KR20220139705A - Composition for antigenicity comprising peptide from PRRSV - Google Patents

Abstract

The present invention relates to an immunogenic composition comprising an epitope peptide inducing T cell immunity of porcine reproductive and respiratory syndrome virus (PRRSV). The peptide of the present invention stimulates a peripheral blood mononuclear cell (PBMC) of a pig infected with a PRRSV to induce the expression of interferon-gamma and inhibit the proliferation of viruses in a target cell, thereby effectively blocking the PRRSV.

Description

Immunogenic composition comprising a peptide derived from PRRSV {Composition for antigenicity comprising peptide from PRRSV}

The present invention relates to an immunogenic composition comprising a PRRSV-derived peptide, and more particularly, to a composition comprising a T-cell immunity-inducing epitope peptide of porcine reproductive and respiratory syndrome virus (PRRSV).

The porcine reproductive and respiratory syndrome virus (PRRSV), which causes porcine reproductive and respiratory syndrome, is largely divided into North American type and European type, and there are numerous species due to severe mutation. In addition, secondary infection of other pathogens is easy to occur by destroying alveolar macrophages, causing interstitial pneumonia directly in the lungs, and acute infection in sows causes abortion with high fever. Pregnant pigs that do not cause abortion are infected with PRRSV through the placenta and the fetus dies.

The porcine reproductive and respiratory syndrome virus causes porcine genital and respiratory syndrome through the nasal cavity, muscle, oral cavity, uterus, and vagina of pigs. In general, pigs are more susceptible to parenteral infection than to oral infection. Types of PRRSV infection include indirect transmission, vertical transmission, persistent infection, within-farm transmission, and farm-to-farm transmission. Indirect transmission can occur through equipment, tools, clothing, water, food, insect vectors (mosquitoes, flies), airborne droplets, meat juice, etc. PRRSV is also detected in workers' work clothes, boots, and hands. Vertical transmission means that PRRSV is transmitted to the fetus through the placenta of sows at the end of pregnancy with viremia.

In addition, PRRSV causes chronic infection in pigs. The virus also replicates in susceptible cells of pigs that have not shown clinical signs for several months. This is the most important characteristic of PRRSV transmission, and it has been reported that infected sows can transmit the virus up to 99 days.

On the other hand, although many efforts have been made to develop a preventive method for about 20 years after the discovery of PRRSV, the cause of porcine reproductive and respiratory syndrome, an effective preventive method and management method have not yet been developed. Various vaccines, such as inactivated vaccines and live attenuated vaccines, have been developed for PRRSV control, but only attenuated vaccines with secured infectivity have been found to induce a satisfactory level of protective effect. However, since PRRSV is genetically very diverse, it is difficult to completely protect against PRRSV infection with only existing commercial vaccines due to the absence of cross-immunity between various viruses.

Korean Patent Registration No. 10-1933932 (2018.12.24.)

The present inventors completed the present invention by confirming that the novel peptide developed by the present inventors can effectively protect PRRSV by remarkably increasing T cell immunity while studying for effective prevention of porcine reproductive and respiratory syndrome.

Accordingly, an object of the present invention is to provide a porcine reproductive and respiratory syndrome virus immunogenic peptide comprising the peptide of SEQ ID NO: 1 or the peptide of SEQ ID NO: 2.

In addition, another object of the present invention is to provide an immunogenic composition comprising the peptide of SEQ ID NO: 1 or the peptide of SEQ ID NO: 2, a pharmaceutical composition or feed composition for preventing or treating porcine reproductive and respiratory syndrome.

In addition, another object of the present invention is to provide a method for preventing or treating porcine reproductive and respiratory syndrome comprising administering the peptide of SEQ ID NO: 1 or the peptide of SEQ ID NO: 2 to pigs.

The present invention provides a porcine reproductive and respiratory syndrome virus immunogenic peptide consisting of the peptide of SEQ ID NO: 1 or the peptide of SEQ ID NO: 2.

The present invention provides an immunogenic composition for porcine reproductive and respiratory syndrome virus comprising the peptide of SEQ ID NO: 1 or the peptide of SEQ ID NO: 2.

The present invention provides a pharmaceutical composition for preventing or treating porcine reproductive and respiratory syndrome comprising the peptide of SEQ ID NO: 1 or the peptide of SEQ ID NO: 2.

The present invention provides a feed composition for preventing or improving pig reproductive and respiratory syndrome comprising the peptide of SEQ ID NO: 1 or the peptide of SEQ ID NO: 2.

The present invention provides a method for preventing or treating porcine reproductive and respiratory syndrome comprising administering the peptide of SEQ ID NO: 1 or the peptide of SEQ ID NO: 2 to pigs.

The peptide of the present invention stimulates peripheral blood mononuclear cells (PBMC) of pigs infected with porcine reproductive and respiratory syndrome virus (PRRSV) to induce the expression of interferon gamma, and in the target cells. By suppressing the virus amplification, it can effectively defend against the swine reproductive and respiratory syndrome virus.

1 is a view confirming the IFN-γ inducing ability according to the peptide infection of Example 1 in pigs.
2 is a schematic diagram of the proliferation inhibitory ability analysis of PRRSV.
3 is a view confirming the virus proliferation inhibitory ability according to the infection of the peptide mixture of Example 1.
Figure 4 is a view confirming the virus proliferation inhibitory ability according to the individual infection of the peptide of Example 1.

The present invention provides a porcine reproductive and respiratory syndrome virus immunogenic peptide consisting of the peptide of SEQ ID NO: 1 or the peptide of SEQ ID NO: 2.

In the porcine reproductive and respiratory syndrome virus immunogenic peptide of the present invention, the peptide is preferably synthesized based on the domestic virus Type2 PRRSV domestic virus, and is a T cell epitope peptide that has significantly superior immunity inducing ability compared to peptides composed of other sequences. An epitope refers to a site on an antigen recognized by the immune system (eg, a site to which an antibody binds). Epitopes may be formed from contiguous or noncontiguous amino acids juxtaposed by tertiary folding of one or more proteins. An epitope typically comprises at least 3, more typically at least 5 or 8-10 amino acids in a unique spatial conformation.

The peptides of the invention represent polymeric forms of amino acids of any length, including coded or uncoded amino acids and chemically or biochemically modified or derivatized amino acids.

As used herein, the term “immunogenicity” refers to the innate ability of a molecule (eg, protein, nucleic acid, antigen, or organism) to elicit an immune response in a subject when administered to a subject. In this case, antigen is used in the present invention to refer to a substance that, when brought into contact with a subject (eg, present in or detected by a subject), elicits a detectable immune response from the subject.

The peptide of the present invention may be referred to as an antigenic peptide, which refers to a peptide that, when present in or detected by a subject, leads to mounting of an immune response in a subject.

In addition, the present invention provides an immunogenic composition for porcine reproductive and respiratory syndrome virus comprising the peptide of SEQ ID NO: 1 or the peptide of SEQ ID NO: 2. In this case, the immunogenic composition is preferably a vaccine or a vaccine composition.

According to an embodiment of the present invention, the peptide of SEQ ID NO: 1 or the peptide of SEQ ID NO: 2 can be used to effectively protect PRRSV by significantly increasing T-cell immunity when inoculated into pigs, and is useful as a vaccine or vaccine composition for PRRS prevention It was confirmed that it can be used.

The vaccine composition comprising the peptide of the present invention has superiority in that the manufacturing process and virus inoculation are convenient compared to a vaccine using an inactivated virus. PRRSV is cultured and used in MARC-145cell, but the virus titer is not high when obtained 4-5 days after virus infection. , 4H, 4 degrees) or a process of concentration using a membrane is required. Also, it was difficult to select a virus because the vaccine strain developed in the virus selection process had to match the domestic virus. On the other hand, if the porcine reproductive and respiratory syndrome virus immunogenic peptide of the present invention is used, it can be produced in E. coli or by inserting it into an expression vector or an infectious vector to produce a vaccine more easily, and a sufficient amount of Vaccines can be effectively manufactured. In addition, since the porcine reproductive and respiratory syndrome virus immunogenic peptide of the present invention is a combination made from a common sequence among the membrane sequences between Type 2 PRRSVs, there is an advantage in that PRRS protection between Type2s is possible.

The vaccine of the present invention further comprises a pharmaceutically acceptable carrier or diluent. Suitable carriers for vaccines are known to those skilled in the art and include, but are not limited to, proteins, sugars, and the like. Such carriers may be aqueous or non-aqueous solutions, suspensions, and emulsions. Examples of non-aqueous carriers include propylene glycol, polyethylene glycol, edible oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous carriers include water, alcohol/aqueous solutions, emulsions or suspensions, including saline and buffered media. Parenteral carriers include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's or fixed oils. Carriers for intravenous use include, for example, electrolyte supplements such as those based on Ringer's dextrose, liquid and nutritional supplements, and the like. In addition, preservatives and other additives such as antimicrobial agents, antioxidants, chelating agents, inert gases and the like may further be present. Preferred preservatives may include formalin, thimerosal, neomycin, polymyxin B and amphotericin B.

In addition, the vaccine composition may further comprise an adjuvant.

The adjuvant refers to a compound or mixture that enhances the immune response and/or promotes the rate of absorption after inoculation, and includes any absorption-promoting agent. Acceptable adjuvants include Freund's complete adjuvant, Freund's incomplete adjuvant, saponins, mineral gels such as aluminum hydroxide, surfactants, lysolecithin, pluronic polyols, polyanions, peptides, oils, hydrocarbon emulsions, keyhole limpet hemocy. Not, including, but not limited to, dinitrophenol and the like.

The vaccine may be one type of vaccine selected from the group consisting of a live vaccine, an attenuated vaccine, and a dead vaccine. The dosage of the vaccine composition for the purpose of the present invention is preferably 0.01 ml to 1 ml per 1 kg of body weight.

The vaccine composition of the present invention is preferably administered through one or more routes of administration selected from the group consisting of intramuscular, subcutaneous, intraperitoneal, intravenous, oral, dermal, eye and brain.

In the present invention, the immunogenic composition preferably induces the expression of interferon-gamma (INF-γ) in T cells, and has a higher porcine reproductive and respiratory syndrome virus (PRRSV) proliferation inhibitory ability than the inactivated vaccine. good night.

According to an embodiment of the present invention, when T cells isolated from pigs infected with PRRSV were stimulated with this peptide, the expression of INF-γ was induced, and the stimulated T cells inhibited the growth of the virus infected in the target. Confirmed.

On the other hand, the present invention provides a pharmaceutical composition for preventing or treating porcine reproductive and respiratory syndrome comprising the peptide of SEQ ID NO: 1 or the peptide of SEQ ID NO: 2.

As used herein, the term "prevention" refers to any action that suppresses or delays the onset of porcine reproductive and respiratory syndrome by administration of the pharmaceutical composition according to the present invention.

As used herein, the term "treatment" refers to any action in which the symptoms caused by porcine reproductive and respiratory syndrome are improved or advantageously changed by administration of the pharmaceutical composition according to the present invention.

The composition comprising the peptide of the present invention may contain one or more active ingredients exhibiting the same or similar function in addition to the ingredients. In addition, the pharmaceutical composition of the present invention may further include a pharmaceutically acceptable carrier in addition to the peptide of the present invention.

The type of carrier that can be used in the present invention is not particularly limited, and any carrier commonly used in the art may be used. Non-limiting examples of the carrier include saline, sterile water, Ringer's solution, buffered saline, albumin injection solution, lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, maltodextrin, glycerol, ethanol, and the like. can These may be used alone or in combination of two or more.

In addition, the pharmaceutical composition of the present invention may be used by adding other pharmaceutically acceptable additives such as excipients, diluents, antioxidants, buffers or bacteriostats, if necessary, and fillers, extenders, wetting agents, disintegrants, dispersants, surfactants, etc. , a binder or lubricant may be additionally added.

In the pharmaceutical composition of the present invention, the peptide of the present invention may be included in an amount of 0.00001% to 99.99% by weight based on the total weight of the pharmaceutical composition, preferably 0.1% to 90% by weight, more preferably It may be included in an amount of preferably 0.1% to 70% by weight, more preferably 0.1% to 50% by weight, but is not limited thereto and may be variously changed depending on the condition of the administration target, the degree of progression of the disease, and the like. If necessary, it may be included in the total amount of the pharmaceutical composition.

The pharmaceutical composition of the present invention may be formulated and used in various formulations suitable for oral or parenteral administration.

Non-limiting examples of formulations for oral administration using the pharmaceutical composition of the present invention include troches, lozenges, tablets, aqueous suspensions, oily suspensions, prepared powders, granules, emulsions, hard capsules, soft capsules, syrups or elixirs; and the like.

In order to formulate the pharmaceutical composition of the present invention for oral administration, a binder such as lactose, saccharose, sorbitol, mannitol, starch, amylopectin, cellulose or gelatin; excipients such as dicalcium phosphate and the like; disintegrants such as corn starch or sweet potato starch; Lubricating oils such as magnesium stearate, calcium stearate, sodium stearyl fumarate or polyethylene glycol wax may be used, and sweeteners, fragrances, syrups and the like may also be used. Furthermore, in the case of capsules, in addition to the above-mentioned substances, a liquid carrier such as fatty oil may be additionally used.

Non-limiting examples of parenteral preparations using the pharmaceutical composition of the present invention include injections, suppositories, powders for respiratory inhalation, aerosols for spraying, ointments, powders for application, oils, creams, and the like.

In order to formulate the pharmaceutical composition of the present invention for parenteral administration, sterile aqueous solutions, non-aqueous solvents, suspensions, emulsions, freeze-dried preparations, external preparations, etc. may be used, and the non-aqueous solvents and suspensions include propylene glycol, polyethylene Glycol, vegetable oils such as olive oil, injectable esters such as ethyl oleate, and the like can be used.

When the pharmaceutical composition of the present invention is formulated as an injection solution, the pharmaceutical composition of the present invention is mixed in water with a stabilizer or buffer to prepare a solution or suspension, and it is used for unit administration of an ampoule or vial. can be formulated.

When the pharmaceutical composition of the present invention is formulated as an aerosol, a propellant or the like may be blended with an additive so that the aqueous dispersion concentrate or wet powder is dispersed.

When the pharmaceutical composition of the present invention is formulated into an ointment, cream, powder for application, oil, external preparation for skin, etc., animal oil, vegetable oil, wax, paraffin, starch, tracanth, cellulose derivative, polyethylene glycol, silicone, bentonite , silica, talc, zinc oxide, etc. can be used as a carrier to be formulated.

The pharmaceutically effective amount and effective dosage of the pharmaceutical composition of the present invention may vary depending on the formulation method, administration method, administration time and/or route of administration of the pharmaceutical composition, and may vary depending on the reaction to be achieved by administration of the pharmaceutical composition. Several factors, including the type and extent, age, weight, general health status, symptoms or severity of disease, sex, diet, excretion, and components of drugs or other compositions used simultaneously or concurrently with the subject subject to administration and similar factors well known in the pharmaceutical field, and those of ordinary skill in the art can easily determine and prescribe an effective dosage for the desired treatment. For example, the daily dose of the pharmaceutical composition of the present invention is about 0.01 to 1,000 mg/kg, preferably 0.1 to 100 mg/kg, and may be administered once to several times a day.

On the other hand, the present invention provides a feed composition for preventing or improving pig reproductive and respiratory syndrome comprising the peptide of SEQ ID NO: 1 or the peptide of SEQ ID NO: 2.

The feed composition of the present invention may be prepared in the form of fermented feed, compound feed, pellet form, silage, etc., but is not limited thereto, and may be prepared by modifying it as necessary.

The feed composition of the present invention may include additional ingredients that are commonly used to improve odor, taste, vision, and the like. For example, vitamins A, C, D, E, B1, B2, B6, B12, niacin, biotin, folate, pantothenic acid, and the like may be included. In addition, it may include minerals such as zinc (Zn), iron (Fe), calcium (Ca), chromium (Cr), magnesium (Mg), manganese (Mn), copper (Cu). In addition, it may include amino acids such as lysine, tryptophan, cysteine, and valine. In addition, preservatives (potassium sorbate, sodium benzoate, salicylic acid, sodium dihydroacetate, etc.), disinfectants (bleaching powder and high bleaching powder, sodium hypochlorite, etc.), antioxidants (butylhydroxyanisole (BHA), butylhydroxytoluene (BHT) ), etc.), colorant (tar pigment, etc.), color developer (sodium nitrite, sodium nitrite, etc.), bleach (sodium sulfite), seasoning (MSG sodium glutamate, etc.), sweetener (dulcin, cyclimate, saccharin, sodium, etc.), Food additives such as flavorings (vanillin, lactones, etc.), expanding agents (alum, D-potassium hydrogen tartrate, etc.), strengthening agents, emulsifiers, thickeners (flavors), film agents, gum base agents, foam inhibitors, solvents, and improving agents can be added. The additive may be used in an appropriate amount.

In the feed composition of the present invention, the content of the peptide of the present invention is not particularly limited, and may be variously changed depending on the condition of the subject to be administered, the degree of progression of the disease, and the like.

On the other hand, the present invention provides a method for preventing or treating porcine reproductive and respiratory syndrome comprising the step of administering the peptide of SEQ ID NO: 1 or the peptide of SEQ ID NO: 2 to pigs.

As used herein, the term "administration" refers to introducing the peptide of the present invention to a pig by any suitable method, and the administration route of the composition of the present invention may be oral or parenteral as long as it can reach the target tissue. It can be administered through

As a parenteral administration method of the peptide of the present invention, intravenous administration, intraperitoneal administration, intramuscular administration, transdermal administration, or subcutaneous administration may be used, and methods of spraying or inhaling the peptide may also be used, but is not limited thereto. .

The administration of the peptide of the present invention may be administered once a day, or divided into several administrations. The peptides of the present invention may be administered as individual therapeutic agents or in combination with other therapeutic agents, and may be administered sequentially or simultaneously with conventional therapeutic agents. In consideration of all of the above factors, it can be administered in an amount that can obtain the maximum effect with a minimum amount without side effects, which can be easily determined by those skilled in the art.

The route and mode of administration of the peptide of the present invention may be independent of each other, and as long as the peptide can reach a desired target, any route and mode of administration may be followed without particular limitation.

The peptide of the present invention may be used in combination with various methods such as hormone treatment and drug treatment additionally to prevent, improve or treat porcine reproductive and respiratory syndrome.

Hereinafter, the content of the present invention will be described in more detail through the following Examples or Experimental Examples. However, the scope of the present invention is not limited only to the following examples and experimental examples, and includes modifications of technical ideas equivalent thereto.

[ Example 1: of the present invention peptide Selection]

In order to select peptides to protect against the porcine reproductive and respiratory syndrome virus, 10 types of T cell epitope peptides with 100% similar genetic homology were selected and synthesized based on the amino acid sequence of the membrane protein of the domestic virus Type2 PRRSV, and their spanning region The results of analyzing the information are shown in Table 1. The selected T cell epitope peptide consists of a sequence of 20 to 38 amino acids, and a comparative experiment was performed on these 10 types in the following experiment.

Peptides spanning region Peptides spanning region PS1 NSP1alpha PS6 GP5 PS2 NSP2 PS7 M PS3 NSP2 PS8 M PS4 GP4 PS9 M PS5 GP5 PS10 NSP1 alpha

[ Experimental example One: Example 1 of on peptides Confirmation of increased cellular immunity by

In order to analyze the IFN-γ inducing ability of the 10 peptides selected in Example 1 at all times, ELISpot (Enzyme linked immunospot) kit (MABTECH) was performed. A domestic isolate (Type 2 PRRS LMY, Accession No. GenBank accession no.DQ473474.1) (intramuscular inoculation: _{10 4.5 TCID 50} ^{/ ml} ) was infected into 3-week-old pigs (individual numbers #90, #93) and 5 After weeks, PBMCs obtained from pigs were used for cell immunity confirmation experiments. Prepare wells in a 96-well U form plate so that each PBMC of individual numbers #90 and #93 contains 1x10 ⁶ cells/well, and 10 μM/well of each of 10 peptides or inactivated LMY (PRRS LMY parent strain (Accession No. GenBank accession no.DQ473474.1, virus strain obtained by passage 7 in MARC-145 cells) 1x10 ⁶ /well, positive control PHA 0.5μg/well, negative control serum-free medium After adding each, PBMC and antigen were mixed and reacted using a pipette, transferred to a previously coated ELISA plate with capture mAb, and reacted for 21 hours at 5% CO ₂ , 37° C. After that, biotin-labeled anti- IFN-gamma primary antibody and streptavidin-HRP-labeled secondary antibody (these antibodies are all included in ELISpot kit (MABTECH)) are sequentially treated, and after TMB color development, spot forming unit (SFU) per 1x10 ⁶ cells ) was calculated.In this case, the SFU level indicates the IFN-γ expression level, and the IFN-γ secretion amount of each experimental group is shown in FIG.

As shown in FIG. 1 , the amount of IFN-γ secretion in PBMCs #90 and #93 was different depending on the peptide treatment group. In particular, it was confirmed that IFN-γ was secreted at an above average or similar level in the PS7 and PS8 treated groups compared to the inactivated LMY antigen-treated group, which is a positive control. It was confirmed that the value was low. These results show that not all membrane protein peptide sequence-based T cell epitope peptides exhibit an immunogenicity-inducing effect, and only peptides having a specific sequence effectively exhibit an immunogenicity-inducing effect. The sequence information of the PS7 and PS8 peptides showing the best effect is shown in Table 2 below.

peptide amino acid sequence (AA) SEQ ID NO: 1 PS7 LLAFSITYTPVMIYALKVSRGRLLGL 26 SEQ ID NO: 2 PS8 LWGVYSAIETWKFITSRCRLCLLGRKYILAPAHHVESA 38

[ Experimental example 2: Example 1 of of peptide virus propagation deterrent Confirm]

2.1 Example 1 of peptide Virus propagation in the mixed solution deterrent evaluation

PBMCs extracted 5 weeks after pig infection of a domestic isolate (LMY: Type 2 PRRS LMY, Accession No. GenBank accession no.DQ473474.1) were selected as a mixture of 10 peptides of Example 1 or inactivated antigen (heat inactivated LMY, no. DQ473474.1). Heat inactivated LMY, an inactivated antigen, is an antigen that was inactivated by heat treatment at 1x10 ⁷ /ml at 56°C for 30 minutes. The peptide mixture was prepared by mixing 10 kinds of selected peptides of Example 1 by 1 uM to make 10 uM of the mixture, and PBMCs were stimulated with the prepared peptide mixture. Serum-free medium was added to PBMC to establish a negative control group. After 7 days of stimulation, stimulated peripheral blood mononuclear cells, infectious PRRS virus (live LMY, 0.00005 moi) and target cells, monocyte-derived macrophages (MDM) were co-cultured for 4 days. Thereafter, the LMY virus proliferation inhibitory action was analyzed using real-time PCR, and the PCR results are shown in FIG. 2 and FIG.

As shown in FIG. 3 , it was confirmed that the mixed solution mixed with 10 peptides showed a higher level of inhibition of virus proliferation than the same heat-inactivated virus. Specifically, in the experimental group stimulated with the heat inactivated virus (HIV stimulation), 80.4% inhibitory ability was confirmed compared to the negative control group (PBMC non-stimulation), but it was confirmed that the peptide mixture of the present invention inhibited virus proliferation by 97%.

2.2 Example 1 of of peptide virus propagation deterrent evaluation

Through the above experiment, it was confirmed that the virus proliferation inhibitory ability in the peptide mixture was higher than that of the inactivated virus, and the amount of virus produced after inoculation was measured by TCID50 to determine whether individual peptides also have substantial virus proliferation inhibitory ability. did. Virus proliferation inhibitory ability was evaluated in the same manner as in the peptide mixture of Experimental Example 2.1, except that each peptide was stimulated with 10 uM, and the results are shown in FIG. 4 .

As shown in FIG. 4 , the virus proliferation inhibition rate of PS7 among the peptides of Example 1 was confirmed to be 98.1%, and the virus proliferation inhibition rate of PS8 was confirmed to be 99.6%, and a high level in the target cell, that is, a level similar to the inactivated virus. It was confirmed that it has the ability to inhibit virus proliferation. On the other hand, other peptides showed a weak level of virus inhibitory ability, confirming the results consistent with the IFN-γ secretion effect of Experimental Example 1.

Through the above results, it was confirmed that the peptides PS7 and PS8 had better PRRS virus proliferation inhibitory effect and excellent immune induction effect, and it was confirmed that these peptides can be used as vaccines by replacing inactivated virus.

<110> REPUBLIC OF KOREA (Animal and Plant Quarantine Agency) <120> Composition for antigenicity comprising peptide from PRRSV <130> 1-107P <160> 2 <170> KoPatentIn 3.0 <210> 1 <211> 26 <212> PRT <213> porcine reproductive and respiratory syndrome virus <400> 1 Leu Leu Ala Phe Ser Ile Thr Tyr Thr Pro Val Met Ile Tyr Ala Leu 1 5 10 15 Lys Val Ser Arg Gly Arg Leu Leu Gly Leu 20 25 <210> 2 <211> 38 <212> PRT <213> porcine reproductive and respiratory syndrome virus <400> 2 Leu Trp Gly Val Tyr Ser Ala Ile Glu Thr Trp Lys Phe Ile Thr Ser 1 5 10 15 Arg Cys Arg Leu Cys Leu Leu Gly Arg Lys Tyr Ile Leu Ala Pro Ala 20 25 30 His His Val Glu Ser Ala 35

Claims (7)

Pig reproductive and respiratory syndrome virus immunogenic peptide consisting of the peptide of SEQ ID NO: 1 or the peptide of SEQ ID NO: 2.
An immunogenic composition for porcine reproductive and respiratory syndrome virus comprising the peptide of SEQ ID NO: 1 or the peptide of SEQ ID NO: 2.
3. The method of claim 2,
The immunogenic composition comprises:
An immunogenic composition, characterized in that it is a vaccine or vaccine composition.
3. The method of claim 2,
The immunogenic composition comprises:
An immunogenic composition characterized in that it induces the expression of interferon-gamma (INF-γ) in T cells.
A pharmaceutical composition for preventing or treating porcine reproductive and respiratory syndrome comprising the peptide of SEQ ID NO: 1 or the peptide of SEQ ID NO: 2.
A feed composition for preventing or improving pig reproductive and respiratory syndrome comprising the peptide of SEQ ID NO: 1 or the peptide of SEQ ID NO: 2.
A method for preventing or treating porcine reproductive and respiratory syndrome, comprising the step of administering the peptide of SEQ ID NO: 1 or the peptide of SEQ ID NO: 2 to the pig.

Images