 수술, 항암화학요법, 방사선 치료를 병행하는 방법이 있다. 현재 절제 수술 후 보조적인 항암치료까지 병행하여 대장암 환자의 5년 생존율을 증가시켰으나 25~35%의 환자들에서 전이가 발견되었고, 약 20%의 환자에서 대장암 진단 시 다른 장기로의 전이가 함께 진단되며, 전이성 대장암과 재발 암환자의 경우 항암약물치료가 주요 치료 방법이지만 완치가 힘들다고 보고된 바 있다. 또한, 대장암 말기에는 암줄기세포가 간(40%), 폐(15%), 복막(28%), 뼈(16%) 등 절제술이 힘든 곳으로 전이되어 주요 사망원인이 된다. 따라서 대장암의 진행 및 전이 억제를 위한 새로운 치료제 개발이 시급한 상황이다.In the treatment of colorectal cancer, the treatment method is determined not by the size of the tumor but by the degree of tissue penetration of the tumor. Current treatments include surgery, chemotherapy, and radiation therapy. Currently, adjuvant chemotherapy after excisional surgery has increased the 5-year survival rate of colorectal cancer patients, but metastasis was found in 25-35% of patients, and metastasis to other organs was found in about 20% of patients when diagnosed with colorectal cancer. It is diagnosed together, and in the case of patients with metastatic colorectal cancer and recurrent cancer, chemotherapy is the main treatment method, but it has been reported that it is difficult to cure it. In addition, in the late stage of colorectal cancer, cancer stem cells metastasize to places where resection is difficult, such as the liver (40%), lungs (15%), peritoneum (28%), and bone (16%), becoming a major cause of death. Therefore, there is an urgent need to develop new therapies for suppressing progression and metastasis of colorectal cancer.

대장암을 치료하기 위해 대장암의 전이 발생을 줄이고, 종양의 크기 및 성장을 감소시키기 위한 항암화학요법이 일반적으로 사용된다. 항암화학요법 중 옥살라플라틴(oxaliplatin)을 기반으로 하는 폴폭스요법(FOLFOX4)이 대장암 stage III, IV의 표준치료방법으로 사용되고 있다. 옥살라플라틴을 이용한 항암화학요법은 3기 대장암 환자의 3년간 생존율을 78.2%로 증가시킬 정도로 치료 효과가 뛰어나다. 따라서 FOLFOX 요법으로 알려진 5-플루오로우라실(5-Fluorourail), 류코보린(leucovorin) 등이 대장암 치료를 위한 1차 치료제인 보조 항암화학약제로 사용되고 있다. 하지만, 항암화학요법은 항암 효과와 더불어 다양한 부작용이 보고되고 있다. 옥살리플라틴의 부작용으로는 신독성과 이독성이 있고, 용량 제한 독성인 말초신경병증(85~95%), 알라닌아미노전이효소(alanine aminotransferase, ALT) 증가 (54% grade 3/4: 4%), 아스파테이트아미노전이효소(Aspartate aminotransferase, AST) 증가(36% grade 3/4: 1%), 혈소판 감소증(30%), 설사(46%), 메스꺼움 64%), 구토(37%) 등도 보고되고 있다. 이러한 부작용은 정상적인 세포에도 영향을 줄 수 있기 때문에 암 세포만을 특이적으로 표적할 수 있는 새로운 치료 방법이 필요하다. In order to treat colorectal cancer, chemotherapy for reducing the occurrence of metastasis of colorectal cancer and reducing the size and growth of tumors is generally used. Among chemotherapy, oxaliplatin-based FOLFOX4 is used as a standard treatment method for colorectal cancer stages III and IV. Chemotherapy using oxalaplatin is so effective that it increases the 3-year survival rate of patients with stage 3 colorectal cancer to 78.2%. Therefore, 5-fluorouracil, leucovorin, and the like, known as FOLFOX therapy, are used as adjuvant chemotherapy agents for the treatment of colorectal cancer. However, chemotherapy has been reported to have various side effects along with anticancer effects. Side effects of oxaliplatin include nephrotoxicity and ototoxicity, dose-limiting toxicity, peripheral neuropathy (85-95%), alanine aminotransferase (ALT) increase (54% grade 3/4: 4%), aspar. Increased aspartate aminotransferase (AST) (36% grade 3/4: 1%), thrombocytopenia (30%), diarrhea (46%), nausea (64%), and vomiting (37%) have also been reported. . Since these side effects can also affect normal cells, a new treatment method capable of specifically targeting only cancer cells is needed.

상기와 같은 화학항암요법의 부작용을 해결하기 위하여, 암 세포에 특이적으로 발현하는 특정 분자를 표적하는 약물 및 암을 치료하기 위한 분자표적 약물에 대한 연구가 활발하게 진행되고 있다. 암 세포의 특정 항원을 표적으로 하는 분자표적 의약품으로서 항체 약물이 출시되어 있으며, 대부분 항체 약물의 주요기작은 항체 의존성 세포독성 활성을 통해 약물의 치료 효과가 나타나는 것으로 보고되어 있다. 더불어 항체 약물의 암 치료 효과는 완전한 것이 아니기 때문에, 더 우수한 항암 효과를 가진 항체 약물을 위해 다양한 기술 개발이 진행되고 있다. In order to solve the side effects of chemotherapy as described above, studies on drugs that target specific molecules specifically expressed in cancer cells and molecular target drugs for treating cancer are being actively conducted. Antibody drugs have been released as molecular targeting drugs that target specific antigens of cancer cells, and it is reported that the main mechanism of most antibody drugs is antibody-dependent cytotoxic activity to show the therapeutic effect of the drug. In addition, since the cancer treatment effect of antibody drugs is not perfect, various technologies are being developed for antibody drugs with better anti-cancer effects.

한편, 정상 프리온 단백질(prion protein)은 전장 209개의 아미노산으로 이루어진 알파 헬릭스(α-helix) 구조의 당단백질로, 상기 단백질은 세포막 부위에 걸쳐 있거나, 관통하는 형태를 가지고 있다. 프리온 단백질은 세포간의 부착, 세포내 신호전달, 세포간의 소통 및 다양 세포과정에 중요한 역할을 하는 단백질로서 알려져 있다. 또한, 프리온 단백질은 일반적으로 신경세포에서 흔히 발현되고 세포분화, 세포 이동 및 신경물질의 교환을 조절하는 것으로 알려져 있지만, 신경세포 이외에 근육, 심장, 줄기세포 등 다양한 세포 및 장기에서 발견되는 것으로 보고된다. On the other hand, the normal prion protein is a glycoprotein of alpha helix structure consisting of 209 amino acids in length, and the protein has a form that spans or penetrates the cell membrane. Prion protein is known as a protein that plays an important role in adhesion between cells, intracellular signal transduction, communication between cells, and various cellular processes. In addition, prion proteins are commonly expressed in nerve cells and are known to regulate cell differentiation, cell migration, and exchange of nerve substances, but are reported to be found in various cells and organs, such as muscle, heart, and stem cells, in addition to nerve cells. .

더불어 프리온 단백질은 대장암, 위암 등 고형 암세포에서 과발현하고 있는 것으로 보고되었다. 프리온 단백질과 암과의 연구를 통해, 프리온 단백질은 암세포의 증식, 종양의 성장 및 전이를 촉진하는 역할을 하며, 항암제에 대한 내성 및 암 줄기세포에도 관여하고 있는 것으로 확인되었다. 이러한 여러 보고를 통해 프리온 단백질이 대장암을 포함한 여러 암의 치료에 있어 우수한 치료표적이 될 수 있고, 암을 진단하기 위한 마커로서의 가능성이 대두되었다.In addition, it has been reported that prion protein is overexpressed in solid cancer cells such as colorectal cancer and gastric cancer. Through research on prion protein and cancer, it was confirmed that prion protein plays a role in promoting cancer cell proliferation, tumor growth and metastasis, and is also involved in resistance to anticancer drugs and cancer stem cells. Through these various reports, prion protein can be an excellent therapeutic target for the treatment of various cancers, including colorectal cancer, and its potential as a marker for diagnosing cancer has emerged.

따라서 인간 프리온 단백질에 대해 우수한 결합능을 보이는 새로운 항체의 개발이 요구되고 있다.Therefore, there is a demand for the development of new antibodies showing excellent binding ability to human prion protein.

본 발명의 발명자들은 프리온 단백질을 표적하는 항체에 대하여 연구하던 중, 새로운 항체를 발굴하고 이의 프리온 단백질에 대한 결합능, 프리온 단백질을 과발현하는 암세포에 대한 결합능, 암 세포의 증식 억제 효과, 세포사멸 유도 효과 및 항체-약물 전달체로서의 사용 가능성을 확인하여 본 발명을 완성하였다.While the inventors of the present invention were researching antibodies targeting prion proteins, they discovered new antibodies and their binding ability to prion proteins, binding ability to cancer cells overexpressing prion proteins, inhibitory effect on cancer cell proliferation, and apoptosis inducing effect And the present invention was completed by confirming the possibility of use as an antibody-drug delivery system.

따라서 본 발명의 목적은 프리온 단백질(Prion protein) 특이적 항체를 제공하는 것이다.Accordingly, an object of the present invention is to provide a prion protein-specific antibody.

본 발명의 다른 목적은 하이브리도마 세포주를 제공하는 것이다.Another object of the present invention is to provide a hybridoma cell line.

본 발명의 또 다른 목적은 프리온 단백질 검출용 조성물을 제공하는 것이다.Another object of the present invention is to provide a composition for detecting prion protein.

본 발명의 또 다른 목적은 프리온 단백질 검출용 키트를 제공하는 것이다.Another object of the present invention is to provide a kit for detecting prion protein.

본 발명의 또 다른 목적은 프리온 단백질 검출 방법을 제공하는 것이다.Another object of the present invention is to provide a method for detecting prion protein.

본 발명의 또 다른 목적은 암 진단용 조성물을 제공하는 것이다.Another object of the present invention is to provide a composition for diagnosing cancer.

본 발명의 또 다른 목적은 암 예방 또는 치료용 약학적 조성물을 제공하는 것이다.Another object of the present invention is to provide a pharmaceutical composition for preventing or treating cancer.

본 발명의 또 다른 목적은 암 예방 또는 개선용 식품 조성물을 제공하는 것이다.Another object of the present invention is to provide a food composition for preventing or improving cancer.

본 발명의 또 다른 목적은 세포내 약물전달용 조성물을 제공하는 것이다.Another object of the present invention is to provide a composition for intracellular drug delivery.

본 발명의 또 다른 목적은 약물 또는 검출 시약을 세포내로 전달하는 방법을 제공하는 것이다.Another object of the present invention is to provide a method for delivering a drug or detection reagent into cells.

상기 목적을 달성하기 위하여, 본 발명은 서열번호 1의 아미노산 서열로 구성된 CDR1 부위, 서열번호 2의 아미노산 서열로 구성된 CDR2 부위 및 서열번호 3의 아미노산 서열로 구성된 CDR3 부위를 포함하는 중쇄 가변영역; 및 서열번호 4의 아미노산 서열로 구성된 CDR1 부위, 서열번호 5의 아미노산 서열로 구성된 CDR2 부위 및 서열번호 6의 아미노산 서열로 구성된 CDR3 부위를 포함하는 경쇄 가변영역;을 포함하는, 프리온 단백질(Prion protein) 특이적 항체를 제공한다.In order to achieve the above object, the present invention provides a heavy chain variable region comprising a CDR1 region composed of the amino acid sequence of SEQ ID NO: 1, a CDR2 region composed of the amino acid sequence of SEQ ID NO: 2, and a CDR3 region composed of the amino acid sequence of SEQ ID NO: 3; And a light chain variable region comprising a CDR1 region composed of the amino acid sequence of SEQ ID NO: 4, a CDR2 region composed of the amino acid sequence of SEQ ID NO: 5, and a CDR3 region composed of the amino acid sequence of SEQ ID NO: 6; containing, a prion protein specific antibodies are provided.

상기 다른 목적을 달성하기 위하여, 본 발명은 본 발명에 따른 프리온 단백질 특이적 항체를 생산하는 하이브리도마 세포주를 제공한다.In order to achieve the above other object, the present invention provides a hybridoma cell line producing a prion protein-specific antibody according to the present invention.

상기 또 다른 목적을 달성하기 위하여, 본 발명은 본 발명에 따른 프리온 단백질 특이적 항체를 포함하는, 프리온 단백질 검출용 조성물을 제공한다.In order to achieve the above another object, the present invention provides a composition for detecting prion protein comprising the prion protein-specific antibody according to the present invention.

상기 또 다른 목적을 달성하기 위하여, 본 발명은 본 발명에 따른 프리온 단백질 특이적 항체를 포함하는, 프리온 단백질 검출용 키트를 제공한다.In order to achieve the above another object, the present invention provides a kit for detecting prion protein, including the prion protein-specific antibody according to the present invention.

상기 또 다른 목적을 달성하기 위하여, 본 발명은 본 발명에 따른 프리온 단백질 특이적 항체를 시료에 처리하는 단계; 시료의 반응을 검출하는 단계;를 포함하는, 프리온 단백질 검출 방법을 제공한다.In order to achieve the above another object, the present invention comprises the steps of treating a sample with a prion protein-specific antibody according to the present invention; It provides a prion protein detection method comprising; detecting the reaction of the sample.

상기 또 다른 목적을 달성하기 위하여, 본 발명은 본 발명에 따른 프리온 단백질 특이적 항체를 포함하는, 암 진단용 조성물을 제공한다.In order to achieve the above another object, the present invention provides a composition for diagnosing cancer comprising the prion protein-specific antibody according to the present invention.

상기 또 다른 목적을 달성하기 위하여, 본 발명은 본 발명에 따른 프리온 단백질을 포함하는, 암 예방 또는 치료용 약학적 조성물을 제공한다.In order to achieve the above another object, the present invention provides a pharmaceutical composition for preventing or treating cancer, comprising the prion protein according to the present invention.

상기 또 다른 목적을 달성하기 위하여, 본 발명은 본 발명에 따른 프리온 단백질을 포함하는, 암 예방 또는 개선용 식품 조성물을 제공한다.In order to achieve the above another object, the present invention provides a food composition for preventing or improving cancer, comprising the prion protein according to the present invention.

상기 또 다른 목적을 달성하기 위하여, 본 발명은 본 발명에 따른 프리온 단백질을 포함하는, 세포내 약물전달용 조성물을 제공한다.In order to achieve the above another object, the present invention provides a composition for intracellular drug delivery comprising the prion protein according to the present invention.

상기 또 다른 목적을 달성하기 위하여, 본 발명은 1) 본 발명에 따른 프리온 단백질 특이적 항체에 목적하는 약물 또는 검출 시약을 결합시키는 단계; 및 2) 상기 1) 단계에서 제조된 결합 물질을 세포에 처리하는 단계;를 포함하는 약물 또는 검출 시약을 세포내로 전달하는 방법을 제공한다.In order to achieve the above another object, the present invention is 1) binding a desired drug or detection reagent to the prion protein-specific antibody according to the present invention; and 2) treating cells with the binding material prepared in step 1).

본 발명의 프리온 단백질에 결합하는 신규한 항체는 프리온 단백질 자체 및 프리온 단백질을 발현하는 암 세포에 고특이적으로 결합할 수 있고, 저농도의 프리온 단백질에 대해서도 우수한 친화도를 보여주었으며, 특히 인간 프리온 단백질에 대해 우수한 결합 반응성을 보여주었다. 더불어 암 세포 및 항암제 내성암의 증식을 억제하는 효과 및 세포사멸을 촉진하는 효과를 보였을 뿐만 아니라 암 세포에 대해서 세포내 유입이 가능한 것을 확인한 바, 이를 프리온 단백질 검출, 프리온 단백질을 과발현하는 암의 진단 및 치료와 항체-약물 접합체(Antibody drug conjugat, ADC) 등 다양한 용도로 유용하게 활용할 수 있다.The novel antibody that binds to the prion protein of the present invention can highly specifically bind to the prion protein itself and to cancer cells expressing the prion protein, and shows excellent affinity even to low concentrations of the prion protein, especially human prion protein. showed excellent binding reactivity to In addition, it was confirmed that it not only showed the effect of inhibiting the proliferation of cancer cells and anticancer drug-resistant cancer and the effect of promoting apoptosis, but also that it was possible to enter the cells into cancer cells. And it can be usefully used for various purposes such as treatment and antibody-drug conjugates (Antibody drug conjugat, ADC).

도 1은 본 발명에 따른 프리온 단백질을 표적하는 항체를 도출하기 위한 바이오패닝(biopanning) 수행 결과를 나타낸 도이다.
도 2는 도 1의 라이브러리에서 선별된 독립 클론의 프리온 단백질에 대한 비특이적 결합 여부를 확인한 결과이다.
도 3은 히트 시퀀스(hit sequence)를 통해 선별된 클론들의 서열을 분석한 결과를 나타낸 도이다.
도 4는 본 발명에 따른 프리온 단백질을 표적하는 항체의 항 프리온 인간 항체(Anti-prion human antibody)에 대한 발현 및 생산성을 확인한 결과이다.
도 5는 본 발명에 따른 프리온 단백질을 표적하는 항체의 프리온 단백질에 대한 친화도를 확인한 결과이다.
도 6은 본 발명에 따른 프리온 단백질을 표적하는 항체의 에피토프 맵핑(Epitope mapping) 결과를 기반으로 프리온 단백질에 대한 항원 결합 부위를 확인한 결과이다.
도 7은 본 발명에 따른 프리온 단백질을 표적하는 항체의 인간 또는 마우스 유래 프리온 단백질에 대한 교차반응성을 확인한 결과이다.
도 8 및 도 9는 본 발명에 따른 프리온 단백질을 표적하는 항체의 암 세포에서의 항원 결합력을 확인한 결과이다.
도 10은 본 발명에 따른 프리온 단백질을 표적하는 항체의 대장암 세포 증식 억제 효과를 확인한 결과이다.
도 11은 본 발명에 따른 프리온 단백질을 표적하는 항체의 항암제 내성 결장암 세포 증식 억제 효과를 확인한 결과이다.
도 12는 본 발명에 따른 프리온 단백질을 표적하는 항체의 전립선암, 대장암 및 폐암 세포에 대한 세포사멸 유도 효과를 확인한 결과이다.
도 13은 본 발명에 따른 프리온 단백질을 표적하는 항체를 항암제 내성암 세포에 처리한 후, 세포 내 위치를 확인한 결과이다.
도 14는 본 발명에 따른 프리온 단백질을 표적하는 항체를 항암제 내성암 세포에 처리한 후, 암 세포 표면의 시간에 따른 항체 잔류량을 확인한 결과이다.1 is a diagram showing the results of performing biopanning to derive an antibody targeting a prion protein according to the present invention.
FIG. 2 is a result of confirming non-specific binding of independent clones selected from the library of FIG. 1 to prion protein.
3 is a diagram showing the results of sequence analysis of clones selected through a hit sequence.
4 is a result of confirming the expression and productivity of an anti-prion human antibody of an antibody targeting a prion protein according to the present invention.
5 is a result of confirming the affinity of the antibody targeting the prion protein according to the present invention to the prion protein.
6 is a result of confirming the antigen binding site for the prion protein based on the result of epitope mapping of the antibody targeting the prion protein according to the present invention.
7 is a result of confirming the cross-reactivity of the prion protein-targeting antibody according to the present invention to human or mouse-derived prion protein.
8 and 9 show the results of confirming the antigen-binding ability of the antibody targeting the prion protein according to the present invention in cancer cells.
10 is a result of confirming the effect of the antibody targeting the prion protein according to the present invention to inhibit colon cancer cell proliferation.
11 is a result confirming the effect of the antibody targeting the prion protein according to the present invention to inhibit the proliferation of anti-cancer drug-resistant colon cancer cells.
12 is a result of confirming the apoptosis inducing effect of the antibody targeting the prion protein according to the present invention on prostate cancer, colorectal cancer and lung cancer cells.
13 is a result of confirming the intracellular location after treating anticancer drug-resistant cancer cells with the antibody targeting the prion protein according to the present invention.
14 is a result of confirming the amount of antibody remaining on the surface of cancer cells over time after anticancer drug-resistant cancer cells were treated with an antibody targeting the prion protein according to the present invention.

이하, 본 발명에 대해 상세히 설명한다.Hereinafter, the present invention will be described in detail.

본 발명은 서열번호 1의 아미노산 서열로 구성된 CDR1 부위, 서열번호 2의 아미노산 서열로 구성된 CDR2 부위 및 서열번호 3의 아미노산 서열로 구성된 CDR3 부위를 포함하는 중쇄 가변영역; 및 서열번호 4의 아미노산 서열로 구성된 CDR1 부위, 서열번호 5의 아미노산 서열로 구성된 CDR2 부위 및 서열번호 6의 아미노산 서열로 구성된 CDR3 부위를 포함하는 경쇄 가변영역;을 포함하는, 프리온 단백질(Prion protein) 특이적 항체를 제공한다.The present invention comprises a heavy chain variable region comprising a CDR1 region composed of the amino acid sequence of SEQ ID NO: 1, a CDR2 region composed of the amino acid sequence of SEQ ID NO: 2, and a CDR3 region composed of the amino acid sequence of SEQ ID NO: 3; And a light chain variable region comprising a CDR1 region composed of the amino acid sequence of SEQ ID NO: 4, a CDR2 region composed of the amino acid sequence of SEQ ID NO: 5, and a CDR3 region composed of the amino acid sequence of SEQ ID NO: 6; containing, a prion protein specific antibodies are provided.

아미노산 서열amino acid sequence 서열번호sequence number 중쇄 가변영역heavy chain variable region CDR1CDR1 NSYAFSNSYAFS 1One CDR2CDR2 RVIPVLDVANYAQKFQGRVIPVLDVANYAQKFQG 22 CDR3CDR3 EGGTGWGNSFDLEGGTGWGNSFDL 33 경쇄 가변영역light chain variable region CDR1CDR1 RASQSVGTFLHRASQSVGTFLH 44 CDR2CDR2 TASTLESTASTLES 55 CDR3CDR3 QQFHDLPITQQFHDLPIT 66

상기 항체는 파지디스플레이(Phage display) 분석법을 이용한 바이오패닝(biopanning)을 진행하여 프리온 단백질을 타겟으로 하는 라이브러리(library)를 준비하고, 비특이적 결합을 보이는 클론을 제외한 후, 히트 시퀀스(hit sequence)를 통해 선별된 클론의 서열을 분석하고, 프리온 단백질에 대해 고특이적인 높은 결합력을 보이는 항체를 선별한 것으로, 본 발명에서는 상기 항체를 CSA0156으로 명칭하였다.The antibody is subjected to biopanning using a phage display assay to prepare a library targeting the prion protein, excluding clones showing non-specific binding, and then generating a hit sequence. The sequence of the selected clone was analyzed, and an antibody showing high specificity and high binding ability to the prion protein was selected. In the present invention, the antibody was named CSA0156.

본 발명의 항체에 있어서, 서열번호 7의 아미노산 서열로 표시되는 중쇄 가변영역 및 서열번호 8의 아미노산 서열로 표시되는 경쇄 가변영역을 포함하는 것이 바람직하다. 상기 중쇄 가변영역은 서열번호 9로 표시되는 염기서열에 의해 암호화되고, 상기 경쇄 가변영역은 서열번호 10으로 표시되는 염기서열에 의해 암호화되는 것이 바람직하다.The antibody of the present invention preferably comprises a heavy chain variable region represented by the amino acid sequence of SEQ ID NO: 7 and a light chain variable region represented by the amino acid sequence of SEQ ID NO: 8. Preferably, the heavy chain variable region is encoded by the nucleotide sequence represented by SEQ ID NO: 9, and the light chain variable region is encoded by the nucleotide sequence represented by SEQ ID NO: 10.

.. 서열order 서열번호sequence number 중쇄 가변영역heavy chain variable region 아미노산 서열amino acid sequence QVQLVQSGAEVKKPGSSVKVSCKAPGGTFNSYAFSWLRQAPGQGLEWMGRVIPVLDVANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCAREGGTGWGNSFDLWGQGALITVSSQVQLVQSGAEVKKPGSSVKVSCKAPGGTFNSYAFSWLRQAPGQGLEWMGRVIPVLDVANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCAREGGTGWGNSFDLWGQGALITVSS 77 염기서열base sequence CAGGTTCAGTTGGTTCAGTCTGGCGCCGAAGTGAAGAAACCCGGCTCCTCTGTGAAGGTGTCCTGCAAAGCTCCTGGCGGCACCTTCAACTCCTACGCCTTTAGCTGGCTGAGACAGGCTCCTGGACAGGGCCTTGAGTGGATGGGAAGAGTGATCCCTGTGCTGGACGTGGCCAACTACGCCCAGAAATTCCAGGGCAGAGTGACCATCACCGCCGACAAGTCTACCTCCACCGCCTACATGGAACTGTCCAGCCTGAGATCTGAGGACACCGCCGTGTACTACTGCGCTAGAGAAGGCGGAACCGGCTGGGGCAACTCTTTTGATTTGTGGGGACAGGGCGCTCTGATCACCGTGTCCTCTCAGGTTCAGTTGGTTCAGTCTGGCGCCGAAGTGAAGAAACCCGGCTCCTCTGTGAAGGTGTCCTGCAAAGCTCCTGGCGGCACCTTCAACTCCTACGCCTTTAGCTGGCTGAGACAGGCTCCTGGACAGGGCCTTGAGTGGATGGGAAGAGTGATCCCTGTGCTGGACGTGGCCAACTACGCCCAGAAATTCCAGGGCAGAGTGACCATCACCGCCGACAAGTCTACCTCCACCGCCTACAT GGAACTGTCCAGCCTGAGATCTGAGGACACCGCCGTGTACTACTGCGCTAGAGAAGGCGGAACCGGCTGGGGCAACTCTTTTGATTTGTGGGGACAGGGCGCTCTGATCACCGTGTCCTCT 99 경쇄 가변영역light chain variable region 아미노산 서열amino acid sequence DIQMTQSPSSLSASVGDRVTITCRASQSVGTFLHWYQQKPGKAPKLLIYTASTLESGVPSRFSGSGSGTHFTLTINRLQPEDIATYYCQQFHDLPITFGQGTRLDIKRDIQMTQSPSSLSASVGDRVTITCRASQSVGTFLHWYQQKPGKAPKLLIYTASTLESGVPSRFSGSGSGTHFTLTINRLQPEDIATYYCQQFHDLPITFGQGTRLDIKR 88 염기서열base sequence GACATTCAGATGACCCAGTCTCCATCCAGCCTGTCCGCCTCTGTGGGCGACAGAGTGACCATCACCTGTCGGGCTTCTCAGTCCGTGGGCACCTTCCTGCATTGGTATCAGCAGAAGCCTGGCAAGGCCCCTAAGCTGCTGATCTACACCGCTAGCACCCTGGAATCTGGCGTGCCCTCTAGATTCTCCGGCTCTGGCTCTGGCACCCACTTCACCCTGACCATCAACAGACTGCAGCCCGAGGATATCGCCACCTACTACTGCCAGCAGTTCCACGACCTGCCTATCACCTTTGGCCAGGGCACCAGACTGGACATCAAGAGAGACATTCAGATGACCCAGTCTCCATCCAGCCTGTCCGCCTCTGTGGGCGACAGAGTGACCATCACCTGTCGGGCTTCTCAGTCCGTGGGCACCTTCCTGCATTGGTATCAGCAGAAGCCTGGCAAGGCCCCTAAGCTGCTGATCTACACCGCTAGCACCCTGGAATCTGGCGTGCCCTCTAGATTCTCCGGCTCTGGCTCTGGCACCCACTTCACCCTGACCATCAACAGACTGCAGCCGA GGATATCGCCACCTACTACTGCCAGCAGTTCCACGACCTGCCTATCACCTTTGGCCAGGGCACCAGACTGGACATCAAGAGA 1010

본 발명의 "프리온 단백질 특이적 항체"는 프리온 단백질 또는 프리온 단백질을 발현하는 세포 표면에 특이적으로 결합하는 단일 클론 항체이며, 상기와 같이 정의된 경쇄 가변 영역 및 중쇄 가변 영역을 포함하는 항체를 의미한다.본 발명의 일실시예에 따르면, 본 발명에 따른 항체를 인간 유래 프리온 단백질과 마우스 유래 프리온 단백질에 처리하였을 때 인간 유래 프리온 단백질에 더 높은 결합력을 보임을 확인하였다.The "prion protein-specific antibody" of the present invention is a monoclonal antibody that specifically binds to the surface of a prion protein or a cell expressing the prion protein, and refers to an antibody comprising a light chain variable region and a heavy chain variable region defined as above According to one embodiment of the present invention, it was confirmed that when the antibody according to the present invention was treated with human-derived prion protein and mouse-derived prion protein, it exhibited higher binding affinity to human-derived prion protein.

따라서 본 발명의 항체는 인간 유래 프리온 단백질에 고특이적으로 결합하는 것을 특징으로 한다.Therefore, the antibody of the present invention is characterized by highly specific binding to human-derived prion protein.

본 발명에서 제공하는 단일 클론 항체는 당해 분야에 공지된 방법에 의하여 제조될 수 있다. 일례로, 파지 디스플레이를 사용하여 비면역화 공여자로부터의 면역글로불린 가변 영역 유전자 레퍼토리로부터 시험관내에서 항체를 생성할 수 있다. 또는 화학적 펩티드 합성방법으로 제조할 수도 있고, 상기 단클론 항체를 코딩하는 유전자를 PCR(polymerase chain reaction)을 통해 증폭하거나, 공지된 방법으로 합성한 후 발현벡터에 클로닝하여 발현시켜서 제조할 수도 있으며, 상기 단일 클론 항체의 면역원을 동물에 주사하여 얻어진 림프구로부터 유래된 하이브리도마 세포주를 사용하여 제조할 수도 있고 프리온 단백질을 면역원으로 동물에 접종하고, 상기 동물로부터 얻어진 림프구를 사용하여 제작된 하이브리도마 세포주를 사용하여 제조할 수 있다.Monoclonal antibodies provided in the present invention can be produced by methods known in the art. In one example, phage display can be used to generate antibodies in vitro from immunoglobulin variable region gene repertoires from non-immunized donors. Alternatively, it may be prepared by a chemical peptide synthesis method, or it may be prepared by amplifying the gene encoding the monoclonal antibody through PCR (polymerase chain reaction) or synthesizing it by a known method and then cloning it into an expression vector and expressing it. It may be prepared using a hybridoma cell line derived from lymphocytes obtained by injecting an immunogen of a monoclonal antibody into an animal, or a hybridoma cell line prepared by inoculating an animal with a prion protein as an immunogen and using lymphocytes obtained from the animal. can be produced using

따라서, 본 발명은 본 발명의 프리온 단백질 특이적 항체를 생산하는 하이브리도마(hybridoma) 세포주를 제공한다.Accordingly, the present invention provides a hybridoma cell line producing the prion protein-specific antibody of the present invention.

상기 하이브리도마 세포주란 2개의 다른 종류의 세포를 인공적으로 융합시켜 만든 세포로, 폴리에틸렌글리콜 등 세포융합을 일으키게 하는 물질이나 어떤 종의 바이러스를 사용하여 둘 이상의 동종 세포나 이종 세포가 융합되어, 각기 다른 세포가 갖는 다른 기능을 하나의 세포 속에 통합시킨 세포 또는 세포주를 의미한다. 특히, 골수종 세포(myeloma cell)와 비장이나 림프절에 들어 있는 림프구 가운데 항체 생성세포의 선구세포인 B세포를 융합시킨 잡종세포는 단일 클론항체를 만들어내므로 연구와 임상에 널리 응용된다. 그 밖에 림포카인(생리활성물질)을 만들어내는 T세포와 그 종양세포인 하이브리드마 등도 실용화되고 있다. 본 발명의 하이브리도마 세포는 바람직하게는 프리온 단백질로 면역화된 림프구와 골수종 세포가 융합된 세포일 수 있으며, 프리온 단백질 특이적 항체를 생산할 수 있는 하이브리도마 세포주를 제한없이 포함할 수 있다.The hybridoma cell line is a cell made by artificially fusing two different types of cells, and two or more allogeneic or heterogeneous cells are fused using a substance that causes cell fusion, such as polyethylene glycol, or a virus of a certain species. It refers to a cell or cell line in which different functions of different cells are integrated into one cell. In particular, hybrid cells fused with myeloma cells and B cells, precursor cells of antibody-producing cells among lymphocytes in the spleen or lymph node, produce monoclonal antibodies, and are therefore widely applied in research and clinical practice. In addition, T cells that produce lymphokines (physiologically active substances) and hybridomas, which are tumor cells, are also being put into practical use. The hybridoma cell of the present invention may preferably be a cell in which a lymphocyte immunized with a prion protein and a myeloma cell are fused, and may include, without limitation, a hybridoma cell line capable of producing a prion protein-specific antibody.

본 발명에 따른 항체는 프리온 단백질에 대해 고특이적으로 높은 결합능을 보이는 바, 본 발명은 본 발명에 따른 프리온 단백질 특이적 항체를 포함하는, 프리온 단백질 검출용 조성물을 제공한다.Since the antibody according to the present invention exhibits highly specific and high binding ability to prion protein, the present invention provides a composition for detecting prion protein comprising the prion protein-specific antibody according to the present invention.

더불어 본 발명은 본 발명에 따른 프리온 단백질 특이적 항체를 포함하는, 프리온 단백질 검출용 키트를 제공한다.In addition, the present invention provides a kit for detecting prion protein, including the prion protein-specific antibody according to the present invention.

본 발명의 항체를 이용한 프리온 단백질의 검출을 위하여, 본 발명의 항체는 구별가능한 표지물질로 표지될 수 있으며, 상기 표지 물질은 상기 항체에 결합되어 목적하는 프리온 단백질 또는 프리온 단백질이 표면에 발현된 세포를 구별 또는 분리하는데 사용될 수 있는 한, 특별히 이에 제한되지 않는다. 예컨대 리간드, 비드(bead), 방사성 핵종, 효소, 기질, 보조인자, 억제제, 형광물질(fluorescer), 화학발광물질, 자성 입자, 합텐, 염료 등이 될 수 있고, 다른 예로서, 바이오틴, 아비딘, 스트렙토아비딘 등의 리간드; 루시퍼라아제, 퍼옥시다아제, 베타 갈락토시다아제 등의 효소; 플루오레세인, 6-카르복시플루오레세인, 핵사크로로-6-카르복시플루오레세인, 테트라크로로-6-카르복시플루오레세인, VIC, JOE, 5-(2'-아미노에틸)아미노 나프탈렌-1-술폰산, 쿠마린 및 이의 유도체, 시아닌-5, 루시퍼 옐로우, 텍사스 레드, 테트라메틸로다민, 야키마 옐로우, 칼 플루오르레드 610, 쿠마린, 이들의 유도체 등의 형광물질 등이 상기 표지물질에 제한없이 포함될 수 있다.For detection of the prion protein using the antibody of the present invention, the antibody of the present invention may be labeled with a distinguishable label, and the label is bound to the antibody to target the prion protein or cells expressing the prion protein on the surface. As long as it can be used to distinguish or separate, it is not particularly limited thereto. For example, it may be a ligand, a bead, a radionuclide, an enzyme, a substrate, a cofactor, an inhibitor, a fluorescer, a chemiluminescent material, a magnetic particle, a hapten, a dye, and the like. Other examples include biotin, avidin, ligands such as streptavidin; Enzymes such as luciferase, peroxidase and beta galactosidase; Fluorescein, 6-carboxyfluorescein, hexachloro-6-carboxyfluorescein, tetrachloro-6-carboxyfluorescein, VIC, JOE, 5-(2'-aminoethyl)aminonaphthalene-1 - Fluorescent substances such as sulfonic acid, coumarin and derivatives thereof, cyanine-5, lucifer yellow, Texas red, tetramethylrhodamine, Yakima yellow, Cal Fluor Red 610, coumarin and derivatives thereof, etc. may be included in the label without limitation. can

프리온 단백질에 결합한 본 발명에 따른 항체의 확인, 검출 및 정량을 용이하게 하기 위하여, 본 발명의 키트에 포함되는 항체는 상술한 바와 같이 표지된 상태로 제공될 수 있다. 한편, 본 발명의 항체가 표지되지 않은 채로 제공되는 경우에는, 본 발명의 키트는 본 발명의 항체의 시험관 내 또는 생체 내에서 프리온 단백질과의 결합을 검출 및 확인하기 위한 성분을 추가로 포함할 수 있다. 상기 성분은 본 발명의 항체의 표지를 위한 공지의 화합물이거나, 항원-항체반응을 통한 탐색을 위하여 본 발명의 항체 또는 본 발명의 항체에 대한 2차 항체 및 이의 검출을 위한 시약일 수 있다. In order to facilitate the identification, detection and quantification of the antibody according to the present invention bound to the prion protein, the antibody included in the kit of the present invention may be provided in a labeled state as described above. On the other hand, when the antibody of the present invention is provided unlabeled, the kit of the present invention may further include a component for detecting and confirming the binding of the antibody of the present invention to the prion protein in vitro or in vivo. there is. The component may be a known compound for labeling the antibody of the present invention, or a reagent for detecting the antibody of the present invention or a secondary antibody to the antibody of the present invention for detection through an antigen-antibody reaction.

또한 본 발명은 본 발명에 따른 프리온 단백질 특이적 항체를 시료에 처리하는 단계; 및 시료의 반응을 검출하는 단계;를 포함하는, 프리온 단백질 검출 방법을 제공한다.In addition, the present invention comprises the steps of treating a sample with a prion protein-specific antibody according to the present invention; And detecting the reaction of the sample; it provides a method for detecting prion protein, including.

본 발명에 있어서 상기 "시료"는 가장 광범위한 의미로 사용된다. 한편으로 이는 검체 또는 배양물(예를 들어 미생물 배양물)을 포함하는 의미이다. 다른 한편으로는 생물학적 및 환경적 시료 양자 모두를 포함하는 의미이다. 더불어 시료는 합성 기원의 검체를 포함할 수 있다. 상기 생물학적 시료는 전혈(whole blood), 혈장(plasma), 혈청(serum), 객담(sputum), 눈물(tears), 점액(mucus), 세비액(nasal washes), 비강 흡인물(nasal aspirate), 호흡(breath), 소변(urine), 정액(semen), 침(saliva), 복강 세척액(peritoneal washings), 복수(ascites), 낭종액(cystic fluid), 뇌척수막 액(meningeal fluid), 양수(amniotic fluid), 백혈구(leukocytes), 말초혈액 단핵 세포(peripheral blood mononuclear cells), 백혈구 연층(buffy coat), 선액(glandular fluid), 췌장액(pancreatic fluid), 림프액(lymph fluid), 흉수(pleural fluid), 유두 흡인물(nipple aspirate), 기관지 흡인물(bronchial aspirate), 활액(synovial fluid), 관절 흡인물(joint aspirate), 기관 분비물(organ secretions), 세포(cell), 세포 추출물(cell extract) 및 뇌척수액(cerebrospinal fluid)으로 이루어진 군에서 선택된 어느 하나 이상일 수 있으나, 이에 제한되는 것은 아니다.In the present invention, the "sample" is used in the broadest sense. On the one hand, it is meant to include specimens or cultures (eg microbial cultures). On the other hand, it is meant to include both biological and environmental samples. In addition, samples may include specimens of synthetic origin. The biological sample may be whole blood, plasma, serum, sputum, tears, mucus, nasal washes, nasal aspirate, Breath, urine, semen, saliva, peritoneal washings, ascites, cystic fluid, meningeal fluid, amniotic fluid ), leukocytes, peripheral blood mononuclear cells, leukocyte buffy coat, glandular fluid, pancreatic fluid, lymph fluid, pleural fluid, papilla Nipple aspirate, bronchial aspirate, synovial fluid, joint aspirate, organ secretions, cells, cell extract and cerebrospinal fluid ( cerebrospinal fluid) may be any one or more selected from the group consisting of, but is not limited thereto.

본 발명의 다른 일실시예에 따르면 본 발명에 따른 항체는 프리온 단백질을 표면에 과발현하는 암 세포의 세포막에 결합하는 것을 확인하였다. According to another embodiment of the present invention, it was confirmed that the antibody according to the present invention binds to the cell membrane of cancer cells overexpressing the prion protein on the surface.

따라서 본 발명은 본 발명에 따른 프리온 단백질 특이적 항체를 포함하는, 암 진단용 조성물을 제공한다.Accordingly, the present invention provides a composition for diagnosing cancer comprising the prion protein-specific antibody according to the present invention.

본 발명에 있어서, 상기 "진단"은 특정 질병 또는 질환, 또는 이의 원인에 대한 한 개체의 감수성(susceptibility)을 판정하는 것, 한 개체가 특정 질병 또는 질환을 현재 가지고 있는 지 여부를 판정하는 것, 특정 질병 또는 질환에 걸린 한 객체의 예후(prognosis)를 판정하는 것, 또는 테라메트릭스(therametrics)(예컨대, 치료 효능에 대한 정보를 제공하기 위하여 개체의 상태를 모니터링 하는 것)를 포함한다.In the present invention, the "diagnosis" refers to determining an individual's susceptibility to a specific disease or disorder or its cause, determining whether an individual currently has a specific disease or disorder, determining the prognosis of a subject suffering from a particular disease or condition, or therametrics (eg, monitoring a subject's condition to provide information about the efficacy of a treatment).

상술한 바와 같이, 본 발명의 항체를 이용하여 표면에 프리온 단백질을 발현하고 있는 세포, 특히 암 세포의 검출이 가능한바, 상기 암은 프리온 단백질을 과발현하는 암인 것을 특징으로 한다. 바람직하게는 상기 암은 이에 제한되는 것은 아니나 대장암, 폐암, 전립선암, 위암, 유방암 및 췌장암으로 이루어진 군에서 선택된 어느 하나 이상일 수 있고/있거나 항암제 내성 암일 수 있다.As described above, since the antibody of the present invention can be used to detect cells expressing prion protein on the surface, particularly cancer cells, the cancer is characterized by overexpressing prion protein. Preferably, the cancer may be at least one selected from the group consisting of, but not limited to, colorectal cancer, lung cancer, prostate cancer, gastric cancer, breast cancer, and pancreatic cancer, and/or may be anticancer drug-resistant cancer.

또한 본 발명의 또 다른 일실시예에 따르면, 본 발명에 따른 항체를 대장암 또는 항암제 내성 대장암에 처리시 농도의존적인 암 세포의 증식 억제 효과를 확인하였다.In addition, according to another embodiment of the present invention, when colorectal cancer or anticancer drug-resistant colorectal cancer was treated with the antibody according to the present invention, a concentration-dependent effect of inhibiting cancer cell proliferation was confirmed.

더불어 본 발명의 또 다른 일실시예에 따르면, 본 발명에 따른 항체를 전립선암, 대장암 및 폐암에 처리시 세포사멸 유도 효과가 있음을 확인하였다.In addition, according to another embodiment of the present invention, it was confirmed that there is an apoptosis inducing effect when the antibody according to the present invention is treated with prostate cancer, colon cancer and lung cancer.

따라서 본 발명은 본 발명에 따른 프리온 단백질 특이적 항체를 포함하는, 암 예방 또는 치료용 약학적 조성물을 제공한다.Accordingly, the present invention provides a pharmaceutical composition for preventing or treating cancer comprising the prion protein-specific antibody according to the present invention.

본 발명에 있어서, 상기 암에 대해서는 앞서 기술한 바와 같다.In the present invention, the cancer is as described above.

본 발명에 있어서, 상기 약학적 조성물은 캡슐, 정제, 과립, 주사제, 연고제, 분말 또는 음료 형태임을 특징으로 할 수 있으며, 상기 약학적 조성물은 인간을 대상으로 하는 것을 특징으로 할 수 있다. 상기 약학적 조성물은 이들로 한정되는 것은 아니지만, 각각 통상의 방법에 따라 산제, 과립제, 캡슐, 정제, 수성 현탁액 등의 경구형 제형, 외용제, 좌제 및 멸균 주사용액의 형태로 제형화하여 사용될 수 있다. In the present invention, the pharmaceutical composition may be in the form of capsules, tablets, granules, injections, ointments, powders or beverages, and the pharmaceutical composition may be intended for humans. The pharmaceutical compositions are not limited to these, but may be formulated and used in the form of oral formulations such as powders, granules, capsules, tablets, aqueous suspensions, external preparations, suppositories and sterile injection solutions, respectively, according to conventional methods. .

본 발명에 따른 약학적 조성물은 약제학적으로 허용가능한 담체를 포함할 수 있다. 약제학적으로 허용되는 담체는 경구투여시에는 결합제, 활탁제, 붕해제, 부형제, 가용화제, 분산제, 안정화제, 현탁화제, 색소, 향료 등을 사용할 수 있으며, 주사제의 경우에는 완충제, 보존제, 무통화제, 가용화제, 등장제, 안정화제 등을 혼합하여 사용할 수 있으며, 국소투여용의 경우에는 기제, 부형제, 윤활제, 보존제 등을 사용할 수 있다. 본 발명에 따른 약학적 조성물의 제형은 상술한 바와 같은 약제학적으로 허용되는 담체와 혼합하여 다양하게 제조될 수 있다. 예를 들어, 경구투여 시에는 정제, 트로키, 캡슐, 엘릭서(elixir), 서스펜션, 시럽, 웨이퍼 등의 형태로 제조할 수 있으며, 주사제의 경우에는 단위 투약 앰플 또는 다수회 투약 형태로 제조할 수 있다. The pharmaceutical composition according to the present invention may include a pharmaceutically acceptable carrier. Pharmaceutically acceptable carriers may include binders, lubricants, disintegrants, excipients, solubilizers, dispersants, stabilizers, suspending agents, pigments, flavors, etc. for oral administration, and buffers, preservatives, and painless agents for injections. A topical, solubilizing agent, isotonic agent, stabilizer, etc. may be mixed and used, and in the case of topical administration, a base, excipient, lubricant, preservative, etc. may be used. Formulations of the pharmaceutical composition according to the present invention may be variously prepared by mixing with the pharmaceutically acceptable carrier as described above. For example, for oral administration, it can be prepared in the form of tablets, troches, capsules, elixirs, suspensions, syrups, wafers, etc., and in the case of injections, it can be prepared in unit dosage ampoules or multiple dosage forms. there is.

한편, 제제화에 적합한 담체, 부형제 및 희석제의 예로는, 락토즈, 덱스트로즈, 수크로즈, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말디톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 미정질 셀룰로즈, 폴리비닐피롤리돈, 물, 메틸하이드록시벤조에이트, 프로필하이드록시벤조에이트, 탈크, 마그네슘 스테아레이트 또는 광물유 등이 사용될 수 있다. 또한, 충진제, 항응집제, 윤활제, 습윤제, 향료, 유화제, 방부제 등을 추가로 포함할 수 있다.On the other hand, examples of carriers, excipients and diluents suitable for formulation include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, malditol, starch, acacia gum, alginate, gelatin, calcium phosphate, calcium silicate, Cellulose, methyl cellulose, microcrystalline cellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate or mineral oil and the like can be used. In addition, fillers, anti-coagulants, lubricants, wetting agents, flavoring agents, emulsifiers, preservatives, and the like may be further included.

본 발명에 따른 약학적 조성물의 투여 경로는 이들로 한정되는 것은 아니지만 구강, 정맥내, 근육내, 동맥내, 골수내, 경막내, 심장내, 경피, 피하, 복강내, 비강내, 장관, 국소, 설하 또는 직장이 포함된다. 상기 "비경구"는 피하, 피내, 정맥내, 근육내, 관절내, 활액낭내, 흉골내, 경막내, 병소내 및 두개골 내 주사 또는 주입기술을 포함한다. 본 발명에 따른 약학적 조성물은 또한 직장 투여를 위한 좌제의 형태로 투여될 수 있다.The route of administration of the pharmaceutical composition according to the present invention is, but is not limited to, oral, intravenous, intramuscular, intraarterial, intramedullary, intrathecal, intracardiac, transdermal, subcutaneous, intraperitoneal, intranasal, intestinal, topical , sublingual or rectal. The term "parenteral" includes subcutaneous, intradermal, intravenous, intramuscular, intraarticular, intrasynovial, intrasternal, intrathecal, intralesional and intracranial injection or infusion techniques. The pharmaceutical composition according to the present invention may also be administered in the form of a suppository for rectal administration.

본 발명에 따른 약학적 조성물은 사용된 특정 유효성분의 활성, 연령, 체중, 일반적인 건강, 성별, 정식, 투여시간, 투여경로, 배출율, 약물 배합 및 예방 또는 치료될 특정 질환의 중증을 포함한 여러 요인에 따라 다양하게 변할 수 있고, 상기 약학적 조성물의 투여량은 환자의 상태, 체중, 질병의 정도, 약물형태, 투여경로 및 기간에 따라 다르지만 당업자에 의해 적절하게 선택될 수 있다. 바람직하게는 상기 요소를 모두 고려하여 부작용 없이 최소한의 양으로 최대 효과를 얻을 수 있는 양을 투여할 수 있으며, 더욱 바람직하게는 1~10000㎍/체중kg/day, 더욱더 바람직하게는 10~1000㎎/체중kg/day의 유효용량으로 하루에 수회 반복 투여될 수 있다. 상기 투여량은 어떠한 면으로든 본 발명의 범위를 한정하는 것은 아니다.The pharmaceutical composition according to the present invention is a variety of factors including the activity of the specific active ingredient used, age, body weight, general health, sex, diet, administration time, route of administration, excretion rate, drug combination, and severity of a specific disease to be prevented or treated. The dosage of the pharmaceutical composition may vary depending on the patient's condition, weight, disease severity, drug type, administration route and duration, but may be appropriately selected by those skilled in the art. Preferably, considering all of the above factors, it is possible to administer an amount that can obtain the maximum effect with the minimum amount without side effects, more preferably 1 to 10000 μg/kg body weight/day, and even more preferably 10 to 1000 mg It can be administered repeatedly several times a day with an effective dose of /kg body weight/day. The dosage is not intended to limit the scope of the present invention in any way.

더불어 본 발명은 본 발명에 따른 프리온 단백질 특이적 항체를 포함하는, 암 예방 또는 개선용 식품 조성물을 제공한다.In addition, the present invention provides a food composition for preventing or improving cancer, including the prion protein-specific antibody according to the present invention.

본 발명에 따른 식품 조성물은 기능성 식품(functional food), 영양 보조제(nutritional supplement), 건강식품(health food), 건강기능식품(health functional food) 및 식품 첨가제(food additives) 등의 모든 형태를 포함한다.The food composition according to the present invention includes all forms such as functional food, nutritional supplement, health food, health functional food and food additives. .

본 발명에 있어서, 용어 "건강기능식품"이란 건강보조의 목적으로 특정성분을 원료로 하거나 식품 원료에 들어있는 특정성분을 추출, 농축, 정제, 혼합 등의 방법으로 제조, 가공한 식품을 말하며, 상기 성분에 의해 생체 방어, 생체리듬의 조절, 질병의 방지와 회복 등 생체조절기능을 생체에 대하여 충분히 발휘할 수 있도록 설계되고 가공된 식품을 말하는 것으로서, 질병의 예방 또는 건강의 회복 등과 관련된 기능을 수행할 수 있는 것을 말한다.In the present invention, the term "health functional food" refers to a food prepared and processed by extracting, concentrating, refining, mixing, etc., a specific ingredient as a raw material or a specific ingredient contained in a food raw material for the purpose of health supplementation, It refers to food designed and processed to sufficiently exert biological control functions such as biological defense, regulation of biological rhythm, prevention and recovery of disease, etc. by the above components, and performs functions related to disease prevention or health recovery. say what you can do

본 발명에 따른 식품 조성물은 당업계에 공지된 통상적인 방법에 따라 다양한 형태로 제조할 수 있다.The food composition according to the present invention can be prepared in various forms according to conventional methods known in the art.

예를 들면, 건강식품으로는 본 발명에 따른 프리온 단백질 특이적 항체를 과립화, 캡슐화 및 분말화하여 섭취하거나 차, 쥬스 및 드링크의 형태로 제조하여 음용하도록 할 수 있다. 또한, 본 발명의 프리온 단백질 특이적 항체를 암 예방, 개선 또는 치료 효과가 알려진 공지의 물질 또는 활성 성분과 함께 혼합하여 조성물의 형태로 제조할 수 있다.For example, as a health food, the prion protein-specific antibody according to the present invention can be granulated, encapsulated, and powdered to be ingested, or prepared in the form of tea, juice, and drink to be consumed. In addition, the prion protein-specific antibody of the present invention can be prepared in the form of a composition by mixing it with known substances or active ingredients known to have cancer preventive, ameliorative or therapeutic effects.

또한, 기능성 식품으로는 음료(알콜성 음료 포함), 과실 및 그의 가공식품(예: 과일통조림, 병조림, 잼, 마멀레이드 등), 어류, 육류 및 그 가공식품(예: 햄, 소시지콘비이프 등), 빵류 및 면류(예: 우동, 메밀국수, 라면, 스파게티, 마카로니 등), 과즙, 각종 드링크, 쿠키, 엿, 유제품(예: 버터, 치이즈 등), 식용식물유지, 마아가린, 식물성 단백질, 레토르트 식품, 냉동식품, 각종 조미료(예: 된장, 간장, 소스 등) 등에 본 발명의 프리온 단백질 특이적 항체를 첨가하여 제조할 수 있다.In addition, functional foods include beverages (including alcoholic beverages), fruits and their processed foods (e.g., canned fruit, bottled food, jam, marmalade, etc.), fish, meat, and their processed foods (e.g., ham, sausage corned beef, etc.) , breads and noodles (e.g. udon, buckwheat noodles, ramen, spaghetti, macaroni, etc.), fruit juice, various drinks, cookies, taffy, dairy products (e.g. butter, cheese, etc.), edible vegetable oil, margarine, vegetable protein, retort It can be prepared by adding the prion protein-specific antibody of the present invention to food, frozen food, various seasonings (eg, soybean paste, soy sauce, sauce, etc.).

본 발명의 식품 조성물 중 상기 본 발명의 프리온 단백질 특이적 항체의 바람직한 함유량으로는 이에 한정되지 않지만 예를 들어 최종적으로 제조된 식품 중 0.01 내지 80 중량%일 수 있으며, 바람직하게는 최종적으로 제조된 식품 중 0.01 내지 50 중량%일 수 있다.The preferred content of the prion protein-specific antibody of the present invention in the food composition of the present invention is not limited thereto, but may be, for example, 0.01 to 80% by weight of the finally prepared food, preferably the finally prepared food It may be 0.01 to 50% by weight of.

본 발명의 식품 조성물은 여러 가지 향미제 또는 천연 탄수화물 등을 추가 성분으로서 함유할 수 있다. 상술한 천연 탄수화물은 포도당, 과당과 같은 모노사카라이드, 말토스, 슈크로스와 같은 디사카라이드, 및 덱스트린, 사이클로덱스트린과 같은 천연 감미제나, 사카린, 아스파르탐과 같은 합성 감미제 등을 사용할 수 있다. 상기 천연 탄수화물의 비율은 본 발명의 조성물 100㎖ 당 일반적으로 약 0.01 내지 0.4g, 바람직하게는 약 0.02 내지 0.03g일 수 있다.The food composition of the present invention may contain various flavoring agents or natural carbohydrates as additional components. The aforementioned natural carbohydrates may include monosaccharides such as glucose and fructose, disaccharides such as maltose and sucrose, natural sweeteners such as dextrin and cyclodextrin, and synthetic sweeteners such as saccharin and aspartame. . The proportion of the natural carbohydrate may be generally about 0.01 to 0.4 g, preferably about 0.02 to 0.03 g per 100 ml of the composition of the present invention.

상기 외에 본 발명의 식품 조성물은 여러 가지 영양제, 비타민, 전해질, 풍미제, 착색제, 펙트산 및 그의 염, 알긴산 및 그의 염, 유기산, 보호성 콜로이드 증점제, pH 조절제, 안정화제, 방부제, 글리세린, 알콜, 탄산 음료에 사용되는 탄산화제 등을 함유할 수 있다. 그 밖에 본 발명의 식품 조성물은 천연 과일쥬스, 과일쥬스 음료 및 야채 음료의 제조를 위한 과육을 함유할 수 있다. 이러한 성분은 독립적으로 또는 조합하여 사용할 수 있다. 이러한 첨가제의 비율은 본 발명의 조성물 100중량부 당 0.01 내지 0.1 중량부의 범위에서 선택되는 것이 일반적이나, 이에 제한되는 것은 아니다.In addition to the above, the food composition of the present invention includes various nutrients, vitamins, electrolytes, flavors, colorants, pectic acid and its salts, alginic acid and its salts, organic acids, protective colloidal thickeners, pH adjusters, stabilizers, preservatives, glycerin, alcohol , carbonation agents used in carbonated beverages, and the like. In addition, the food composition of the present invention may contain fruit flesh for preparing natural fruit juice, fruit juice beverages and vegetable beverages. These components may be used independently or in combination. The ratio of these additives is generally selected from the range of 0.01 to 0.1 parts by weight per 100 parts by weight of the composition of the present invention, but is not limited thereto.

또한 본 발명의 또 다른 실시예에 따르면, 본 발명에 따른 항체를 항암제 내성암에 처리시 세포내로 유입됨이 확인되었다.In addition, according to another embodiment of the present invention, it was confirmed that the antibody according to the present invention was introduced into cells when anticancer drug-resistant cancer was treated.

따라서 본 발명은 본 발명에 따른 프리온 단백질 특이적 항체를 포함하는, 세포내 약물전달용 조성물을 제공한다.Accordingly, the present invention provides a composition for intracellular drug delivery comprising the prion protein-specific antibody according to the present invention.

바람직하게는 본 발명에 따른 세포내 약물전달용 조성물은 목적하는 약물을 더 포함할 수 있으며, 본 발명에 따른 프리온 단백질 특이적 항체와 약물이 상호 결합하여 결합체를 형성함으로써, 상기 약물을 세포내로 전달할 수 있다. Preferably, the composition for intracellular drug delivery according to the present invention may further contain a drug of interest, and the prion protein-specific antibody according to the present invention and the drug bind to each other to form a conjugate, thereby delivering the drug into cells. can

즉, 본 발명의 세포내 약물전달용 조성물은 항체-약물 접합체(Antibody drug conjugat, ADC)을 의미하는 것일 수 있으며, 사기 세포는 약물 전달이 필요한 세포를 제한없이 포함할 수 있고, 바람직하게는 프리온 단백질을 표면에 발현하는 세포일 수 있으며, 더욱 바람직하게는 암 세포일 수 있고, 더욱 더 바람직하게는 프리온 단백질을 과발현하는 암 세포일 있다.That is, the intracellular drug delivery composition of the present invention may refer to an antibody-drug conjugate (ADC), and the fraudulent cells may include cells requiring drug delivery without limitation, preferably prion. It may be a cell that expresses a protein on its surface, more preferably a cancer cell, and even more preferably a cancer cell that overexpresses a prion protein.

본 발명에 있어서, 상기 ADC는 항원과 결합하는 항체에 독소 또는 약물을 결합시킨 후 세포 내부에서 독성물질을 방출하면서 암세포 등을 사멸에 이르게 하는 표적지향성 신기술이다. 건강한 세포에는 최소한으로 영향을 주면서 약물을 타겟 암세포에 정확하게 전달하고, 특정한 조건하에서만 방출되도록 해주기 때문에 항체 치료제 자체보다 효능이 우수하고 기존의 항암제들에 비해 부작용의 위험성을 크게 낮출 수 있는 기술이다.In the present invention, the ADC is a target-oriented new technology that binds toxins or drugs to antigen-binding antibodies and then releases toxic substances inside the cells to kill cancer cells and the like. Because it accurately delivers drugs to target cancer cells and releases them only under specific conditions with minimal effect on healthy cells, it is a technology that is more effective than antibody therapeutics themselves and can greatly reduce the risk of side effects compared to existing anticancer drugs.

본 발명에 따른 항체-약물 접합체는 약물을 항체 또는 기능적 균등물을 결합하여 공지된 방법으로 제작할 수 있다. 항체와 약물은 그들 자신이 가진 연결기 등을 통해 직접 결합할 수도 있고 또는 링커나 다른 물질을 통해 간접적으로 결합할 수 있다. 약물이 항체로부터 절단되도록 하는 주요 기전에는 리소좀(히드라존, 아세탈 및 시스-아코니테이트-유사 아미드)의 산성 pH에서의 가수분해, 리소좀 효소(카텝신 및 기타 리소좀 효소)에 의한 펩타이드 절단 및 디설파이드의 환원이 포함된다. 이러한 다양한 절단 기전의 결과로서, 약물을 항체에 연결시키는 기전은 매우 다양하며 어떠한 적합한 링커라도 사용될 수 있다.The antibody-drug conjugate according to the present invention can be prepared by a known method by combining a drug with an antibody or a functional equivalent. Antibodies and drugs may be directly bonded through their own linking groups or indirectly through linkers or other substances. The main mechanisms by which drugs are cleaved from antibodies are hydrolysis at acidic pH in lysosomes (hydrazones, acetals and cis-aconitate-like amides), cleavage of peptides by lysosomal enzymes (cathepsins and other lysosomal enzymes), and disulfide reduction of is included. As a result of these different cleavage mechanisms, the mechanisms for linking drugs to antibodies are very diverse and any suitable linker may be used.

항체와 약물이 결합하기 위한 적절한 연결기는 당해 분야에 널리 공지되며 예로써, 이황화 기, 티오에테르 기, 산분해성 기, 광분해성 기, 펩티다제 분해성 기 및 에스테라아제 분해성 기를 포함한다.Suitable linking groups for binding the antibody to the drug are well known in the art and include, for example, disulfide groups, thioether groups, acid cleavable groups, photolytic groups, peptidase cleavable groups and esterase cleavable groups.

약물이 직접 결합될 경우 연결기(linking group)는 예로서는, SH기를 이용한 이황화결합이나 말레이미드를 매개로 하는 결합을 들 수 있다. 예를 들면, 항체 Fc영역의 분자 내 이황화결합과 약물의 이황화결합을 환원하여, 양자를 이황화결합으로 연결한다. 또한, 말레이미드를 통하는 방법 및 항체 내에 시스테인을 유전공학적으로 도입하는 방법도 있다.When the drug is directly bonded, the linking group may be, for example, a disulfide bond using an SH group or a bond mediated by a maleimide. For example, the intramolecular disulfide bond of the antibody Fc region and the disulfide bond of the drug are reduced, and both are linked by a disulfide bond. In addition, a method through maleimide and a method of genetically introducing cysteine into an antibody are also available.

항체와 약물을 다른 물질(링커)을 통해 간접적으로 결합할 수도 있다. 링커로는 항체, 약물 또는 모두와 반응하는 작용기를 1 또는 2종류 이상 가지는 것이 바람직하다. 작용기의 예로는 아미노기, 카르복실기, 머캡토기, 말레이미드기, 피리디닐기 등을 들 수 있다.An antibody and a drug may be indirectly coupled through another substance (linker). The linker preferably has one or two or more types of functional groups that react with antibodies, drugs, or both. Examples of the functional group include an amino group, a carboxyl group, a mercapto group, a maleimide group, and a pyridinyl group.

상기 약물은 검출을 위한 시약 또는 약리학적 효과를 나타내는 제제로 본 발명의 항체 또는 이의 절편에 결합될 수 있고, 산성조건에 의하여 상기 항체 또는 이의 절편과 분리될 수 있으며, 표적 세포에 대한 치료 효과를 나타내는 화합물을 의미한다. 상기 약물은 특별히 이에 제한되지 않으나, 검출 시약, 세포독소(cytotoxin), 방사성 동위원소, 항증식제, 아폽토시스 촉진제(pro-apoptotic agent), 화학요법제 및 치료용 핵산으로 이루어진 군에서 선택된 어느 하나 이상일 수 있으나, 이에 제한되는 것은 아니다.The drug may be bound to the antibody or fragment thereof of the present invention as a reagent for detection or an agent exhibiting a pharmacological effect, may be separated from the antibody or fragment thereof by acidic conditions, and have a therapeutic effect on target cells. represents a compound. The drug is not particularly limited thereto, but may be at least one selected from the group consisting of a detection reagent, a cytotoxin, a radioisotope, an antiproliferative agent, a pro-apoptotic agent, a chemotherapeutic agent, and a therapeutic nucleic acid. It may be, but is not limited thereto.

본 발명에 따른 항체를 이용한 항체-약물 접합체는 세포로 내재화될 수 있으며 항체 의존성 세포독성 또는 항체 의존성 약물 방출을 매개할 수 있다.The antibody-drug conjugate using the antibody according to the present invention can be internalized into cells and can mediate antibody-dependent cytotoxicity or antibody-dependent drug release.

본 발명에 있어서, 상기 "세포독성 활성"은 항체-약물 접합체 또는 항체-약물 접합체의 세포 내 대사물질의 세포-사멸, 세포증식 억제 또는 성장 억제 효과를 의미한다. 세포독성 활성은 1/2의 세포가 생존하는 단위 부피당 농도(몰 또는 질량)인 IC5O 값으로서 표현될 수 있다.In the present invention, the "cytotoxic activity" refers to the cell-killing, cell proliferation inhibitory or growth inhibitory effect of the antibody-drug conjugate or intracellular metabolite of the antibody-drug conjugate. Cytotoxic activity can be expressed as the IC50 value, which is the concentration (molar or mass) per unit volume at which half the cells survive.

본 발명에 있어서, 상기 “세포독소”는 일반적으로 세포의 기능을 억제하거나 방지하고/하거나 세포를 파괴하는 제제를 말한다. 대표적인 세포독소에는 항생제, 튜불린 중합 억제제, DNA에 결합하여 이를 파괴하는 알킬화제, 및 단백질 키나제, 포스파타제, 토포아이소머라제, 효소 및 사이클린과 같은 필수적인 세포 단백질의 기능 또는 단백질 합성을 파괴하는 제제가 포함된다. 세포독소의 예로서 택솔, 사이토칼라신 B(cytochalasin B), 그라미시딘 D(gramicidin D), 에티듐 브로마이드(ethidium bromide), 에메틴(emetine), 미토마이신(mitomycin), 에토포시드(etoposide), 테노포시드(tenoposide), 빈크리스틴(vincristine), 빈블라스틴(vinblastine), 콜히친(colchicin), 독소루비신(doxorubicin), 다우노루비신(daunorubicin), 디하이드록시안트라신디온(dihydroxy anthracin dione), 미톡산트론(mitoxantrone), 미트라마이신(mithramycin), 악티노마이신 D(actinomycin D), 1-디하이드로테스토스테론(1-dehydrotestosterone), 글루코코르티코이드(glucocorticoids), 프로카인(procaine), 테트라카인(tetracaine), 리도카인(lidocaine), 프로프라노롤(propranolol), 및 퓨로마이신(puromycin) 및 이들의 유사체 또는 동족체 등이 있으나, 이에 제한되는 것은 아니다.In the present invention, the "cytotoxin" generally refers to an agent that inhibits or prevents the function of cells and/or destroys cells. Representative cytotoxins include antibiotics, tubulin polymerization inhibitors, alkylating agents that bind to and destroy DNA, and agents that disrupt the function or protein synthesis of essential cellular proteins such as protein kinases, phosphatases, topoisomerases, enzymes, and cyclins. do. Examples of cytotoxins include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide , tenoposide, vincristine, vinblastine, colchicine, doxorubicin, daunorubicin, dihydroxy anthracin dione, Mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine , lidocaine, propranolol, and puromycin, and analogs or homologues thereof, but are not limited thereto.

더불어 방사선요법 적용을 위해, 본 발명의 항체는 고 에너지 방사성 동위원소를 포함할 수 있다. 당해 동위원소는 예를 들면, 항체 내에 존재하는 시스테인 잔기에서 항체에 직접적으로 결합될 수 있거나, 또는 킬레이트를 사용하여 항체와 방사성 동위원소의 결합을 매개할 수 있다. 방사선요법에 적합한 방사성 동위원소에는, α-방출기, β-방출기 및 오제 전자(auger electron)가 포함되지만, 이에 제한되지 않는다. 진단상 적용에 유용한 방사성 동위원소에는 양전자방출기 및 γ-방출기가 포함된다.In addition, for radiotherapy applications, the antibodies of the present invention may contain high-energy radioactive isotopes. The isotope may be directly linked to the antibody, for example at a cysteine residue present in the antibody, or a chelate may be used to mediate the binding of the antibody to the radioactive isotope. Radioactive isotopes suitable for radiotherapy include, but are not limited to, α-emitters, β-emitters, and Auger electrons. Radioactive isotopes useful for diagnostic applications include positron emitters and γ-emitters.

상기 항증식제 및 아폽토시스 촉진제에는 예로서 PPAR-감마(예를 들면, 사이클로펜테논 프로스타글란딘(cyPGs)), 레티노이드, 트리테르피노이드(예를 들면, 사이클로아르탄, 루판, 우르산, 올레아난, 프리에델란, 담마란, 쿠쿠르비타신 및 리모노이드 트리테르페노이드), EGF 수용체의 억제제(예를 들면, HER4), 라파마이신, CALCITRIOL(1,25-디하이드록시콜레칼시페롤(비타민 D)), 아로마타제 억제제(FEMARA (레트로존)), 텔로머라제 억제제, 철킬레이트제(예를 들면, 3-아미노피리딘-2-카복스알데하이드 티오세미카르바존(트리아핀)), 아폽틴(바이러스 단백질 3-닭 빈혈 바이러스로부터의 VP3), Bcl-2 및 Bcl-X(L)의 억제제, TNF-알파, FAS 리간드, TNF-관련 아폽토시스-유도 리간드(TRAIL/Apo2L), TNF-알파/FAS 리간드/TNF-관련 아폽토시스-유도 리간드(TRAIL/Apo2L) 신호전달의 활성화제 또는 PI3K-Akt 생존 경로 신호전달의 억제제(예를 들면, UCN-01 및 겔다나마이신)가 있으나, 이에 제한되는 것은 아니다.The antiproliferative and apoptosis promoters include, for example, PPAR-gamma (eg, cyclopentenone prostaglandins (cyPGs)), retinoids, triterpinoids (eg, cycloartan, lupan, uric acid, oleanane, Friedelan, dammaran, cucurbitacin and limonoid triterpenoids), inhibitors of EGF receptors (eg HER4), rapamycin, CALCITRIOL (1,25-dihydroxycholecalciferol (vitamin D )), aromatase inhibitors (FEMARA (retrozone)), telomerase inhibitors, iron chelators (eg 3-aminopyridine-2-carboxaldehyde thiosemicarbazone (triapine)), apoptin ( Viral protein 3 - VP3 from chicken anemia virus), inhibitor of Bcl-2 and Bcl-X(L), TNF-alpha, FAS ligand, TNF-related apoptosis-inducing ligand (TRAIL/Apo2L), TNF-alpha/FAS activators of ligand/TNF-related apoptosis-inducing ligand (TRAIL/Apo2L) signaling or inhibitors of PI3K-Akt survival pathway signaling (eg, UCN-01 and geldanamycin), but are not limited thereto. .

본 발명에 있어서, 상기 "화학요법제"는 작용의 메커니즘과는 관계없이, 암의 치료에 유용한 화학적 화합물이다. 화학요법제의 부류는 알킬화제, 대사길항물질, 방추체 독성 식물 알칼로이드, 세포독성/항종양 항생제, 국소이성화효소 억제물질, 항체, 감광제, 그리고 키나아제 억제물질을 포함하지만 이들에 제한되지 않는다. 화학요법제는 "표적화된 요법" 및 전통적인 화학요법에 이용되는 화합물을 포함한다.In the present invention, the "chemotherapeutic agent" is a chemical compound useful for the treatment of cancer, regardless of the mechanism of action. Classes of chemotherapeutic agents include, but are not limited to, alkylating agents, antimetabolites, spindle toxic plant alkaloids, cytotoxic/antitumor antibiotics, topoisomerase inhibitors, antibodies, photosensitizers, and kinase inhibitors. Chemotherapeutic agents include compounds used in "targeted therapy" and traditional chemotherapy.

더불어, 본 발명은 1) 본 발명에 따른 프리온 단백질 특이적 항체에 목적하는 약물 또는 검출 시약을 결합시키는 단계; 및 2) 상기 1) 단계에서 제조된 결합 물질을 세포에 처리하는 단계;를 포함하는 약물 또는 검출 시약을 세포내로 전달하는 방법을 제공한다.In addition, the present invention comprises the steps of 1) binding a desired drug or detection reagent to the prion protein-specific antibody according to the present invention; and 2) treating cells with the binding material prepared in step 1).

상기 세포는 암 세포 또는 항암제에 대하여 내성을 가지는 암 세포일 수 있으며, 상기 암 세포는 대장암, 위암, 췌장암 및 유방암으로 이루어진 군에서 선택된 어느 하나 이상일 수 있으나 이에 제한되는 것은 아니다. 또는 상기 내성을 가지는 암으로서 사이클로포스파마이드(cyclophosphamide), 5-FU, 암사크린(amsacrine), 도노마이신(daunomycin), 빈블라스틴(vinblastine), 빈크리스틴(vincristine), 나벨빈(navelbine), 파클리탁셀(paclitaxel), 탁소테르(taxotere), 독소루비신(doxorubicin), 다우노루비신(daunorubicin), 에피루비신(epirubicin), 이다루비신(idarubicin), 에토포시드(etoposide), 테니포시드(teniposide), 콜히친(colchicine), 미톡산트론(mitoxantrone), 닥티노마이신(dactinomycin), 토포테칸(topotecan), 트리메트렉스산(trimetrexate), 미트라마이신(mithramycin) 및 미토마이신 C(mitomycin C)로 이루어지는 군에서 선택된 하나 이상의 항암제에 대해 내성을 가지는 대장암, 폐암, 전립선암, 위암, 유방암 및 췌장암으로 이루어진 군에서 선택된 하나 이상의 암일 수 있으나 이에 제한되는 것은 아니다.The cells may be cancer cells or cancer cells resistant to anticancer drugs, and the cancer cells may be at least one selected from the group consisting of colorectal cancer, gastric cancer, pancreatic cancer, and breast cancer, but are not limited thereto. Or as the above-resistant cancer, cyclophosphamide, 5-FU, amsacrine, daunomycin, vinblastine, vincristine, navelbine, paclitaxel, taxotere, doxorubicin, daunorubicin, epirubicin, idarubicin, etoposide, teniposide The group consisting of colchicine, mitoxantrone, dactinomycin, topotecan, trimetrexate, mithramycin and mitomycin C It may be one or more cancers selected from the group consisting of colorectal cancer, lung cancer, prostate cancer, gastric cancer, breast cancer, and pancreatic cancer that are resistant to one or more anticancer drugs selected from, but are not limited thereto.

본 발명의 실시예에서는 5-FU(5-fluorouracil)에 대해 내성을 가지는 대장암 세포주에 본 발명의 항체를 처리시 세포내 유입 효과가 있음을 확인하였다.In an example of the present invention, it was confirmed that the antibody of the present invention was treated with a colon cancer cell line resistant to 5-fluorouracil (5-FU) to have an intracellular influx effect.

상술한 본 발명의 내용은 상호 모순되지 않는 한, 서로 동일하게 적용되며, 당해 기술분야의 통상의 기술자가 적절한 변경을 가해 실시하는 것 또한 본 발명의 범주에 포함된다.The contents of the present invention described above are equally applied to each other unless contradictory to each other, and implementation by adding appropriate changes by a person skilled in the art is also included in the scope of the present invention.

이하, 본 발명을 실시예를 통해 상세하게 설명하나 본 발명의 범위가 하기 실시예로만 한정되는 것은 아니다.Hereinafter, the present invention will be described in detail through examples, but the scope of the present invention is not limited only to the following examples.

실시예 1. 프리온 단백질을 표적하는 항체 도출Example 1. Derivation of antibodies targeting prion proteins

1-1. 프리온 단백질을 표적하는 라이브러리 준비 및 클론 선별1-1. Library preparation and clone selection targeting prion proteins

프리온 단백질을 표적으로 하는 단일 항체 생산을 위하여, 파지디스플레이(Phage display) 분석법을 이용한 바이오패닝(biopanning)을 진행하여 프리온 단백질을 타겟으로 하는 라이브러리(library)를 준비하였다. 상기 라이브러리를 준비하기 위하여, 와이바이오로직스 사가 보유한 나이브(navie) 항체 라이브러리(Ymax-ABL)을 사용하였다. 먼저 라이브러리 세포를 300 ml의 배양배지에 OD600이 0.1~0.2가 되도록 접종하였다. 이를 37℃ 진탕배양기에서 200 rpm의 속도로 OD600이 0.5~0.7이 되도록 진탕배양하였다. 그 후 M1 보조 파지를 라이브러리 세포 수보다 20배 이상 추가하고, 37℃ 진탕배양기에서 30분간 정치배양한 후, 200 rpm으로 30분간 배양하였다. 배양 후 4℃에서 5000 rpm으로 10분간 원심배양하여 상등액을 제거한 후, 새로운 배지에 현탁해주었다. 이를 30℃ 진탕 배양기에서 200 rpm으로 16시간 배양하였다. 배양 후 4℃에서 5000 rpm으로 10분간 원심배양한 후 4% PEG(polyethylene glycol) 및 NaCl을 첨가하고 얼음에서 1시간가량 놓아두었다. 그 후 4℃에서 8000 rpm으로 30분간 원심분리하여 상등액을 완전히 제거하고, 펠렛(pellet)을 PBS(phosphate buffer saline)에 현탁시켰다. 그 후 4℃에서 10000 rpm으로 10분간 원심분리하고 상등액을 수득해 4℃에 보관하였다. To produce a single antibody targeting the prion protein, a library targeting the prion protein was prepared by performing biopanning using a phage display assay. To prepare the library, a navy antibody library (Ymax-ABL) owned by Y Biologics was used. First, the library cells were inoculated in 300 ml of culture medium so that the OD 600 was 0.1 to 0.2. This was cultured with shaking so that the OD 600 was 0.5 to 0.7 at a rate of 200 rpm in a 37 ° C shaking incubator. Thereafter, M1 helper phages were added 20 times more than the number of library cells, and incubated for 30 minutes in a shaking incubator at 37 ° C., followed by incubation at 200 rpm for 30 minutes. After incubation, the supernatant was removed by centrifugation at 4° C. at 5000 rpm for 10 minutes, and then suspended in a new medium. This was incubated for 16 hours at 200 rpm in a shaking incubator at 30 ° C. After incubation, centrifugation at 4 ° C. at 5000 rpm for 10 minutes, 4% PEG (polyethylene glycol) and NaCl were added, and the cells were placed on ice for about 1 hour. Thereafter, the supernatant was completely removed by centrifugation at 8000 rpm at 4° C. for 30 minutes, and the pellet was suspended in PBS (phosphate buffer saline). Thereafter, centrifugation was performed at 4°C at 10000 rpm for 10 minutes, and the supernatant was obtained and stored at 4°C.

더불어 다음과 같은 방법으로 패닝을 수행하였다. 먼저 2ml PBS가 첨가된 면역튜브(immunotube)에 항원(프리온 단백질)을 첨가한 후 4℃에서 회전(rotation)시켜 코팅하였다. 상등액을 버린 후 5ml 블로킹 용액(blocking solution)로서 4% 탈지유(skim milk)를 포함하는 PBST(Tween-20을 포함하는 PBS)를 첨가하고 상온에서 2시간동안 블로킹시켰다. 그 후 블로킹 용액을 제거하고 상기 라이브러리 파지를 상기 항원이 코팅된 면역튜브에 넣어 상온에서 2시간동안 반응시켰다. 그 후 면역튜브에서 파지를 제거하고 5ml PBST로 세척하였다. 이에 100Mm TAE(Tris Acetate EDTA(ethylenediaminetetraacetic acid)) 버퍼를 500μl 첨가하고 상온에서 10분간 반응시켜 결합된 파지를 용출시킨 후, pH 7.5 TRIS-HCl을 500μl 첨가하여 중화시켰다. 중화된 파지 약 1.4ml을 8ml의 XL1-Blue가 들어있는 튜브에 넣고, 2ml의 XL1-Blue을 추가로 첨가하였다. 이를 밀봉한 후 37℃ 배양기에서 1시간동안 감염을 유도하였다. 이를 통해 융출된 파지에 감염된 XL1-Blue를 유리 구슬을 이용하여 플레이트에 도말한 후 37℃ 배양기에서 16시간 동안 배양하였다. 상기 라이브러리 준비 및 패닝 과정을 3회 반복 수행하였다.In addition, panning was performed in the following way. First, an antigen (prion protein) was added to an immunotube to which 2 ml PBS was added, followed by rotation at 4° C. to coat the mixture. After discarding the supernatant, 5 ml of PBST (PBS containing Tween-20) containing 4% skim milk was added as a blocking solution and blocked for 2 hours at room temperature. Thereafter, the blocking solution was removed, and the library phage was placed in an immunotube coated with the antigen and reacted at room temperature for 2 hours. Then, the phages were removed from the immunotube and washed with 5ml PBST. To this, 500 μl of 100 Mm TAE (Tris Acetate EDTA (ethylenediaminetetraacetic acid)) buffer was added and reacted at room temperature for 10 minutes to elute the bound phages, and then neutralized by adding 500 μl of pH 7.5 TRIS-HCl. About 1.4 ml of neutralized phage was placed in a tube containing 8 ml of XL1-Blue, and 2 ml of XL1-Blue was further added. After sealing it, infection was induced for 1 hour in a 37° C. incubator. The XL1-Blue infected with the phage eluting through this was spread on the plate using glass beads, and then cultured in a 37° C. incubator for 16 hours. The library preparation and panning process was repeated three times.

상기 라이브러리로부터 독립 클론을 선별하였다. 이를 위해 먼저 폴리파지 프렙(Polyphage prep)을 수행하였다. 먼저 라이브러리 스탁(stock), 1라운드 내지 3라운드 패닝 스탁 또는 음성대조군(#38클론) 스탁을 10ml의 배지(55.6ml의 2M 글루코스(Glucose), 5ml의 1M MgCl2 및 1ml의 34mg/ml CM(chloramphenicol) 첨가, 2xYT 배지)에 OD600이 0.1이 되게끔 접종하였다(2xYT-GMC). 각 샘플들을 37℃ 진탕배양기에서 OD600이 0.5가 될 때까지 배양하였다. OD600이 0.5가 되면 각 배양액의 용량을 5ml로 맞추고 M13 보조 파지(helper phage)를 50μl씩 분주하였다. 그 후 37℃ 정체 배양기에서 30분, 37℃ 진탕배양기에서 30분동안 배양하여 감염을 유도하였다. 감염이 완료된 후, 3850 rpm으로 15분간 원심분리하여 세포를 침전시키고 상등액을 제거하였다. 그 후 2xYT 배지에 1M IPTG(Isopropyl β- D -1-thiogalactopyranoside) 1ml, 1M MgCl2 5ml, 70mg/ml의 KM(kanamycin) 1ml, 34mg/ml CM 1ml 첨가한 배지를 준비하고 이의 5ml에 펠렛을 현탁하였다(2xYT-IPTG-MKC). 그런 후 30℃ 진탕배양기에서 16시간동안 배양하여 콜로니(colony)를 수득하였다.Independent clones were selected from the library. To this end, polyphage prep was first performed. First, library stock, 1st to 3rd round panning stock or negative control (#38 clone ) stock was mixed with 10ml of medium (55.6ml of 2M Glucose, 5ml of 1M MgCl 2 and 1ml of 34mg/ml CM ( chloramphenicol) added, 2xYT medium) was inoculated so that the OD 600 became 0.1 (2xYT-GMC). Each sample was incubated at 37° C. in a shaker until the OD 600 reached 0.5. When the OD 600 reached 0.5, the capacity of each culture medium was adjusted to 5 ml, and 50 μl of M13 helper phage was dispensed. Thereafter, infection was induced by culturing for 30 minutes in a 37° C. stationary incubator and 30 minutes in a 37° C. shaking incubator. After infection was complete, the cells were sedimented by centrifugation at 3850 rpm for 15 minutes and the supernatant was removed. After that, 1M IPTG (Isopropyl β- D -1-thiogalactopyranoside) 1ml, 1M MgCl 2 5ml, 70mg/ml KM (kanamycin) 1ml , 34mg/ml CM 1ml 1ml was added to the 2xYT medium to prepare a medium, and pellets were added to 5ml. suspended (2xYT-IPTG-MKC). Then, colonies were obtained by culturing for 16 hours in a shaking incubator at 30°C.

다음으로 단일파지 프렙(Monophage prep)을 수행하였다. 플레이트에 1ml의 배지(2xYT 배지에 1M IGTG 1ml, 1M MgCl2 5ml, 70mg/ml의 KM(kanamycin) 1ml, 34mg/ml CM 1ml 첨가)를 분주하였다(2xYT-GMC). 상기 플레이트 웰마다 상기 배양을 통해 수득한 콜로니를 넣어주고 37℃ 진탕배양기에서 16시간동안 배양하였다. 다른 플레이트에 2xYT-GMC를 850μl씩 분주하였다. 상기 배양이 완료된 배양액 1ml 중 100μl씩을 고체 배지(2xYT 배지에 1M IGTG 1ml, 1M MgCl2 5ml, 70mg/ml의 KM 1ml, 34mg/ml CM 1ml, 마이크로 아가(micro agar) 5.5g 첨가)에 접종하여 37℃ 정체배양기에서 16시간동안 배양하였다. 또한 나머지 배양액은 상기 850μl의 2xYT-GMC를 넣은 플레이트에 넣고 OD600이 0.5가 될 때까지 37℃ 진탕 배양기에서 배양하였다. OD600이 0.5가 되면 50μl의 배지와 M13 보조파지 혼합액(2xYT 40μl 및 M1 보조파지 10μl)을 각 웰에 분주하였다. 그 후 이를 37℃ 정체 배양기에서 30분간 배양하고, 37℃ 진탕 배양기에서 30분 동안 감염을 유도하였다. 감염이 완료된 후 3850 rpm으로 15분간 원심분리하여 상등액을 제거한 후, 배지 1ml(2xYT 배지에 1M IGTG 1ml, 1M MgCl2 5ml, 70mg/ml의 KM 1ml, 34mg/ml CM 1ml 첨가)를 넣고 현탁시켰다. 이를 30℃ 정체 배양기에서 16시간 동안 배양하여 준비된 라이브러리에서 독립 클론 34개를 선별하였다.Next, monophage prep was performed. 1ml of medium (2xYT medium plus 1ml of 1M IGTG, 5ml of 1M MgCl 2 , 1ml of 70mg/ml kanamycin (KM), and 1ml of 34mg/ml CM) was dispensed (2xYT-GMC). Colonies obtained through the culture were added to each well of the plate and incubated for 16 hours in a shaking incubator at 37°C. 850 μl of 2xYT-GMC was dispensed into different plates. Inoculate 100μl of 1ml of the cultured medium (2xYT medium with 1M IGTG 1ml, 1M MgCl 2 5ml, 70mg/ml KM 1ml, 34mg/ml CM 1ml, and micro agar 5.5g added) It was cultured for 16 hours in a 37° C. static incubator. In addition, the remaining culture medium was placed in a plate containing 850 μl of 2xYT-GMC and cultured in a shaking incubator at 37° C. until OD 600 reached 0.5. When the OD 600 reached 0.5, 50 μl of medium and M13 auxiliary phage mixture (2xYT 40 μl and M1 auxiliary phage 10 μl) were dispensed into each well. After that, it was cultured for 30 minutes in a 37° C. stationary incubator, and infection was induced for 30 minutes in a 37° C. shaking incubator. After the infection was completed, the supernatant was removed by centrifugation at 3850 rpm for 15 minutes, and then 1 ml of medium (1 ml of 1 M IGTG, 5 ml of 1 M MgCl 2 , 1 ml of 70 mg/ml KM , and 1 ml of 34 mg/ml CM were added to 2xYT medium) and suspended. . 34 independent clones were selected from the library prepared by culturing this in a 30° C. static incubator for 16 hours.

상기와 같이 준비된 라이브러리의 바이오패닝 수행 결과는 도 1에 나타내었다. 도 1에 있어서, PRNP-Fc는 항원인 프리온 단백질을 나타내며 ITGA6-Fc는 파지 디스플레이 분석의 양성 대조군으로서 사용된 항원이다. 도 1 중 (A)에 있어서, tube는 패닝 과정에서 항원인 PRNP-Fc를 코팅하기 위해 사용된 면역튜브를 의미한다. 이때 항원이 코팅된 면역튜브에 파지 라이브러리를 넣어 항원과 결합된 파지만 수득하는 것으로 첫번째 패닝을 마쳤다. 이렇게 수득한 파지를 사용하여 다음 패닝을 진행하고 면역튜브를 사용하여 총 3번의 패닝을 진행한 결과를 나타낸 것이다. 도 1 중 (B)는 대조군으로, 항원이 없는 서브트랙션 튜브(subtraction tube)로 3번 패닝을 수행한 결과이다.The biopanning results of the library prepared as above are shown in FIG. 1 . In Figure 1, PRNP-Fc represents the prion protein as an antigen, and ITGA6-Fc is an antigen used as a positive control for phage display analysis. In (A) of FIG. 1, the tube means an immunotube used to coat PRNP-Fc as an antigen in the panning process. At this time, the first panning was completed by putting the phage library into an immunotube coated with the antigen and obtaining only the phage bound to the antigen. The following panning was performed using the phage thus obtained, and the result of panning a total of 3 times using immunotubes is shown. (B) in FIG. 1 shows the result of panning three times with a subtraction tube without antigen as a control.

따라서 도 1에 나타낸 바와 같이, 항원이 코팅된 면역튜브로 패닝을 수행한 결과 2차 및 3차 패닝에서 많은 파지를 수득한 것을 확인하였다.Therefore, as shown in FIG. 1, as a result of panning with antigen-coated immunotubes, it was confirmed that many phages were obtained in the second and third rounds of panning.

1-2. 염기서열 분석 및 비특이적 결합을 보이는 클론 제외1-2. Sequencing and exclusion of clones showing non-specific binding

상기 실시예 1-1.을 통해 선별된 독립 클론 34종에 대한 염기서열을 와이바이오로직스사에 의뢰하여 분석하였고, 비특이적 파지 ELISA(non-specific pharge ELISA)를 통해, 도 2와 같이 비특이적 결합을 보이는 클론을 확인하고 제외하였다.The nucleotide sequences of 34 independent clones selected through Example 1-1. were analyzed by requesting Y Biologics, and through non-specific phage ELISA (non-specific phage ELISA), as shown in FIG. 2, non-specific binding Visible clones were identified and excluded.

비특이적 파지 ELISA를 수행하기 위하여, 먼저 96웰 플레이트에 비특이적(non-specific) 항원(ITGA6-Fc, CD58-Fc, hRAGE-Fc, AITR-Fc, Fc, BSA)과 특이적(specific) 항원(PRNP-Fc)을 웰당 100ng/μl로 넣고 4℃에서 16시간동안 코팅하였다. 코팅시킨 플레이트의 용액을 제거한 후 PBST(4% 탈지유 포함)를 200 μl 넣고 상온에서 1시간동안 블로킹시켰다. 상기 블로킹 용액을 제거한 후 상기 실시예 1-1.의 폴리파지 및 단일파지 100 μl씩을 플레이트에 넣고 상온에서 2시간 동안 결합을 유도하였다. 그 후 200 μl의 PBST를 넣어주어 세척하였다. 이를 3회 반복 수행하였다. PBST(4% 탈지유 포함)를 이용하여 M13 박테리오파지 항체(Bacteriophage Antibody)를 1/8000 비율로 희석한 후 이를 상기 플레이트에 100μl/well 넣어주고 상온에서 1시간 동안 반응시켰다. 그 후 상등액을 제거하고 200 μl의 PBST를 넣어주어 세척하였다. 이를 3회 반복 수행하였다. 이에 TMB 퍼옥시다아제 기질(peroxidase substrate) 100 μl/well씩 넣어주고 발색되는 정도를 확인하여 반응을 멈추는 시점을 결정한 후 정지 용액(stop solution)을 50 μl/well씩 첨가하여 반응을 정지시켰다. 그 후 ELISA 기기를 이용하여 OD 450nm에서 흡광도를 측정하였다.To perform non-specific phage ELISA, first, non-specific antigens (ITGA6-Fc, CD58-Fc, hRAGE-Fc, AITR-Fc, Fc, BSA) and specific antigens (PRNP) were prepared in a 96-well plate. -Fc) was added at 100 ng/μl per well and coated at 4°C for 16 hours. After removing the solution from the coated plate, 200 μl of PBST (including 4% skim milk) was added and blocked for 1 hour at room temperature. After removing the blocking solution, 100 μl each of the polyphage and single phage of Example 1-1 were put on a plate and binding was induced at room temperature for 2 hours. Then, 200 μl of PBST was added and washed. This was repeated 3 times. After diluting the M13 bacteriophage antibody at a rate of 1/8000 using PBST (including 4% skim milk), 100 μl/well was added to the plate and allowed to react at room temperature for 1 hour. Then, the supernatant was removed and washed by adding 200 μl of PBST. This was repeated 3 times. To this, 100 μl/well of TMB peroxidase substrate was added, and the degree of color development was determined to determine when to stop the reaction, and then stop solution was added at 50 μl/well to stop the reaction. After that, absorbance was measured at OD 450 nm using an ELISA device.

상기 도 2에 있어서, #38은 음성 대조군으로 사용하는 파지 클론을 의미한다. 라이브러리는 scFv-Phage 형태로 구성되어 있으나 상기 #38클론은 scFv가 없는 파지이다. 상기 음성 대조군 및 비특이적 항원에 0.3 이상 결합하는 값을 가지는 파지를 비특이적 결합을 보이는 클론으로 선정하였으며, 음성대조군 및 비특이적 항원에 0.3 이하이고 특이적 항원(PRNP-Fc)에 1 이상인 값을 가지는 파지를 특이적인 결합을 보이는 클론으로 선정하였다.In FIG. 2, #38 means a phage clone used as a negative control. The library is composed of scFv-Phage type, but the #38 clone is a phage without scFv. Phage having a binding value of 0.3 or more to the negative control and non-specific antigen were selected as clones showing non-specific binding, and phage having a value of 0.3 or less to the negative control and non-specific antigen and 1 or more to the specific antigen (PRNP-Fc) Clones showing specific binding were selected.

1-3. 프리온 단백질에 대해 특이적으로 결합하는 클론 선별1-3. Selection of clones that specifically bind to the prion protein

그런 후 히트 시퀀스(hit sequence)를 통해 프리온 단백질에 특이적으로 결합하는 클론에 대한 서열을 분석하였다(도 3 참고). 기본적으로 항체는 항원에 따라 서열이 달라지는 부위가 있고, 서열이 보존되어 있는 부위가 존재하기 때문에 히트 시퀀스를 통해 보존되어 서열이 동일한 부위는 붉은색으로 표시하였고, 모두 보존되어 있지는 않지만 빈도 수가 높은 서열을 파란색으로 나타내었다. 이를 통해 항원에 따라 달라지는 부위를 추측하였다. 그 결과 클론 001E06이 프리온 단백질에 높은 특이도로 결합하는 것을 확인하였다. 이로부터 생산되는 항체 CSA0156이 프리온 단백질에 고특이적으로 결합하는 항체로 선별되었으므로 이하 실험에서는 항체 CSA0156를 이용하였다.Then, the sequences of clones specifically binding to the prion protein were analyzed through a hit sequence (see FIG. 3). Basically, antibodies have regions whose sequences vary depending on the antigen, and because there are regions where sequences are conserved, regions that are conserved through hit sequences and have the same sequence are marked in red, and sequences that are not all conserved but have a high frequency. is shown in blue. Through this, the region that varies depending on the antigen was inferred. As a result, it was confirmed that clone 001E06 binds to prion protein with high specificity. Antibody CSA0156 produced therefrom was selected as an antibody that specifically binds to prion protein, and thus antibody CSA0156 was used in the following experiments.

실시예 2. 선별된 항체의 특성 확인Example 2. Confirmation of characteristics of selected antibodies

2-1. 항체 발현 및 생산성 확인2-1. Antibody expression and productivity confirmation

선별된 항체인 CSA0156의 발현 및 생산성을 확인하기 위하여 먼저 세포를 준비하였다. 5.5 × 105 Cells/ml의 HEK293F세포를 50 mL 튜브에 넣어주었다. 이를 원심분리기에 넣고 750 rpm (100g)으로 5분간 원심분리하였다. 상등액을 제거하고 새로운 배지(Freestyle 293 Expression Media) 10ml을 상기 튜브에 넣어 펠렛을 현탁시킨 후, 이를 90 mL 배지가 들어 있는 플라스크에 넣어주었다. 그 후 37℃, 8% CO2, 85rpm의 진탕 배양기에서 24시간동안 배양하였다. 상기 세포의 수가 1 × 106 Cells/mL이며 95% 이상의 생존력(Viability)을 가지는지 확인하였다. 그 후 40 mL기준으로 1.5 mL 튜브 두개에 600 μL의 배지(Freestyle 293 Media)를 각각 첨가하고 CSA0156의 DNA와 PEI(polyethyleneimine)를 첨가하였다. 두 개의 튜브를 혼합하고 가볍게 볼텍스(Vortex)한 후 상온에서 20 분간 놓아두었다. 이를 통해 준비된 DNA-PEI 복합체를 전날 배양한 세포에 첨가하였다. 이를 37℃, 8% CO2, 125rpm의 진탕 배양기에서 1일간 배양하였다. 배양이 완료된 후 전체 배지 용량의 0.05% 만큼의 소이톤(Soytone)을 첨가하고 32 ℃, 5% CO2 조건하에서 125 rpm으로 6일간 배양하였다. 생산된 단백질을 정제하기 위하여, 상기 배양액을 4℃에서 4800 rpm으로 30분간 원심분리하였다. 이를 통해 수득한 상등액을 필터(0.22 μm Bottle TOP Filter)로 여과하여 잔여물을 제거하였다. 컬럼(단백질 A 레진(protein A resin)을 충전, 1000ml 기준으로 3ml 컬럼 6개 사용, Capacity: ≥35 mg hIgG/mL)을 DPBS(Dulbecco's phosphate-buffered saline)을 이용해 1ml/min의 속도로 30분간 세척하였다. 그 후 상기 배양액 3ml을 취하여 상기 컬럼에 로딩(loading)하였다. 이때 0.5ml/min으로 흘려줘 레진에 충분히 결합하도록 유도하였다. 그 후 DPBS를 1ml/min의 속도로 1시간 동안 세척하여 결합하지 않은 배양액을 세척하였다. 그 후 0.1 M 글리신(Glycine) 버퍼(pH 3.3)를 비드 베드 볼륨(Bead Bed Volume)의 3배를 첨가한 후 브래드포드(Bradford) 용액으로 용출되는 단백질을 확인하면서 더 이상 단백질이 용출되지 않을 때까지 각 단백질을 용출하였다. 그 후 Maxi GeBaFlex-Tube Dialysis kit(14 kDa MWCO(Molecular Weight Cut Off))을 이용하여 DPBS 용액에서 투석을 수행하였다. 용출된 부피의 150배의 DPBS로 24시간동안 총 2번 투석한 후, 나노-드롭(Nano-drop)을 이용하여 단백질의 Abs 0.1% 값을 입력하고, 단백질 농도를 하기 수학식 1을 통해 산출하였다.Cells were first prepared to confirm the expression and productivity of the selected antibody, CSA0156. 5.5 × 10 5 Cells/ml of HEK293F cells were put into a 50 mL tube. This was placed in a centrifuge and centrifuged at 750 rpm (100 g) for 5 minutes. After removing the supernatant, 10 ml of a new medium (Freestyle 293 Expression Media) was put into the tube to suspend the pellet, and then it was put into a flask containing 90 mL medium. After that, it was cultured for 24 hours in a shaking incubator at 37°C, 8% CO 2 , and 85 rpm. The number of the cells was 1 × 10 6 Cells/mL and it was confirmed that they had a viability of 95% or more. Then, 600 μL of medium (Freestyle 293 Media) was added to two 1.5 mL tubes based on 40 mL, respectively, and DNA of CSA0156 and PEI (polyethyleneimine) were added. The two tubes were mixed, gently vortexed, and left at room temperature for 20 minutes. The DNA-PEI complex prepared through this was added to the cells cultured the day before. This was cultured for 1 day in a shaking incubator at 37°C, 8% CO 2 , and 125 rpm. After the culture was completed, 0.05% of Soytone was added to the total medium volume and cultured at 125 rpm for 6 days under 32 °C and 5% CO 2 conditions. To purify the produced protein, the culture medium was centrifuged at 4° C. at 4800 rpm for 30 minutes. The supernatant obtained through this was filtered with a filter (0.22 μm Bottle TOP Filter) to remove the residue. The column (packed with protein A resin, 6 columns of 3ml based on 1000ml, Capacity: ≥35 mg hIgG/mL) was loaded with DPBS (Dulbecco's phosphate-buffered saline) at a speed of 1ml/min for 30 minutes Washed. Thereafter, 3 ml of the culture medium was taken and loaded onto the column. At this time, flow at 0.5 ml / min was induced to sufficiently bind to the resin. Thereafter, DPBS was washed at a rate of 1 ml/min for 1 hour to wash unbound culture medium. After that, 0.1 M Glycine buffer (pH 3.3) was added 3 times the volume of the bead bed, and the protein eluted with Bradford solution was checked while the protein was no longer eluted. Each protein was eluted until. Thereafter, dialysis was performed in the DPBS solution using a Maxi GeBaFlex-Tube Dialysis kit (14 kDa Molecular Weight Cut Off (MWCO)). After dialyzing a total of 2 times for 24 hours with DPBS 150 times the eluted volume, enter the Abs 0.1% value of the protein using a nano-drop, and calculate the protein concentration through Equation 1 below did

[수학식 1][Equation 1]

단백질 mg/mL=OD/Abs, (OD = Absorbance of Nano-drop, Abs = Ext. Coefficient)Protein mg/mL=OD/Abs, (OD = Absorbance of Nano-drop, Abs = Ext. Coefficient)

상기 배양액에 대하여 SDS-PAGE(sodium dodecyl sulphate-polyacrylamide gel electrophoresis)를 수행하였다. 배양액 8μl에 대해 환원 샘플 버퍼(Reducing sample buffer) 6μl와 비환원(Non-reducing) 샘플 버퍼 6μl를 각각 혼합한 후 100℃의 물에 5분간 놓아두었다. 미리 준비한 겔(gel)에 상기 샘플 20μl와 사이즈 마커(size marker, (BrightBand PreStained Protein Staining Solution)) 4μl를 로딩한 후 90 V로 120분간 러닝(Running)하였다.SDS-PAGE (sodium dodecyl sulphate-polyacrylamide gel electrophoresis) was performed on the culture medium. 6 μl of reducing sample buffer and 6 μl of non-reducing sample buffer were mixed with 8 μl of the culture medium, and then placed in 100° C. water for 5 minutes. 20 μl of the sample and 4 μl of the size marker (BrightBand PreStained Protein Staining Solution) were loaded onto a previously prepared gel, followed by running at 90 V for 120 minutes.

러닝 완료 후, 염색 용액(Sun Gel Staining Solution)을 이용하여 상기 겔을 밤새 염색하였다. 그 후 증류수를 이용하여 세척하였다.After running was completed, the gel was stained overnight using a staining solution (Sun Gel Staining Solution). After that, it was washed with distilled water.

그 결과를 도 4에 나타내었다. 본 발명에 따른 항체 CSA0156의 배양액 농도는 1.17mg/ml로 확인되었고, 단백질은 3.52mg로 확인되었으며, 생산성(Productivity)은 87.89mg/L로 확인되었다.The results are shown in FIG. 4 . The culture medium concentration of the antibody CSA0156 according to the present invention was found to be 1.17mg/ml, the protein was found to be 3.52mg, and the productivity was found to be 87.89mg/L.

2-2. 항원 친화도2-2. antigen affinity

프리온 단백질 항원에 대한 CSA0156의 친화도를 확인하였다(바이오로직스사에 의뢰, SPR(surface plasmon resonance) 기반 Biacore system 이용).The affinity of CSA0156 for the prion protein antigen was confirmed (requested to Biologics, using a surface plasmon resonance (SPR)-based Biacore system).

그 결과 도 5에 나타낸 바와 같이, 본 발명에 따른 CSA0156은 5nM의 저농도에서도 프리온 단백질에 대해 우수한 친화도를 보여주었다. 본 발명에 따른 CSA0156의 결합속도(rate of association, ka(1/Ms))는 1.23E+05였고, 해리속도(rate of dissociation, kd(1/s))는 3.35E-04였으며, 친화상수(affinity constant, KD(M))은 2.71E-09였다. 이때 도 5내 각 색은 항원 농도별로 결합력을 확인한 로우 데이터(Raw data)를 의미하며, 회색 선은 상기 로우 데이터들을 표준화하기 위하여 알고리즘으로 피팅(fitting)한 것으로, 회색선과 각 색의 선이 일치할수록 값에 대한 신뢰성이 높은 것으로 해석하였다.As a result, as shown in FIG. 5, CSA0156 according to the present invention showed excellent affinity to prion protein even at a low concentration of 5 nM. The association rate (rate of association, k a (1/Ms)) of CSA0156 according to the present invention was 1.23E+05, and the dissociation rate (rate of dissociation, k d (1/s)) was 3.35E-04, The affinity constant (K D (M)) was 2.71E-09. At this time, each color in FIG. 5 means raw data for which binding ability is confirmed for each antigen concentration, and the gray line is fitting with an algorithm to standardize the raw data, and the gray line and the line of each color match The higher the value, the higher the reliability of the value.

실시예 3. 선별된 항체의 프리온 단백질에 대한 결합부위 확인Example 3. Confirmation of the binding site of the selected antibody to the prion protein

CSA0156의 프리온 단백질에 대한 결합 부위를 결정하기 위하여 에피토프 맵핑(Epitope mapping)을 수행하였다(진온바이오텍에 의뢰).Epitope mapping was performed to determine the binding site of CSA0156 to the prion protein (requested to Geneon Biotech).

상기 에피토프 맵핑은 다음과 같은 과정으로 수행하였다. 먼저, 표적 항원인 프리온 단백질을 식별한 후, 상기 프리온 단백질이 가질 수 있는, 수학적으로 가능한 모든 선형(Linear) 형태 에피토프와 구조적(Conformational) 형태 에피토프를 계산하였다. 상기 선형 및 구조적 형태의 15mer 에피토프 펩타이드를 통합하였다(이때 총 펩타이드 수는 70,000 개 이상이어야 한다). 통합된 모든 15mer 펩타이드를 각각 합성하고, 펩타이드 어레이 생산을 위한 마이크로어레이 슬라이드의 그리드(grid)와 레이아웃(layout)을 설정하였다. 상기 마이크로어레이 슬라이드에 합성된 15mer 펩타이드를 스포팅(spotting)하였다. 부착된 모든 15mer 펩타이드를 원형(circular form) 펩타이드로 변경하였다. 즉, N-말단과 C-말단이 모두 동일한 마이크로어레이 표면에 있도록 하였다. 생성된 마이크로어레이 표면을 99% 질소(Nitrogen) 총으로 세척하였다. 항체(Anti-FLAG antibody 및 Cy3/AlexaFluor532)을 이용한 면역분석(Immunoassay)를 실시하여 마이크로어레이 칩의 스포팅과 상태를 확인하였다.The epitope mapping was performed in the following process. First, after identifying the prion protein as the target antigen, all mathematically possible linear epitopes and conformational epitopes that the prion protein may have were calculated. The linear and structural 15mer epitope peptides were integrated (at this time, the total number of peptides should be 70,000 or more). All integrated 15mer peptides were synthesized, respectively, and a grid and layout of microarray slides for peptide array production were set. The synthesized 15mer peptide was spotted on the microarray slide. All attached 15mer peptides were changed to circular form peptides. That is, both the N-terminus and the C-terminus were located on the same microarray surface. The resulting microarray surface was washed with a 99% nitrogen gun. Immunoassay using antibodies (Anti-FLAG antibody and Cy3/AlexaFluor532) was performed to confirm the spotting and state of the microarray chip.

이를 이용하여 에피토프 맵핑을 수행하였다. 먼저 2차 항체와 대조군(control) 항체를 이용하여 사전염색(Pre-staining)을 수행하였다. 먼저 마이크로어레이를 인큐베이션 챔버에 넣고 인큐베이션 트레이를 조립하였다. 최적의 액체 표면 적용을 위해 140rpm에서 오비탈 쉐이커(orbital shaker)를 사용하여 세척 완충액(PBST pH7.2)에서 실온에서 15 분 동안 펩타이드 마이크로어레이를 배양하였다. Epitope mapping was performed using this. First, pre-staining was performed using a secondary antibody and a control antibody. First, the microarray was placed in an incubation chamber and an incubation tray was assembled. For optimal liquid surface application, the peptide microarray was incubated for 15 minutes at room temperature in wash buffer (PBST pH7.2) using an orbital shaker at 140 rpm.

펩타이드 마이크로어레이를 블로킹 버퍼와 함께 실온에서 140rpm으로 30 분 동안 배양하였다. 그 후 버퍼를 제거하였다. 상기와 동일한 2차 항체 및 대조군 항체를 염색 완충액에 희석한 후 이를 펩타이드 마이크로어레이에 처리하고, 암 조건에서 실온에서 140 rpm으로 45분간 염색하였다. 그 후 상등액을 제거하고 세척 완충액을 이용해 상기 펩타이드 마이크로어레이를 1분 동안 3회 세척하였다. 그 후 버퍼를 제거하였다. 배양 챔버로부터 마이크로어레이를 꺼낸 후, 디핑 버퍼(dipping buffer)에 2~3회 침지하였다. 그 후 위에서 아래로 가압된 공기 흐름 상에서 마이크로어레이를 완전히 건조시켰다. 그 후 적절한 형광 채널을 사용하여 스캐너(InnoScan 710 Microarray scanner, Innopsys, GenePix 4100A Microarray Scanner, Molecular Devices)의 지침에 따라 펩타이드 마이크로어레이를 스캔하였다.The peptide microarray was incubated for 30 minutes at 140 rpm at room temperature with blocking buffer. The buffer was then removed. After diluting the same secondary antibody and control antibody as above in staining buffer This was treated with a peptide microarray and stained for 45 minutes at 140 rpm at room temperature in the dark. Then, the supernatant was removed and the peptide microarray was washed three times for 1 minute using a washing buffer. The buffer was then removed. After taking out the microarray from the culture chamber, it was immersed in dipping buffer 2-3 times. Then, the microarray was completely dried on a top-down pressurized air stream. Then, the peptide microarray was scanned according to the instructions of the scanner (InnoScan 710 Microarray scanner, Innopsys, GenePix 4100A Microarray Scanner, Molecular Devices) using an appropriate fluorescence channel.

CSA0156과의 인큐베이션을 위해 배양 트레이를 조립하였다. 140 rpm의 궤도 진탕기를 이용하여 실온에서 15분 동안 염색 완충액의 마이크로어레일를 평형화하였다. 완료 후 버퍼를 제거하였다. 그 후 140rpm의 오비탈 쉐이커를 이용해 4℃에서 밤새 염색 완충액에 희석된 CSA0156과 함께 마이크로어레이를 배양하였다. 그후 140rpm의 오비탈 쉐이커를 이용하여 세척 완충액으로 펩타이드 마이크로어레이를 1분동안 3회 세척하고 버퍼를 완전히 제거하였다. 그 후 상기와 동일한 방법으로 2차 항체를 처리하고 펩타이드 마이크로어레이를 스캔하였다.A culture tray was assembled for incubation with CSA0156. Equilibrate the microarray in staining buffer for 15 minutes at room temperature using an orbital shaker at 140 rpm. After completion the buffer was removed. Then, the microarray was incubated with CSA0156 diluted in staining buffer overnight at 4°C using an orbital shaker at 140 rpm. Thereafter, the peptide microarray was washed three times for 1 minute with the washing buffer using an orbital shaker at 140 rpm, and the buffer was completely removed. Then, the secondary antibody was treated in the same manner as above, and the peptide microarray was scanned.

상기와 같이 에피토프 맵핑을 통해 전체 70,000여개의 펩타이드 중 CSA0156과 결합하는 29개 펩타이드 서열을 하기 표 3에 나타내었다.As described above, 29 peptide sequences that bind to CSA0156 among a total of 70,000 peptides through epitope mapping are shown in Table 3 below.

프리온 단백질과 CSA0156 에피토프 결합 부위Prion protein and CSA0156 epitope binding site GGGWGQWNKPSKGGGWGQWNKPSK GGSRYPWNKPSKGGSRYPWNKPSK GGLGGYCKKRPKGGLGGYCKKRPK GGNRYPWNKPSKGGNRYPWNKPSK GGGGWGWNKPSKGGGGWGWNKPSK MSRPIIWNKPSKMSRPIIWNKPSK GWGQPHWNKPSKGWGQPHWNKPSK KTNMKHTDVKMMKTNMKHTDVKMM WGQPHGTNMKHMWGQPHGTNMKHM CWMLVLWNKPSKCWMLVLWNKPSK GGWNTGWNKPSKGGWNTGWNKPSK LLISFLWNKPSKLLISFLWNKPSK FVATWSHSQWNKFVATWSHSQWNK WGQPHGWNKPSKWGQPHGWNKPSK GNRYPPWNKPSKGNRYPPWNKPSK ERESQAQRGSSMERESQAQRGSSM GGSRYPCKKRPKGGSRYPCKKRPK ILLISFKPSKPKILLISFKPSKPK HGGGWGKPSKPKHGGGWGKPSKPK YERESQGAAAAGYERESQGAAAAG SQAYYQYRPMDESQAYYQYRPMDE CKKRPKPPQGGGCKKRPKPPQGGG PVILLIWNKPSKPVILLIWNKPSK ISFLIFHSQWNKISFLIFHSQWNK HGGGWGNQVYYRHGGGWGNQVYYR QPHGGGWNKPSKQPHGGGWNKPSK FVATWSKPSKPKFVATWSKPSKPK PHGGGWHSQWNKPHGGGWHSQWNK GGSRYPNQVYYRGGSRYPNQVYYR

상기 29개의 펩타이드 서열을 분석한 결과, 중복되는 서열을 도출하였고, 상기 서열이 프리온 단백질의 99~104번 서열과 결합하는 것을 확인하였다. 그 결과 도 6에 나타낸 바와 같이, 본 발명에 따른 CSA0156은 프리온 단백질에 대해 한 가지의 항원 결합 부위를 가지는 것을 확인하였다.As a result of analyzing the 29 peptide sequences, an overlapping sequence was derived, and it was confirmed that the sequence binds to sequences 99 to 104 of the prion protein. As a result, as shown in FIG. 6, it was confirmed that CSA0156 according to the present invention has one antigen-binding site for prion protein.

실시예 4. 선별된 항체의 다른 종의 프리온 단백질에 대한 교차반응성 확인Example 4. Confirmation of cross-reactivity of selected antibodies to prion proteins of other species

프리온 단일 인간 항체의 다른 종(species)에서 발견되는 프리온 단백질 동족체에 대한 교차반응성을 ELISA 방법을 통해 확인하였다(고마바이오텍에 의뢰).The cross-reactivity of the prion single human antibody to the prion protein homolog found in other species was confirmed through an ELISA method (commissioned by Goma Biotech).

그 결과 도 7과 같이, 본 발명에 따른 CSA0156은 인간 프리온 단백질에 대해 우수한 결합 반응성을 보여주었으나, 다른 종인 마우스 유래 프리온 단백질에 대해서는 인간 프리온 단백질 대비 현저히 낮은 반응성을 보여주었다.As a result, as shown in FIG. 7 , CSA0156 according to the present invention showed excellent binding reactivity to human prion protein, but showed significantly lower reactivity to mouse-derived prion protein than human prion protein.

실시예 5. 암 세포에서의 항원 결합력 확인Example 5. Confirmation of antigen binding ability in cancer cells

SNU-C5/WT 세포를 사용하여, 세포 표면의 프리온 단백질 발현 정도에 따른 CSA0156의 항원 결합력을 면역형광 염색법을 통해 확인하였다. SNU-C5/WT cells , the antigen-binding ability of CSA0156 according to the level of prion protein expression on the cell surface was confirmed through immunofluorescence staining.

24-well 플레이트에 커버 슬라이드를 넣고 암 세포를 3 × 104개 씨딩(seeding)하였고, 10% FBS(Fetal Bovine Serum)가 포함된 RPMI1640 완전배지에서 하루 동안 배양하였다. 다음날 배지를 제거하고 이에 10 μg/ml의 항-인간 IgG(Anti-human IgG(Novus에서 구입) 또는 10 μg/ml의 CSA0156을 각각 처리한 차가운 RPMI1640 배지를 첨가하고 항체가 암 세포 표면에 결합하도록 4 ℃에서 1시간 동안 반응시켰다. PBS로 3번 세척하여 암 세포에 결합하지 않은 항체를 제거하고, 4% 파라포름알데하이드(paraformaldehyde)가 포함된 PBS(phosphate buffer saline)를 첨가하여 4℃에서 하루 동안 세포가 고정되도록 하였다. 고정된 세포는 10% FBS가 포함된 PBS로 세척한 후, FITC(Fluorescein isothiocyanate)-항-인간 IgG 2차 항체(FITC-anti-human IgG secondary antibody, Novus에서 구입)가 1:200으로 희석되어 포함된 PBS를 첨가하고 상온에서 1시간동안 암배양하였다. 형광염색된 세포는 PBS로 3회 세척한 후, DAPI(4′,6-diamidino-2-phenylindol)를 추가하여 7분간 암배양하였다. 마운팅(Mouning) 용액을 슬라이드에 떨어뜨리고, 기포가 생기기 않게 커버클라스로 덮어 봉쇄한 후 공초점 레이저 현미경을 사용하여 형광염색된 세포를 이미징하였다.A cover slide was placed in a 24-well plate, 3 × 10 4 cancer cells were seeded, and cultured in RPMI1640 complete medium containing 10% Fetal Bovine Serum (FBS) for one day. The next day, the medium was removed, and cold RPMI1640 medium treated with 10 μg/ml of anti-human IgG (purchased from Novus) or 10 μg/ml of CSA0156, respectively, was added to the medium to allow the antibody to bind to the cancer cell surface. Reaction was performed for 1 hour at 4 ° C. After washing with PBS three times to remove antibodies not bound to cancer cells, PBS (phosphate buffer saline) containing 4% paraformaldehyde was added and kept at 4 ° C for one day. After washing the fixed cells with PBS containing 10% FBS, FITC (Fluorescein isothiocyanate)-anti-human IgG secondary antibody (FITC-anti-human IgG secondary antibody, purchased from Novus) PBS diluted 1:200 was added and incubated in the dark for 1 hour at room temperature After washing the fluorescently stained cells three times with PBS, DAPI (4',6-diamidino-2-phenylindol) was added. The mounting solution was dropped on the slide, covered with a cover class to prevent air bubbles, and then imaged the fluorescently stained cells using a confocal laser microscope.

그 결과 도 8에 나타낸 바와 같이, 음성대조군인 항-인간 IgG는 암 세포의 세포막에 결합하지 않았으나, 본 발명의 CSA0156은 암 세포의 세포막에 결합함을 확인하였다.As a result, as shown in FIG. 8, it was confirmed that the negative control, anti-human IgG, did not bind to the cell membrane of cancer cells, but CSA0156 of the present invention binds to the cell membrane of cancer cells.

또한 암 세포 표면의 항원 발현 정도에 따른 항체의 항원 결합력을 FACS 분석을 통해 확인하였다. 상기와 동일한 표면에 프리온 단백질을 다른 정도로 발현하는 암 세포를 5 × 105 cells로 준비하고, 1차 항체로서 2 μ/ml 농도의 CSA0156와 4℃에서 1시간 동안 반응시켰다. 그 후, 차가운 PBS로 세척한 후, FITC 형광이 결합된 항-인간 IgG 2차 항체를 처리하고 4℃에서 1시간동안 암배양하였다. 형광 염색된 세포는 2% FBS가 포함된 500μl의 PBS에 현탁시킨 후, 초고속 유세포 분석기인 FACS AiraII (BD Biosciences, 미국)를 사용하여 분석하였다.In addition, the antigen binding ability of the antibody according to the degree of antigen expression on the surface of cancer cells was confirmed through FACS analysis. Cancer cells expressing prion protein to different degrees were prepared as 5 × 10 5 cells on the same surface as above, and reacted with CSA0156 at a concentration of 2 μ/ml as a primary antibody at 4° C. for 1 hour. Thereafter, after washing with cold PBS, the cells were treated with FITC fluorescence-coupled anti-human IgG secondary antibody and incubated in the dark at 4°C for 1 hour. Fluorescence-stained cells were suspended in 500 μl of PBS containing 2% FBS and then analyzed using a high-speed flow cytometer, FACS AiraII (BD Biosciences, USA).

그 결과 도 9에 나타낸 바와 같이, 본 발명에 따른 CSA0156은 대조군과 비교하여 암 세포 표면의 프리온 단백질에 대해 우수한 결합력 증가를 보여주었다. 이때 도 9에 있어서, 회색 선은 로우 데이터(Raw data)를 표준화하기 위하여 알고리즘으로 피팅(fitting)한 것으로, 회색선과 각 그래프가 일치할수록 값에 대한 신뢰성이 높은 것으로 해석하였다.As a result, as shown in FIG. 9, CSA0156 according to the present invention showed an excellent increase in binding ability to prion protein on the surface of cancer cells compared to the control group. At this time, in FIG. 9, the gray line is a fitting (fitting) with an algorithm to standardize the raw data (Raw data), and the more the gray line and each graph match, the higher the reliability of the value.

실시예 6. 선별된 항체의 항암 효과 확인Example 6. Confirmation of anticancer effect of selected antibodies

6-1. 대장암 세포 및 항암제 내성암의 증식 억제 효과 확인6-1. Confirmation of antiproliferative effect of colon cancer cells and anticancer drug-resistant cancer

본 발명에 따른 항체, CSA0156을 농도별(0, 1, 10, 50, 100, 200, 400 ng/ml)로 프리온 단백질을 과발현하는 대장암 환자 유래 세포주인 CNU-C5/WT와 항암제 내성 결장암 세포주인 SNU-C5/5FUR(한국세포주은행에서 구입)에 처리하여, 암 세포 증식 억제 효과를 확인하였다.CNU-C5/WT, a cell line derived from a colorectal cancer patient overexpressing prion protein with the antibody CSA0156 according to the present invention at different concentrations (0, 1, 10, 50, 100, 200, 400 ng/ml) and an anticancer drug-resistant colon cancer cell line Phosphorus SNU-C5/5FUR (purchased from Korea Cell Line Bank) was treated, and the effect of inhibiting cancer cell proliferation was confirmed.

보다 구체적으로 암세포 증식 억제 효과는 FACS 분석을 통해 확인하였다. 각 세포를 5×105 세포로 준비하고, CSA0156을 농도별(0, 1, 10, 50, 100, 200, 400 ng/ml)로 처리 후 4℃에서 1시간 동안 반응시켰다. 그 후, 세포를 차가운 PBS로 세척한 후, FITC 형광이 결합된 항-인간 IgG 2차 항체를 사용하여 4℃에서 1시간동안 암배양하였다. 형광 염색된 세포는 2% FBS(fetal bovine serum)가 포함된 500㎕의 PBS로 현탁시킨 후, 초고속 유세포 분석기인 FACS AiraII (BD Biosciences, 미국)를 사용하여 분석하였다.More specifically, the effect of inhibiting cancer cell proliferation was confirmed through FACS analysis. Each cell was prepared as 5×10 5 cells, treated with CSA0156 at different concentrations (0, 1, 10, 50, 100, 200, 400 ng/ml) and reacted at 4° C. for 1 hour. Thereafter, the cells were washed with cold PBS and incubated in the dark at 4° C. for 1 hour using an anti-human IgG secondary antibody conjugated with FITC fluorescence. Fluorescence-stained cells were suspended in 500 μl of PBS containing 2% fetal bovine serum (FBS) and analyzed using a high-speed flow cytometer, FACS AiraII (BD Biosciences, USA).

그 결과 도 10 및 도 11에 나타낸 바와 같이, 본 발명에 따른 CAS0156은 농도의존적으로 대장암 세포 또는 항암제 내성의 결장암 세포의 증식을 억제하는 효과를 보였다.As a result, as shown in FIGS. 10 and 11, CAS0156 according to the present invention showed an effect of inhibiting the proliferation of colon cancer cells or anticancer drug-resistant colon cancer cells in a concentration-dependent manner.

6-2. 암 세포사멸 유도 효과 확인6-2. Confirmation of cancer apoptosis induction effect

더불어 본 발명에 따른 CSA0156의 전립선암, 대장암 및 폐암 세포주에 대해 세포사멸 유도 효과를 확인하여 도 12에 나타내었다.In addition, the apoptosis inducing effect of CSA0156 according to the present invention on prostate cancer, colorectal cancer and lung cancer cell lines was confirmed and shown in FIG. 12 .

이를 위하여 본 발명에 따른 CSA0156을 농도별로(0, 0.01, 0.1, 0.4, 9.375, 18.75, 37.5 및 75μg/ml) 전립선암 세포주인 PC3, 대장암 세포주인 SW480 및 폐암 세포주인 Calu-1에 48시간 동안 처리하고 당 분야에 공지된 방법에 따라 WST(water-soluble tetrazolium salt) 분석을 수행하여 각 세포의 세포사멸 정도를 확인하였다.To this end, CSA0156 according to the present invention was administered at concentrations (0, 0.01, 0.1, 0.4, 9.375, 18.75, 37.5, and 75 μg/ml) to prostate cancer cell line PC3, colon cancer cell line SW480, and lung cancer cell line Calu-1 for 48 hours. After treatment, the degree of apoptosis of each cell was confirmed by performing water-soluble tetrazolium salt (WST) analysis according to a method known in the art.

그 결과 도 12에 나타낸 바와 같이, 본 발명에 따른 CSA0156은 전립선암, 대장암 및 폐암 세포주의 세포사멸을 유도하는 것을 확인하였다.As a result, as shown in FIG. 12, it was confirmed that CSA0156 according to the present invention induces apoptosis of prostate cancer, colon cancer and lung cancer cell lines.

실시예 7. 항체-약물 접합체(Antibody drug conjugate, ACD)로서의 활용 가능성 확인Example 7. Confirmation of applicability as an antibody-drug conjugate (Antibody drug conjugate, ACD)

7-1. 세포내 도입 여부 확인7-1. Confirmation of introduction into cells

본 발명에 따른 CSA0156이 세포 표면에 존재하는 항원과 결합한 후, 세포 내로 들어갈 수 있는지 확인하기 위하여 항암제 내성암 SNU-C5/5FUR 세포에서 엔도사이토시스(endocytosis) 시험법을 수행하였고, 항체의 세포 내 위치를 확인하기 위하여 면역세포화학적 염색을 수행하였다.In order to confirm that CSA0156 according to the present invention can bind to an antigen present on the cell surface and enter the cell, an endocytosis assay was performed in anticancer drug-resistant cancer SNU-C5/5FUR cells, and the antibody was injected into the cell. Immunocytochemical staining was performed to confirm the location.

먼저 24-well 플레이트에 커버 슬라이드를 넣고 암세포를 3 × 104개 씨딩하였고, 10% FBS가 포함된 RPMI1640 완전배지에서 하루 동안 배양하였다. 다음날 배지를 제거하고 2 μg/ml의 CSA0156을 처리하여 4℃에서 1시간 동안 반응시켜 암 세포 표면에 존재하는 프리온 단백질에 항체가 결합하도록 하였다. 이후 세포를 차가운 PBS로 세척하고, 항체의 세포 내 유입을 유도하기 위해 37℃에서 준비한 완전배지로 교체하여, 37℃, 5% CO2 조건에서 0.1, 0.5, 1, 2 또는 4시간 동안 배양하였다. 그 후, PBS로 3회 세척하여 배지를 제거하고, 4% 파라포름알데하이드로 고정하고 PBS로 3회 세척한 후, 0.2% 사포닌(saponin)과 10% FBS가 포함된 PBS에 희석한 각각의 엔도좀(endosome) 표지 항체와 함께 상온에서 1시간 동안 반응하였다. 상기 엔도좀 표지 항체는 다음과 같은 항체를 사용하였다. 후기 엔도좀(late endosome)/라이소좀(lysosome) 표지항체로 LAMP1(Lysosomal-associated membrane protein 1, abcam에서 구입)을, 초기 엔도좀(early endosome) 표지 항체로 EEA1(Early Endosome Antigen 1, abcam에서 구입)을, 초기/리사이클링 엔도좀(early/recycling endosome) 표지항체로 트랜스페린 수용체(transferrin receptor(TfR), abcam에서 구입)를 사용하였다. 표지항체 결합 후 세포를 10% FBS가 포함된 PBS로 3회 세척하였다. CSA0156에 대한 2차 항체인 FITC가 결합된 항-인간 IgG, LAMP1에 대한 2차 항체인 PE(phycoerythrin)가 결합된 항-토끼 IgG, 그리고 항-마우스 EEA1 또는 항-마우스 TfR에 대한 2차 항체인 PE가 결합된 항-마우스 IgG를 0.2% 사포닌과 10% FBS가 포함된 PBS를 이용해 각각 1:200으로 희석한 후, 상기 세포에 처리하고 상온에서 1시간 동안 암배양하였다. PBS로 3회 세척한 후, 핵을 염색하기 위해 DAPI를 처리한 후 상온에서 7분간 암배양하고 PBS로 3회 세척하였다. 이 후 마운팅 용액을 슬라이드에 떨어뜨리고, 기포가 생기지 않도록 커버글라스를 덮어 봉쇄하였다. 공초점 레이저 현미경을 사용하여 이미징해 형광염색된 세포를 확인하였다.First, a cover slide was placed in a 24-well plate, 3 × 10 4 cancer cells were seeded, and cultured in RPMI1640 complete medium containing 10% FBS for one day. The next day, the medium was removed, and 2 μg/ml of CSA0156 was treated and reacted at 4° C. for 1 hour to allow the antibody to bind to the prion protein present on the cancer cell surface. Thereafter, the cells were washed with cold PBS, replaced with complete medium prepared at 37 ° C to induce the influx of antibodies into the cells, and cultured at 37 ° C, 5% CO 2 conditions for 0.1, 0.5, 1, 2 or 4 hours. . Thereafter, the medium was removed by washing three times with PBS, fixed with 4% paraformaldehyde, washed three times with PBS, and each endo diluted in PBS containing 0.2% saponin and 10% FBS. It was reacted for 1 hour at room temperature with some (endosome) labeled antibody. As the endosome-labeled antibody, the following antibodies were used. LAMP1 (Lysosomal-associated membrane protein 1, purchased from abcam) was used as the late endosome/lysosome labeling antibody, and EEA1 (Early Endosome Antigen 1, purchased from abcam) was used as the early endosome labeling antibody. purchased), and transferrin receptor (TfR, purchased from abcam) was used as an early/recycling endosome labeling antibody. After binding of the labeled antibody, the cells were washed three times with PBS containing 10% FBS. Anti-human IgG conjugated with FITC, a secondary antibody to CSA0156, anti-rabbit IgG conjugated with PE (phycoerythrin), a secondary antibody to LAMP1, and secondary antibody to anti-mouse EEA1 or anti-mouse TfR Phosphorus PE-conjugated anti-mouse IgG was diluted 1:200 with PBS containing 0.2% saponin and 10% FBS, respectively, and then treated with the cells and incubated in the dark at room temperature for 1 hour. After washing three times with PBS, DAPI was treated to stain the nuclei, followed by dark culture at room temperature for 7 minutes and washed three times with PBS. Thereafter, the mounting solution was dropped on the slide, and covered with a cover glass to prevent air bubbles from forming. Fluorescently stained cells were confirmed by imaging using a confocal laser microscope.

그 결과 도 13과 같이, 본 발명에 따른 CSA0156은 엔도사이토시스 유도 후 0.1시간부터 세포 내로 유입됨을 확인하였다. 유입된 CSA0156는 초기에 초기 엔도좀 표적항체와 같은 위치에 위치되는 빈도가 높았으나, 시간이 갈수록 후기 엔도좀 및 리사이클링(recycling) 엔도좀과 같은 위치에 표지되었다. 따라서 본 발명에 따른 CSA0156은 목적 물질을 세포 내로 전달하기 위한 항체-약물 접합체(Antibody drug conjugat, ADC)로서 사용이 가능함을 확인하였다.As a result, as shown in FIG. 13, it was confirmed that CSA0156 according to the present invention was introduced into cells from 0.1 hour after induction of endocytosis. Introduced CSA0156 was initially frequently located at the same position as the early endosome targeting antibody, but was labeled at the same position as late endosomes and recycling endosomes over time. Therefore, it was confirmed that CSA0156 according to the present invention can be used as an antibody-drug conjugate (Antibody drug conjugate, ADC) for delivering a target substance into cells.

7-2. 세포 표면에 잔류한 항체 양 측정7-2. Measurement of the amount of antibody remaining on the cell surface

본 발명에 따른 CSA0156을 항암제 내성암 세포 표면에 결합 및 세포유입을 유도한 뒤, 시간별로 세포 표면에 남아있는 항체의 양을 측정하기 위해 유세포 분석기를 통한 정량화를 수행하였다. After binding of CSA0156 according to the present invention to the surface of anticancer drug-resistant cancer cells and inducing cell influx, quantification was performed using flow cytometry to measure the amount of antibody remaining on the cell surface over time.

60mm 플레이트에 씨딩한 세포에(웰당 5 × 105 세포) 10 μg/ml의 CSA0156을 처리하여 4℃에서 1시간 동안 암 세포 표면에 존재하는 프리온 단백질에 항체가 결합하도록 반응시켰다. 이후 세포를 차가운 PBS로 세척하고, 항체의 세포 내 유입을 유도하기 위해 37℃에서 준비한 완전배지로 교체하여, 37℃, 5% CO2 조건에서 0, 0.5, 2 또는 4시간동안 배양하였다. 각 시간별로 세포를 차가운 10% FBS가 포함된 PBS로 세척하고 이를 수득해 원심분리하였다. 그 후, FITC 형광이 결합된 항-인간 IgG 2차 항체를 처리하고 4℃에서 0.5시간 동안 암배양하였다. 배양이 완료된 후10% FBS가 포함된 500μl의 PBS에 현탁시킨 후, 초고속 유세포 분석기인 FACS AiraII (BD Biosciences, 미국)를 사용하여 분석하였다. Cells seeded in a 60 mm plate (5 × 10 5 cells per well) were treated with 10 μg/ml of CSA0156 and reacted at 4° C. for 1 hour to bind antibodies to prion proteins present on the surface of cancer cells. Thereafter, the cells were washed with cold PBS, replaced with complete medium prepared at 37°C to induce influx of antibodies into the cells, and cultured at 37°C, 5% CO 2 conditions for 0, 0.5, 2 or 4 hours. At each hour, the cells were washed with PBS containing cold 10% FBS, and centrifuged to obtain them. Thereafter, the cells were treated with FITC fluorescence-coupled anti-human IgG secondary antibody and incubated in the dark at 4°C for 0.5 hour. After the culture was completed, the suspension was suspended in 500 μl of PBS containing 10% FBS, and analyzed using a high-speed flow cytometer, FACS AiraII (BD Biosciences, USA).

그 결과 도 14에 나타낸 바와 같이, 본 발명에 따른 CSA0156은 시간에 따라 암 세포 표면에서의 형광이 감소되었으므로, 세포 내로 유입됨을 확인하였다. 따라서 본 발명에 따른 프리온 단백질을 표적하는 CSA0156은 목적 물질을 세포 내로 전달하기 ADC로 사용이 가능함을 확인하였다. As a result, as shown in FIG. 14, it was confirmed that CSA0156 according to the present invention was introduced into the cells because the fluorescence on the surface of cancer cells decreased over time. Therefore, it was confirmed that CSA0156 targeting the prion protein according to the present invention can be used as an ADC to deliver a target substance into cells.

종합적으로 본 발명에 따른 프리온 단백질에 결합하는 신규한 항체는 프리온 단백질 자체 및 프리온 단백질을 발현하는 암세포에 고특이적으로 결합할 수 있고, 저농도의 프리온 단백질에 대해서도 우수한 친화도를 보여주었으며, 특히 인간 프리온 단백질에 대해 우수한 결합 반응성을 보여주었다. 더불어 대장암 또는 항암제 내성암 세포의 증식 억제 및 암 세포의 세포사멸을 유도하는 효과를 보였을 분만 아니라 암 세포에 대해서 세포내 유입이 가능한 것을 확인한 바, 이를 프리온 단백질 검출, 프리온 단백질을 과발현하는 암의 진단 및 치료와 ADC 등 다양한 용도로 유용하게 활용할 수 있다.Overall, the novel antibody binding to the prion protein according to the present invention can highly specifically bind to the prion protein itself and to cancer cells expressing the prion protein, and shows excellent affinity even to low concentrations of the prion protein. It showed excellent binding reactivity to the prion protein. In addition, it was confirmed that not only did it show the effect of inhibiting the proliferation of colorectal cancer or anti-cancer drug-resistant cancer cells and inducing apoptosis of cancer cells, but also that it was possible to enter the cells into cancer cells. It can be usefully used for various purposes such as diagnosis and treatment and ADC.

<110> Soonchunhyang University Industry Academy Cooperation Foundation <120> Novel antibody with excellent binding affinity to human prion protein, and use thereof <130> 1-22P <160> 10 <170> KoPatentIn 3.0 <210> 1 <211> 6 <212> PRT <213> Artificial Sequence <220> <223> heavy chain variable region_CDR1 <400> 1 Asn Ser Tyr Ala Phe Ser 1 5 <210> 2 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> heavy chain variable region_CDR2 <400> 2 Arg Val Ile Pro Val Leu Asp Val Ala Asn Tyr Ala Gln Lys Phe Gln 1 5 10 15 Gly <210> 3 <211> 12 <212> PRT <213> Artificial Sequence <220> <223> heavy chain variable region_CDR3 <400> 3 Glu Gly Gly Thr Gly Trp Gly Asn Ser Phe Asp Leu 1 5 10 <210> 4 <211> 11 <212> PRT <213> Artificial Sequence <220> <223> light chain variable region_CDR1 <400> 4 Arg Ala Ser Gln Ser Val Gly Thr Phe Leu His 1 5 10 <210> 5 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> light chain variable region_CDR2 <400> 5 Thr Ala Ser Thr Leu Glu Ser 1 5 <210> 6 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> light chain variable region_CDR3 <400> 6 Gln Gln Phe His Asp Leu Pro Ile Thr 1 5 <210> 7 <211> 120 <212> PRT <213> Artificial Sequence <220> <223> CSA0156_heavy chain <400> 7 Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ser 1 5 10 15 Ser Val Lys Val Ser Cys Lys Ala Pro Gly Gly Thr Phe Asn Ser Tyr 20 25 30 Ala Phe Ser Trp Leu Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45 Gly Arg Val Ile Pro Val Leu Asp Val Ala Asn Tyr Ala Gln Lys Phe 50 55 60 Gln Gly Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Glu Gly Gly Thr Gly Trp Gly Asn Ser Phe Asp Leu Trp Gly 100 105 110 Gln Gly Ala Leu Ile Thr Val Ser 115 120 <210> 8 <211> 108 <212> PRT <213> Artificial Sequence <220> <223> CSA0156_Light chain <400> 8 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Val Gly Thr Phe 20 25 30 Leu His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45 Tyr Thr Ala Ser Thr Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr His Phe Thr Leu Thr Ile Asn Arg Leu Gln Pro 65 70 75 80 Glu Asp Ile Ala Thr Tyr Tyr Cys Gln Gln Phe His Asp Leu Pro Ile 85 90 95 Thr Phe Gly Gln Gly Thr Arg Leu Asp Ile Lys Arg 100 105 <210> 9 <211> 363 <212> DNA <213> Artificial Sequence <220> <223> CSA0156_heavy chain <400> 9 caggttcagt tggttcagtc tggcgccgaa gtgaagaaac ccggctcctc tgtgaaggtg 60 tcctgcaaag ctcctggcgg caccttcaac tcctacgcct ttagctggct gagacaggct 120 cctggacagg gccttgagtg gatgggaaga gtgatccctg tgctggacgt ggccaactac 180 gcccagaaat tccagggcag agtgaccatc accgccgaca agtctacctc caccgcctac 240 atggaactgt ccagcctgag atctgaggac accgccgtgt actactgcgc tagagaaggc 300 ggaaccggct ggggcaactc ttttgatttg tggggacagg gcgctctgat caccgtgtcc 360 tct 363 <210> 10 <211> 324 <212> DNA <213> Artificial Sequence <220> <223> CSA0156_light chain <400> 10 gacattcaga tgacccagtc tccatccagc ctgtccgcct ctgtgggcga cagagtgacc 60 atcacctgtc gggcttctca gtccgtgggc accttcctgc attggtatca gcagaagcct 120 ggcaaggccc ctaagctgct gatctacacc gctagcaccc tggaatctgg cgtgccctct 180 agattctccg gctctggctc tggcacccac ttcaccctga ccatcaacag actgcagccc 240 gaggatatcg ccacctacta ctgccagcag ttccacgacc tgcctatcac ctttggccag 300 ggcaccagac tggacatcaa gaga 324 <110> Soonchunhyang University Industry Academy Cooperation Foundation <120> Novel antibody with excellent binding affinity to human prion protein, and its use <130> 1-22P <160> 10 <170> KoPatentIn 3.0 <210> 1 <211> 6 <212> PRT <213> artificial sequence <220> <223> heavy chain variable region_CDR1 <400> 1 Asn Ser Tyr Ala Phe Ser 1 5 <210> 2 <211> 17 <212> PRT <213> artificial sequence <220> <223> heavy chain variable region_CDR2 <400> 2 Arg Val Ile Pro Val Leu Asp Val Ala Asn Tyr Ala Gln Lys Phe Gln 1 5 10 15 Gly <210> 3 <211> 12 <212> PRT <213> artificial sequence <220> <223> heavy chain variable region_CDR3 <400> 3 Glu Gly Gly Thr Gly Trp Gly Asn Ser Phe Asp Leu 1 5 10 <210> 4 <211> 11 <212> PRT <213> artificial sequence <220> <223> light chain variable region_CDR1 <400> 4 Arg Ala Ser Gln Ser Val Gly Thr Phe Leu His 1 5 10 <210> 5 <211> 7 <212> PRT <213> artificial sequence <220> <223> light chain variable region_CDR2 <400> 5 Thr Ala Ser Thr Leu Glu Ser 1 5 <210> 6 <211> 9 <212> PRT <213> artificial sequence <220> <223> light chain variable region_CDR3 <400> 6 Gln Gln Phe His Asp Leu Pro Ile Thr 1 5 <210> 7 <211> 120 <212> PRT <213> artificial sequence <220> <223> CSA0156_heavy chain <400> 7 Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ser 1 5 10 15 Ser Val Lys Val Ser Cys Lys Ala Pro Gly Gly Thr Phe Asn Ser Tyr 20 25 30 Ala Phe Ser Trp Leu Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45 Gly Arg Val Ile Pro Val Leu Asp Val Ala Asn Tyr Ala Gln Lys Phe 50 55 60 Gln Gly Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Glu Gly Gly Thr Gly Trp Gly Asn Ser Phe Asp Leu Trp Gly 100 105 110 Gln Gly Ala Leu Ile Thr Val Ser 115 120 <210> 8 <211> 108 <212> PRT <213> artificial sequence <220> <223> CSA0156_Light chain <400> 8 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Val Gly Thr Phe 20 25 30 Leu His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45 Tyr Thr Ala Ser Thr Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr His Phe Thr Leu Thr Ile Asn Arg Leu Gln Pro 65 70 75 80 Glu Asp Ile Ala Thr Tyr Tyr Cys Gln Gln Phe His Asp Leu Pro Ile 85 90 95 Thr Phe Gly Gln Gly Thr Arg Leu Asp Ile Lys Arg 100 105 <210> 9 <211> 363 <212> DNA <213> artificial sequence <220> <223> CSA0156_heavy chain <400> 9 caggttcagt tggttcagtc tggcgccgaa gtgaagaaac ccggctcctc tgtgaaggtg 60 tcctgcaaag ctcctggcgg caccttcaac tcctacgcct ttagctggct gagacaggct 120 cctggacagg gccttgagtg gatgggaaga gtgatccctg tgctggacgt ggccaactac 180 gccccagaaat tccagggcag agtgaccatc accgccgaca agtctacctc caccgcctac 240 atggaactgt ccagcctgag atctgaggac accgccgtgt actactgcgc tagagaaggc 300 ggaaccggct ggggcaactc ttttgatttg tggggacagg gcgctctgat caccgtgtcc 360 tct 363 <210> 10 <211> 324 <212> DNA <213> artificial sequence <220> <223> CSA0156_light chain <400> 10 gacattcaga tgacccagtc tccatccagc ctgtccgcct ctgtgggcga cagagtgacc 60 atcacctgtc gggcttctca gtccgtgggc accttcctgc attggtatca gcagaagcct 120 ggcaaggccc ctaagctgct gatctacacc gctagcaccc tggaatctgg cgtgccctct 180 agattctccg gctctggctc tggcacccac ttcaccctga ccatcaacag actgcagccc 240 gaggatatcg ccacctacta ctgccagcag ttccacgacc tgcctatcac ctttggccag 300 ggcaccagac tggacatcaa gaga 324

Claims (20)

서열번호 1의 아미노산 서열로 구성된 CDR1 부위, 서열번호 2의 아미노산 서열로 구성된 CDR2 부위 및 서열번호 3의 아미노산 서열로 구성된 CDR3 부위를 포함하는 중쇄 가변영역; 및
서열번호 4의 아미노산 서열로 구성된 CDR1 부위, 서열번호 5의 아미노산 서열로 구성된 CDR2 부위 및 서열번호 6의 아미노산 서열로 구성된 CDR3 부위를 포함하는 경쇄 가변영역;을 포함하는, 프리온 단백질(Prion protein) 특이적 항체.
a heavy chain variable region comprising a CDR1 region composed of the amino acid sequence of SEQ ID NO: 1, a CDR2 region composed of the amino acid sequence of SEQ ID NO: 2, and a CDR3 region composed of the amino acid sequence of SEQ ID NO: 3; and
A light chain variable region comprising a CDR1 region composed of the amino acid sequence of SEQ ID NO: 4, a CDR2 region composed of the amino acid sequence of SEQ ID NO: 5, and a CDR3 region composed of the amino acid sequence of SEQ ID NO: 6; containing, a prion protein specific enemy antibody.
 제 1항에 있어서,
상기 프리온 단백질은 인간 프리온 단백질인 것을 특징으로 하는, 프리온 단백질 특이적 항체.
According to claim 1,
Characterized in that the prion protein is a human prion protein, a prion protein-specific antibody.
 제 1항에 있어서,
상기 항체는 서열번호 7의 아미노산 서열로 표시되는 중쇄 가변영역 및 서열번호 8의 아미노산 서열로 표시되는 경쇄 가변영역을 포함하는, 프리온 단백질 특이적 항체.
According to claim 1,
The antibody is a prion protein-specific antibody comprising a heavy chain variable region represented by the amino acid sequence of SEQ ID NO: 7 and a light chain variable region represented by the amino acid sequence of SEQ ID NO: 8.
 제 3항에 있어서,
상기 중쇄 가변영역은 서열번호 9로 표시되는 염기서열에 의해 암호화되고, 상기 경쇄 가변영역은 서열번호 10으로 표시되는 염기서열에 의해 암호화되는 것을 특징으로 하는, 프리온 단백질 특이적 항체.
According to claim 3,
The heavy chain variable region is encoded by the nucleotide sequence represented by SEQ ID NO: 9, and the light chain variable region is encoded by the nucleotide sequence represented by SEQ ID NO: 10, prion protein-specific antibody.
 제 1항 내지 제 4항 중 어느 한 항에 따른 프리온 단백질 특이적 항체를 생산하는 하이브리도마 세포주.
A hybridoma cell line producing a prion protein-specific antibody according to any one of claims 1 to 4.
 제 1항 내지 제 4항 중 어느 한 항에 따른 프리온 단백질 특이적 항체를 포함하는, 프리온 단백질 검출용 조성물.
A composition for detecting prion protein, comprising the prion protein-specific antibody according to any one of claims 1 to 4.
 제 1항 내지 제 4항 중 어느 한 항에 따른 프리온 단백질 특이적 항체를 포함하는, 프리온 단백질 검출용 키트.
A kit for detecting prion protein, comprising the prion protein-specific antibody according to any one of claims 1 to 4.
 제 1항 내지 제 4항 중 어느 한 항에 따른 프리온 단백질 특이적 항체를 시료에 처리하는 단계; 및 시료의 반응을 검출하는 단계;를 포함하는, 프리온 단백질 검출 방법.
Processing a sample with the prion protein-specific antibody according to any one of claims 1 to 4; And detecting the reaction of the sample; including, prion protein detection method.
 제 1항 내지 제 4항 중 어느 한 항에 따른 프리온 단백질 특이적 항체를 포함하는, 암 진단용 조성물.
A composition for diagnosing cancer comprising the prion protein-specific antibody according to any one of claims 1 to 4.
 제 9항에 있어서,
상기 암은 프리온 단백질을 과발현하는 암인 것을 특징으로 하는, 암 진단용 조성물.
According to claim 9,
The cancer is characterized in that the cancer overexpressing the prion protein, the composition for diagnosing cancer.
 제 9항에 있어서,
상기 암은 대장암, 폐암, 전립선암, 위암, 유방암 및 췌장암으로 이루어진 군에서 선택된 어느 하나 이상인 것을 특징으로 하는, 암 진단용 조성물.
According to claim 9,
The cancer is characterized in that at least one selected from the group consisting of colorectal cancer, lung cancer, prostate cancer, gastric cancer, breast cancer and pancreatic cancer, cancer diagnosis composition.
 제 1항 내지 제 4항 중 어느 한 항에 따른 프리온 단백질 특이적 항체를 포함하는, 암 예방 또는 치료용 약학적 조성물.
A pharmaceutical composition for preventing or treating cancer, comprising the prion protein-specific antibody according to any one of claims 1 to 4.
 제 12항에 있어서,
상기 암은 프리온 단백질을 과발현하는 암인 것을 특징으로 하는, 암 예방 또는 치료용 약학적 조성물.
According to claim 12,
The cancer is a pharmaceutical composition for preventing or treating cancer, characterized in that the cancer overexpressing the prion protein.
 제 12항에 있어서,
상기 암은 대장암, 폐암, 전립선암, 위암, 유방암 및 췌장암으로 이루어진 군에서 선택된 어느 하나 이상인 것을 특징으로 하는, 암 예방 또는 치료용 약학적 조성물.
According to claim 12,
The cancer is a pharmaceutical composition for preventing or treating cancer, characterized in that at least one selected from the group consisting of colorectal cancer, lung cancer, prostate cancer, gastric cancer, breast cancer and pancreatic cancer.
 제 12항에 있어서,
상기 항체는 암 세포의 증식을 억제하는 것을 특징으로 하는, 암 예방 또는 치료용 약학적 조성물.
According to claim 12,
The antibody is a pharmaceutical composition for preventing or treating cancer, characterized in that inhibiting the proliferation of cancer cells.
 제 1항 내지 제 4항 중 어느 한 항에 따른 프리온 단백질 특이적 항체를 포함하는, 암 예방 또는 개선용 식품 조성물.
A food composition for preventing or improving cancer, comprising the prion protein-specific antibody according to any one of claims 1 to 4.
 제 1항 내지 제 4항 중 어느 한 항에 따른 프리온 단백질 특이적 항체를 포함하는, 세포내 약물전달용 조성물.
A composition for intracellular drug delivery comprising the prion protein-specific antibody according to any one of claims 1 to 4.
 제 17항에 있어서,
상기 세포내 약물전달용 조성물은 상기 프리온 단백질 특이적 항체에 결합된 약물을 더 포함하는 것을 특징으로 하는, 세포내 약물전달용 조성물.
According to claim 17,
The intracellular drug delivery composition further comprises a drug linked to the prion protein-specific antibody.
 제 18항에 있어서,
상기 약물은 세포독소(cytotoxin), 방사성 동위원소, 항증식제, 아폽토시스 촉진제(pro-apoptotic agent), 화학요법제 및 치료용 핵산으로 이루어진 군에서 선택된 어느 하나 이상인 것을 특징으로 하는, 세포내 약물전달용 조성물.
According to claim 18,
Characterized in that the drug is at least one selected from the group consisting of cytotoxin, radioactive isotope, antiproliferative agent, pro-apoptotic agent, chemotherapeutic agent, and therapeutic nucleic acid, intracellular drug delivery composition for.
 1) 제 1항 내지 제 4항 중 어느 한 항에 따른 프리온 단백질 특이적 항체에 목적하는 약물 또는 검출 시약을 결합시키는 단계; 및
2) 상기 1) 단계에서 제조된 결합 물질을 세포에 처리하는 단계;를 포함하는 약물 또는 검출 시약을 세포내로 전달하는 방법.1) binding a desired drug or detection reagent to the prion protein-specific antibody according to any one of claims 1 to 4; and
2) treating cells with the binding material prepared in step 1); a method for delivering a drug or detection reagent into cells.
KR1020220013413A 2022-01-28 2022-01-28 Novel antibody with excellent binding affinity to human prion protein, and use thereof KR20230116455A (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
KR1020220013413A KR20230116455A (en) 2022-01-28 2022-01-28 Novel antibody with excellent binding affinity to human prion protein, and use thereof
PCT/KR2022/007914 WO2023146035A1 (en) 2022-01-28 2022-06-03 Novel antibody having excellent binding strength with respect to human prion proteins, and use thereof

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
KR1020220013413A KR20230116455A (en) 2022-01-28 2022-01-28 Novel antibody with excellent binding affinity to human prion protein, and use thereof

Publications (1)

Publication Number Publication Date
KR20230116455A true KR20230116455A (en) 2023-08-04

Family

ID=87472150

Family Applications (1)

Application Number Title Priority Date Filing Date
KR1020220013413A KR20230116455A (en) 2022-01-28 2022-01-28 Novel antibody with excellent binding affinity to human prion protein, and use thereof

Country Status (2)

Country Link
KR (1) KR20230116455A (en)
WO (1) WO2023146035A1 (en)

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2175879A4 (en) * 2007-08-09 2010-09-22 Sylvan Pharmaceuticals Pty Ltd Treatment of prion protein related diseases
US9492472B2 (en) * 2008-12-23 2016-11-15 Case Western Reserve University Compositions and methods of treating cancer
KR101968506B1 (en) * 2017-09-28 2019-04-15 순천향대학교 산학협력단 Screening method for inhibiting colorectal cancer
KR102300672B1 (en) * 2019-12-20 2021-09-10 주식회사 스템바이오 Pharmaceutical composition containing a prion protein-specific antibody

Also Published As

Publication number Publication date
WO2023146035A1 (en) 2023-08-03

Similar Documents

Publication Publication Date Title
TWI564306B (en) Bispecific antibody
TWI523865B (en) Antibodies directed to her-3 and uses thereof
KR101801667B1 (en) Pharmaceutical composition for treatment and/or prevention of cancer
CN103562403B (en) One antibody for identifying tumour initiator cell and antigen and its application
TWI443109B (en) Anti-epha2 antibody
EP3950716A1 (en) Anti-claudin 18.2 antibody and application thereof
JP2018524284A (en) Anti-ROR1 antibody
JP2013056885A (en) Pharmaceutical composition with resistance to soluble cea
EP3434690A2 (en) Antibody that binds to envelope glycoprotein of severe fever with thrombocytopenia syndrome virus, and use for same
CA2442531A1 (en) Peptides and antibodies to muc 1 proteins
KR102005452B1 (en) Pharmaceutical composition for prognosing or treating cancer
WO2017140256A1 (en) Antibodies against n-acetylglucosamine and n-acetyl-galactosamine
KR20050106459A (en) Monoclonal antibody, gene encoding the same, hybridoma, medicinal composition and diagnostic reagent
CN101143902B (en) Anti-HER2 single-chain antibody-cefuroxime sodium enhanced fusion protein HER2(Fv-LDM)
CN105385694B (en) Anti-human CD98 monoclonal antibody 98-3H3 light and heavy chain variable region gene and its application
CN115975035B (en) Use of stem cells and antibodies in combination for the treatment of cancer
KR20230116455A (en) Novel antibody with excellent binding affinity to human prion protein, and use thereof
JP2021530250A (en) Specific epitopes of SMO proteins, antibodies that recognize them and compositions containing them
CN113373118B (en) Hybridoma cell strain, monoclonal antibody and application thereof
EP4293044A1 (en) Anti-trpv6 monoclonal antibody and application thereof
KR101875912B1 (en) Radiolabeled anti-CD55 antibody for the diagnosis and therapy of cancer and use thereof
Wang et al. In vitro efficacy of immuno-chemotherapy with anti-EGFR human Fab-Taxol conjugate on A431 epidermoid carcinoma cells
CN108250297B (en) anti-EGFR antibodies, methods of making and uses thereof
US9868784B2 (en) Antibodies against the S100P protein for the treatment and diagnosis of cancer
JP2022510988A (en) Anti-c-Met agonist antibody and its use

Legal Events

Date Code Title Description
E902 Notification of reason for refusal