KR20230040277A - Composition for Coronavirus Infection Diagnosis - Google Patents
Composition for Coronavirus Infection Diagnosis Download PDFInfo
- Publication number
- KR20230040277A KR20230040277A KR1020220113081A KR20220113081A KR20230040277A KR 20230040277 A KR20230040277 A KR 20230040277A KR 1020220113081 A KR1020220113081 A KR 1020220113081A KR 20220113081 A KR20220113081 A KR 20220113081A KR 20230040277 A KR20230040277 A KR 20230040277A
- Authority
- KR
- South Korea
- Prior art keywords
- coronavirus
- seq
- composition
- diagnosing
- present
- Prior art date
Links
- 239000000203 mixture Substances 0.000 title claims abstract description 108
- 208000001528 Coronaviridae Infections Diseases 0.000 title claims abstract description 34
- 238000003745 diagnosis Methods 0.000 title claims description 8
- 229940096437 Protein S Drugs 0.000 claims abstract description 168
- 101710198474 Spike protein Proteins 0.000 claims abstract description 168
- 241000711573 Coronaviridae Species 0.000 claims abstract description 132
- 108090001074 Nucleocapsid Proteins Proteins 0.000 claims abstract description 50
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 99
- 239000000427 antigen Substances 0.000 claims description 62
- 102000036639 antigens Human genes 0.000 claims description 62
- 108091007433 antigens Proteins 0.000 claims description 62
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 51
- 102000008070 Interferon-gamma Human genes 0.000 claims description 30
- 108010074328 Interferon-gamma Proteins 0.000 claims description 30
- 229960003130 interferon gamma Drugs 0.000 claims description 29
- 241001678559 COVID-19 virus Species 0.000 claims description 24
- 238000002965 ELISA Methods 0.000 claims description 24
- 239000013642 negative control Substances 0.000 claims description 16
- 239000013641 positive control Substances 0.000 claims description 14
- 238000000034 method Methods 0.000 claims description 7
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 6
- 101000599940 Homo sapiens Interferon gamma Proteins 0.000 claims description 5
- 102000043557 human IFNG Human genes 0.000 claims description 5
- 238000000926 separation method Methods 0.000 claims description 3
- 238000008157 ELISA kit Methods 0.000 claims description 2
- 238000002955 isolation Methods 0.000 claims 1
- 238000002405 diagnostic procedure Methods 0.000 abstract 1
- 210000004369 blood Anatomy 0.000 description 35
- 239000008280 blood Substances 0.000 description 35
- 239000000523 sample Substances 0.000 description 19
- 208000025721 COVID-19 Diseases 0.000 description 14
- 108090000623 proteins and genes Proteins 0.000 description 13
- 102000004169 proteins and genes Human genes 0.000 description 12
- 230000035945 sensitivity Effects 0.000 description 7
- 150000001413 amino acids Chemical group 0.000 description 6
- 238000006243 chemical reaction Methods 0.000 description 6
- 238000001514 detection method Methods 0.000 description 6
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 6
- 238000003018 immunoassay Methods 0.000 description 6
- 230000035772 mutation Effects 0.000 description 6
- 102000004190 Enzymes Human genes 0.000 description 5
- 108090000790 Enzymes Proteins 0.000 description 5
- 241000700605 Viruses Species 0.000 description 5
- 229940088598 enzyme Drugs 0.000 description 5
- 239000007787 solid Substances 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- AZQWKYJCGOJGHM-UHFFFAOYSA-N 1,4-benzoquinone Chemical compound O=C1C=CC(=O)C=C1 AZQWKYJCGOJGHM-UHFFFAOYSA-N 0.000 description 4
- 241000282412 Homo Species 0.000 description 4
- 241000315672 SARS coronavirus Species 0.000 description 4
- 239000003146 anticoagulant agent Substances 0.000 description 4
- 229940127219 anticoagulant drug Drugs 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- 201000010099 disease Diseases 0.000 description 4
- 229940127121 immunoconjugate Drugs 0.000 description 4
- 208000015181 infectious disease Diseases 0.000 description 4
- 229920001184 polypeptide Polymers 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- -1 such as a tool Substances 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 3
- 239000012472 biological sample Substances 0.000 description 3
- 210000004027 cell Anatomy 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 210000002381 plasma Anatomy 0.000 description 3
- 238000006467 substitution reaction Methods 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 2
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 2
- 102100035765 Angiotensin-converting enzyme 2 Human genes 0.000 description 2
- 108090000975 Angiotensin-converting enzyme 2 Proteins 0.000 description 2
- 241000282472 Canis lupus familiaris Species 0.000 description 2
- 208000035473 Communicable disease Diseases 0.000 description 2
- 108010015776 Glucose oxidase Proteins 0.000 description 2
- 239000004366 Glucose oxidase Substances 0.000 description 2
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 2
- QIGBRXMKCJKVMJ-UHFFFAOYSA-N Hydroquinone Chemical compound OC1=CC=C(O)C=C1 QIGBRXMKCJKVMJ-UHFFFAOYSA-N 0.000 description 2
- 208000025370 Middle East respiratory syndrome Diseases 0.000 description 2
- 241000282887 Suidae Species 0.000 description 2
- 239000002250 absorbent Substances 0.000 description 2
- 230000002745 absorbent Effects 0.000 description 2
- 238000010241 blood sampling Methods 0.000 description 2
- 239000007853 buffer solution Substances 0.000 description 2
- 230000007969 cellular immunity Effects 0.000 description 2
- 208000035475 disorder Diseases 0.000 description 2
- 241001493065 dsRNA viruses Species 0.000 description 2
- 239000012636 effector Substances 0.000 description 2
- 210000003162 effector t lymphocyte Anatomy 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 229940116332 glucose oxidase Drugs 0.000 description 2
- 235000019420 glucose oxidase Nutrition 0.000 description 2
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 2
- 108010028403 hemagglutinin esterase Proteins 0.000 description 2
- 229960002897 heparin Drugs 0.000 description 2
- 229920000669 heparin Polymers 0.000 description 2
- 238000012744 immunostaining Methods 0.000 description 2
- 239000004816 latex Substances 0.000 description 2
- 229920000126 latex Polymers 0.000 description 2
- 230000003902 lesion Effects 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 210000004379 membrane Anatomy 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 230000015654 memory Effects 0.000 description 2
- 210000003071 memory t lymphocyte Anatomy 0.000 description 2
- 239000003226 mitogen Substances 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 238000003118 sandwich ELISA Methods 0.000 description 2
- 239000012089 stop solution Substances 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 238000011282 treatment Methods 0.000 description 2
- 229940005561 1,4-benzoquinone Drugs 0.000 description 1
- 108010022752 Acetylcholinesterase Proteins 0.000 description 1
- 102000012440 Acetylcholinesterase Human genes 0.000 description 1
- 108010003415 Aspartate Aminotransferases Proteins 0.000 description 1
- 102000004625 Aspartate Aminotransferases Human genes 0.000 description 1
- BSYNRYMUTXBXSQ-UHFFFAOYSA-N Aspirin Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O BSYNRYMUTXBXSQ-UHFFFAOYSA-N 0.000 description 1
- 241000271566 Aves Species 0.000 description 1
- 241000112287 Bat coronavirus Species 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 108090000489 Carboxy-Lyases Proteins 0.000 description 1
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 1
- 108010061994 Coronavirus Spike Glycoprotein Proteins 0.000 description 1
- 206010011224 Cough Diseases 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 206010012735 Diarrhoea Diseases 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 101710091045 Envelope protein Proteins 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 102000053187 Glucuronidase Human genes 0.000 description 1
- 108010060309 Glucuronidase Proteins 0.000 description 1
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 1
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 1
- 102000005548 Hexokinase Human genes 0.000 description 1
- 108700040460 Hexokinases Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 108060004795 Methyltransferase Proteins 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 108091000041 Phosphoenolpyruvate Carboxylase Proteins 0.000 description 1
- 102000001105 Phosphofructokinases Human genes 0.000 description 1
- 108010069341 Phosphofructokinases Proteins 0.000 description 1
- 108010053210 Phycocyanin Proteins 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- 101710188315 Protein X Proteins 0.000 description 1
- 108010083644 Ribonucleases Proteins 0.000 description 1
- 102000006382 Ribonucleases Human genes 0.000 description 1
- 239000012327 Ruthenium complex Substances 0.000 description 1
- BQCADISMDOOEFD-UHFFFAOYSA-N Silver Chemical compound [Ag] BQCADISMDOOEFD-UHFFFAOYSA-N 0.000 description 1
- 101710172711 Structural protein Proteins 0.000 description 1
- 102100021696 Syncytin-1 Human genes 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 108010046334 Urease Proteins 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 229940022698 acetylcholinesterase Drugs 0.000 description 1
- 229960001138 acetylsalicylic acid Drugs 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- PNEYBMLMFCGWSK-UHFFFAOYSA-N aluminium oxide Inorganic materials [O-2].[O-2].[O-2].[Al+3].[Al+3] PNEYBMLMFCGWSK-UHFFFAOYSA-N 0.000 description 1
- 239000012491 analyte Substances 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- 102000005936 beta-Galactosidase Human genes 0.000 description 1
- 125000004057 biotinyl group Chemical class [H]N1C(=O)N([H])[C@]2([H])[C@@]([H])(SC([H])([H])[C@]12[H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C(*)=O 0.000 description 1
- 210000000601 blood cell Anatomy 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 229910001417 caesium ion Inorganic materials 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 239000000919 ceramic Substances 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 235000013330 chicken meat Nutrition 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 229910052802 copper Inorganic materials 0.000 description 1
- 239000010949 copper Substances 0.000 description 1
- 230000000875 corresponding effect Effects 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 231100000517 death Toxicity 0.000 description 1
- RAABOESOVLLHRU-UHFFFAOYSA-N diazene Chemical compound N=N RAABOESOVLLHRU-UHFFFAOYSA-N 0.000 description 1
- 229910000071 diazene Inorganic materials 0.000 description 1
- 231100000676 disease causative agent Toxicity 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 239000012645 endogenous antigen Substances 0.000 description 1
- KTWOOEGAPBSYNW-UHFFFAOYSA-N ferrocene Chemical compound [Fe+2].C=1C=C[CH-]C=1.C=1C=C[CH-]C=1 KTWOOEGAPBSYNW-UHFFFAOYSA-N 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- ZFKJVJIDPQDDFY-UHFFFAOYSA-N fluorescamine Chemical compound C12=CC=CC=C2C(=O)OC1(C1=O)OC=C1C1=CC=CC=C1 ZFKJVJIDPQDDFY-UHFFFAOYSA-N 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 229940044627 gamma-interferon Drugs 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 239000005090 green fluorescent protein Substances 0.000 description 1
- 108010029257 guanosine-diphosphatase Proteins 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 230000005965 immune activity Effects 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 238000003125 immunofluorescent labeling Methods 0.000 description 1
- 230000006054 immunological memory Effects 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 239000003547 immunosorbent Substances 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 238000011998 interferon-gamma release assay Methods 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 208000028774 intestinal disease Diseases 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 150000002540 isothiocyanates Chemical class 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 1
- 210000004400 mucous membrane Anatomy 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- ZWLUXSQADUDCSB-UHFFFAOYSA-N phthalaldehyde Chemical compound O=CC1=CC=CC=C1C=O ZWLUXSQADUDCSB-UHFFFAOYSA-N 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 238000003127 radioimmunoassay Methods 0.000 description 1
- 238000003156 radioimmunoprecipitation Methods 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 210000002345 respiratory system Anatomy 0.000 description 1
- 208000023504 respiratory system disease Diseases 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 239000004065 semiconductor Substances 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 229910052710 silicon Inorganic materials 0.000 description 1
- 239000010703 silicon Substances 0.000 description 1
- 229910052709 silver Inorganic materials 0.000 description 1
- 239000004332 silver Substances 0.000 description 1
- 206010041232 sneezing Diseases 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 238000010998 test method Methods 0.000 description 1
- MPLHNVLQVRSVEE-UHFFFAOYSA-N texas red Chemical compound [O-]S(=O)(=O)C1=CC(S(Cl)(=O)=O)=CC=C1C(C1=CC=2CCCN3CCCC(C=23)=C1O1)=C2C1=C(CCC1)C3=[N+]1CCCC3=C2 MPLHNVLQVRSVEE-UHFFFAOYSA-N 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- PJVWKTKQMONHTI-UHFFFAOYSA-N warfarin Chemical compound OC=1C2=CC=CC=C2OC(=O)C=1C(CC(=O)C)C1=CC=CC=C1 PJVWKTKQMONHTI-UHFFFAOYSA-N 0.000 description 1
- 229960005080 warfarin Drugs 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/08—RNA viruses
- G01N2333/165—Coronaviridae, e.g. avian infectious bronchitis virus
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Virology (AREA)
- Chemical & Material Sciences (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- Molecular Biology (AREA)
- Hematology (AREA)
- Microbiology (AREA)
- Cell Biology (AREA)
- Biotechnology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Food Science & Technology (AREA)
- Medicinal Chemistry (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
본 발명은 코로나바이러스 감염증 진단용 조성물에 관한 것이다.The present invention relates to a composition for diagnosing a coronavirus infection.
코로나바이러스(coronavirus)는 1937년 닭에서 처음 발견된 뒤 개, 돼지, 조류 등의 동물을 거쳐 1965년에는 사람에게서도 발견되었다. Coronavirus was first discovered in chickens in 1937, then in animals such as dogs, pigs and birds, and then in humans in 1965.
지금까지 코로나바이러스는 사람에게는 거의 감염되지 않고 주로 개, 돼지, 소 등의 동물에 감염되는 병원균으로 인식되어 왔다. 사람에게 감염될 때에도 호흡기 증상을 유발하는 여러 바이러스 가운데 하나로서 단순한 감기를 유발하거나 어린이에게 위험성이 그리 높지 않은 설사 등의 장 질환을 일으키는 경우가 있을 뿐이었다. 그러나 세계적으로 수백명이 넘는 사망자와 수천여 명의 환자를 발생시킨 중동 호흡기 증후군(메르스;MERS)의 원인균이 신종(변종) 코로나바이러스인 것으로 알려지면서 점차적으로 주목받았으며, 2019년 말 중국 후베이 지방의 수도인 우한에서 처음 확인되어 전세계로 확산되어 진행성 팬데믹을 초래한 질환인 COVID-19 역시 코로나바이러스에 의해 유발되는 감염성 질환이다.Until now, coronaviruses have been recognized as pathogens that rarely infect humans and mainly infect animals such as dogs, pigs, and cattle. Even when it infects humans, it is one of many viruses that cause respiratory symptoms, causing simple colds or causing intestinal diseases such as diarrhea, which are not very dangerous to children. However, as it became known that the causative agent of Middle East Respiratory Syndrome (MERS), which caused hundreds of deaths and thousands of patients worldwide, was a new (mutant) coronavirus, it gradually drew attention. COVID-19, a disease that was first identified in Wuhan and spread worldwide, resulting in a progressive pandemic, is also an infectious disease caused by a coronavirus.
COVID-19(코로나19)의 명칭은 감염병을 나타내는 것으로, SARS-CoV-2(severe acute respiratory syndrome coronavirus 2)는 바이러스 이름을 나타내는 것으로 각각 분리되어 명명되었다. COVID-19는 감염자의 비말이 호흡기나 눈, 코, 입의 점막으로 침투될 때 전염되는 것으로 알려져 있으며, 전염성이 높은 것으로 보고되어 일부 국가는 확진자가 다수 발생한 국가로부터의 입국을 통제하는 등 확산 방지에 총력을 기울이고 있다. 더욱이 COVID-19의 판데믹 상황이 지속되면서 SARS-CoV-2의 유전 변이들이 전 세계에서 나타내고, 이로 인해 기존 치료법의 효과가 떨어질 수 있는 변이들 역시 나타나고 있는 실정이다.The name COVID-19 (Corona 19) represents an infectious disease, and SARS-CoV-2 (severe acute respiratory syndrome coronavirus 2) represents the name of the virus. COVID-19 is known to be transmitted when droplets of an infected person penetrate the respiratory tract or the mucous membranes of the eyes, nose, and mouth, and it is reported to be highly contagious, so some countries prevent the spread by controlling entry from countries with a large number of confirmed cases. are focusing their efforts on Moreover, as the COVID-19 pandemic continues, genetic variants of SARS-CoV-2 appear all over the world, and variants that can reduce the effectiveness of existing treatments are also appearing.
이에 따라, 분석 대상 개체의 코로나바이러스 감염 여부를 신속 정확히 진단할 수 있는 방법의 개발이 필요하다.Accordingly, it is necessary to develop a method for quickly and accurately diagnosing whether an object to be analyzed is infected with the coronavirus.
본 발명의 목적은 코로나바이러스 감염증 진단용 조성물을 제공하는 것이다.An object of the present invention is to provide a composition for diagnosing a coronavirus infection.
본 발명의 다른 목적은 상기 조성물을 포함하는 의료기기를 제공하는 것이다.Another object of the present invention is to provide a medical device comprising the composition.
본 발명의 다른 목적은 상기 조성물을 포함하는 키트를 제공하는 것이다.Another object of the present invention is to provide a kit comprising the composition.
본 발명의 또 다른 목적은 상기 조성물 또는 의료기기를 이용하여 코로나바이러스 감염 진단 방법을 제공하는 것이다. Another object of the present invention is to provide a method for diagnosing coronavirus infection using the composition or medical device.
이를 구체적으로 설명하면 다음과 같다. 한편, 본 발명에서 개시된 각각의 설명 및 실시형태는 각각의 다른 설명 및 실시 형태에도 적용될 수 있다. 즉, 본 발명에서 개시된 다양한 요소들의 모든 조합이 본 발명의 범주에 속한다. 또한, 하기 기술된 구체적인 서술에 의하여 본 발명의 범주가 제한된다고 볼 수 없다.A detailed description of this is as follows. Meanwhile, each description and embodiment disclosed in the present invention may also be applied to each other description and embodiment. That is, all combinations of the various elements disclosed herein fall within the scope of the present invention. In addition, it cannot be seen that the scope of the present invention is limited by the specific descriptions described below.
또한, 당해 기술분야의 통상의 지식을 가진 자는 통상의 실험만을 사용하여 본 발명에 기재된 본 발명의 특정 양태에 대한 다수의 등가물을 인지하거나 확인할 수 있다. 또한, 이러한 등가물은 본 발명에 포함되는 것으로 의도된다.In addition, those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Also, such equivalents are intended to be included in this invention.
본 발명의 하나의 양태는 코로나바이러스 감염증 진단용 조성물을 제공한다.One aspect of the present invention provides a composition for diagnosing a coronavirus infection.
본 발명에 있어서, "코로나바이러스"는 코로나바이러스과(Coronaviridae)에 속하며 구형의 외막을 가지는, 약 100-120 nm 크기의 positive sense RNA 바이러스를 지칭한다. 코로나바이러스는 가장 외각에 있는 스파이크 (spike, S) 단백질, 헤마글루티닌-에스터라제(hemagglutinin-esterase, HE) 단백질, 멤브레인 (transmembrane, M) 단백질, 스몰 멤브레인(small membrane, E) 단백질 및 뉴클레오캡시드(nucleocapsid, N) 단백질 등 5개의 구조 단백질을 포함하는 것으로 알려져 있다(Lai, M.M.C., and Holmes, K.V. 2001. Fields Virology 1163-1185).In the present invention, "coronavirus" refers to a positive sense RNA virus with a size of about 100-120 nm, belonging to the family Coronaviridae and having a spherical outer membrane. Coronaviruses are the outermost spike (S) protein, hemagglutinin-esterase (HE) protein, transmembrane (M) protein, small membrane (E) protein and It is known to contain five structural proteins, including the nucleocapsid (N) protein (Lai, M.M.C., and Holmes, K.V. 2001. Fields Virology 1163-1185).
본 발명의 코로나바이러스는 사스-코로나바이러스-2 (SARS-CoV-2)일 수 있다. The coronavirus of the present invention may be SARS-CoV-2.
본 발명의 용어, "SARS-CoV-2(사스-코로나바이러스-2)"는 호흡기 질환인 코로나바이러스 질환-19(coronavirus disease 2019; COVID-19)를 야기하는 바이러스이다. The term of the present invention, "SARS-CoV-2 (SARS-coronavirus-2)" is a virus that causes coronavirus disease 2019 (COVID-19), which is a respiratory disease.
SARS-CoV-2는 양성 단일가닥 RNA 바이러스(positive-sense single-stranded RNA virus)이다. SARS-CoV-2는 분류학적으로 SARS-CoV의 계통(strain)으로, 동물원성 감염증의 기원(zoonotic origins)을 가지며, 박쥐 코로나바이러스와 근접한 유전적 유사성을 갖는 것으로 간주된다. 상기 SARS-CoV-2는 주로 사람들 간의 긴밀한 접촉을 통해 및/또는 기침이나 재채기시 발생하는 비말을 통해 전파되며, 주로 수용체 안지오텐신 전환 효소 2(receptor angiotensin converting enzyme 2; ACE2)에 결합하여 인간 세포에 진입하는 것으로 알려져 있다. SARS-CoV-2 is a positive-sense single-stranded RNA virus. SARS-CoV-2 is taxonomically considered to be a strain of SARS-CoV, has zoonotic origins, and has close genetic similarities to bat coronaviruses. The SARS-CoV-2 is mainly spread through close contact between people and/or through droplets generated during coughing or sneezing, and mainly binds to receptor angiotensin converting enzyme 2 (ACE2) to enter human cells. known to enter.
SARS-CoV-2는 RNA 의존적 RNA 중합효소 (RNA-dependent RNA polymerase), 스파이크 단백질(SP), 피막 단백질 및 뉴클레오캡시드 단백질(NP) 및/또는 상기 단백질을 코딩하는 유전자를 포함할 수 있다. SARS-CoV-2 may include RNA-dependent RNA polymerase, spike protein (SP), envelope protein, and nucleocapsid protein (NP) and/or genes encoding the proteins.
본 발명의 SARS-CoV-2는 SARS-CoV-2로 분류될 수 있는 모든 변이 형태 또한 제한 없이 포함하며, 그 예시로 알파(B.1.1.7 계통), 베타(B.1.351 계통: B.1.351.2, B.1.351.3), 델타(B.1.617.2 및 AY 계통: AY.1, AY.2, AY.3), 감마(P.1 계통: P.1.1, P.1.2), 오미크론(B.1.1.529, BA.1, BA.1.1, BA.2, BA.3, BA.4 및 BA.5 계통) 변이로 칭해지는 변이를 포함할 수 있다. 변이형 SARS-CoV-2는 스파이크 단백질에 특정 치환 또는 치환 조합을 포함할 수 있고, 그 예시로 L452R, E484K, K417N/T, E484K, N501Y 및 이들의 치환 조합을 포함할 수 있다. The SARS-CoV-2 of the present invention includes all mutant forms that can be classified as SARS-CoV-2 without limitation, and examples thereof include alpha (B.1.1.7 strain) and beta (B.1.351 strain: B. 1.351.2, B.1.351.3), delta (B.1.617.2 and AY strains: AY.1, AY.2, AY.3), gamma (P.1 strain: P.1.1, P.1.2) , mutations referred to as omicron (lineages B.1.1.529, BA.1, BA.1.1, BA.2, BA.3, BA.4 and BA.5) mutations. The mutant SARS-CoV-2 may include a specific substitution or substitution combination in the spike protein, and examples thereof may include L452R, E484K, K417N/T, E484K, N501Y, and substitution combinations thereof.
구체적으로, 본 발명의 SARS-CoV-2는 델타(B.1.617.2) 변이, 베타(B.1.351) 변이 및 오미크론 (B.1.1.529)변이를 포함하나, 이에 제한되지는 않는다.Specifically, SARS-CoV-2 of the present invention includes, but is not limited to, a delta (B.1.617.2) mutation, a beta (B.1.351) mutation, and an omicron (B.1.1.529) mutation.
본 발명에서 제공하는 조성물은 코로나바이러스의 스파이크 단백질(SP) 및/또는 뉴클레오캡시드 단백질(NP) 을 포함할 수 있다. 한편 본 발명에서 제공하는 조성물에 있어서 코로나바이러스의 "스파이크 단백질" 또는 "뉴클레오캡시드 단백질"이라고 지칭하는 경우, 이는 상기 단백질의 전장 또는 그의 단편을 모두 포함하는 개념이다.The composition provided in the present invention may include a coronavirus spike protein (SP) and/or a nucleocapsid protein (NP). On the other hand, when referring to the "spike protein" or "nucleocapsid protein" of coronavirus in the composition provided by the present invention, this is a concept that includes all of the full length or fragments of the protein.
일 구현예로, 본 발명에서 제공하는 조성물은 In one embodiment, the composition provided by the present invention
a) 원형(original) 코로나바이러스의 스파이크 단백질 (SP);a) the spike protein (SP) of the original coronavirus;
b) 변이형 코로나바이러스의 스파이크 단백질 (SP); 및b) the spike protein (SP) of a variant coronavirus; and
c) 원형(original) 코로나바이러스의 뉴클레오캡시드 단백질(NP) 중 어느 하나 이상의 구성을 포함할 수 있다. 예를 들어 a) 및 c)의 구성을 포함하거나, a) 및 b)의 구성을 포함하거나, a), b) 및 c)의 구성을 포함할 수 있으나 이에 제한되지 않는다. 상기 조성물 내의 a) 내지 c)는 분리되어 있을 수 있고, 그 예로, 각각 별도의 용기에 포함되어 있을 수 있다. 다른 예로, 상기 조성물 내의 a) 내지 c)는 하나의 용기에 포함되어 있을 수 있다. 다른 예로, 상기 조성물 내의 a) 및 b)는 하나의 용기에 포함되어 있을 수 있다.c) may include any one or more components of the nucleocapsid protein (NP) of the original coronavirus. For example, it may include the components of a) and c), include the components of a) and b), or include the components of a), b) and c), but is not limited thereto. A) to c) in the composition may be separated, for example, each contained in a separate container. As another example, a) to c) in the composition may be included in one container. Alternatively, a) and b) in the composition may be contained in one container.
상기 변이형 코로나바이러스는 델타 변이형. 베타 변이형 또는 오미크론 변이형일 수 있으나, 이에 제한되지 않는다. 일 예로, 상기 변이형 코로나바이러스의 스파이크 단백질은 수용체 결합 도메인(RBD) 영역을 포함할 수 있다. The mutant coronavirus is a delta mutant. It may be a beta variant or an omicron variant, but is not limited thereto. For example, the spike protein of the mutant coronavirus may include a receptor binding domain (RBD) region.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 다음 i) 내지 iv) 중에서 선택되는 어느 하나 이상의 구성을 포함할 수 있다:In any one of the embodiments described above, the composition provided by the present invention may include any one or more components selected from the following i) to iv):
i) 원형(original) 코로나바이러스의 스파이크 단백질 (SP);i) the spike protein (SP) of the original coronavirus;
ii) 베타 변이형 코로나바이러스의 스파이크 단백질 (SP);ii) the spike protein (SP) of the beta variant coronavirus;
iii) 델타 변이형 코로나바이러스의 스파이크 단백질 (SP); iii) the spike protein (SP) of the delta mutant coronavirus;
iv) 원형(original) 코로나바이러스의 뉴클레오캡시드 단백질(NP); 및iv) the nucleocapsid protein (NP) of the original coronavirus; and
v) 오미크론 변이형 코로나바이러스의 스파이크 단백질(SP).v) Spike protein (SP) of Omicron variant coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 상기 i) 원형(original) 코로나바이러스의 스파이크 단백질 (SP)은 Wuhan-Hu-1 유래 SARS-CoV-2의 SP로, 예를 들어 서열번호 1 및 2 중에서 선택되는 1 이상의 펩타이드일 수 있다.In any one of the embodiments described above, i) the spike protein (SP) of the original coronavirus is the SP of SARS-CoV-2 from Wuhan-Hu-1, for example SEQ ID NO: 1 and It may be one or more peptides selected from two.
전술한 구현예 중 어느 하나의 구현예로, 상기 ii) 베타 변이형 코로나바이러스의 스파이크 단백질 (SP)은 베타(B.1.351) 변이형 SARS-CoV-2의 SP로, 예를 들어 서열번호 3 및 4 중에서 선택되는 1 이상의 펩타이드일 수 있다.In any one of the embodiments described above, the ii) spike protein (SP) of the beta mutant coronavirus is the SP of the beta (B.1.351) mutant SARS-CoV-2, for example SEQ ID NO: 3 And it may be one or more peptides selected from 4.
전술한 구현예 중 어느 하나의 구현예로, 상기 iii) 델타 변이형 코로나바이러스의 스파이크 단백질 (SP)은 델타(B.1.617.2) 변이형 SARS-CoV-2의 SP로, 예를 들어 서열번호 5의 펩타이드일 수 있다. In any one of the foregoing embodiments, wherein iii) the spike protein (SP) of the delta mutant coronavirus is the SP of the delta (B.1.617.2) mutant SARS-CoV-2, for example, the sequence It may be the peptide of number 5.
전술한 구현예 중 어느 하나의 구현예로, 상기 iv) 원형(original) 코로나바이러스의 뉴클레오캡시드 단백질(NP)은 Wuhan-Hu-1 유래 SARS-CoV-2의 NP 항원으로, 예를 들어 서열번호 6의 펩타이드 일 수 있다. In any one of the foregoing embodiments, the iv) nucleocapsid protein (NP) of the original coronavirus is an NP antigen of SARS-CoV-2 derived from Wuhan-Hu-1, for example, the sequence It may be the peptide of number 6.
전술한 구현예 중 어느 하나의 구현예로, 상기 v) 오미크론 변이형 코로나바이러스의 스파이크 단백질(SP) 은 오미크론(B.1.1.529) 변이형 SARS-CoV-2의 SP로, 예를 들어 서열번호 7의 펩타이드 일 수 있다.In any one of the embodiments described above, v) the spike protein (SP) of the Omicron mutant coronavirus is the SP of the Omicron (B.1.1.529) mutant SARS-CoV-2, for example For example, it may be the peptide of SEQ ID NO: 7.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 i) 내지 v) 중 1 이상의 펩타이드를 포함할 수 있다. In any one of the foregoing embodiments, the composition of the present invention may include one or more peptides from i) to v).
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 i) 내지 v) 중 2 이상의 펩타이드를 포함할 수 있다. 전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 i) 내지 v) 중 3 이상, 4 이상의 펩타이드를 포함할 수 있다. In any one of the foregoing embodiments, the composition of the present invention may include two or more peptides from i) to v). In any one of the foregoing embodiments, the composition of the present invention may include 3 or more, 4 or more peptides from i) to v).
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 i) 원형(original) 코로나바이러스의 스파이크 단백질(SP)을 포함할 수 있다. In any one of the foregoing embodiments, the composition of the present invention may include i) spike protein (SP) of the original coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 ii) 베타 변이형 코로나바이러스의 스파이크 단백질(SP)을 포함할 수 있다. In any one of the foregoing embodiments, the composition of the present invention may include ii) a spike protein (SP) of beta mutant coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 iii) 델타 변이형 코로나바이러스의 스파이크 단백질(SP)을 포함할 수 있다. In any one of the foregoing embodiments, the composition of the present invention may include iii) spike protein (SP) of delta mutant coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 iv) 원형(original) 코로나바이러스의 뉴클레오캡시드 단백질(NP)을 포함할 수 있다. In any one of the foregoing embodiments, the composition of the present invention may include iv) the nucleocapsid protein (NP) of the original coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 v) 오미크론 변이형 코로나바이러스의 스파이크 단백질(SP)을 포함할 수 있다. In any one of the foregoing embodiments, the composition of the present invention may include v) a spike protein (SP) of an omicron mutant coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 i) 원형(original) 코로나바이러스의 스파이크 단백질 (SP); 및 ii) 베타 변이형 코로나바이러스의 스파이크 단백질 (SP)을 포함할 수 있다.In any one of the foregoing embodiments, the composition of the present invention comprises i) the spike protein (SP) of the original coronavirus; and ii) the spike protein (SP) of the beta mutant coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 i) 원형(original) 코로나바이러스의 스파이크 단백질 (SP); 및 iii) 델타 변이형 코로나바이러스의 스파이크 단백질 (SP) 을 포함할 수 있다.In any one of the foregoing embodiments, the composition of the present invention comprises i) the spike protein (SP) of the original coronavirus; and iii) spike protein (SP) of delta mutant coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 i) 원형(original) 코로나바이러스의 스파이크 단백질 (SP); 및 iv) 원형(original) 코로나바이러스의 뉴클레오캡시드 단백질(NP)을 포함할 수 있다.In any one of the foregoing embodiments, the composition of the present invention comprises i) the spike protein (SP) of the original coronavirus; and iv) the nucleocapsid protein (NP) of the original coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 ii) 베타 변이형 코로나바이러스의 스파이크 단백질 (SP); 및 iii) 델타 변이형 코로나바이러스의 스파이크 단백질 (SP)을 포함할 수 있다.In any one of the foregoing embodiments, the composition of the present invention comprises ii) a spike protein (SP) of beta mutant coronavirus; and iii) spike protein (SP) of delta mutant coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 ii) 베타 변이형 코로나바이러스의 스파이크 단백질 (SP); 및 iv) 원형(original) 코로나바이러스의 뉴클레오캡시드 단백질(NP)을 포함할 수 있다.In any one of the foregoing embodiments, the composition of the present invention comprises ii) a spike protein (SP) of beta mutant coronavirus; and iv) the nucleocapsid protein (NP) of the original coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 iii) 델타 변이형 코로나바이러스의 스파이크 단백질 (SP); 및 iv) 원형(original) 코로나바이러스의 뉴클레오캡시드 단백질(NP)을 포함할 수 있다. In any one of the foregoing embodiments, the composition of the present invention comprises: iii) spike protein (SP) of delta mutant coronavirus; and iv) the nucleocapsid protein (NP) of the original coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 i) 원형(original) 코로나바이러스의 스파이크 단백질 (SP); ii) 베타 변이형 코로나바이러스의 스파이크 단백질 (SP); 및 iii) 델타 변이형 코로나바이러스의 스파이크 단백질 (SP)을 포함할 수 있다. In any one of the foregoing embodiments, the composition of the present invention comprises i) the spike protein (SP) of the original coronavirus; ii) the spike protein (SP) of the beta variant coronavirus; and iii) spike protein (SP) of delta mutant coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 i) 원형(original) 코로나바이러스의 스파이크 단백질 (SP); ii) 베타 변이형 코로나바이러스의 스파이크 단백질 (SP); 및 iv) 원형(original) 코로나바이러스의 뉴클레오캡시드 단백질(NP)을 포함할 수 있다.In any one of the foregoing embodiments, the composition of the present invention comprises i) the spike protein (SP) of the original coronavirus; ii) the spike protein (SP) of the beta variant coronavirus; and iv) the nucleocapsid protein (NP) of the original coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 i) 원형(original) 코로나바이러스의 스파이크 단백질 (SP); iii) 델타 변이형 코로나바이러스의 스파이크 단백질 (SP); 및 iv) 원형(original) 코로나바이러스의 뉴클레오캡시드 단백질(NP) 을 포함할 수 있다.In any one of the foregoing embodiments, the composition of the present invention comprises i) the spike protein (SP) of the original coronavirus; iii) the spike protein (SP) of the delta mutant coronavirus; and iv) the nucleocapsid protein (NP) of the original coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 i) 원형(original) 코로나바이러스의 스파이크 단백질 (SP); ii) 베타 변이형 코로나바이러스의 스파이크 단백질 (SP); iii) 델타 변이형 코로나바이러스의 스파이크 단백질 (SP); 및 iv) 원형(original) 코로나바이러스의 뉴클레오캡시드 단백질(NP) 을 포함할 수 있다.In any one of the foregoing embodiments, the composition of the present invention comprises i) the spike protein (SP) of the original coronavirus; ii) the spike protein (SP) of the beta variant coronavirus; iii) the spike protein (SP) of the delta mutant coronavirus; and iv) the nucleocapsid protein (NP) of the original coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 i) 원형(original) 코로나바이러스의 스파이크 단백질 (SP); ii) 베타 변이형 코로나바이러스의 스파이크 단백질 (SP); 및 v) 오미크론 변이형 코로나바이러스의 스파이크 단백질(SP)을 포함할 수 있다.In any one of the foregoing embodiments, the composition of the present invention comprises i) the spike protein (SP) of the original coronavirus; ii) the spike protein (SP) of the beta variant coronavirus; and v) spike protein (SP) of Omicron mutant coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 i) 원형(original) 코로나바이러스의 스파이크 단백질 (SP); iii) 델타 변이형 코로나바이러스의 스파이크 단백질 (SP); 및 v) 오미크론 변이형 코로나바이러스의 스파이크 단백질(SP) 을 포함할 수 있다.In any one of the foregoing embodiments, the composition of the present invention comprises i) the spike protein (SP) of the original coronavirus; iii) the spike protein (SP) of the delta mutant coronavirus; and v) spike protein (SP) of Omicron mutant coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 i) 원형(original) 코로나바이러스의 스파이크 단백질 (SP); iv) 원형(original) 코로나바이러스의 뉴클레오캡시드 단백질(NP); 및 v) 오미크론 변이형 코로나바이러스의 스파이크 단백질(SP)을 포함할 수 있다.In any one of the foregoing embodiments, the composition of the present invention comprises i) the spike protein (SP) of the original coronavirus; iv) the nucleocapsid protein (NP) of the original coronavirus; and v) spike protein (SP) of Omicron mutant coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 ii) 베타 변이형 코로나바이러스의 스파이크 단백질 (SP); iii) 델타 변이형 코로나바이러스의 스파이크 단백질 (SP); 및 v) 오미크론 변이형 코로나바이러스의 스파이크 단백질(SP)을 포함할 수 있다.In any one of the foregoing embodiments, the composition of the present invention comprises ii) a spike protein (SP) of beta mutant coronavirus; iii) the spike protein (SP) of the delta mutant coronavirus; and v) spike protein (SP) of Omicron mutant coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 ii) 베타 변이형 코로나바이러스의 스파이크 단백질 (SP); iv) 원형(original) 코로나바이러스의 뉴클레오캡시드 단백질(NP); 및 v) 오미크론 변이형 코로나바이러스의 스파이크 단백질(SP)을 포함할 수 있다.In any one of the foregoing embodiments, the composition of the present invention comprises ii) a spike protein (SP) of beta mutant coronavirus; iv) the nucleocapsid protein (NP) of the original coronavirus; and v) spike protein (SP) of Omicron mutant coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 iii) 델타 변이형 코로나바이러스의 스파이크 단백질 (SP); iv) 원형(original) 코로나바이러스의 뉴클레오캡시드 단백질(NP); 및 v) 오미크론 변이형 코로나바이러스의 스파이크 단백질(SP)을 포함할 수 있다. In any one of the foregoing embodiments, the composition of the present invention comprises: iii) spike protein (SP) of delta mutant coronavirus; iv) the nucleocapsid protein (NP) of the original coronavirus; and v) spike protein (SP) of Omicron mutant coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 i) 원형(original) 코로나바이러스의 스파이크 단백질 (SP); ii) 베타 변이형 코로나바이러스의 스파이크 단백질 (SP); iii) 델타 변이형 코로나바이러스의 스파이크 단백질 (SP); 및 v) 오미크론 변이형 코로나바이러스의 스파이크 단백질(SP)을 포함할 수 있다. In any one of the foregoing embodiments, the composition of the present invention comprises i) the spike protein (SP) of the original coronavirus; ii) the spike protein (SP) of the beta variant coronavirus; iii) the spike protein (SP) of the delta mutant coronavirus; and v) spike protein (SP) of Omicron mutant coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 i) 원형(original) 코로나바이러스의 스파이크 단백질 (SP); ii) 베타 변이형 코로나바이러스의 스파이크 단백질 (SP); iv) 원형(original) 코로나바이러스의 뉴클레오캡시드 단백질(NP); 및 v) 오미크론 변이형 코로나바이러스의 스파이크 단백질(SP)을 포함할 수 있다.In any one of the foregoing embodiments, the composition of the present invention comprises i) the spike protein (SP) of the original coronavirus; ii) the spike protein (SP) of the beta variant coronavirus; iv) the nucleocapsid protein (NP) of the original coronavirus; and v) spike protein (SP) of Omicron mutant coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 i) 원형(original) 코로나바이러스의 스파이크 단백질 (SP); iii) 델타 변이형 코로나바이러스의 스파이크 단백질 (SP); iv) 원형(original) 코로나바이러스의 뉴클레오캡시드 단백질(NP); 및 v) 오미크론 변이형 코로나바이러스의 스파이크 단백질(SP)을 포함할 수 있다.In any one of the foregoing embodiments, the composition of the present invention comprises i) the spike protein (SP) of the original coronavirus; iii) the spike protein (SP) of the delta mutant coronavirus; iv) the nucleocapsid protein (NP) of the original coronavirus; and v) spike protein (SP) of Omicron mutant coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명의 조성물은 i) 원형(original) 코로나바이러스의 스파이크 단백질 (SP); ii) 베타 변이형 코로나바이러스의 스파이크 단백질 (SP); iii) 델타 변이형 코로나바이러스의 스파이크 단백질 (SP); iv) 원형(original) 코로나바이러스의 뉴클레오캡시드 단백질(NP); 및 v) 오미크론 변이형 코로나바이러스의 스파이크 단백질(SP)을 포함할 수 있다.In any one of the foregoing embodiments, the composition of the present invention comprises i) the spike protein (SP) of the original coronavirus; ii) the spike protein (SP) of the beta variant coronavirus; iii) the spike protein (SP) of the delta mutant coronavirus; iv) the nucleocapsid protein (NP) of the original coronavirus; and v) spike protein (SP) of Omicron mutant coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 상기 조성물 내의 i), ii), iii), iv) 및 v) 는 서로 분리되어 있는 것일 수 있다. In any one of the embodiments described above, i), ii), iii), iv) and v) in the composition may be separated from each other.
분리된(seperated) 상태는 서로 혼합되지 않은 상태를 의미하는 것으로, 그 예로는 상기 i), ii), iii), iv) 및 v)의 구성이 별개의 용기에 포함되어 있는 상태를 들 수 있다. 상기 용기의 예시로는 튜브(tube)를 들 수 있고, 그 예로 채혈관 튜브일 수 있으나, 반드시 이에 제한되는 것은 아니다. 상기 채혈관 튜브는 진공 채혈기에 사용되는 진공 채혈관 튜브일 수 있다. 각각의 튜브는 구분의 용이를 위해 튜브를 식별할 수 있는 표시를 할 수 있고, 그 예로 튜브 뚜껑의 색을 달리할 수 있으나, 이에 제한되지는 않는다.The separated state means a state in which they are not mixed with each other, such as a state in which the above components i), ii), iii), iv) and v) are contained in separate containers. . An example of the container may be a tube, and an example thereof may be a blood collection tube, but is not necessarily limited thereto. The blood collection tube may be a vacuum blood collection tube used in a vacuum blood sampling machine. Each tube may be marked to identify the tube for ease of identification, and for example, the color of the tube lid may be different, but is not limited thereto.
전술한 구현예 중 어느 하나의 구현예로, 상기 조성물 내의 i), ii), iii), iv) 및 v)는 그 일부 또는 전부가 혼합되어 있는 것일 수 있다.In any one of the above embodiments, i), ii), iii), iv) and v) in the composition may be partially or entirely mixed.
일 예로, 상기 조성물 내의 i), ii), iii) 및 v)는 혼합되어 하나의 용기에 포함되어 있는 상태일 수 있다. 그러나 이에 제한되지는 않는다.For example, i), ii), iii) and v) in the composition may be mixed and contained in one container. However, it is not limited thereto.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 서열번호 1 내지 7의 아미노산 서열로 기재되는 단백질 중 어느 하나 이상의 단백질을 포함할 수 있다. In any one of the above embodiments, the composition provided by the present invention may include any one or more of the proteins represented by the amino acid sequences of SEQ ID NOs: 1 to 7.
구체적으로, 상기 단백질은 서열번호 1 내지 7 중 어느 하나의 폴리펩티드와 약 60%, 70%, 75%. 80%. 85%, 90%, 93%, 95%, 96%, 97%, 98% 또는 99% 이상의 서열 동일성을 갖는 폴리펩티드일 수 있으나 상기 서열번호 1 내지 7의 아미노산 서열과 동일 혹은 상응하는 활성을 가지는 경우라면 제한 없이 포함할 수 있다. Specifically, the protein is about 60%, 70%, 75% of the polypeptide of any one of SEQ ID NOs: 1 to 7. 80%. It may be a polypeptide having a sequence identity of 85%, 90%, 93%, 95%, 96%, 97%, 98% or 99% or more, but having the same or corresponding activity as the amino acid sequence of SEQ ID NOs: 1 to 7 can be included without limitation.
또한, 본 발명의 단백질은 서열번호 1 내지 7 중 어느 하나의 아미노산 서열을 가지거나, 포함하거나, 상기 아미노산 서열로 필수적으로 이루어진(consisting essentially of) 것일 수 있으나 이에 제한되지 않는다. 또한, 일부 서열이 결실, 변형, 치환 또는 부가된 아미노산 서열을 갖는 폴리펩티드/단백질도 이러한 상동성 또는 동일성을 가지며 상기 아미노산 서열로 구성된 단백질과 동일한 활성을 나타내는 단백질이라면 본 발명의 조성물에 포함될 수 있다.In addition, the protein of the present invention may have, contain, or consist essentially of the amino acid sequence of any one of SEQ ID NOs: 1 to 7, but is not limited thereto. In addition, polypeptides/proteins having an amino acid sequence in which some sequences are deleted, modified, substituted or added may be included in the composition of the present invention as long as they have homology or identity and show the same activity as the protein composed of the amino acid sequence.
본 발명에서 용어, '상동성(homology)' 또는 '동일성(identity)'은 두 개의 주어진 아미노산 서열 또는 염기 서열 상호간 유사한 정도를 의미하며 백분율로 표시될 수 있다. 용어 상동성 및 동일성은 종종 상호교환적으로 이용될 수 있다. 임의의 두 폴리뉴클레오티드 또는 폴리펩티드 서열이 상동성, 유사성 또는 동일성을 갖는지 여부는 당업계에 공지된 다양한 컴퓨터 알고리즘, 예를 들어 FASTA 프로그램, EMBOSS 패키지의 니들만 프로그램, 국립 생물공학 정보 데이터베이스 센터의 BLAST, 또는 ClustalW를 이용하여 결정할 수 있다. In the present invention, the term 'homology' or 'identity' refers to the degree of similarity between two given amino acid sequences or base sequences and can be expressed as a percentage. The terms homology and identity are often used interchangeably. Whether any two polynucleotide or polypeptide sequences have homology, similarity or identity can be determined by various computer algorithms known in the art, such as the FASTA program, the Needleman program in the EMBOSS package, BLAST from the National Center for Biotechnology Information Database, Alternatively, it can be determined using ClustalW.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 다음 (i) 내지 (iv) 중에서 선택되는 어느 하나 이상의 구성을 포함할 수 있다:In any one of the embodiments described above, the composition provided in the present invention may include any one or more components selected from the following (i) to (iv):
(i) 서열번호 1 및 2 중에서 선택되는 1 이상의 펩타이드; (i) at least one peptide selected from SEQ ID NOs: 1 and 2;
(ii) 서열번호 3 및 4 중에서 선택되는 1 이상의 펩타이드; (ii) one or more peptides selected from SEQ ID NOs: 3 and 4;
(iii) 서열번호 5의 펩타이드;(iii) the peptide of SEQ ID NO: 5;
(iv) 서열번호 6의 펩타이드; 및(iv) the peptide of SEQ ID NO: 6; and
(v) 서열번호 7의 펩타이드.(v) the peptide of SEQ ID NO: 7.
상기 (i) 의 펩타이드는 original (Wuhan-Hu-1 유래) SARS-CoV-2의 SP, 상기 (ii)의 펩타이드는 베타(B.1.351) 변이형 SARS-CoV의 SP, 상기 (iii)의 펩타이드는 델타(B.1.617.2) 변이형 SARS-CoV의 SP, 상기 (iv)의 펩타이드는 original (Wuhan-Hu-1 유래) SARS-CoV-2의 NP, 상기 (v) 의 펩타이드는 오미크론(B.1.1.529) 변이형 SARS-CoV의 SP 항원일 수 있다.The peptide of (i) above is the SP of the original (derived from Wuhan-Hu-1) SARS-CoV-2, the peptide of (ii) is the SP of the beta (B.1.351) mutant SARS-CoV, the above (iii) The peptide is the SP of the delta (B.1.617.2) mutant SARS-CoV, the peptide of (iv) is the NP of the original (derived from Wuhan-Hu-1) SARS-CoV-2, the peptide of (v) is Oh It may be the SP antigen of micron (B.1.1.529) variant SARS-CoV.
상기 서열번호 1의 펩타이드, 서열번호 3의 펩타이드 및 서열번호 7의 펩타이드는 각각 스파이크 단백질의 RBD 영역의 일부 또는 전부를 포함할 수 있다. The peptide of SEQ ID NO: 1, the peptide of SEQ ID NO: 3, and the peptide of SEQ ID NO: 7 may each include part or all of the RBD region of the spike protein.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 서열번호 1 및 2 중에서 선택되는 1 이상의 펩타이드를 포함할 수 있다. In any one of the above embodiments, the composition provided in the present invention may include one or more peptides selected from SEQ ID NOs: 1 and 2.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 서열번호 3 및 4 중에서 선택되는 1 이상의 펩타이드를 포함할 수 있다.In any one of the above embodiments, the composition provided in the present invention may include one or more peptides selected from SEQ ID NOs: 3 and 4.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 서열번호 5의 펩타이드를 포함할 수 있다. In any one of the above embodiments, the composition provided in the present invention may include the peptide of SEQ ID NO: 5.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 서열번호 6의 펩타이드를 포함할 수 있다. In any one of the above embodiments, the composition provided in the present invention may include the peptide of SEQ ID NO: 6.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 서열번호 7의 펩타이드를 포함할 수 있다. In any one of the above embodiments, the composition provided in the present invention may include the peptide of SEQ ID NO: 7.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 다음 (i) 및 (ii)의 구성을 포함할 수 있다:In any one of the foregoing embodiments, the composition provided by the present invention may include the following (i) and (ii) components:
(i) 서열번호 1 및 2 중에서 선택되는 1 이상의 펩타이드; 및 (ii) 서열번호 3 및 4 중에서 선택되는 1 이상의 펩타이드.(i) at least one peptide selected from SEQ ID NOs: 1 and 2; and (ii) one or more peptides selected from SEQ ID NOs: 3 and 4.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 다음 (i), (ii) 및 (iii)의 구성을 포함할 수 있다:In any one of the foregoing embodiments, the composition provided in the present invention may include the following (i), (ii) and (iii) components:
(i) 서열번호 1 및 2 중에서 선택되는 1 이상의 펩타이드; (ii) 서열번호 3 및 4 중에서 선택되는 1 이상의 펩타이드 및 (iii) 서열번호 5의 펩타이드.(i) at least one peptide selected from SEQ ID NOs: 1 and 2; (ii) one or more peptides selected from SEQ ID NOs: 3 and 4 and (iii) the peptide of SEQ ID NO: 5.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 다음 (i), (ii) 및 (iv)의 구성을 포함할 수 있다: In any one of the foregoing embodiments, the composition provided by the present invention may include the following components (i), (ii) and (iv):
(i) 서열번호 1 및 2 중에서 선택되는 1 이상의 펩타이드; (ii) 서열번호 3 및 4 중에서 선택되는 1 이상의 펩타이드 및 (iv) 서열번호 6의 펩타이드.(i) at least one peptide selected from SEQ ID NOs: 1 and 2; (ii) one or more peptides selected from SEQ ID NOs: 3 and 4 and (iv) the peptide of SEQ ID NO: 6.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 다음 (i), (ii), (iii) 및 (iv)의 구성을 포함할 수 있다: In any one of the foregoing embodiments, the composition provided herein may include the following (i), (ii), (iii) and (iv) components:
(i) 서열번호 1 및 2 중에서 선택되는 1 이상의 펩타이드; (ii) 서열번호 3 및 4 중에서 선택되는 1 이상의 펩타이드; (iii) 서열번호 5의 펩타이드; 및 (iv) 서열번호 6의 펩타이드.(i) at least one peptide selected from SEQ ID NOs: 1 and 2; (ii) one or more peptides selected from SEQ ID NOs: 3 and 4; (iii) the peptide of SEQ ID NO: 5; and (iv) the peptide of SEQ ID NO:6.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 (i) 서열번호 1 및 서열번호 2의 펩타이드; 및 (ii) 서열번호 3 및 서열번호 4 의 펩타이드를 포함할 수 있다. In any one of the embodiments described above, the composition provided in the present invention comprises (i) the peptides of SEQ ID NO: 1 and SEQ ID NO: 2; and (ii) the peptides of SEQ ID NO: 3 and SEQ ID NO: 4.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 (i) 서열번호 1 및 서열번호 2의 펩타이드; 및 (ii) 서열번호 3 및 서열번호 4 의 펩타이드; 및 (iv) 서열번호 6의 펩타이드를 포함할 수 있다. In any one of the embodiments described above, the composition provided in the present invention comprises (i) the peptides of SEQ ID NO: 1 and SEQ ID NO: 2; and (ii) the peptides of SEQ ID NO: 3 and SEQ ID NO: 4; and (iv) the peptide of SEQ ID NO: 6.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 서열번호 1, 서열번호 3, 서열번호 5 및 서열번호 7의 펩타이드를 포함할 수 있다.In any one of the above embodiments, the composition provided in the present invention may include the peptides of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, and SEQ ID NO: 7.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 (i) 서열번호 1, 서열번호 3, 서열번호 5 및 서열번호 7의 펩타이드; 및 (ii) 서열번호 6의 펩타이드를 포함할 수 있다.In any one of the embodiments described above, the composition provided by the present invention comprises (i) the peptides of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5 and SEQ ID NO: 7; and (ii) the peptide of SEQ ID NO: 6.
전술한 구현예 중 어느 하나의 구현예로, 상기 조성물 내의 (i), (ii), (iii), (iv) 및 (v) 는 서로 분리되어 있는 것일 수 있다. In any one of the foregoing embodiments, (i), (ii), (iii), (iv) and (v) in the composition may be separated from each other.
분리된(seperated) 상태는 서로 혼합되지 않은 상태를 의미하는 것으로, 그 예로는 상기 (i), (ii), (iii), (iv) 및 (v) 의 구성이 별개의 용기에 포함되어 있는 상태를 들 수 있다. 상기 용기의 예시로는 튜브(tube)를 들 수 있고, 그 예로 채혈관 튜브일 수 있으나, 반드시 이에 제한되는 것은 아니다. 상기 채혈관 튜브는 진공 채혈기에 사용되는 진공 채혈관 튜브일 수 있다. 각각의 튜브는 구분의 용이를 위해 튜브를 식별할 수 있는 표시를 할 수 있고, 그 예로 튜브 뚜껑의 색을 달리할 수 있으나, 이에 제한되지는 않는다. The separated state means a state in which the components of (i), (ii), (iii), (iv) and (v) are not mixed with each other. state can be An example of the container may be a tube, and an example thereof may be a blood collection tube, but is not necessarily limited thereto. The blood collection tube may be a vacuum blood collection tube used in a vacuum blood sampling machine. Each tube may be marked to identify the tube for ease of identification, and for example, the color of the tube lid may be different, but is not limited thereto.
그 예로, 상기 조성물은 (i) 서열번호 1 및 서열번호 2의 펩타이드; 및 이와 분리된 상태의 (ii) 서열번호 3 및 서열번호 4의 펩타이드를 포함할 수 있다. For example, the composition comprises (i) the peptides of SEQ ID NO: 1 and SEQ ID NO: 2; and (ii) the peptides of SEQ ID NO: 3 and SEQ ID NO: 4 in an isolated state.
다른 예로, 상기 조성물은 (i) 서열번호 1 및 서열번호 2의 펩타이드; 이와 분리된 상태의 (ii) 서열번호 3 및 서열번호 4의 펩타이드; 및 이와 분리된 상태의 (iii) 서열번호 6의 펩타이드를 포함할 수 있다. In another embodiment, the composition comprises (i) the peptides of SEQ ID NO: 1 and SEQ ID NO: 2; (ii) the peptides of SEQ ID NO: 3 and SEQ ID NO: 4 in an isolated state; and (iii) the peptide of SEQ ID NO: 6 in a state of separation therefrom.
다른 예로, 상기 조성물은 서열번호 1, 3, 5, 및 7의 펩타이드를 포함할 수 있다. As another example, the composition may include the peptides of SEQ ID NOs: 1, 3, 5, and 7.
다른 예로, 상기 조성물은 (i) 서열번호 1, 3, 5, 및 7의 펩타이드; 및 이와 분리된 상태의 (ii) 서열번호 6의 펩타이드를 포함할 수 있다. In another embodiment, the composition comprises (i) the peptides of SEQ ID NOs: 1, 3, 5, and 7; and (ii) the peptide of SEQ ID NO: 6 in an isolated state.
본 발명의 조성물에 포함될 수 있는 코로나바이러스의 항원은 원형(original)뿐만 아니라 백신을 회피하고 치명적인 증상을 나타내는 베타 변이, 감염력이 기존 바이러스에 비해 매우 높아 이전 유형에 비해 심각한 질환을 유발할 우려가 있는 델타 변이의 항원을 포함하므로, 기존 코로나바이러스뿐만 아니라 변이형 코로나바이러스의 감염 여부까지 확인할 수 있다는 이점을 가진다.The antigens of coronaviruses that can be included in the composition of the present invention are not only original, but also beta mutations that evade vaccines and show fatal symptoms, and delta, which have a higher infectivity than existing viruses and can cause serious diseases compared to previous types. Since it contains mutant antigens, it has the advantage of being able to check whether or not the mutant coronavirus is infected as well as the existing coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 d) 음성 대조 항원을 더 포함할 수 있다. 상기 d) 음성 대조 항원은 본 발명에서 제공하는 조성물에 포함되어 있는 다른 항원, 예를 들어 전술한 a) 내지 c)의 코로나바이러스 항원과 분리되어 있을 수 있고, 그 예로, 코로나바이러스 항원과는 별개의 용기에 포함되어 있을 수 있다.In any one of the foregoing embodiments, the composition provided by the present invention may further comprise d) a negative control antigen. The d) negative control antigen may be separated from other antigens included in the composition provided by the present invention, for example, the coronavirus antigens of a) to c) described above, for example, separate from the coronavirus antigens. may be included in the container.
상기 d) 음성 대조 항원은 코로나바이러스 감염증을 진단하고자 하는 개체의 비특이적 면역 활성을 측정하는 지표로 사용될 수 있다. 예를 들어, 상기 음성 대조 항원에서 검출되는 인터페론 감마가 일정 수치 이하인 경우 검사 결과를 신뢰할 수 있다고 볼 수 있다.The d) negative control antigen may be used as an indicator for measuring the non-specific immune activity of an individual to be diagnosed with coronavirus infection. For example, when the interferon gamma detected in the negative control antigen is below a certain value, the test result can be considered reliable.
상기 d) 음성 대조 항원에 노출시킨 검체의 인터페론-감마 수준과 a) 내지 c)의 항원에 노출시킨 혈액의 인터페론-감마 수준을 비교함으로써, 코로나바이러스 항원 노출 전후 인터페론 감마 수준의 변화량을 확인하여, 코로나바이러스 감염증의 병변이 현재 진행 중에 있거나 코로나바이러스 에 대한 노출이 최근에 있었는지 확인할 수 있다. d) by comparing the interferon-gamma level of the specimen exposed to the negative control antigen and the interferon-gamma level of the blood exposed to the antigens a) to c), the amount of change in interferon-gamma level before and after exposure to the coronavirus antigen was confirmed, It can determine if the lesion of coronavirus infection is currently ongoing or if exposure to coronavirus was recent.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 e) 양성 대조 항원을 더 포함할 수 있다. 상기 e) 양성 대조 항원은 본 발명에서 제공하는 조성물에 포함되어 있는 다른 항원, 예를 들어 전술한 a) 내지 c)의 코로나바이러스 항원 및 d) 음성 대조 항원과 분리되어 있을 수 있다. 그 예로 a) 내지 d) 와는 별개의 용기에 포함되어 있을 수 있다.In any one of the above embodiments, the composition provided by the present invention may further comprise e) a positive control antigen. The e) positive control antigen may be separated from other antigens included in the composition provided by the present invention, for example, coronavirus antigens of a) to c) and d) negative control antigens. For example, it may be contained in a separate container from a) to d).
상기 e) 양성 대조 항원은 코로나바이러스 감염증을 진단하고자 하는 개체의 면역 상태를 판별하는 지표로 사용될 수 있다. 예를 들어 상기 양성 대조 항원에 대해 노출된 검체에서 생성되는 인터페론 감마 수준과 음성 대조 항원에 노출된 검체에서 생성되는 인터페론 감마 수준의 차이가 일정 수준 이하인 경우, 검체에서 인터페론 감마가 생성되기 어려운 상태로서 코로나바이러스 감염 여부에 대한 판정이 불가능한 상태로 판단할 수 있다. 상기 양성 대조 항원은 미토겐(mitogen)일 수 있으나 이에 제한되지는 않는다.The e) positive control antigen may be used as an indicator for determining the immune status of an individual to be diagnosed with a coronavirus infection. For example, when the difference between the level of interferon gamma produced in a sample exposed to the positive control antigen and the level of interferon gamma produced in a sample exposed to the negative control antigen is below a certain level, the sample is considered to be in a state in which interferon gamma is difficult to produce. It can be judged in a state where it is impossible to determine whether or not a person is infected with the coronavirus. The positive control antigen may be a mitogen, but is not limited thereto.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 검사대상의 시료를 채취 또는 진단 시약을 적용하기 위한 도구, 시약 또는 장치 등 생물학적 시료로부터 바이러스의 존재유무를 확인하는 통상의 진단용 조성물에 포함될 수 있는 도구, 장치 또는 시약이 더 포함될 수 있다.In any one of the above-described embodiments, the composition provided by the present invention is a conventional method for confirming the presence or absence of a virus from a biological sample, such as a tool, reagent, or device for collecting a sample of a test subject or applying a diagnostic reagent. Tools, devices, or reagents that may be included in the diagnostic composition may be further included.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 개체의 혈중 면역세포에서 생성되는 인터페론-감마의 수준을 측정함으로써 감염 여부를 판정하는 것일 수 있다.In any one of the above-described embodiments, the composition provided in the present invention may determine whether or not an infection is present by measuring the level of interferon-gamma produced by immune cells in the blood of an individual.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 혈액 항응고제를 더 포함할 수 있다. 구체적으로, 상기 혈액 항응고제는 헤파린(heparin), 아스피린 또는 와파린일 수 있으나, 이에 제한되지 않는다. In any one of the above embodiments, the composition provided in the present invention may further include a blood anticoagulant. Specifically, the blood anticoagulant may be heparin, aspirin or warfarin, but is not limited thereto.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 인터페론 감마(interferon-gamma) 를 검출할 수 있는 구성을 더 포함할 수 있다. As any one of the above embodiments, the composition provided by the present invention may further include a component capable of detecting interferon-gamma.
구체적으로, 본 발명에서 제공하는 조성물은 생체 내에서 외인성 혹은 내인성항원에 의하여 자극 받았을 때(Primed), 자극한 항원에 대한 면역학적 기억을 할 수 있는 혈액 중의 임파구를 가진다는 사실을 이용하는 인터페론 감마 분비검사(Interferon-gamma Releasing Assay, IGRA)에 사용될 수 있다. 환자로부터 채취한 혈액에 시험관 내에서 항원을 첨가하면 항원 특이적 기억세포(antigen specific effector/memory T cell)의 빠른 재자극(re-stimulation)이 되고, 사이토카인인 감마 인터페론을 분비하게 되며, 이 인터페론은 항원에 의해 유도된 세포성 면역 반응의 특이 마커로 이용될 수 있다. Specifically, when the composition provided by the present invention is stimulated by an exogenous or endogenous antigen in vivo (primed), it secretes interferon gamma using the fact that it has lymphocytes in the blood capable of immunological memory for the stimulated antigen. It can be used for testing (Interferon-gamma Releasing Assay, IGRA). When antigens are added to blood collected from patients in vitro, antigen specific effector/memory T cells are rapidly re-stimulated and secrete gamma interferon, a cytokine. Interferons can be used as specific markers of cellular immune responses induced by antigens.
본 발명에서 제공하는 조성물은 채혈 튜브를 이용하여 전혈을 채취한 뒤 본 발명의 코로나바이러스 항원 또는 대조군 항원을 첨가하여 Effector/memory T cell을 자극시키고, 16~24시간 동안 배양하여 항원에 반응하여 생성된 인터페론 감마를 정량 분석할 수 있다. 본 발명은 혈액 항응고제가 처리되어 분리되어 지지 않은 전혈을 자극항원과 함께 배양하여 세포성 면역능(CMI)을 측정하는 원리를 사용하는 것이다. 일 예로, 본 발명에서 제공하는 조성물을 이용한 검사는 다음의 두 단계로 수행될 수 있다: 첫째, 본 발명의 코로나바이러스 항원 또는 대조군 항원 펩타이드를 포함하는 용기에 전혈을 채취한다. 또는 혈액 항응고제를 포함한 용기에 혈액을 채취한 후 본 발명의 항원 펩타이드를 포함하는 용기로 혈액을 옮긴다. 양성 대조 항원을 포함한 튜브는 ELISA 분석에서 양성 대조군으로 사용될 수 있다. 둘째, 코로나바이러스 항원을 포함한 용기에 혈액을 채취한 후 약 37℃에서 약 16-24시간 동안 배양하고 원심분리하여, 혈장을 채취해 ELISA를 이용하여 인터페론 감마의 양(IU/ml)을 측정한다.The composition provided by the present invention is produced in response to the antigen by collecting whole blood using a blood collection tube, adding the coronavirus antigen or control antigen of the present invention to stimulate effector/memory T cells, and culturing for 16 to 24 hours Interferon gamma can be quantitatively analyzed. The present invention uses the principle of measuring cellular immunity (CMI) by incubating whole blood that has not been treated with a blood anticoagulant and separated together with a stimulatory antigen. For example, the test using the composition provided in the present invention can be performed in the following two steps: First, whole blood is collected in a container containing the coronavirus antigen or control antigen peptide of the present invention. Alternatively, after blood is collected in a container containing a blood anticoagulant, the blood is transferred to a container containing the antigenic peptide of the present invention. A tube containing a positive control antigen can be used as a positive control in an ELISA assay. Second, blood is collected in a container containing coronavirus antigens, incubated at about 37 ° C for about 16-24 hours, centrifuged, and plasma is collected to measure the amount of interferon gamma (IU / ml) using ELISA .
전술한 구현예 중 어느 하나의 구현예로, 상기 인터페론-감마는 면역분석에 의해 검출 될 수 있다. 이러한 면역분석은 종래에 개발된 다양한 면역분석(immunoassay) 또는 면역염색(immunostaining) 프로토콜에 따라 실시될 수 있다. 상기 면역분석 또는 면역염색 포맷은 방사능면역분석, 방사능면역침전, 면역침전, 효소면역측정법 (ELISA: enzyme-linked immunosorbent assay), 캡처-ELISA, 억제 또는 경쟁 분석, 샌드위치 분석, 유세포 분석(flow cytometry), 면역형광염색 및 면역친화성 정제를 포함하지만, 이에 제한되는 것은 아니다. 구체적으로 상기 면역분석법은 ELISA 일 수 있다.In any one of the foregoing embodiments, the interferon-gamma can be detected by immunoassay. Such an immunoassay may be performed according to various immunoassay or immunostaining protocols previously developed. The immunoassay or immunostaining format is radioimmunoassay, radioimmunoprecipitation, immunoprecipitation, enzyme-linked immunosorbent assay (ELISA), capture-ELISA, inhibition or competition assay, sandwich assay, flow cytometry , immunofluorescence staining and immunoaffinity purification. Specifically, the immunoassay may be ELISA.
본 발명의 용어 "ELISA(Enzyme-linked immunosorbent assay)"는 효소면역 측정방법이라고도 하며, 항체에 효소를 결합시켜 항원-항체 복합체를 형성함으로써 이의 효소와 기질의 반응을 통해 흡광도를 이용하여 정량하는 방법이다. 상기 ELISA는 고체 지지체에 부착된 항원을 인지하는 표지된 항체를 이용하는 직접적 ELISA, 고체 지지체에 부착된 항원을 인지하는 항체의 복합체에서 포획 항체를 인지하는 표지된 이차 항체를 이용하는 간접적 ELISA, 고체 지지체에 부착된 항체와 항원의 복합체에서 항원을 인지하는 표지된 또 다른 항체를 이용하는 직접적 샌드위치 ELISA, 고체 지지체에 부착된 항체와 항원의 복합체에서 항원을 인지하는 또 다른 항체와 반응시킨 후 이 항체를 인지하는 표지된 2차 항체를 이용하는 간접적 샌드위치 ELISA 등을 포함한다.The term "ELISA (Enzyme-linked immunosorbent assay)" of the present invention is also referred to as an enzyme immunoassay method, and is a method of quantifying using absorbance through the reaction between an enzyme and a substrate by forming an antigen-antibody complex by binding an enzyme to an antibody. am. The ELISA includes direct ELISA using a labeled antibody that recognizes an antigen attached to a solid support, indirect ELISA using a labeled secondary antibody that recognizes a capture antibody in a complex of antibodies that recognize an antigen attached to a solid support, and Direct sandwich ELISA using another labeled antibody that recognizes an antigen in a complex of attached antibody and antigen, followed by reaction with another antibody that recognizes an antigen in a complex of antibody and antigen attached to a solid support and then recognizing this antibody indirect sandwich ELISA using labeled secondary antibodies; and the like.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 조성물은 효소면역측정법(ELISA)에 사용되는 구성을 더 포함할 수 있다.In any one of the above-described embodiments, the composition provided in the present invention may further include a component used in enzyme-linked immunosorbent assay (ELISA).
전술한 구현예 중 어느 하나의 구현예로 상기 효소면역측정법(ELISA)에 사용되는 구성은 인터페론 감마 항체를 포함할 수 있다. 일 예로, 상기 항체는 인터페론 감마 단일클론항체일 수 있고, 구체적으로 인간 인터페론 감마 단일클론항체일 수 있으나, 이에 제한되지 않는다. In any one of the above-described embodiments, the construct used in the enzyme-linked immunosorbent assay (ELISA) may include an interferon gamma antibody. For example, the antibody may be an interferon-gamma monoclonal antibody, specifically, a human interferon-gamma monoclonal antibody, but is not limited thereto.
상기 단일클론항체는 고체 지지체에 부착된 포획 항체일 수 있다. 구체적으로, 상기 포획 항체는 마이크로플레이트에 코팅된 것일 수 있다. 상기 지지체는 유리, 알루미나, 세라믹, 탄소, 금, 은, 구리, 알루미늄, 화합물 반도체, 실리콘 및 이들의 조합으로 구성된 군으로부터 선택될 수 있으나 이에 제한되지는 않는다. The monoclonal antibody may be a capture antibody attached to a solid support. Specifically, the capture antibody may be coated on a microplate. The support may be selected from the group consisting of glass, alumina, ceramics, carbon, gold, silver, copper, aluminum, compound semiconductors, silicon, and combinations thereof, but is not limited thereto.
전술한 구현예 중 어느 하나의 구현예로 상기 효소면역측정법(ELISA)에 사용되는 구성은 인터페론 감마 특이적 항체 컨쥬게이트를 포함할 수 있다. In any one of the above-described embodiments, a component used in the enzyme-linked immunosorbent assay (ELISA) may include an interferon gamma-specific antibody conjugate.
상기 항체 컨쥬게이트는 항체에 검출 가능한 표지 물질이 결합되어 있는, 검출 항체일 수 있다. 상기 검출 항체는 마우스 단일클론항체일 수 있으나 이에 제한되지는 않는다.The antibody conjugate may be a detection antibody in which a detectable label is bound to the antibody. The detection antibody may be a mouse monoclonal antibody, but is not limited thereto.
상기 인터페론 감마 특이적 항체 컨쥬게이트는, 포획 항체에 포획된 인터페론 감마 또는 포획 항체와 인터페론 감마의 결합체를 특이적으로 인식하여 표지 물질에서 검출 가능한 시그널을 발생시킬 수 있다. The interferon-gamma-specific antibody conjugate can specifically recognize interferon-gamma captured by the capture antibody or a conjugate of the capture antibody and interferon-gamma to generate a signal detectable from a labeling substance.
상기 검출 표지의 예로는, 바이오틴-스트렙트아비딘 결합체, 바이오틴 유도체 등의 리간드, 형광 물질(플루오레세인, 텍사스 레드, 로다민, 그린 형광 단백질, 이소티오시아네이트, 피코에리테린, 피코시아닌, 알로피코시아닌, o-프탈데히드, 플루오레스카민 등), 방사성 표지물(3H, 125I, 35S, 14C, 32P, 36Cl, 51Cr, 57Co, 58Co 등), 효소(HRP, β-글루쿠로니다제, β-D-글루코시다제, β-D-갈락토시다제, 우레아제, 퍼옥시다아제, 알칼라인 포스파타아제, 아세틸콜린에스테라제, 글루코오스 옥시다제, 헥소키나제, GDPase, RNase, 글루코오스 옥시다제, 루시퍼라제, 포스포프럭토키나제, 포스포에놀피루베이트 카복실라제, 아스파르테이트 아미노트랜스페라제, 포스페놀피루베이트 데카복실라제, β-라타마제, 알칼라인 포스파타제, 기타 ELISA에서 일반적으로 사용되는 것 등), 미소입자(콜로이드 금, 착색된 라텍스 등), 레독스 분자(페로센, 루테늄 착화합물, 바이올로젠, 퀴논, Ti 이온, Cs 이온, 디이미드, 1,4-벤조퀴논, 하이드로퀴논 등), 플라스틱(폴리스티렌, 폴리프로필렌, 라텍스 등) 비드 등이 있으나, 이에 제한되는 것은 아니다.Examples of the detection label include ligands such as biotin-streptavidin conjugates and biotin derivatives, fluorescent substances (fluorescein, Texas red, rhodamine, green fluorescent protein, isothiocyanate, phycoerytherin, phycocyanin, Allophycocyanine, o-phthaldehyde, fluorescamine, etc.), radiolabels (3H, 125I, 35S, 14C, 32P, 36Cl, 51Cr, 57Co, 58Co, etc.), enzymes (HRP, β-glucuronidase) , β-D-glucosidase, β-D-galactosidase, urease, peroxidase, alkaline phosphatase, acetylcholinesterase, glucose oxidase, hexokinase, GDPase, RNase, glucose oxidase, luciferase enzyme, phosphofructokinase, phosphoenolpyruvate carboxylase, aspartate aminotransferase, phosphophenolpyruvate decarboxylase, β-latamase, alkaline phosphatase, and others commonly used in ELISA etc.), microparticles (colloidal gold, colored latex, etc.), redox molecules (ferrocene, ruthenium complex, biologen, quinone, Ti ion, Cs ion, diimide, 1,4-benzoquinone, hydroquinone, etc.), Plastic (polystyrene, polypropylene, latex, etc.) beads and the like, but are not limited thereto.
전술한 구현예 중 어느 하나의 구현예로, 상기 효소면역측정법(ELISA)에 사용되는 구성은 재조합 인간 인터페론 감마 항원을 더 포함할 수 있다. 상기 재조합 인간 인터페론 감마 항원은 시료 내 인터페론 감마 농도를 정량하기 위해 필요한 표준곡선을 작성하는 데 이용될 수 있다.In any one of the foregoing embodiments, the construct used in the ELISA may further include a recombinant human interferon gamma antigen. The recombinant human interferon-gamma antigen may be used to prepare a standard curve required to quantify the concentration of interferon-gamma in a sample.
전술한 구현예 중 어느 하나의 구현예로, 상기 효소면역측정법(ELISA)에 사용되는 구성은 완충액, 세척액, 기질액 및 반응 정지액을 포함할 수 있다. In any one of the above-described embodiments, components used in the enzyme immunosorbent assay (ELISA) may include a buffer solution, a wash solution, a substrate solution, and a reaction stop solution.
본 발명의 다른 하나의 양태는 본 발명에서 제공하는 조성물을 포함하는 코로나바이러스 감염증 진단용 의료기기를 제공한다. 상기 의료기기는 키트일 수 있다.Another aspect of the present invention provides a medical device for diagnosing coronavirus infection comprising the composition provided in the present invention. The medical device may be a kit.
상기 조성물에 대해서는 전술한 바와 같다.The composition is as described above.
일 구현예로, 본 발명에서 제공하는 의료기기는 a) 원형(original) 코로나바이러스의 스파이크 단백질 (SP)을 포함하는 용기; b) 변이형 코로나바이러스의 스파이크 단백질 (SP)을 포함하는 용기; 및 c) 원형(original) 코로나바이러스의 뉴클레오캡시드 단백질(NP) 을 포함하는 용기 중 어느 하나 이상의 구성을 포함할 수 있다. 예를 들어 a) 및 c)의 구성을 포함하거나, a) 및 b)의 구성을 포함하거나, a), b) 및 c)의 구성을 포함할 수 있으나 이에 제한되지 않는다.In one embodiment, the medical device provided by the present invention includes a) a container containing the spike protein (SP) of the original coronavirus; b) a container comprising a spike protein (SP) of a variant coronavirus; and c) a container containing the nucleocapsid protein (NP) of the original coronavirus. For example, it may include the components of a) and c), include the components of a) and b), or include the components of a), b) and c), but is not limited thereto.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 의료기기는 i) 원형(original) 코로나바이러스의 스파이크 단백질 (SP)을 포함하는 용기; ii) 베타 변이형 코로나바이러스의 스파이크 단백질 (SP) 을 포함하는 용기; iii) 델타 변이형 코로나바이러스의 스파이크 단백질 (SP) 을 포함하는 용기; iv) 원형(original) 코로나바이러스의 뉴클레오캡시드 단백질(NP) 을 포함하는 용기; 및 v) 오미크론 변이형 코로나바이러스의 스파이크 단백질 (SP) 을 포함하는 용기 중 어느 하나 이상을 포함할 수 있다. In any one of the embodiments described above, the medical device provided by the present invention includes i) a container containing spike protein (SP) of an original coronavirus; ii) a container containing the spike protein (SP) of the beta variant coronavirus; iii) a container containing spike protein (SP) of delta mutant coronavirus; iv) a container containing the nucleocapsid protein (NP) of the original coronavirus; and v) a container comprising a spike protein (SP) of an Omicron variant coronavirus.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 의료기기는 음성 대조 항원이 포함된 용기; 및 다음 (i) 내지 (iv) 중 어느 하나 이상의 용기를 포함할 수 있다;In any one of the above embodiments, the medical device provided by the present invention includes a container containing a negative control antigen; and a container of any one or more of the following (i) to (iv);
(i) 서열번호 1 및 2 중에서 선택되는 1 이상의 펩타이드를 포함하는 용기; (ii) 서열번호 3 및 4 중에서 선택되는 1 이상의 펩타이드를 포함하는 용기; (iii) 서열번호 5의 펩타이드를 포함하는 용기; (iv) 서열번호 6의 펩타이드를 포함하는 용기; 및 (v) 서열번호 7의 펩타이드를 포함하는 용기.(i) a container containing one or more peptides selected from SEQ ID NOs: 1 and 2; (ii) a container containing one or more peptides selected from SEQ ID NOs: 3 and 4; (iii) a container containing the peptide of SEQ ID NO: 5; (iv) a container containing the peptide of SEQ ID NO: 6; and (v) a container comprising the peptide of SEQ ID NO: 7.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 의료기기는 (i) 서열번호 1 및 2 중에서 선택되는 1 이상의 펩타이드; (ii) 서열번호 3 및 4 중에서 선택되는 1 이상의 펩타이드; (iii) 서열번호 5의 펩타이드; (iv) 서열번호 6의 펩타이드; 및 (v) 서열번호 7의 펩타이드 중 어느 하나 이상을 포함하고, (vi) 음성 대조 항원을 포함하며, 선택적으로 (vii) 양성 대조 항원을 추가로 포함할 수 있다. 전술한 구현예 중 어느 하나의 구현예로, 상기 (i) 내지 (vii)는 각각 별도의 용기에 포함되어 있는 것일 수 있으나 이에 제한되지 않는다.In any one of the embodiments described above, the medical device provided by the present invention includes (i) one or more peptides selected from SEQ ID NOs: 1 and 2; (ii) one or more peptides selected from SEQ ID NOs: 3 and 4; (iii) the peptide of SEQ ID NO: 5; (iv) the peptide of SEQ ID NO: 6; and (v) a peptide of SEQ ID NO: 7, (vi) a negative control antigen, and optionally (vii) a positive control antigen. In any one of the above embodiments, (i) to (vii) may be included in separate containers, but are not limited thereto.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 의료기기는 (i) 서열번호 1 및 2의 펩타이드를 포함하는 용기; (ii) 서열번호 3 및 4의 펩타이드를 포함하는 용기; (iii) 서열번호 1, 3, 5, 7의 펩타이드를 포함하는 용기; 및 (iv) 서열번호 6의 펩타이드를 포함하는 용기 중에서 1 이상을 포함하고, (v) 음성 대조 항원을 포함하는 용기를 포함하고, 선택적으로 (vi) 양성 대조 항원을 포함하는 용기를 포함할 수 있다. In any one of the embodiments described above, the medical device provided by the present invention includes: (i) a container containing the peptides of SEQ ID NOs: 1 and 2; (ii) a container comprising the peptides of SEQ ID NOs: 3 and 4; (iii) a container containing the peptides of SEQ ID NOs: 1, 3, 5, and 7; and (iv) a container comprising the peptide of SEQ ID NO: 6, (v) a container comprising a negative control antigen, and optionally (vi) a container comprising a positive control antigen. there is.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 의료기기는 서열번호 1 및 2의 펩타이드를 포함하는 용기; 서열번호 3 및 4의 펩타이드를 포함하는 용기; 음성 대조 항원을 포함하는 용기; 및 양성 대조 항원을 포함하는 용기를 포함할 수 있다.In any one of the embodiments described above, the medical device provided by the present invention includes a container including the peptides of SEQ ID NOs: 1 and 2; A vessel containing the peptides of SEQ ID NOs: 3 and 4; a container containing a negative control antigen; and a container comprising a positive control antigen.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 의료기기는 서열번호 1 및 2의 펩타이드를 포함하는 용기; 서열번호 3 및 4의 펩타이드를 포함하는 용기; 서열번호 6의 펩타이드를 포함하는 용기; 음성 대조 항원을 포함하는 용기; 및 양성 대조 항원을 포함하는 용기를 포함할 수 있다.In any one of the embodiments described above, the medical device provided by the present invention includes a container including the peptides of SEQ ID NOs: 1 and 2; A vessel containing the peptides of SEQ ID NOs: 3 and 4; A container containing the peptide of SEQ ID NO: 6; a container containing a negative control antigen; and a container comprising a positive control antigen.
전술한 구현예 중 어느 하나의 구현예로, 본 발명에서 제공하는 의료기기는 서열번호 1, 3, 5 및 7의 펩타이드를 포함하는 용기; 서열번호 6의 펩타이드를 포함하는 용기; 음성 대조 항원을 포함하는 용기; 및 양성 대조 항원을 포함하는 용기를 포함할 수 있다.In any one of the above embodiments, the medical device provided by the present invention includes a container including the peptides of SEQ ID NOs: 1, 3, 5 and 7; A container containing the peptide of SEQ ID NO: 6; a container containing a negative control antigen; and a container comprising a positive control antigen.
전술한 구현예 중 어느 하나의 구현예로, 상기 의료기기는 인터페론 감마(interferon-gamma) 를 검출할 수 있는 구성을 더 포함할 수 있다.In any one of the above embodiments, the medical device may further include a component capable of detecting interferon-gamma.
전술한 구현예 중 어느 하나의 구현예로, 상기 의료기기는 인간 인터페론 감마 단일클론항체가 코팅된 마이크로플레이트 및 인터페론 감마 특이적 항체 컨쥬게이트를 포함할 수 있다.In any one of the above embodiments, the medical device may include a microplate coated with human interferon gamma monoclonal antibody and an interferon gamma specific antibody conjugate.
전술한 구현예 중 어느 하나의 구현예로, 상기 의료기기는 완충액, 세척액, 기질액 및 반응 정지액을 포함할 수 있다.In any one of the above-described embodiments, the medical device may include a buffer solution, a washing solution, a substrate solution, and a reaction stop solution.
전술한 구현예 중 어느 하나의 구현예로, 상기 의료기기는 ELISA 키트일 수 있다.In any one of the foregoing embodiments, the medical device may be an ELISA kit.
전술한 구현예 중 어느 하나의 구현예로, 상기 의료기기는 고체 담체; 분석하고자 하는 검체를 수용하고 버퍼 투입부 및 검체 투입부를 구비하는 검체 패드; 상기 검체 패드에서 유입된 검체에 함유되어 있는 코로나바이러스와 특이적으로 결합하는 항체를 포함하는 컨쥬게이트 패드; 상기 검체에 코로나바이러스가 존재하는지 여부를 검출하는 신호검출부와 분석 물질의 존재 유무와 관계없이 검체가 흡수 패드로 이동하였는지 여부를 확인하는 대조부를 포함하는 신호 검출 패드; 및 신호 검출 반응이 종료된 검체를 흡수하는 흡수 패드를 포함하는 것일 수 있으나, 이에 제한되지 않는다.In any one of the foregoing embodiments, the medical device comprises a solid carrier; a sample pad accommodating a sample to be analyzed and having a buffer input unit and a sample input unit; a conjugate pad containing an antibody that specifically binds to the coronavirus contained in the sample introduced from the sample pad; a signal detection pad including a signal detection unit for detecting whether or not coronavirus is present in the sample and a control unit for determining whether the sample has moved to the absorbent pad regardless of the presence or absence of an analyte; and an absorbent pad for absorbing the specimen after the signal detection reaction is completed, but is not limited thereto.
본 발명의 다른 하나의 양태는, 개체로부터 분리된 시료를 전술한 코로나바이러스 감염증 진단용 조성물과 접촉시키는 단계 또는 상기 조성물을 포함하는 의료기기를 이용하는 단계를 포함하는, 코로나바이러스 감염증 진단에 필요한 정보를 제공하는 방법을 제공한다.Another aspect of the present invention provides information necessary for diagnosing coronavirus infection, including the step of contacting a sample isolated from an individual with the above-described composition for diagnosing coronavirus infection or using a medical device containing the composition provides a way to
본 발명의 용어, "진단"은 특정 질병 또는 질환에 대한 개체의 감수성(susceptibility)을 판정하는 것, 개체가 특정 질병 또는 질환을 현재 가지고 있는지 여부를 판정하는 것 또는 치료 효능에 대한 정보를 제공하기 위해 개체의 상태를 모니터링 하는 것을 포함한다. 구체적으로, 본 발명의 "진단"은 개체의 코로나바이러스 감염증의 병변이 현재 진행 중에 있거나 코로나바이러스 에 대한 노출이 최근에 있었는지 확인하는 것일 수 있다.As used herein, the term "diagnosis" refers to determining an individual's susceptibility to a specific disease or disorder, determining whether an individual currently has a specific disease or disorder, or providing information on treatment efficacy. This includes monitoring the health of the object for Specifically, the "diagnosis" of the present invention may be to determine whether a lesion of a coronavirus infection in an individual is currently in progress or exposure to a coronavirus has recently occurred.
본 발명의 용어, "개체" 는 코로나바이러스 감염 또는 노출 여부를 확인하고자 하는 대상을 의미한다. 이때, 상기 개체는 사람을 비롯하여 코로나바이러스에 감염될 수 있는 동물은 제한 없이 포함될 수 있다.The term of the present invention, "subject" means a subject to be confirmed whether or not infected or exposed to coronavirus. At this time, the subject may include without limitation animals that can be infected with coronavirus, including humans.
본 발명의 용어, "시료"는 개체로부터 분리된 조직, 세포, 전혈, 혈청, 혈장 등을 포함하며, 구체적으로는 혈액일 수 있으나, 인터페론 감마를 생성할 수 있는 기억 세포를 포함하는 시료면 제한되지 않는다.As used herein, the term "sample" includes tissues, cells, whole blood, serum, plasma, etc., isolated from an individual, and may specifically be blood, but is limited to samples containing memory cells capable of producing interferon gamma. It doesn't work.
본 발명에서 제공하는 조성물 또는 의료기기는 생물학적 시료와 접촉시켜, 반응을 확인하여 생물학적 시료 내 코로나바이러스 존재 여부 또는 코로나바이러스 노출 여부를 확인하는 데 사용될 수 있다. 구체적으로는 시료 내 포함되어 있는 기억세포가 생성하는 인터페론 감마의 양을 측정함으로써 코로나바이러스 감염증 진단에 필요한 정보를 제공할 수 있다. 일 예로, 인터페론 감마의 양을 음성 대조군과 비교하여 결과를 판독할 수 있다.The composition or medical device provided in the present invention can be used to confirm the presence or absence of coronavirus in a biological sample or exposure to coronavirus by confirming a reaction by contacting a biological sample. Specifically, by measuring the amount of interferon gamma produced by memory cells included in the sample, information necessary for diagnosing coronavirus infection can be provided. In one example, the results can be read by comparing the amount of interferon gamma to a negative control.
본 발명에서 제공하는 조성물 또는 의료기기는 신속 정확하고 간편하게 코로나바이러스 또는 이의 변이형 감염을 확인하는 데 사용될 수 있다.The composition or medical device provided by the present invention can be used to quickly, accurately and simply identify coronavirus or its mutant infection.
이하 본 발명을 실시예 및 실험예를 통하여 보다 상세하게 설명한다. 그러나 이들 실시예 및 실험예는 본 발명을 예시적으로 설명하기 위한 것으로 본 발명의 범위가 이들 실시예 및 실험예에 한정되는 것은 아니다.Hereinafter, the present invention will be described in more detail through Examples and Experimental Examples. However, these Examples and Experimental Examples are intended to illustrate the present invention, and the scope of the present invention is not limited to these Examples and Experimental Examples.
제조예: 코로나바이러스 감염증 진단용 조성물의 제조Preparation Example: Preparation of a composition for diagnosing coronavirus infection
다음과 같이 SARS-CoV-2 검출을 위한 조성물을 구성하였다. 표 1의 O,X 는 각 품목에 있어서 표 2의 튜브 포함 여부를 나타낸다. A composition for detecting SARS-CoV-2 was constructed as follows. O, X in Table 1 indicates whether or not the tubes in Table 2 are included in each item.
실험예: 채혈 및 검체 배양Experimental Example: Blood collection and specimen culture
상기 제조예에서 제조한 튜브는 사용 전 15-30분간 상온(15-25℃)에 보관하였다. 정맥채혈(venipuncture)을 통해 피검자의 혈액을 각각의 튜브에 1ml씩 직접 수집하였다. 튜브에 혈액을 직접 주입하기 어려운 경우 헤파린이 포함된 채혈 튜브에 혈액을 수집하고 상온에 보관하되 16시간 이내에 각각의 튜브에 피펫을 이용해 1ml씩 주입하였다. The tube prepared in the above Preparation Example was stored at room temperature (15-25° C.) for 15-30 minutes before use. Through venipuncture, 1 ml of the subject's blood was directly collected into each tube. If it is difficult to directly inject blood into the tube, the blood was collected in a blood collection tube containing heparin and stored at room temperature, but 1 ml was injected into each tube using a pipette within 16 hours.
검체로는 PCR 검사에서 SARS-CoV-2 양성으로 확인된 COVID-19 감염 환자로부터 채취한 COVID-19 양성 혈액 시료와, 백신을 접종하지 않은 COVID-19 음성 환자로부터 채취한 COVID-19 음성 혈액 시료를 사용하였다.Specimens include a COVID-19 positive blood sample from a COVID-19 infected patient confirmed to be SARS-CoV-2 positive by a PCR test, and a COVID-19 negative blood sample from an unvaccinated COVID-19 negative patient. was used.
튜브에 혈액을 채우고 부드럽게 흔들어 튜브 안쪽 표면 전체가 혈액에 묻게 하여 튜브 벽에 있는 항원과 혼합이 잘 되도록 하였다. 검사 방법은 살아 있는 림프구를 필요로 하는 실험이므로 튜브를 과도하게 흔들어 혈구가 깨지지 않도록 주의하였다. 채혈된 혈액 튜브는 랙에 꽂아 수직으로 세워 16 내지 24시간 동안 37℃에서 배양하였다. 배양한 튜브를 원심분리하여 혈장을 채취한 후 ELISA를 이용하여 인터페론 감마의 양(IU/ml)을 측정하였다. 원심분리는 15분간, RCF 2200 내지 2300 xg로 수행하였다.The tube was filled with blood and gently shaken so that the entire inner surface of the tube was stained with blood so that the antigen and the antigen on the tube wall were well mixed. Since the test method requires live lymphocytes, care was taken not to break the blood cells by shaking the tube excessively. The collected blood tubes were placed in a rack, placed vertically, and incubated at 37° C. for 16 to 24 hours. After the culture tube was centrifuged to collect plasma, the amount of interferon gamma (IU/ml) was measured using ELISA. Centrifugation was performed at RCF 2200 to 2300 xg for 15 minutes.
실시예: 민감도 및 특이도 확인Example: Confirmation of sensitivity and specificity
제조예에서 제조한 코로나바이러스 감염증 진단용 조성물을 이용하여 0.25 IU/mL의 컷-오프 값에서 실험예에 기재한 것과 같이 실험을 수행하여 민감도 및 특이도를 확인하였다. 민감도는 감염자들을 대상으로 양성이 진단되는 비율이고, 특이도는 비감염자들을 대상으로 음성이 진단되는 비율이다. 정확도(accuracy) 는 음성을 음성으로, 양성을 양성으로 즉 감염자와 비감염자를 정확히 구별하는 능력을 나타낸 것으로 다음과 같이 계산할 수 있다. Total sample은 실험에 사용한 각 샘플의 수를 나타낸다. Using the composition for diagnosis of coronavirus infection prepared in Preparation Example, an experiment was performed as described in Experimental Example at a cut-off value of 0.25 IU/mL to confirm sensitivity and specificity. Sensitivity is the rate at which a positive diagnosis is made among infected people, and specificity is the rate at which a negative diagnosis is made among uninfected people. Accuracy indicates the ability to accurately distinguish negative from negative and positive from positive, i.e., the infected person and the non-infected person, and can be calculated as follows. Total sample represents the number of each sample used in the experiment.
참양성(True positive) 사례 수를 TP, 가양성 (False positive) 사례 수를 FP, 참음성(True negative) 사례 수를 TN, 위음성 (False negative) 사례 수를 FN이라고 하면 민감도와 특이도, 정확도는 다음과 같이 계산할 수 있다.Sensitivity, specificity, and accuracy can be calculated as:
민감도 = (TP)/(TP+FN), 특이도 = (TN)/(TN+FP), 정확도 = (TP+TN)/(TP+TN+FP+FN)Sensitivity = (TP)/(TP+FN), Specificity = (TN)/(TN+FP), Accuracy = (TP+TN)/(TP+TN+FP+FN)
양성 혈액 시료를 민감도(sensitivity) 측정에, 음성 혈액 시료를 특이도(specificity) 측정에 사용하였으며, 결과를 하기 표 3 및 표 4에 나타내었다. Covi-FERON 300+100은 Covi-FERON 300 및 Covi-FERON 100 제품을 함께 사용한 것임을 나타낸다.Positive blood samples were used for sensitivity measurement and negative blood samples for specificity measurement, and the results are shown in Tables 3 and 4 below. Covi-FERON 300+100 indicates a combination of Covi-FERON 300 and Covi-FERON 100 products.
실험결과 실시예에서 사용한 코로나바이러스 감염증 진단용 조성물 모두 94% 이상, 최대 100%의 민감도, 특이도를 보였고, 95% 이상 최대 100%의 정확도를 보이는 것을 확인하였다. 이를 통해 본원발명의 조성물이 높은 정확도로 코로나바이러스 감염증 진단에 사용될 수 있음을 알 수 있다. Experimental results It was confirmed that all the compositions for diagnosing coronavirus infection used in Examples showed sensitivity and specificity of 94% or more and up to 100%, and accuracy of 95% or more and up to 100%. Through this, it can be seen that the composition of the present invention can be used for diagnosing coronavirus infection with high accuracy.
이상의 설명으로부터, 본 발명이 속하는 기술분야의 당업자는 본 발명이 그 기술적 사상이나 필수적 특징을 변경하지 않고서 다른 구체적인 형태로 실시될 수 있다는 것을 이해할 수 있을 것이다. 이와 관련하여, 이상에서 기술한 실시예들은 모든 면에서 예시적인 것이며 한정적인 것이 아닌 것으로 이해해야만 한다. 본 발명의 범위는 상기 상세한 설명보다는 후술하는 특허 청구범위의 의미 및 범위 그리고 그 등가 개념으로부터 도출되는 모든 변경 또는 변형된 형태가 본 발명의 범위에 포함되는 것으로 해석되어야 한다.From the above description, those skilled in the art to which the present invention pertains will be able to understand that the present invention may be embodied in other specific forms without changing its technical spirit or essential features. In this regard, it should be understood that the embodiments described above are illustrative in all respects and not limiting. The scope of the present invention should be construed as including all changes or modifications derived from the meaning and scope of the claims to be described later and equivalent concepts rather than the detailed description above are included in the scope of the present invention.
COVID19 RBDCOVID19 RBD
VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAHHHHHH
COVID19 (VUI-2) RBDCOVID19 (VUI-2) RBD
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPCVKKH
(RAF4702)(RAF4702)
COVID19 (VUI-2) S1COVID-19 (VUI-2) S1
VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFANPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRGLPQGFSALEPLVDLPIGINITRFQTLLHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARHHHHHH
(RAU4704)(RAU4704)
Covi-FERON Delta variant SP antigenCovi-FERON Delta variant SP antigen
RVQPTESIVRFPNITNLCPFDEVFNATRFASVYAWNRKRISNCVADYSVLYNLAPFFTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGFNCYFPLRSYSFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLKGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSHHHHHH
Claims (14)
b) 변이형 코로나바이러스의 스파이크 단백질 (SP); 및
c) 원형(original) 코로나바이러스의 뉴클레오캡시드 단백질(NP) 중 1 이상을 포함하는
코로나바이러스 감염증 진단용 조성물.
a) the spike protein (SP) of the original coronavirus;
b) the spike protein (SP) of a variant coronavirus; and
c) one or more of the nucleocapsid proteins (NP) of the original coronavirus
A composition for diagnosing a coronavirus infection.
The composition for diagnosing coronavirus infection according to claim 1, wherein the mutant coronavirus is a beta mutant, delta mutant or omicron mutant coronavirus.
상기 a) 원형 코로나바이러스의 스파이크 단백질은 서열번호 1 및 2 중에서 선택되는 1 이상의 펩타이드를 포함하고;
상기 b) 변이형 코로나바이러스의 스파이크 단백질은, 베타 변이형의 경우 서열번호 3 및 4 중에서 선택되는 하나 이상의 펩타이드를 포함하고, 델타 변이형의 경우 서열번호 5의 펩타이드를 포함하고, 오미크론 변이형의 경우 서열번호 7의 펩타이드를 포함하며;
상기 c) 원형 코로나바이러스의 뉴클레오캡시드 단백질은 서열번호 6의 펩타이드를 포함하는,
코로나바이러스 감염증 진단용 조성물.
The method of claim 1 or 2, in the diagnostic composition,
Wherein a) the spike protein of the round coronavirus comprises one or more peptides selected from SEQ ID NOs: 1 and 2;
The b) spike protein of the mutant coronavirus includes one or more peptides selected from SEQ ID NOs: 3 and 4 in the case of the beta variant, and includes the peptide of SEQ ID NO: 5 in the case of the delta variant, and the omicron variant In the case of includes the peptide of SEQ ID NO: 7;
The c) nucleocapsid protein of the circular coronavirus comprises the peptide of SEQ ID NO: 6,
A composition for diagnosing a coronavirus infection.
(A) (i) 서열번호 1 및 서열번호 2의 펩타이드; 및 이와 분리된 상태의 (ii) 서열번호 3 및 서열번호 4의 펩타이드,
(B) (i) 서열번호 1 및 서열번호 2의 펩타이드; 이와 분리된 상태의 (ii) 서열번호 3 및 서열번호 4의 펩타이드; 및 이와 분리된 상태의 (iii) 서열번호 6의 펩타이드,
(C) 서열번호 1, 3, 5, 및 7의 펩타이드, 및
(D) (i) 서열번호 1, 3, 5, 및 7의 펩타이드; 및 이와 분리된 상태의 (ii) 서열번호 6의 펩타이드.
The composition for diagnosing coronavirus infection according to claim 1, wherein the composition comprises any one of the following (A) to (D):
(A) (i) the peptides of SEQ ID NO: 1 and SEQ ID NO: 2; and (ii) the peptides of SEQ ID NO: 3 and SEQ ID NO: 4, in isolation therefrom;
(B) (i) the peptides of SEQ ID NO: 1 and SEQ ID NO: 2; (ii) the peptides of SEQ ID NO: 3 and SEQ ID NO: 4 in an isolated state; and (iii) the peptide of SEQ ID NO: 6 in an isolated state,
(C) the peptides of SEQ ID NOs: 1, 3, 5, and 7, and
(D) (i) the peptides of SEQ ID NOs: 1, 3, 5, and 7; and (ii) the peptide of SEQ ID NO: 6 in an isolated state.
d) 상기 a) 내지 c)와 분리된 상태의 음성 대조 항원을 더 포함하는,
코로나바이러스 감염증 진단용 조성물.
The method of claim 1, wherein the diagnostic composition
d) further comprising a negative control antigen in a state of separation from a) to c),
A composition for diagnosing a coronavirus infection.
e) 상기 a) 내지 c)와 분리된 상태의 양성 대조 항원을 더 포함하는,
코로나바이러스 감염증 진단용 조성물.
The method of claim 1, wherein the diagnostic composition
e) further comprising a positive control antigen in a state of separation from a) to c),
A composition for diagnosing a coronavirus infection.
The composition for diagnosis of coronavirus infection according to claim 1, further comprising a component capable of detecting interferon-gamma.
The composition for diagnosis of coronavirus infection according to claim 1, further comprising a component used in enzyme-linked immunosorbent assay (ELISA).
The composition for diagnosing coronavirus infection according to claim 8, wherein the construct used in the enzyme-linked immunosorbent assay (ELISA) comprises a human interferon gamma monoclonal antibody.
The composition for diagnosing coronavirus according to any one of claims 1 to 9, wherein the coronavirus is SARS-CoV-2.
A medical device for diagnosing coronavirus infection comprising the composition of any one of claims 1 to 9.
(i) 서열번호 1 및 2 중에서 선택되는 1 이상의 펩타이드,
(ii) 서열번호 3 및 4 중에서 선택되는 1 이상의 펩타이드,
(iii) 서열번호 5의 펩타이드,
(iv) 서열번호 6의 펩타이드, 및
(v) 서열번호 7의 펩타이드 중 어느 하나 이상을 포함하고,
(vi) 음성 대조 항원을 포함하거나;
또는 상기 (i) 내지 (v) 및 (vi) 양성 대조 항원을 추가로 포함하는, 코로나바이러스 감염증 진단용 의료기기.
The method of claim 11, wherein the medical device
(i) one or more peptides selected from SEQ ID NOs: 1 and 2;
(ii) one or more peptides selected from SEQ ID NOs: 3 and 4;
(iii) the peptide of SEQ ID NO: 5;
(iv) the peptide of SEQ ID NO: 6, and
(v) contains any one or more of the peptides of SEQ ID NO: 7;
(vi) contains a negative control antigen;
Or a medical device for diagnosing coronavirus infection, further comprising the above (i) to (v) and (vi) positive control antigens.
The medical device for diagnosing coronavirus infection according to claim 11, further comprising a component capable of detecting interferon-gamma.
The medical device for diagnosing coronavirus infection according to claim 11, wherein the medical device is an ELISA kit.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR20210118448 | 2021-09-06 | ||
KR1020210118448 | 2021-09-06 |
Publications (1)
Publication Number | Publication Date |
---|---|
KR20230040277A true KR20230040277A (en) | 2023-03-22 |
Family
ID=86005750
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020220113081A KR20230040277A (en) | 2021-09-06 | 2022-09-06 | Composition for Coronavirus Infection Diagnosis |
Country Status (1)
Country | Link |
---|---|
KR (1) | KR20230040277A (en) |
-
2022
- 2022-09-06 KR KR1020220113081A patent/KR20230040277A/en not_active Application Discontinuation
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Zhang et al. | A serological survey on neutralizing antibody titer of SARS convalescent sera | |
US20100062420A1 (en) | Type I interferon-inducible proteins to detect viral infection | |
Kim et al. | Clinical evaluation of rapid diagnostic test kit for scrub typhus with improved performance | |
Yoon et al. | Comparison of a commercial H1N1 enzyme-linked immunosorbent assay and hemagglutination inhibition test in detecting serum antibody against swine influenza viruses | |
Wellinghausen et al. | Evaluation of the SARS-CoV-2-IgG response in outpatients by five commercial immunoassays | |
Moennig et al. | Classical swine fever | |
Best et al. | Laboratory diagnosis of rubella and congenital rubella | |
CN107144694B (en) | For detecting the antigen, kit and application of tuberculosis infection T cell | |
CN107219362A (en) | Antigen, kit and application for detecting tuberculosis infection T cell | |
EA030721B1 (en) | Method for determining the status of tuberculosis infection in an individual | |
CN107219363B (en) | For detecting the antigen, kit and application of tuberculosis infection T cell | |
US20200264193A1 (en) | Diagnostic markers for bovine tuberculosis and uses thereof | |
Bligh et al. | Serological analysis of the outcome of treatment of Schistosoma mansoni infections with praziquantel | |
Al-Rubayie et al. | Detection of border disease in ovine using ELISA in Iraq | |
KR20230040277A (en) | Composition for Coronavirus Infection Diagnosis | |
Vilibić-Čavlek et al. | Diagnosis of SARS-CoV-2 infection: preliminary results of six serology tests | |
Ferrari et al. | SARS-CoV-2 tests in occupational settings: what you look for is what you get | |
US9678071B2 (en) | Detecting latent tuberculosis infections | |
Rackova et al. | Borna disease virus circulating immunocomplex positivity and psychopathology in psychiatric patients in the Czech Republic | |
Kumagai et al. | Virus specific cell‐mediated immunity may play a role in controlling reactivated human herpesvirus 6B in patients under measles induced immunosuppression | |
Hussein | Correlation of CCL2, CCL5 and CXCL10 Chemokines with Disease Severity among Patients with COVID-19 Infection | |
Zhao et al. | Diagnostic value of using a combination of nucleic acid and specific antibody tests for SARS-CoV-2 in coronavirus disease 2019 | |
CN116102629B (en) | Mycobacterium tuberculosis T cell epitope polypeptide and application thereof | |
Fournier et al. | Predominant immunoglobulin A response to phase II antigen of Coxiella burnetii in acute Q fever | |
CN112444626B (en) | African swine fever virus antibody ELISA detection kit and preparation method thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
E902 | Notification of reason for refusal |