KR20220073454A - Novel long-acting protein conjugates for brain targeting and a preparation method thereof - Google Patents

Novel long-acting protein conjugates for brain targeting and a preparation method thereof Download PDF

Info

Publication number
KR20220073454A
KR20220073454A KR1020200161534A KR20200161534A KR20220073454A KR 20220073454 A KR20220073454 A KR 20220073454A KR 1020200161534 A KR1020200161534 A KR 1020200161534A KR 20200161534 A KR20200161534 A KR 20200161534A KR 20220073454 A KR20220073454 A KR 20220073454A
Authority
KR
South Korea
Prior art keywords
brain
leu
interleukin
pro
receptor
Prior art date
Application number
KR1020200161534A
Other languages
Korean (ko)
Inventor
최재혁
오의림
허용호
김진영
Original Assignee
한미약품 주식회사
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 한미약품 주식회사 filed Critical 한미약품 주식회사
Priority to KR1020200161534A priority Critical patent/KR20220073454A/en
Priority to PCT/KR2021/017597 priority patent/WO2022114838A1/en
Publication of KR20220073454A publication Critical patent/KR20220073454A/en

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/65—Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y301/00—Hydrolases acting on ester bonds (3.1)
    • C12Y301/06—Sulfuric ester hydrolases (3.1.6)
    • C12Y301/06013—Iduronate-2-sulfatase (3.1.6.13)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Abstract

본 발명은 신규한 뇌 표적 가능한 지속형 단백질 결합체 및 이의 제조 방법에 관한 것이다.The present invention relates to a novel brain-targetable long-acting protein conjugate and a method for preparing the same.

Description

신규한 뇌 표적 지속형 단백질 결합체 및 이의 제조방법 {Novel long-acting protein conjugates for brain targeting and a preparation method thereof}Novel long-acting protein conjugates for brain targeting and a preparation method thereof {Novel long-acting protein conjugates for brain targeting and a preparation method thereof}

본 발명은 신규한 뇌 표적 가능한 지속형 단백질 결합체 및 이의 제조 방법에 관한 것이다.The present invention relates to a novel brain-targetable long-acting protein conjugate and a method for preparing the same.

뇌로의 효과적인 치료 약제 전달의 필요성이 대두되고 있으나, 뇌에 대한 새로운 약제의 개발은 나머지 신체에 비하여 훨씬 느린 속도로 진행되고 있다. 이러한 느린 진행은 대부분의 약제가 뇌혈관 장벽(blood-brain barrier, BBB)을 형성하는 뇌 모세관 벽(brain capillary wall)을 통하여 뇌 내로 침투할 수 없는 상황에 상당 부분 기인한다. 뇌혈관 장벽(blood-brain barrier, BBB)이란 뇌혈관의 내피세포 간의 조밀한 연결(tight junction) 및 이를 더욱 강화하는 성상세포(astrocyte)로 이루어진 구조물로서, 혈관 내부의 물질이 혈관벽을 통과하여 뇌 실질 내로 쉽게 나오지 않게 해 주는 기능을 한다. 이런 이유로 뇌질환 치료제로 개발된 상당수의 약이 뇌혈관 장벽의 통과가 잘 이루어지지 않는 문제점을 갖고 있다. 거의 100%의 거대-분자 약제 및 98% 이상의 소형-분자 약제는 BBB를 통과하지 못한다. 극히 일부의 약제, 높은 지질 용해도 및 400-500 달톤(dalton) 이하의 분자량을 보유하는 소형 분자만이 BBB를 실제로 통과한다. 또한, BBB를 통과하는 소형 분자 중에서, 극히 일부만 약학적으로 유의한 양으로 BBB를 통과한다.Although the need for effective therapeutic drug delivery to the brain is emerging, the development of new drugs for the brain is progressing at a much slower rate compared to the rest of the body. This slow progression is largely due to a situation in which most drugs cannot penetrate into the brain through the brain capillary wall forming the blood-brain barrier (BBB). The blood-brain barrier (BBB) is a structure composed of a tight junction between endothelial cells of the brain blood vessels and astrocytes that further strengthen it. It functions to prevent it from coming out easily into the substance. For this reason, many of the drugs developed for the treatment of brain diseases have a problem in that they do not pass through the blood-brain barrier well. Nearly 100% of macro-molecular drugs and more than 98% of small-molecule drugs do not cross the BBB. Very few drugs, high lipid solubility and small molecules with a molecular weight of 400-500 daltons or less actually cross the BBB. In addition, of the small molecules that cross the BBB, only a small fraction of them cross the BBB in a pharmaceutically significant amount.

소수의 뇌 질환, 예를 들면, 우울증, 정동 장애, 만성 통증, 간질만이 BBB를 통과하는 소형 분자 약제에 반응한다. 훨씬 많은 뇌 질환, 예를 들면, 알츠하이머병, 뇌졸중/신경보호, 뇌와 척수 손상, 뇌암, 뇌의 HIV 감염, 다양한 실조증-유발 장애(ataxia-producing disorder), 근위축성 측삭경화증(amyotrophic lateral sclerosis,ALS), 헌팅턴병(Huntington disease), 뇌에 영향을 주는 유년기 선천성 유전자 오류(childhood inborn genetic error), 파킨슨병(Parkinson's disease), 다발성 경화증(multiple sclerosis), 리소좀 축적 질환 등은 통상적인 지질-용해성 소형 분자량 약제에 반응하지 않는다.Only a few brain disorders, such as depression, affective disorders, chronic pain, and epilepsy, respond to small molecule drugs that cross the BBB. much more brain diseases, such as Alzheimer's disease, stroke/neuroprotection, brain and spinal cord injuries, brain cancer, HIV infection of the brain, various ataxia-producing disorders, amyotrophic lateral sclerosis, ALS), Huntington disease, childhood inborn genetic error affecting the brain, Parkinson's disease, multiple sclerosis, lysosomal storage disease, etc. are common lipid-soluble small Does not respond to molecular weight agents.

현재 뇌혈관 장벽을 통과하여 약물 등을 전달해 줄 수 있는 전달 체(carrier)에 대한 개발이 활발하게 진행 중이다. 한편, 특정한 아미노산 서열을 갖는 펩타이드는 뇌혈관 장벽을 통과하며 약물이나 siRNA 등을 전달하는 기능을 갖고 있다고 알려져 있으나, 여전히 특정 구조체의 크기가 큰 생리활성 물질의 전달 가능성이 있는지에 대한 연구는 미비한 상태이다(Kumar et al., Nature. 2007, 448:39-43). 또한, 효과적인 소형 분자 약제가 존재하는 극소수의 뇌 질환에 대해서도 새롭고 향상된 약제에 관한 개발과 연구가 더욱 필요하다.Currently, the development of a carrier that can pass through the blood-brain barrier to deliver drugs, etc. is actively in progress. On the other hand, peptides having a specific amino acid sequence are known to have a function of passing drugs or siRNA through the blood-brain barrier, but research on whether there is a possibility of delivering a physiologically active substance with a large size of a specific structure is still insufficient. Ida (Kumar et al . al ., Nature. 2007, 448:39-43). In addition, there is a need for further development and research on new and improved drugs for very few brain diseases for which effective small molecule drugs exist.

본 발명의 하나의 목적은 뇌 표적 지속형 단백질 결합체를 제공하는 것이다. One object of the present invention is to provide a brain-targeting long-acting protein conjugate.

본 발명의 다른 목적은 상기 뇌 표적 지속형 단백질 결합체를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 발현 벡터, 및 상기 발현 벡터를 포함하는 형질전환체를 제공하는 것이다.Another object of the present invention is to provide a polynucleotide encoding the brain-targeting long-acting protein conjugate, an expression vector comprising the polynucleotide, and a transformant comprising the expression vector.

본 발명의 또 다른 목적은 상기 뇌 표적 지속형 단백질 결합체의 제조 방법을 제공하는 것이다. Another object of the present invention is to provide a method for producing the brain-targeting long-acting protein conjugate.

본 발명의 또 다른 목적은 상기 뇌 표적 지속형 단백질 결합체를 포함하는 조성물을 제공하는 것이다. Another object of the present invention is to provide a composition comprising the brain-targeting long-acting protein conjugate.

본 발명의 또 다른 목적은 약제의 제조에 있어 상기 뇌 표적 지속형 단백질 결합체의 용도를 제공하는 것이다.Another object of the present invention is to provide a use of the brain-targeting long-acting protein conjugate in the manufacture of a medicament.

본 발명을 구현하는 하나의 양태는 뇌 표적 지속형 단백질 결합체이다.One aspect embodying the present invention is a brain-targeting long-acting protein conjugate.

하나의 구체예에서, 본 발명은 하기 화학식 1로 표시되는 뇌 표적 지속형 결합체에 관한 것이다:In one embodiment, the present invention relates to a brain-targeting long-acting conjugate represented by the following formula (1):

[화학식 1][Formula 1]

X-L1-F1 : Y-L2-F2XL 1 -F1 : YL 2 -F2

여기에서,From here,

X 및 Y는 각각 독립적으로 생리활성 물질 또는 뇌 표적 펩타이드로, X 및 Y 중 하나가 생리활성 물질이면 다른 하나는 뇌 표적 펩타이드이고; X and Y are each independently a physiologically active substance or a brain-targeting peptide, and if one of X and Y is a physiologically active substance, the other is a brain-targeting peptide;

L1 및 L2는 각각 독립적으로 펩타이드성 링커 또는 비펩타이드성 링커이고,L 1 and L 2 are each independently a peptidic linker or a non-peptidyl linker,

L1 및 L2중 어느 하나 또는 이들 둘 다가 펩타이드성 링커일 때, 상기 펩타이드성 링커는 0개부터 1000개의 아미노산을 포함하고;when either or both of L 1 and L 2 are peptidic linkers, the peptidic linker comprises 0 to 1000 amino acids;

:는 X-L1-F1 및 Y-L2-F2 간의 화학결합이며;: is a chemical bond between XL 1 -F1 and YL 2 -F2;

F1 및 F2는 각각 독립적으로 면역글로불린 불변 영역을 포함하며, FcRn 결합부위를 포함하는 물질임.F1 and F2 each independently include an immunoglobulin constant region, and is a substance comprising an FcRn binding site.

앞선 구체예에 따른 뇌 표적 지속형 결합체에서, 상기 F1과 F2의 면역글로불린 불변 영역은 면역글로불린 CH1, CH2, CH3, 및 CH4 도메인으로 이루어진 군으로부터 선택된 1개 내지 4개의 도메인을 포함하는 것을 특징으로 한다.In the brain-targeting long-acting conjugate according to the preceding embodiment, the immunoglobulin constant regions of F1 and F2 include 1 to 4 domains selected from the group consisting of immunoglobulin CH1, CH2, CH3, and CH4 domains. do.

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, 상기 면역글로불린 불변 영역은 힌지 영역을 포함하는 것을 특징으로 한다.In the brain-targeted long-acting conjugate according to any one of the preceding embodiments, the immunoglobulin constant region comprises a hinge region.

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, 상기 F1의 면역글로불린 불변 영역 및 F2의 면역글로불린 불변 영역 각각은 힌지 영역, CH2 도메인 및 CH3 도메인을 포함하는 것을 특징으로 한다.In the brain-targeted long-acting conjugate according to any one of the preceding embodiments, each of the immunoglobulin constant region of F1 and the immunoglobulin constant region of F2 comprises a hinge region, a CH2 domain and a CH3 domain.

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, 상기 면역글로불린 불변 영역은 면역글로불린 Fc 영역인 것을 특징으로 한다.In the brain-targeting long-acting conjugate according to any one of the preceding embodiments, the immunoglobulin constant region is an immunoglobulin Fc region.

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, 상기 면역글로불린 불변 영역은 IgG 유래인 것을 특징으로 한다.In the brain-targeting long-acting conjugate according to any one of the preceding embodiments, the immunoglobulin constant region is characterized in that it is derived from IgG.

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, 상기 IgG는 IgG1, IgG2, IgG3, 및 IgG4로 이루어진 군에서 선택되는 것을 특징으로 한다.In the brain-targeting long-acting conjugate according to any one of the preceding embodiments, the IgG is selected from the group consisting of IgG1, IgG2, IgG3, and IgG4.

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, 상기 면역글로불린 불변 영역은 IgG1 또는 IgG4 유래인 것을 특징으로 한다.In the brain-targeting long-acting conjugate according to any one of the preceding embodiments, the immunoglobulin constant region is characterized in that it is derived from IgG1 or IgG4.

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, 상기 면역글로불린 불변 영역은 비당쇄화되고, 인간 IgG1 또는 IgG4 Fc 영역 유래의 아미노산 서열을 가지는 것을 특징으로 한다.In the brain-targeting long-acting conjugate according to any one of the preceding embodiments, the immunoglobulin constant region is non-glycosylated and has an amino acid sequence derived from a human IgG1 or IgG4 Fc region.

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, 상기 F1은 IgG1의 힌지 영역, CH2 도메인, 및 CH3 도메인을 포함하고, 여기서 CH3 도메인은 야생형 IgG1의 CH3 도메인의 아미노산 서열에서 26번 아미노산인 트레오닌(Thr)의 류신(Leu)으로의 치환 및 59번 아미노산인 아스파르트산 (Asp)의 아르기닌(Arg)으로의 치환을 포함하며; The brain target long-acting conjugate according to any one of the preceding embodiments, wherein the F1 comprises a hinge region, a CH2 domain, and a CH3 domain of IgG1, wherein the CH3 domain is amino acid 26 in the amino acid sequence of the CH3 domain of wild-type IgG1 substitution of threonine (Thr) with leucine (Leu) and substitution of amino acid 59 aspartic acid (Asp) with arginine (Arg);

상기 F2는 IgG1의 힌지 영역, CH2 도메인 및 CH3 도메인을 포함하고, 상기 CH3 도메인은 야생형 IgG1의 CH3 도메인의 아미노산 서열에서 11번 아미노산인 류신(Leu)의 글루탐산(Glu)으로의 치환, 67번 아미노산인 티로신(Tyr)의 류신(Leu)으로의 치환, 및 69번 아미노산인 라이신(Lys)의 발린(Val)으로의 치환을 포함하는 것을 특징으로 한다.The F2 includes a hinge region, a CH2 domain and a CH3 domain of IgG1, wherein the CH3 domain is amino acid 11 in the amino acid sequence of the CH3 domain of wild-type IgG1, leucine (Leu) is substituted with glutamic acid (Glu), amino acid 67 It is characterized in that it includes a substitution of tyrosine (Tyr) with leucine (Leu), and substitution of lysine (Lys) at amino acid position 69 with valine (Val).

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, 상기 지속형 결합체는 뇌 혈관 장벽을 통과하여, 뇌 조직 내로 생리 활성 물질을 전달하는 것을 특징으로 한다.In the brain-targeting long-acting conjugate according to any one of the preceding embodiments, the long-acting conjugate is characterized in that it passes the blood-brain barrier and delivers a physiologically active substance into the brain tissue.

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, 상기 뇌 표적 펩타이드는 뇌 혈관 장벽을 통과할 수 있는 아미노산 서열을 포함하는 펩타이드, 단백질, 또는 항체의 형태인 것을 특징으로 한다.In the brain-targeting long-acting conjugate according to any one of the preceding embodiments, the brain-targeting peptide is characterized in that it is in the form of a peptide, protein, or antibody comprising an amino acid sequence that can cross the blood-brain barrier.

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, 상기 뇌 표적 펩타이드는 수동전달(passive transport)에 의한 경로 또는 수용체 매개 전달(receptor-mediated transport)에 의한 경로를 통해 뇌 혈관 장벽을 통과하는 것을 특징으로 한다.In the brain-targeting long-acting conjugate according to any one of the preceding embodiments, the brain-targeting peptide passes through the blood-brain barrier through a pathway by passive transport or a pathway by receptor-mediated transport. characterized in that

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, 인슐린 수용체(insulin receptor), 트랜스페린 수용체(transferrin receptor), 저밀도 지질단백질 수용체(low density lipoprotein receptor), 저밀도 지질단백질 수용체 관련 단백질(Low density lipoprotein receptor-related protein), 렙틴 수용체(leptin receptor), 니코틴성 아세틸콜린 수용체(nicotinic acetylcholine receptor), 글루타티온 수송체(Glutathione transporter), 칼슘의존성 칼륨통로(calcium-activated potassium channel), 및 RAGE (receptor for advanced glycation endproducts), 및 상기 수용체들의 리간드 및 상기 수용체 또는 리간드에 결합하는 항체로 이루어진 군으로부터 선택된 어느 하나를 통하여 수용체 매개 전달 경로에 의해 뇌 혈관 장벽을 통과하는 것을 특징으로 한다.In the brain-targeting long-acting conjugate according to any one of the preceding embodiments, an insulin receptor, a transferrin receptor, a low density lipoprotein receptor, a low density lipoprotein receptor-related protein (Low density lipoprotein) receptor-related protein, leptin receptor, nicotinic acetylcholine receptor, glutathione transporter, calcium-activated potassium channel, and RAGE (receptor for advanced) glycation endproducts), and it is characterized in that it crosses the blood-brain barrier by a receptor-mediated transduction pathway through any one selected from the group consisting of a ligand of the receptors and an antibody binding to the receptor or ligand.

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, 상기 생리활성 물질은 톡신; 또는 GLP-1(Glucagon like peptide-1) 수용체 아고니스트; 글루카곤 수용체 아고니스트; GIP(Gastric inhibitory polypeptide) 수용체 아고니스트; FGF(Fibroblast growth factor) 수용체 아고니스트; 콜레키스토키닌 (Cholecystokinin) 수용체 아고니스트; 가스트린(gastrin) 수용체 아고니스트; 멜라노코르틴(melanocortin) 수용체 아고니스트; 인간 성장호르몬; 성장호르몬 방출 호르몬; 성장호르몬 방출 펩타이드; 인터페론; 인터페론 수용체; 콜로니 자극인자 (과립구 콜로니 자극인자); 인터루킨; 인터루킨 수용체; 효소; 인터루킨 결합 단백질; 사이토카인 결합 단백질; 마크로파지 활성인자; 마크로파지 펩타이드; B 세포인자; T 세포인자; 단백질 A; 알러지 억제인자; 세포 괴사 당단백질; 면역독소; 림포독소; 종양 괴사인자; 종양 억제인자; 전이 성장인자; 알파-1 안티트립신; 알부민; 알파-락트알부민(alpha-lactalbumin); 아포리포 단백질-E; 적혈구 생성 인자; 고 당쇄화 적혈구 생성인자; 안지오포이에틴(angiopoietin); 헤모글로빈; 트롬빈(thrombin); 트롬빈 수용체 활성 펩타이드; 트롬보모듈린(thrombomodulin); 혈액인자 VII; 혈액인자 VIIa; 혈액인자 VIII; 혈액인자 IX; 혈액인자 XIII; 플라즈미노겐 활성인자; 피브린-결합 펩타이드; 유로키나제; 스트렙토키나제; 히루딘(hirudin); 단백질 C; C-반응성 단백질; 레닌 억제제; 콜라게나제 억제제; 수퍼옥사이드 디스뮤타제; 렙틴; 혈소판 유래 성장인자; 상피세포 성장인자; 표피세포 성장인자; 안지오스타틴(angiostatin); 안지오텐신(angiotensin); 골 형성 성장인자; 골 형성 촉진 단백질; 칼시토닌; 인슐린; 아트리오펩틴; 연골 유도인자; 엘카토닌(elcatonin); 결합조직 활성인자; 조직인자 경로 억제제(tissue factor pathway inhibitor); 여포 자극 호르몬; 황체 형성 호르몬; 황체 형성 호르몬 방출 호르몬; 신경 성장인자류; 악소제네시스 인자-1(axogenesis factor-1); 뇌-나트륨 이뇨 펩타이드(brain-natriuretic peptide); 신경교 유래 신경영양인자(glial derived neurotrophic factor); 네트린(netrin); 중성구 억제인자(neurophil inhibitor factor); 신경영양인자; 뉴트린(neuturin); 부갑상선 호르몬; 릴랙신; 시크레틴; 소마토메딘; 인슐린 유사 성장인자; 부신피질 호르몬; 글루카곤; 콜레시스토키닌; 췌장 폴리펩타이드; 가스트린 방출 펩타이드; 코티코트로핀 방출인자; 갑상선 자극호르몬; 오토탁신(autotaxin); 락토페린(lactoferrin); 미오스타틴(myostatin); ADNP(activity-dependent neuroprotective protein), BACE1(beta-secretase1), APP(Amyloid Precursor Protein), NCAM(Neural cell adhesion molecule), 아밀로이드 베타(Amyloid beta), 타우(Tau), RAGE(receptor for advanced glycation endproducts), 알파-시누클레인(alpha-synuclein), 또는 이들의 아고니스트 또는 안타고니스트; 수용체류, 수용체 아고니스트; 세포표면항원; 단일클론 항체; 다중클론 항체; 항체 단편; 바이러스 유래 백신 항원; 하나 이상의 수용체 아고니스트를 활성화 시키는 하이브리드 폴리펩타이드 또는 키메릭 (chimeric) 폴리펩타이드; 및 이들의 아날로그를 포함하는 군으로 이루어진 군에서 선택된 생리활성 물질인 것을 특징으로 한다.In the brain-targeting long-acting conjugate according to any one of the preceding embodiments, the physiologically active substance is a toxin; or a GLP-1 (Glucagon like peptide-1) receptor agonist; glucagon receptor agonists; Gastric inhibitory polypeptide (GIP) receptor agonists; Fibroblast growth factor (FGF) receptor agonists; Cholecystokinin receptor agonist; gastrin receptor agonists; melanocortin receptor agonists; human growth hormone; growth hormone releasing hormone; growth hormone releasing peptide; interferon; interferon receptor; colony stimulator (granulocyte colony stimulator); interleukin; interleukin receptor; enzyme; interleukin binding protein; cytokine binding protein; macrophage activator; macrophage peptides; B cell factor; T cell factor; protein A; allergy suppressors; cell necrosis glycoprotein; immunotoxins; lymphotoxin; tumor necrosis factor; tumor suppressors; metastatic growth factor; alpha-1 antitrypsin; albumin; alpha-lactalbumin; apolipoprotein-E; erythropoietin; high glycosylated erythropoietin; angiopoietin; hemoglobin; thrombin; thrombin receptor activating peptide; thrombomodulin; blood factor VII; blood factor VIIa; blood factor VIII; blood factor IX; blood factor XIII; plasminogen activator; fibrin-binding peptide; urokinase; streptokinase; hirudin; protein C; C-reactive protein; renin inhibitors; collagenase inhibitors; superoxide dismutase; leptin; platelet-derived growth factor; epidermal growth factor; epidermal growth factor; angiostatin; angiotensin; osteogenic growth factor; bone formation promoting protein; calcitonin; insulin; atriopeptin; cartilage inducer; elcatonin; connective tissue activator; tissue factor pathway inhibitors; follicle stimulating hormone; luteinizing hormone; luteinizing hormone releasing hormone; nerve growth factors; axogenesis factor-1; brain-natriuretic peptide; glial derived neurotrophic factor; netrin; neutrophil inhibitor factor; neurotrophic factor; nutrin; parathyroid hormone; relaxin; secretin; somatomedin; insulin-like growth factor; adrenocortical hormone; glucagon; cholecystokinin; pancreatic polypeptide; gastrin releasing peptide; corticotropin releasing factor; thyroid stimulating hormone; autotaxin; lactoferrin; myostatin; ADNP (activity-dependent neuroprotective protein), BACE1 (beta-secretase1), APP (Amyloid Precursor Protein), NCAM (Neural cell adhesion molecule), Amyloid beta, Tau, RAGE (receptor for advanced glycation endproducts) ), alpha-synuclein, or an agonist or antagonist thereof; receptor class, receptor agonist; cell surface antigen; monoclonal antibody; polyclonal antibodies; antibody fragments; virus-derived vaccine antigens; hybrid polypeptides or chimeric polypeptides that activate one or more receptor agonists; And it is characterized in that it is a bioactive substance selected from the group consisting of analogs thereof.

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, In the brain target long-acting conjugate according to any one of the preceding embodiments,

상기 톡신은 메이탄신(Maytansine) 또는 이의 유도체, 오리스타틴 (Auristatin) 또는 이의 유도체, 듀오카마이신(Duocarmycin) 또는 이의 유도체, 및 PBD(Pyrrolobenzodiazepine) 또는 이의 유도체로 이루어진 군에서 선택되고,The toxin is selected from the group consisting of maytansine or a derivative thereof, auristatin or a derivative thereof, duocarmycin or a derivative thereof, and Pyrrolobenzodiazepine (PBD) or a derivative thereof,

GLP-1(Glucagon like peptide-1) 수용체 아고니스트는 천연형 엑센딘-3 또는 천연형 엑센딘-4, 및 이들의 아날로그로 이루어진 군에서 선택된 것이며, GLP-1 (Glucagon like peptide-1) receptor agonist is selected from the group consisting of native exendin-3 or native exendin-4, and analogs thereof,

FGF 수용체 아고니스트는 FGF1 또는 이의 아날로그, FGF19 또는 이의 아날로그, FGF21 또는 이의 아날로그, 및 FGF23 또는 이의 아날로그로 이루어진 군에서 선택되고,The FGF receptor agonist is selected from the group consisting of FGF1 or an analog thereof, FGF19 or an analog thereof, FGF21 or an analog thereof, and FGF23 or an analog thereof,

인터페론은 인터페론-알파, 인터페론-베타 및 인터페론-감마로 이루어진 군에서 선택되고,the interferon is selected from the group consisting of interferon-alpha, interferon-beta and interferon-gamma;

인터페론 수용체는 인터페론-알파 수용체, 인터페론-베타 수용체, 인터페론-감마 수용체, 및 수용성 타입 I 인터페론 수용체로 이루어진 군에서 선택되고,the interferon receptor is selected from the group consisting of an interferon-alpha receptor, an interferon-beta receptor, an interferon-gamma receptor, and a soluble type I interferon receptor,

인터루킨은 인터루킨-1, 인터루킨-2, 인터루킨-3, 인터루킨-4, 인터루킨-5, 인터루킨-6, 인터루킨-7, 인터루킨-8, 인터루킨-9, 인터루킨-10, 인터루킨-11, 인터루킨-12, 인터루킨-13, 인터루킨-14, 인터루킨-15, 인터루킨-16, 인터루킨-17, 인터루킨-18, 인터루킨-19, 인터루킨-20, 인터루킨-21, 인터루킨-22, 인터루킨-23, 인터루킨-24, 인터루킨-25, 인터루킨-26, 인터루킨-27, 인터루킨-28, 인터루킨-29, 및 인터루킨-30으로 이루어진 군에서 선택되고,Interleukin is interleukin-1, interleukin-2, interleukin-3, interleukin-4, interleukin-5, interleukin-6, interleukin-7, interleukin-8, interleukin-9, interleukin-10, interleukin-11, interleukin-12, Interleukin-13, Interleukin-14, Interleukin-15, Interleukin-16, Interleukin-17, Interleukin-18, Interleukin-19, Interleukin-20, Interleukin-21, Interleukin-22, Interleukin-23, Interleukin-24, Interleukin- 25, interleukin-26, interleukin-27, interleukin-28, interleukin-29, and interleukin-30;

인터루킨 수용체는 인터루킨- 1 수용체 또는 인터루킨-4 수용체이고,the interleukin receptor is an interleukin-1 receptor or an interleukin-4 receptor,

효소는 베타글루코시다제(beta-glucosidase), 알파갈락토시다제(alpha-galactosidase), 베타갈락토시다제(beta-galactosidase), 이두로니다제(iduronidase), 이두로네이트 2-설파타제(iduronate-2-sulfatase), 갈락토스-6-설파타제(Galactose-6-sulfatase), 산성 알파-글루코시다제(acid alpha-glucosidase), 산성 세라미다제(acid ceramidase), 산성 스핑고미엘리나제(acid sphingomyelinsase), 갈락토세레브로시다제(galactocerebrosidsase), 아릴설파타제(arylsulfatase) A, 아릴설파타제 B, 베타-헥소사미니다제 (beta-hexosaminidase) A, 베타-헥소사미니다제 B, 헤파린-N-설파타제(heparin N-sulfatase), 알파-D-마노시다제(alpha-D-mannosidase), 베타-글루쿠로니다제(beta-glucuronidase), N-아세틸갈락토사민-6-설파타제(N-acetylgalactosamine-6 sulfatase), 리소좀 산성 리파제(lysosomal acid lipase), 알파-N-아세틸-글루코사미니다제(alpha-N-acetyl-glucosaminidase), 글루코세레브로시다제(glucocerebrosidase), 부티릴콜린에스터라제(butyrylcholinesterase), 키티나제(Chitinase), 글루타메이트 디카르복실라제(glutamate decarboxylase), 이미글루세라제(imiglucerase), 리파아제(lipase), 우리카제(Uricase), 혈소판활성인자 아세틸하이드로라제(Platelet-Activating Factor Acetylhydrolase), 뉴트럴 엔도펩티다제(neutral endopeptidase), 미엘로퍼옥시다제(myeloperoxidase), 알파-갈락토시다제-A, 아갈시다제 알파(agalsidase alpha), 아갈시다제 베타, 알파-L-이두로니다제(alpha-L-iduronidase), 뷰티릴콜린에스터라제(butyrylcholinesterase), 키티나제(chitinase), 글루타메이트 디카르복실라제(glutamate decarboxylase), 및 이미글루세라제(imiglucerase)로 이루어진 군에서 선택되고,Enzymes are beta-glucosidase, alpha-galactosidase, beta-galactosidase, iduronidase, iduronate 2-sulfatase ( iduronate-2-sulfatase, galactose-6-sulfatase, acid alpha-glucosidase, acid ceramidase, acid sphingomyelinase sphingomyelinsase), galactocerebrosidsase, arylsulfatase A, arylsulfatase B, beta-hexosaminidase A, beta-hexosaminidase B, heparin-N -sulfatase (heparin N-sulfatase), alpha-D-mannosidase (alpha-D-mannosidase), beta-glucuronidase (beta-glucuronidase), N-acetylgalactosamine-6-sulfatase ( N-acetylgalactosamine-6 sulfatase, lysosomal acid lipase, alpha-N-acetyl-glucosaminidase, glucocerebrosidase, butyrylcholine Butyrylcholinesterase, Chitinase, glutamate decarboxylase, imiglucerase, lipase, Uricase, platelet activator acetylhydrolase (Platelet-) Activating Factor Acetylhydrolase, neutral endopeptidase, myeloperoxidase, alpha-galactosidase-A, agalsidase alpha, agalsidase beta, alpha-L-iduronidase, butyrylcholinesterase, chitinase, glutamate decarboxylase, and imiglucerase selected from the group consisting of

인터루킨 결합 단백질은 IL-18bp이고, the interleukin binding protein is IL-18bp,

사이토카인 결합 단백질은 TNF (Tumor necrosis factor) 결합 단백질이고,The cytokine binding protein is a TNF (Tumor necrosis factor) binding protein,

신경 성장인자류는 신경 성장인자, 모양체 신경영양인자(cilliary neurotrophic factor), 악소제네시스 인자-1(axogenesis factor-1), 뇌-나트륨 이뇨 펩타이드(brain-natriuretic peptide), 신경교 유래 신경영양인자(glial derived neurotrophic factor), 네트린(netrin), 중성구 억제인자(neurophil inhibitor factor), 신경영양인자, 및 뉴트린(neuturin)으로 이루어진 군에서 선택되고,Nerve growth factors include nerve growth factor, cilliary neurotrophic factor, axogenesis factor-1, brain-natriuretic peptide, glial derived neurotrophic factor factor), netrin (netrin), neutrophil inhibitor factor (neurophil inhibitor factor), neurotrophic factor, and selected from the group consisting of nutrin (neuturin),

미오스타틴 수용체는 TNFR(P75), TNFR(P55), IL-1 수용체, VEGF 수용체, 및 B 세포 활성인자 수용체로 이루어진 군에서 선택되고,Myostatin receptor is selected from the group consisting of TNFR (P75), TNFR (P55), IL-1 receptor, VEGF receptor, and B cell activator receptor,

미오스타틴 수용체 안타고니스트는 IL1-Ra이고,The myostatin receptor antagonist is IL1-Ra,

세포표면 항원은 CD2, CD3, CD4, CD5, CD7, CD11a, CD11b, CD18, CD19, CD20, CD23, CD25, CD33, CD38, CD40, CD45 및 CD69로 이루어진 군에서 선택되고,the cell surface antigen is selected from the group consisting of CD2, CD3, CD4, CD5, CD7, CD11a, CD11b, CD18, CD19, CD20, CD23, CD25, CD33, CD38, CD40, CD45 and CD69,

항체 단편류는 scFv, Fab, Fab', F(ab')2 및 Fd로 이루어진 군에서 선택되는 것을 특징으로 한다.Antibody fragments are characterized in that they are selected from the group consisting of scFv, Fab, Fab', F(ab') 2 and Fd.

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, 상기 GLP-1 수용체 아고니스트는 천연형 엑센딘-4, 천연형 엑센딘-4의 N-말단 아민 그룹이 제거된 엑센딘-4, 천연형 엑센딘-4의 N-말단 아민 그룹이 하이드록실 그룹으로 치환된 엑센딘-4, 천연형 엑센딘-4의 N-말단 아민 그룹이 디메틸기로 수식된 엑센딘-4, 천연형 엑센딘-4의 N-말단 아민기가 카르복실기로 치환된 엑센딘-4, 천연형 엑센딘-4의 첫 번째 아미노산(히스티딘)의 알파 탄소가 제거된 엑센딘-4; 및 상기 엑센딘-4의 열두 번째 아미노산(라이신)이 세린으로 치환된 엑센딘-4 및 상기 엑센딘-4의 열두 번째 아미노산(라이신)이 알지닌으로 치환된 엑센딘-4로 이루어진 군에서 선택되는 것을 특징으로 한다.In the brain-targeting long-acting conjugate according to any one of the preceding embodiments, the GLP-1 receptor agonist is native exendin-4, exendin-4 from which the N-terminal amine group of native exendin-4 is removed, Exendin-4 in which the N-terminal amine group of native exendin-4 is substituted with a hydroxyl group, exendin-4 in which the N-terminal amine group of native exendin-4 is modified with a dimethyl group, and native exendin exendin-4 in which the N-terminal amine group of -4 is substituted with a carboxyl group, exendin-4 in which the alpha carbon of the first amino acid (histidine) of native exendin-4 is removed; and exendin-4 in which the twelfth amino acid (lysine) of exendin-4 is substituted with serine and exendin-4 in which the twelfth amino acid (lysine) of exendin-4 is substituted with arginine. characterized by being

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, 상기 L1 및 L2 중 어느 하나 또는 둘 다가 비펩타이드성 링커일 때, 상기 비펩타이드성 링커는 폴리에틸렌글리콜, 폴리프로필렌 글리콜, 에틸렌 글리콜-프로필렌 글리콜 공중합체, 폴리옥시에틸화폴리올, 폴리비닐알콜, 다당류, 덱스트란, 폴리비닐에틸에테르, 생분해성 고분자, 지질 중합체, 키틴, 히알루론산, 지방산, 고분자 중합체, 저분자 화합물, 뉴클레오타이드 및 이들의 조합으로 이루어진 군으로부터 선택되는 것을 특징으로 한다.In the brain-targeting long-acting conjugate according to any one of the preceding embodiments, when one or both of L 1 and L 2 is a non-peptide linker, the non-peptide linker is polyethylene glycol, polypropylene glycol, ethylene glycol- Propylene glycol copolymer, polyoxyethylated polyol, polyvinyl alcohol, polysaccharide, dextran, polyvinyl ethyl ether, biodegradable polymer, lipid polymer, chitin, hyaluronic acid, fatty acid, high molecular weight polymer, low molecular weight compound, nucleotide and combinations thereof It is characterized in that it is selected from the group consisting of.

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, 상기 L1 및 L2 중 어느 하나 또는 둘 다가 펩타이드성 링커일 때, 상기 X와 F1 및 Y와 F2는 각각 독립적으로 공유 화학결합, 비공유 화학결합 또는 이들의 조합으로 L1 및 L2 에 의해 서로 결합되고, L1 및 L2는 각각 독립적으로 0개부터 1000개의 아미노산을 포함하는 것을 특징으로 한다.In the brain-targeting long-acting conjugate according to any one of the preceding embodiments, when any one or both of L 1 and L 2 is a peptidic linker, the X and F1 and Y and F2 are each independently a covalent chemical bond, a non-covalent bond They are bonded to each other by L 1 and L 2 by a chemical bond or a combination thereof, and L 1 and L 2 are each independently 0 to 1000 amino acids.

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, L1 및 L2 중 어느 하나 또는 둘 다가 펩타이드성 링커일 때, L1 및 L2 는 0개의 아미노산으로 이루어지고, 상기 결합체는 (i) X와 F1 간의 펩타이드 결합, (ii) Y와 F2 간의 펩타이드 결합; 또는 (iii) X와 F1 간의 펩타이드 결합 및 Y와 F2 간의 펩타이드 결합을 포함하는 것을 특징으로 한다.In the brain-targeting long-acting conjugate according to any one of the preceding embodiments, when any one or both of L 1 and L 2 is a peptidic linker, L 1 and L 2 consist of 0 amino acids, and the conjugate is (i ) a peptide bond between X and F1, (ii) a peptide bond between Y and F2; or (iii) a peptide bond between X and F1 and a peptide bond between Y and F2.

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, L1 및 L2 중 어느 하나가 펩타이드성 링커이고, 이 중 다른 하나는 비펩타이드성 링커이며, 이때 상기 펩타이드성 링커는 0부터 1000개의 아미노산을 포함하는 링커이며, 상기 비펩타이드성 링커는 폴리에틸렌 글리콜인 것을 특징으로 한다.In the brain-targeting long-acting conjugate according to any one of the preceding embodiments, any one of L 1 and L 2 is a peptidic linker, and the other is a non-peptidyl linker, wherein the peptidic linker is 0 to 1000 It is a linker comprising an amino acid, and the non-peptidyl linker is characterized in that it is polyethylene glycol.

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, 상기 비펩타이드성 링커는 1kDa 내지 100kDa의 분자량을 가지는 것을 특징으로 한다.In the brain-targeting long-acting conjugate according to any one of the preceding embodiments, the non-peptidyl linker is characterized in that it has a molecular weight of 1 kDa to 100 kDa.

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, L1에 의해 X의 C-말단 영역 및 F1의 N-말단 영역이 연결되고, L2에 의해 Y의 C-말단 영역 및 F2의 N-말단 영역이 연결되는 것을 특징으로 한다.In the brain target long-acting conjugate according to any one of the preceding embodiments, the C-terminal region of X and the N-terminal region of F1 are connected by L 1 , and the C-terminal region of Y and N of F2 are connected by L 2 . - Characterized in that the end regions are connected.

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, L1의 일 말단은 X의 라이신 잔기 또는 시스테인 잔기에, L1의 다른 말단은 F1의 N-말단 영역에 연결되고, L2의 일 말단은 Y의 라이신 잔기 또는 시스테인 잔기에, L2의 다른 말단은 F2의 N-말단 영역에 연결되는 것을 특징으로 한다.In the brain target long-acting conjugate according to any one of the preceding embodiments, one end of L 1 is linked to a lysine residue or cysteine residue of X, and the other end of L 1 is linked to the N-terminal region of F1, and one of L 2 It is characterized in that one end is connected to a lysine residue or a cysteine residue of Y, and the other end of L 2 is connected to the N-terminal region of F2.

앞선 구체예 중 어느 하나에 따른 뇌 표적 지속형 결합체에서, X-L1-F1 및 Y-L2-F2 간의 화학결합은 F1의 면역글로불린 불변영역의 힌지 영역 및 F2의 면역글로불린 불변영역의 힌지 영역 간에 형성된 이황화 결합인 것을 특징으로 한다.In the brain-targeting long-acting conjugate according to any one of the preceding embodiments, the chemical bond between XL 1 -F1 and YL 2 -F2 is a disulfide formed between the hinge region of the immunoglobulin constant region of F1 and the hinge region of the immunoglobulin constant region of F2. It is characterized by bonding.

본 발명을 구현하는 다른 하나의 양태는 상기 뇌 표적 지속형 단백질 결합체를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 발현 벡터, 및 상기 발현 벡터를 포함하는 형질전환체이다. Another aspect embodying the present invention is a polynucleotide encoding the brain target long-acting protein conjugate, an expression vector comprising the polynucleotide, and a transformant comprising the expression vector.

하나의 구체예로서, 본 발명은 X-L1-F1를 코딩하는 폴리뉴클레오티드를 포함하는 발현 카세트 및 Y-L2-F2를 코딩하는 폴리뉴클레오티드를 포함하는 발현 카세트를 포함하며, X 및 Y는 각각 독립적으로 생리활성 물질 또는 뇌 표적 펩타이드로, X 및 Y 중 하나가 생리활성 물질이면 다른 하나는 뇌 표적 펩타이드이고; L1 및 L2는 각각 펩타이드성 링커이고, L1 및 L2중 어느 하나 또는 이들 둘 다가 펩타이드성 링커일 때, 상기 펩타이드성 링커는 0개부터 1000개의 아미노산을 포함하며, F1 및 F2는 각각 독립적으로 면역글로불린 불변 영역을 포함하며, FcRn 결합부위를 포함하는 물질인 것을 특징으로 하는 뇌 표적 지속형 결합체를 발현하는 발현벡터에 관한 것이다. In one embodiment, the present invention includes an expression cassette comprising a polynucleotide encoding XL 1 -F1 and an expression cassette comprising a polynucleotide encoding YL 2 -F2, wherein X and Y are each independently physiological an active substance or brain-targeting peptide, wherein if one of X and Y is a physiologically active substance, the other is a brain-targeting peptide; L 1 and L 2 are each a peptidic linker, and when either or both of L 1 and L 2 are peptidic linkers, the peptidic linker contains 0 to 1000 amino acids, and F1 and F2 are each It relates to an expression vector expressing a brain-targeting sustained-type conjugate, characterized in that it is a material that independently includes an immunoglobulin constant region and includes an FcRn binding site.

하나의 구체예로서, 본 발명은 상기 발현벡터를 포함하는 인간을 제외한 형질전환체에 관한 것이다. In one embodiment, the present invention relates to a non-human transformant comprising the expression vector.

본 발명을 구현하는 다른 하나의 양태는 상기 뇌 표적 지속형 단백질 결합체의 제조 방법이다. Another aspect embodying the present invention is a method for producing the brain-targeting long-acting protein conjugate.

하나의 구체예로서, 본 발명은 하기 단계를 포함하는 상기 뇌 표적 지속형 결합체의 제조방법에 관한 것이다: In one embodiment, the present invention relates to a method for preparing the brain-targeting long-acting conjugate comprising the steps of:

(a) X-L1-F1 및 L2-Y-F2를 각각 제공하는 단계; 및 (a) providing XL 1 -F1 and L 2 -Y-F2, respectively; and

(b) X-L1-F1 및 L2-Y-F2을 서로 접촉시켜 이들 간에 화학 결합을 형성하는 단계; (b) contacting XL 1 -F1 and L 2 -Y-F2 with each other to form a chemical bond therebetween;

여기서, here,

X 및 Y는 각각 독립적으로 생리활성 물질 또는 뇌 표적 펩타이드로, X 및 Y 중 하나가 생리활성 물질이면 다른 하나는 뇌 표적 펩타이드이고; X and Y are each independently a physiologically active substance or a brain-targeting peptide, and if one of X and Y is a physiologically active substance, the other is a brain-targeting peptide;

L1 및 L2는 각각 독립적으로 펩타이드성 링커 또는 비펩타이드성 링커이고,L 1 and L 2 are each independently a peptidic linker or a non-peptidyl linker,

L1 및 L2중 어느 하나 또는 이들 둘 다가 펩타이드성 링커일 때, 상기 펩타이드성 링커는 0개부터 1000개의 아미노산을 포함하고;when either or both of L 1 and L 2 are peptidic linkers, the peptidic linker comprises 0 to 1000 amino acids;

F1 및 F2는 각각 독립적으로 면역글로불린 불변 영역을 포함하며, FcRn 결합부위를 포함하는 물질임F1 and F2 each independently include an immunoglobulin constant region, and is a substance comprising an FcRn binding site

앞선 구체예에 따른 제조방법에서, 상기 L1 및 L2는 각각 독립적으로 펩타이드성 링커 또는 비펩타이드성 링커인 것을 특징으로 한다.In the preparation method according to the preceding embodiment, L 1 and L 2 are each independently a peptidic linker or a non-peptidyl linker.

앞선 구체예 중 어느 하나에 따른 제조방법에서, 상기 L1 및 L2는 모두 펩타이드성 링커인 것을 특징으로 한다.In the preparation method according to any one of the preceding embodiments, L 1 and L 2 are both peptidic linkers.

앞선 구체예 중 어느 하나에 따른 제조방법에서, 상기 L1 및 L2 각각은 0개의 아미노산을 가지는 펩타이드성 링커인 펩타이드 결합인 것을 특징으로 한다.In the preparation method according to any one of the preceding embodiments, each of L 1 and L 2 is a peptide bond, which is a peptidic linker having 0 amino acids.

앞선 구체예 중 어느 하나에 따른 제조방법에서, 상기 L1 및 L2은 모두 비펩타이드성 링커인 것을 특징으로 한다.In the preparation method according to any one of the preceding embodiments, L 1 and L 2 are both non-peptidyl linkers.

앞선 구체예 중 어느 하나에 따른 제조방법에서, 상기 L1 또는 L2은 비펩타이드성 링커이며, 상기 비펩타이드성 링커는 알데히드 기, 말레이미드(maleimide) 기 및 석시니미드 유도체(succinimide derivative)로 이루어진 군에서 선택되는 작용기를 통하여 X 또는 Y의 작용기와 공유 결합을 형성하는 것을 특징으로 한다.In the preparation method according to any one of the preceding embodiments, L 1 or L 2 is a non-peptide linker, and the non-peptide linker is an aldehyde group, a maleimide group and a succinimide derivative. It is characterized in that it forms a covalent bond with a functional group of X or Y through a functional group selected from the group consisting of.

다른 하나의 구체예로서, 본 발명은 (a) 상기 형질전환체를 배양하여 뇌 표적 지속형 결합체를 발현하는 단계; 및 (b) 상기 (a) 단계에서 발현된 뇌 표적 지속형 결합체를 회수하는 단계를 포함하는, 뇌 표적 지속형 결합체를 제조하는 방법에 관한 것이다.As another embodiment, the present invention comprises the steps of (a) culturing the transformant to express a brain target long-acting conjugate; and (b) recovering the brain-targeting long-acting conjugate expressed in step (a).

본 발명을 구현하는 다른 하나의 양태는 상기 뇌 표적 지속형 단백질 결합체를 포함하는 조성물이다. Another embodiment embodying the present invention is a composition comprising the brain-targeting long-acting protein conjugate.

본 발명을 구현하는 다른 하나의 양태는 약제의 제조에 있어 상기 뇌 표적 지속형 단백질 결합체의 용도이다. Another aspect embodying the present invention is the use of the brain-targeting long-acting protein conjugate in the manufacture of a medicament.

뇌 표적 펩타이드와 생리활성 물질을 포함하는 본 발명의 뇌 표적 지속성 결합체는 생체 내에서 뇌혈관 장벽을 통과하고, 생리활성을 유지하고, 혈중 반감기가 현저히 증가되는 효과를 보유할 수 있다. 상기 신규한 뇌 표적 지속성 결합체는 개선된 안정성을 보유할 수 있으며, 뇌 관련 질환의 치료제로 이용될 수 있다.The brain-targeting long-acting conjugate of the present invention comprising a brain-targeting peptide and a physiologically active substance can pass the blood-brain barrier in vivo, maintain physiological activity, and have the effect of significantly increasing the blood half-life. The novel long-acting brain-targeting conjugate may have improved stability and may be used as a therapeutic agent for brain-related diseases.

이하, 본 발명을 상세히 설명한다.Hereinafter, the present invention will be described in detail.

한편, 본원에서 개시되는 각각의 설명 및 실시형태는 각각의 다른 설명 및 실시 형태에도 적용될 수 있다. 즉, 본원에서 개시된 다양한 요소들의 모든 조합이 본 발명의 범주에 속한다. 또한, 하기 기술되는 구체적인 서술에 의하여 본 발명의 범주가 제한된다고 할 수 없다.On the other hand, each description and embodiment disclosed herein may also be applied to each other description and embodiment. That is, all combinations of the various elements disclosed herein are within the scope of the present invention. In addition, it cannot be said that the scope of the present invention is limited by the specific descriptions described below.

또한, 당해 기술분야의 통상의 지식을 가진 자는 통상의 실험만을 사용하여 본 출원에 기재된 본 발명의 특정 양태에 대한 다수의 등가물을 인지하거나 확인할 수 있다. 또한, 이러한 등가물은 본 발명에 포함되는 것으로 의도된다.In addition, those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Also, such equivalents are intended to be encompassed by the present invention.

본 명세서 전반을 통하여, 아미노산에 대한 통상의 1문자 및 3문자 코드가 사용된다. 또한, Dap (다이아미노프로피오닉산, diaminopropionic acid) 등과 같은 다른 아미노산에 대해 일반적으로 허용되는 3문자 코드가 사용된다. 또한, 본 명세서에서 약어로 언급된 아미노산은 IUPAC-IUB 명명법에 따라 기재되었다. Throughout this specification, conventional one-letter and three-letter codes for amino acids are used. Also, commonly accepted three-letter codes for other amino acids such as Dap (diaminopropionic acid) are used. In addition, amino acids referred to by abbreviation herein are described according to the IUPAC-IUB nomenclature.

본 발명을 구현하는 하나의 양태는 뇌 표적 지속형 단백질 결합체를 제공한다. One aspect embodying the present invention provides a brain-targeting long-acting protein conjugate.

본 발명에서 용어, "뇌 표적 지속형 단백질 결합체"는, 뇌 표적 펩타이드 및 생리활성 물질을 포함하며, 면역글로불린 불변 영역을 포함하고 FcRn 결합 부위을 갖는 물질 각각에 뇌 표적 펩타이드 및 생리활성 물질이 각각 직간접적으로 연결된 구조를 가지는 결합체를 말한다. 상기 지속형 결합체는 본 발명에서 "지속성 결합체"와 혼용되어 사용될 수 있으며, "지속형"이란 면역글로불린 불변 영역를 포함하고 FcRn 결합 부위을 갖는 물질에 연결된 생리활성 물질이 생리활성 물질 자체에 비해 증가된 활성 지속 시간을 나타낸다는 것을 의미한다.As used herein, the term "brain-targeting long-acting protein conjugate" includes a brain-targeting peptide and a physiologically active substance, and includes an immunoglobulin constant region and a brain-targeting peptide and a physiologically active substance, respectively, directly or indirectly in each substance having an FcRn binding site. It refers to a compound having a structurally linked structure. The long-acting conjugate may be used interchangeably with “long-acting conjugate” in the present invention, and the term “persistent” refers to a bioactive substance linked to a substance including an immunoglobulin constant region and having an FcRn binding site has increased activity compared to the bioactive substance itself. indicates the duration.

상기 뇌 표적 지속형 결합체는 뇌 혈관 장벽을 통과하여, 뇌 조직 내로 생리활성 물질을 전달할 수 있으나, 특별히 이에 제한되는 것은 아니다. The brain-targeting long-acting conjugate may pass through the blood-brain barrier and deliver a physiologically active substance into the brain tissue, but is not particularly limited thereto.

보다 구체적으로, 본 발명의 뇌 표적 지속형 결합체는 뇌 표적 펩타이드가 면역글로불린 불변 영역을 포함하고, 또한 FcRn 결합 부위를 포함하는 물질에 펩타이드성 링커 또는 비펩타이드성 링커를 통하여 연결된, 제1 결합체;와 생리활성 물질이 면역글로불린 불변 영역을 포함하고 또한 FcRn 결합 부위를 포함하는 물질에 펩타이드성 링커 또는 비펩타이드성 링커를 통하여 연결된, 제2 결합체를 포함하며, 상기 제1 결합체 및 제2 결합체 간의 화학 결합을 통하여 제1 결합체 및 제2 결합체가 서로 연결된 구조를 가질 수 있다. More specifically, the brain-targeting long-acting conjugate of the present invention comprises a first conjugate, wherein the brain-targeting peptide includes an immunoglobulin constant region and is linked to a substance including an FcRn binding site via a peptidic linker or a non-peptidyl linker; and a second conjugate, wherein the physiologically active substance is linked to a substance including an immunoglobulin constant region and an FcRn binding site through a peptide linker or a non-peptide linker, wherein the chemical between the first conjugate and the second conjugate The first binder and the second binder may have a structure connected to each other through bonding.

구체적으로, 상기 뇌 표적 지속형 결합체는 다음과 같은 구조, 즉 화학식 1의 구조로 표시될 수 있다. Specifically, the brain-targeting long-acting conjugate may be represented by the following structure, that is, the structure of Formula 1.

[화학식 1][Formula 1]

X-L1-F1 : Y-L2-F2XL 1 -F1 : YL 2 -F2

여기에서,From here,

X 및 Y는 각각 독립적으로 생리활성 물질 또는 뇌 표적 펩타이드로, X 및 Y 중 하나가 생리활성 물질이면 다른 하나는 뇌 표적 펩타이드이고; X and Y are each independently a physiologically active substance or a brain-targeting peptide, and if one of X and Y is a physiologically active substance, the other is a brain-targeting peptide;

L1 및 L2는 각각 독립적으로 펩타이드성 링커 또는 비펩타이드성 링커이고,L 1 and L 2 are each independently a peptidic linker or a non-peptidyl linker,

L1 및 L2중 어느 하나 또는 이들 둘 다가 펩타이드성 링커일 때, 상기 펩타이드성 링커는 0개부터 1000개의 아미노산을 포함하고;when either or both of L 1 and L 2 are peptidic linkers, the peptidic linker comprises 0 to 1000 amino acids;

:는 X-L1-F1 및 Y-L2-F2 간의 화학결합이며;: is a chemical bond between XL 1 -F1 and YL 2 -F2;

F1 및 F2는 각각 독립적으로 면역글로불린 불변 영역을 포함하며, FcRn 결합부위를 포함하는 물질임.F1 and F2 each independently include an immunoglobulin constant region, and is a substance comprising an FcRn binding site.

한편, 상기 뇌 표적 지속형 결합체에서, On the other hand, in the brain target long-acting conjugate,

(1) L1에 의해 X의 C-말단 영역 및 F1의 N-말단 영역이 연결되거나, L1에 의해 X의 N-말단 영역 및 F1의 C-말단 영역이 연결되거나, L1에 의해 X의 N-말단 영역 및 F1의 N-말단 영역이 연결되거나, L1에 의해 X의 C-말단 영역 및 F1의 C-말단 영역이 연결되고, (1) the C-terminal region of X and the N-terminal region of F1 are connected by L 1 , the N-terminal region of X and the C-terminal region of F1 are connected by L 1 , or X by L 1 the N-terminal region of and the N-terminal region of F1 are connected, or the C-terminal region of X and the C-terminal region of F1 are connected by L 1 ,

(2) L2에 의해 Y의 C-말단 영역 및 F2의 N-말단 영역이 연결되거나, L2에 의해 Y의 N-말단 영역 및 F2의 C-말단 영역이 연결되거나, L2에 의해 Y의 N-말단 영역 및 F2의 N-말단 영역이 연결되거나, L2에 의해 Y의 C-말단 영역 및 F2의 C-말단 영역이 연결되는 것일 수 있으나, 특별히 이에 제한되지 않는다. (2) the C-terminal region of Y and the N-terminal region of F2 are connected by L 2 , or the N-terminal region of Y and the C-terminal region of F2 are connected by L 2 , or Y by L 2 The N-terminal region of and the N-terminal region of F2 may be connected, or the C-terminal region of Y and the C-terminal region of F2 may be connected by L 2 , but the present invention is not particularly limited thereto.

보다 구체적으로, L1에 의해 X의 C-말단 영역 및 F1의 N-말단 영역이 연결되고, L2에 의해 Y의 C-말단 영역 및 F2의 N-말단 영역이 연결되는 것일 수 있으나, 특별히 이에 제한되지 않는다. More specifically, the C-terminal region of X and the N-terminal region of F1 are connected by L 1 , and the C-terminal region of Y and the N-terminal region of F2 are connected by L 2 , but in particular It is not limited thereto.

또한, (3) 상기 L1 및 L2가 각각 독립적으로 양 말단 또는 세 말단을 가지며, L1의 일 말단은 X의 라이신 잔기 또는 시스테인 잔기 등에, L1의 다른 하나의 말단은 F1의 N-말단 영역에 연결되고/되거나 L2의 일 말단은 Y의 라이신 잔기 또는 시스테인 잔기 등에, L2의 다른 하나의 말단은 F2의 N-말단 영역에 연결된 것일 수 있다. 그러나, 이에 제한되는 것은 아니다. In addition, (3) L 1 and L 2 each independently has both ends or three ends, one end of L 1 is a lysine residue or a cysteine residue of X, and the other end of L 1 is N- of F1 It may be connected to a terminal region and/or one end of L 2 may be connected to a lysine residue or a cysteine residue of Y, and the other end of L 2 may be connected to an N-terminal region of F2. However, the present invention is not limited thereto.

상술한 X-L1-F1 및 Y-L2-F2의 연결 방향은, 뇌 표적 펩타이드 및/또는 생리활성 물질의 종류 등을 고려하여 뇌 혈관 장벽을 통과하여, 뇌 조직 내로 생리 활성 물질을 전달하고/하거나 상기 물질이 보유하는 생리활성을 나타낼 수 있는 형태가 되도록 적절히 구현할 수 있는 것이고, 상기 기술된 예에 제한되지 아니한다. The above-described connection direction of XL 1 -F1 and YL 2 -F2 passes through the blood-brain barrier in consideration of the type of brain target peptide and/or physiologically active substance, and/or delivers the physiologically active substance into the brain tissue and/or the It can be appropriately implemented so as to be in a form that can exhibit the physiological activity possessed by the material, and is not limited to the above-described examples.

또한, 상기 신규한 뇌 표적 지속형 결합체에서, "X-L1-F1 및 Y-L2-F2 간의 화학결합; 또는 제1 결합체 또는 제2 결합체 간의 화학 결합"은 X-L1-F1 및 Y-L2-F2를 서로 연결시켜 뇌 조직 내로 생리 활성 물질을 전달하도록 하는 종류의 화학 결합이라면 특별히 그 종류에 제한되지는 않는다. In addition, in the novel brain-targeted long-acting conjugate, "a chemical bond between XL 1 -F1 and YL 2 -F2; or a chemical bond between the first conjugate or the second conjugate" means XL 1 -F1 and YL 2 -F2 to each other If it is a kind of chemical bond that connects to deliver a physiologically active substance into the brain tissue, the type is not particularly limited.

그 예로, 상기 화학 결합은 공유결합일 수 있고, 보다 구체적으로는 이황화 결합일 수 있으며, 더욱 더 구체적으로는 F1 및 F2 간에 형성된 이황화 결합일 수 있고, 더더욱 구체적으로는 F1의 면역글로불린 불변영역의 힌지 영역 및 F2의 면역글로불린 불변영역의 힌지 영역 간에 형성된 이황화 결합일 수 있으나, 특별히 이에 제한되는 것은 아니다. For example, the chemical bond may be a covalent bond, more specifically a disulfide bond, even more specifically a disulfide bond formed between F1 and F2, and still more specifically, the immunoglobulin constant region of F1. It may be a disulfide bond formed between the hinge region and the hinge region of the immunoglobulin constant region of F2, but is not particularly limited thereto.

본 발명에서 사용되는 용어 "N-말단 영역"은 펩타이드 또는 단백질의 아미노 말단 영역을 의미한다. 그 예로, 이에 제한되지는 않으나, 상기 "N-말단 영역"은 N-말단 영역의 최말단 아미노산 잔기뿐만 아니라 N-말단 아미노산 잔기 주변의 아미노산 잔기를 모두 포함할 수 있으며, 구체적으로는 최말단으로부터 첫 번째 내지 20 번째의 아미노산 잔기를 포함할 수 있다. 그러나, 특별히 이에 제한되는 것은 아니다. As used herein, the term “N-terminal region” refers to an amino-terminal region of a peptide or protein. For example, but not limited thereto, the "N-terminal region" may include not only the most terminal amino acid residue of the N-terminal region but also all amino acid residues surrounding the N-terminal amino acid residue, specifically from the most It may include the first to twentieth amino acid residues. However, it is not particularly limited thereto.

본 발명에서 사용되는 용어 "C-말단 영역"은 펩타이드 또는 단백질의 카르복실 말단 영역을 의미한다. 그 예로, 이에 제한되지는 않으나, 상기 "C-말단 영역"은 C-말단 영역의 최말단 아미노산 잔기뿐만 아니라 C-말단 아미노산 잔기 주변의 아미노산 잔기를 모두 포함할 수 있으며, 구체적으로는 최말단으로부터 첫 번째 내지 20 번째의 아미노산 잔기를 포함할 수 있다. 그러나, 특별히 이에 제한되는 것은 아니다. As used herein, the term “C-terminal region” refers to a carboxyl-terminal region of a peptide or protein. For example, but not limited thereto, the "C-terminal region" may include not only the most terminal amino acid residue of the C-terminal region but also all amino acid residues surrounding the C-terminal amino acid residue, specifically from the most It may include the first to twentieth amino acid residues. However, it is not particularly limited thereto.

상기 뇌 표적 지속형 결합체를 구성하는 요소들을 보다 구체적으로 설명하면 다음과 같다. The elements constituting the brain target long-acting conjugate will be described in more detail as follows.

본 발명에서, "뇌 표적 펩타이드"는 뇌 혈관 장벽을 통과할 수 있는 아미노산 서열을 포함하는 펩타이드, 또는 단백질, 또는 항체를 포함한다. 상기 뇌 표적 펩타이드는 본 발명의 뇌 표적 지속형 결합체를 구성하는 하나의 모이어티에 해당한다.In the present invention, "brain targeting peptide" includes a peptide, protein, or antibody comprising an amino acid sequence capable of passing through the blood-brain barrier. The brain-targeting peptide corresponds to one moiety constituting the brain-targeting long-acting conjugate of the present invention.

또한, 상기 뇌 표적 펩타이드는 공지의 펩타이드, 단백질, 또는 항체로부터 분리된 일부 서열로서, BBB를 통과하여 뇌 혈관 장벽을 통과할 수 있는 활성을 보유한 것일 수 있다. In addition, the brain-targeting peptide is a partial sequence separated from a known peptide, protein, or antibody, and may have an activity capable of passing through the BBB and the blood-brain barrier.

본 발명에서 용어 "아미노산"은 임의의 자연-발생 또는 비-자연 발생 또는 합성 아미노산 잔기를 포함하는 아미노산 모이어티(moiety), 다시 말하면, 1개, 2개, 3개 또는 그 이상의 탄소 원자, 전형적으로, 1개의 (α) 탄소원자에 의해 직접적으로 연결된 적어도 하나의 카르복실 잔기와 적어도 하나의 아미노 잔기를 포함하는 임의의 모이어티를 의미한다.As used herein, the term "amino acid" refers to an amino acid moiety comprising any naturally-occurring or non-naturally occurring or synthetic amino acid residue, ie, 1, 2, 3 or more carbon atoms, typically , means any moiety comprising at least one carboxyl moiety and at least one amino moiety directly linked by one (α) carbon atom.

본 발명의 뇌 표적 펩타이드는 수동전달(passive transport)에 의한 경로 또는 수용체 매개 전달(receptor-mediated transport)에 의한 경로를 통해 뇌 혈관 장벽을 통과하는 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다. 그 예로 뇌 혈관 장벽을 통과할 수 있는 펩타이드, 단백질 또는 항체로 특별히 그 종류 및 크기에 제한을 두지 않는다.The brain-targeting peptide of the present invention may be characterized in that it crosses the blood-brain barrier through a pathway by passive transport or a pathway by receptor-mediated transport, but is not limited thereto. For example, a peptide, protein or antibody that can cross the blood-brain barrier is not particularly limited in its type and size.

한편, 상기 뇌 표적 펩타이드는 수용체 매개 전달에 의한 경로를 통해 뇌 혈관 장벽을 통과하는 것일 수 있다. Meanwhile, the brain-targeting peptide may pass through the blood-brain barrier through a pathway by receptor-mediated delivery.

구체적으로, 상기 뇌 표적 펩타이드는 인슐린 수용체(insulin receptor); 트랜스페린 수용체(transferrin receptor); 저밀도 지질단백질 수용체(low density lipoprotein receptor); 저밀도 지질단백질 수용체 관련 단백질(Low density lipoprotein receptor-related protein); 렙틴 수용체(leptin receptor); 니코틴성 아세틸콜린 수용체(nicotinic acetylcholine receptor); 글루타티온 수송체(Glutathione transporter); 칼슘의존성 칼륨통로(calcium-activated potassium channel); 및 RAGE (receptor for advanced glycation endproducts); 및 상기 수용체들의 리간드, 및 상기 수용체 또는 리간드에 결합하는 항체로 이루어진 군에서 선택되는 어느 하나를 통하여 수용체 매개 전달 경로에 의해 뇌 혈관 장벽을 통과할 수 있으나, 특별히 이에 제한되지 않는다. Specifically, the brain target peptide is an insulin receptor (insulin receptor); transferrin receptor; low density lipoprotein receptor; low density lipoprotein receptor-related protein; leptin receptor; nicotinic acetylcholine receptor; Glutathione transporter; calcium-activated potassium channel; and RAGE (receptor for advanced glycation endproducts); And through any one selected from the group consisting of a ligand of the receptors, and an antibody binding to the receptor or ligand, it may pass through the blood-brain barrier by a receptor-mediated transduction pathway, but is not particularly limited thereto.

상기 뇌 표적 펩타이드는 The brain-targeting peptide is

(1) Angiopep-2 : TFFYGGSRGKRNNFKTEEY-OH (서열번호: 29), (1) Angiopep-2: TFFYGGSRGKRNNFKTEEY- OH (SEQ ID NO: 29),

(2) ApoB(3371-3409) : SVIDALQYKLEGTTRLTRKRGLKLATALSLSNKFVEGS (서열번호: 30),(2) ApoB (3371-3409): SVIDALQYKLEGTTRLTRKRGLKLATALSLSNKFVEGS (SEQ ID NO: 30),

(3) ApoE(159-167)2 : (LRKLRKRLL)2 (서열번호: 51), (3) ApoE(159-167) 2 : (LRKLRKRLL) 2 (SEQ ID NO: 51),

(4) 펩타이드-22 : Ac-C(&)MPRLRGC(&)-NH 2 (서열번호: 31),(4) peptide-22: Ac-C(&)MPRLRGC(&)- NH 2 (SEQ ID NO: 31),

(5) THR : THRPPMWSPVWP-NH 2 (서열번호: 32),(5) THR: THRPPMWSPVWP- NH 2 (SEQ ID NO: 32),

(6) THR retro - enantio : pwvpswmpprht-NH 2 (서열번호: 33),(6) THR retro - enantio : pwvpswmpprht- NH 2 (SEQ ID NO: 33),

(7) CRT : C(&)RTIGPSVC(&)(서열번호: 34),(7) CRT: C (&) RTIGPSVC (&) (SEQ ID NO: 34),

(8) Leptin 30 : YQQILTSMPSRNVIQISNDLENLRDLLHVL(서열번호: 35), (8) Leptin 30: YQQILTSMPSRNVIQISNDLENLRDLLHVL (SEQ ID NO: 35),

(9) RVG29 : YTIWMPENPRPGTPCDIFTNSRGKRASNG-OH(서열번호: 36)(9) RVG29: YTIWMPENPRPGTPCDIFTNSRGKRASNG- OH (SEQ ID NO: 36)

(10) DCDX : GreirtGraerwsekf-OH (서열번호: 37)(10) D CDX: GreirtGraerwsekf-OH (SEQ ID NO: 37)

(11) Apamin : C(&1)NC(&2)KAPETALC(&1)-ARRC(&2)QQH-NH 2 (서열번호: 38), (11) Apamin: C(& 1 )NC(& 2 )KAPETALC(& 1 )-ARRC(& 2 )QQH- NH 2 (SEQ ID NO: 38),

(12) MiniAp-4 : [Dap](&)KAPETALD(&)(서열번호: 39), (12) MiniAp-4: [Dap] (&) KAPETALD (&) (SEQ ID NO: 39),

(13) GSH : γ-L-glutamyl-CG-OH(13) GSH: γ-L-glutamyl-CG-OH

(14) G23 : HLNILSTLWKYRC(서열번호: 40), (14) G23: HLNILSTLWKYRC (SEQ ID NO: 40),

(15) g7 : GFtGFLS(O-β-Glc)-NH 2 (서열번호: 41), (15) g7: GFtGFLS(O-β-Glc) -NH 2 (SEQ ID NO: 41),

(16) TGN : TGNYKALHPHNG (서열번호: 42), (16) TGN: TGNYKALHPHNG (SEQ ID NO: 42),

(17) TAT(47-57) : YGRKKRRQRRR-NH 2 (서열번호: 43), (17) TAT (47-57): YGRKKRRQRRR- NH 2 (SEQ ID NO: 43),

(18) SynB1 : RGGRLSYSRRRFSTSTGR (서열번호: 44),(18) SynB1: RGGRLSYSRRRFSTSTGR (SEQ ID NO: 44),

(19) Diketopiperazines : &(N-MePhe)-(N-MePhe)Diketopiperazines, (19) Diketopiperazines: &(N-MePhe)-(N-MePhe)Diketopiperazines;

(20) PhPro : (Phenylproline)4-NH 2 (서열번호: 45), 또는 (20) PhPro: (Phenylproline) 4 -NH 2 (SEQ ID NO: 45), or

(21) HAIYPRH (서열번호: 46) 일 수 있으나, 이에 제한되지 않는다. (21) HAIYPRH (SEQ ID NO: 46), but is not limited thereto.

상기 서열에서 &은 J. Pept. Res., 2005, 65, 550-555 (J.Spengler et al.)에 기재된 고리형 펩타이드에 대한 명명법에 따른 기호로서, '&'은 연결 위치(connecting point)를 말한다. 예를 들어, 단일 쇄에서 첫 번째로 기재된 '&'은 화학 결합의 일 말단의 위치를, 두 번째로 기재된 '&'은 상기 화학 결합이 부착되는 부위를 말한다. 예컨대, "&Ala-Ala-Phe-Leu-Pro&"은 알라닌과 프롤린 간에 화학 결합이 형성되어 고리형 펩타이드를 형성함을 나타낸다. 2 이상의 화학 결합이 존재할 경우, 해당 화학 결합이 형성되는 위치를 나타내기 위하여 &1, &2와 같은 기호를 사용할 수 있다. 예를 들어, &1Asp(&2)-Trp-Phe-Dpr(&2)-Leu-Met&1과 같이 표시된 경우, Asp 및 Met 간에 화학 결합이 형성되고, Asp 및 Dpr 간에 화학 결합이 형성되는 것을 말한다. 한편, [Dap]은 다이아미노프로피오닉산(diaminopropionic acid)을 나타낸다.In the above sequence, & is J. Pept. Res., 2005, 65, 550-555 (J. Spengler et al.) as a symbol according to the nomenclature for a cyclic peptide described in, '&' refers to a connecting point. For example, in a single chain, the first '&' indicates the position of one end of the chemical bond, and the second '&' indicates the site to which the chemical bond is attached. For example, "&Ala-Ala-Phe-Leu-Pro&" indicates that a chemical bond is formed between alanine and proline to form a cyclic peptide. When two or more chemical bonds exist, symbols such as &1 and &2 may be used to indicate a position where the corresponding chemical bond is formed. For example, when expressed as &1Asp(&2)-Trp-Phe-Dpr(&2)-Leu-Met&1, a chemical bond is formed between Asp and Met, and a chemical bond is formed between Asp and Dpr. On the other hand, [Dap] represents diaminopropionic acid.

본 발명에서, "생리활성 물질"은 생체 내에서 임의의 생리작용을 가지는 물질을 말한다. 상기 생리활성 물질은 본 발명의 뇌 표적 지속형 결합체를 구성하는 하나의 모이어티에 해당한다. In the present invention, "biologically active substance" refers to a substance having any physiological action in a living body. The physiologically active substance corresponds to one moiety constituting the brain-targeting long-acting conjugate of the present invention.

이와 같은 생리활성 물질은 톡신 또는 생리활성 폴리펩타이드일 수 있고, 인간의 질병을 치료 또는 예방할 목적으로 사용되는 사이토카인, 인터루킨, 인터루킨 결합 단백질, 효소, 항체, 성장인자, 전사조절인자, 혈액인자, 백신, 구조단백질, 리간드 단백질 또는 수용체, 세포표면항원, 수용체 안타고니스트, 당뇨 및 비만에 치료효과를 보이는 소장 및 췌장에서 분비되는 생리활성 펩타이드, GPCR (G protein-coupled receptors) 아고니스트 혹은 안타고니스트 등과 같은 다양한 생리활성 폴리펩타이드, 이들의 아날로그들을 예시할 수 있으나, 이에 제한되지 않는다.Such physiologically active substances may be toxins or physiologically active polypeptides, and cytokines, interleukins, interleukin-binding proteins, enzymes, antibodies, growth factors, transcriptional regulators, blood factors used for the purpose of treating or preventing human diseases, Vaccines, structural proteins, ligand proteins or receptors, cell surface antigens, receptor antagonists, bioactive peptides secreted from the small intestine and pancreas that have therapeutic effects on diabetes and obesity, GPCR (G protein-coupled receptors) agonists or antagonists, etc. Bioactive polypeptides and analogs thereof may be exemplified, but are not limited thereto.

본 발명에서 사용되는 용어, "X의 아날로그"는 X와 동일한 종류의 활성을 나타낼 수 있는 물질로서, X의 아고니스트(agonist), X의 유도체(derivatives), X의 단편(fragments), X의 변이체(variants) 등을 모두 포함한다.As used herein, the term "analog of X" is a substance capable of exhibiting the same kind of activity as X, and is an agonist of X, derivatives of X, fragments of X, and All variants and the like are included.

구체적으로 톡신은 암세포 사멸에 효과적인 메이탄신 (maytansine) 및/또는 이의 유도체, 오리스타틴 (auristatin) 및/또는 그 유도체, 듀오카마이신 (duocarmycin) 및/또는 그 유도체, PBD (pyrrolobenzodiazepine) 및/또는 그 유도체 중에서 선택될 수 있으나, 암세포 사멸에 효력을 보이는 톡신은 제한 없이 포함된다.Specifically, the toxin may include maytansine and / or its derivatives, auristatin and / or its derivatives, duocarmycin and / or its derivatives, PBD (pyrrolobenzodiazepine) and / or its derivatives effective in killing cancer cells Although it may be selected from derivatives, toxins that are effective in killing cancer cells are included without limitation.

구체적으로, 생리활성 폴리펩타이드는 GLP-1 수용체 아고니스트, 글루카곤 수용체 아고니스트, GIP (Gastric inhibitory polypeptide) 수용체 아고니스트, FGF (Fibroblast growth factors) 수용체 아고니스트 (FGF1, FGF19, FGF21, FGF23 등), 콜레시스토키닌 (Cholecystokinin) 수용체 아고니스트, 가스트린 (gastrin) 수용체 아고니스트, 멜라노코르틴 (melanocortin) 수용체 아고니스트, 인간 성장호르몬, 성장호르몬 방출 호르몬, 성장호르몬 방출 펩타이드, 인터페론류와 인터페론 수용체류 (예: 인터페론-알파, -베타 및 -감마, 수용성 타입 I 인터페론 수용체 등), 콜로니 자극인자, 인터루킨류(예: 인터루킨-1, -2, -3, -4, -5, -6, -7, -8, -9, -10, -11, -12, -13, -14, -15, -16, -17, -18, -19, -20, -21, -22, -23, -24, -25, -26, -27, -28, -29, -30 등)와 인터루킨 수용체류(예: IL-1 수용체, IL-4 수용체 등), 효소류 (예: 베타글루코시다제 (beta-glucosidase), 알파갈락토시다제 (alpha-galactosidase), 베타갈락토시다제 (beta-galactosidase), 이두로니다제 (iduronidase), 이두로네이트 2-설파타제 (iduronate-2-sulfatase), 갈락토스-6-설파타제 (Galactose-6-sulfatase), 산성 알파-글루코시다제 (acid alpha-glucosidase), 산성 세라미다제 (acid ceramidase), 산성 스핑고미엘리나제 (acid sphingomyelinsase), 갈락토세레브로시다제 (galactocerebrosidsase), 아릴설파타제 (arylsulfatase) A, B, 베타-헥소사미니다제 (beta-hexosaminidase) A, B, 헤파린-N-설파타제 (heparin N-sulfatase), 알파-D-마노시다제 (alpha-D-mannosidase), 베타-글루쿠로니다제 (beta-glucuronidase), N-아세틸갈락토사민-6-설파타제 (N-acetylgalactosamine-6 sulfatase), 리소좀 산성 리파제 (lysosomal acid lipase), 알파-N-아세틸-글루코사미니다제 (alpha-N-acetyl-glucosaminidase), 글루코세레브로시다제 (glucocerebrosidase), 부티릴콜린에스터라제 (butyrylcholinesterase), 키티나제 (Chitinase), 글루타메이트 디카르복실라제 (glutamate decarboxylase), 이미글루세라제 (imiglucerase), 리파아제 (lipase), 우리카제 (Uricase), 혈소판활성인자 아세틸하이드로라제 (Platelet-Activating Factor Acetylhydrolase), 뉴트럴 엔도펩티다제 (neutral endopeptidase), 미엘로퍼옥시다제 (myeloperoxidase), 알파-갈락토시다제-A, 아갈시다제 알파(agalsidase alpha), 베타, 알파-L-이두로니다제(alpha-L-iduronidase), 뷰티릴콜린에스터라제(butyrylcholinesterase), 키티나제(chitinase), 글루타메이트 디카르복실라제(glutamate decarboxylase), 이미글루세라제(imiglucerase), 리파제(lipase), 유리케이즈(uricase), 혈소판-활성인자 아세틸하이드롤라제(platelet-activating factor acetylhydrolase), 중성 엔도펩티다제(neutral endopeptidase), 및 마이엘로퍼옥시다제(myeloperoxidase) 등), 인터루킨 및 사이토카인 결합 단백질류(예: IL-18bp, TNF-결합 단백질 등), 마크로파지 활성인자, 마크로파지 펩타이드, B 세포인자, T 세포인자, 단백질 A, 알러지 억제인자, 세포 괴사 당단백질, 면역독소, 림포독소, 종양 괴사인자, 종양 억제인자, 전이 성장인자, 알파-1 안티트립신, 알부민, 알파-락트알부민(alpha-lactalbumin), 아포리포단백질-E, 적혈구 생성인자, 고 당쇄화 적혈구 생성인자, 안지오포이에틴류(angiopoietin), 헤모글로빈, 트롬빈(thrombin), 트롬빈 수용체 활성 펩타이드, 트롬보모듈린(thrombomodulin), 혈액인자 VII, 혈액인자 VIIa, 혈액인자 VIII, 혈액인자 IX, 혈액인자 XIII, 플라즈미노겐 활성인자, 피브린-결합 펩타이드, 유로키나제, 스트렙토키나제, 히루딘(hirudin), 단백질 C, C-반응성 단백질, 레닌 억제제, 콜라게나제 억제제, 수퍼옥사이드 디스뮤타제, 렙틴, 혈소판 유래 성장인자, 상피세포 성장인자, 표피세포 성장인자, 안지오스타틴(angiostatin), 안지오텐신(angiotensin), 골 형성 성장인자, 골 형성 촉진 단백질, 칼시토닌, 인슐린, 아트리오펩틴, 연골 유도인자, 엘카토닌(elcatonin), 결합조직 활성인자, 조직인자 경로 억제제(tissue factor pathway inhibitor), 여포 자극 호르몬, 황체 형성 호르몬, 황체 형성 호르몬 방출 호르몬, 신경 성장인자류(예: 신경 성장인자, 모양체 신경영양인자(cilliary neurotrophic factor), 악소제네시스 인자-1(axogenesis factor-1), 뇌-나트륨 이뇨 펩타이드(brain-natriuretic peptide), 신경교 유래 신경영양인자(glial derived neurotrophic factor), 네트린(netrin), 중성구 억제인자(neurophil inhibitor factor), 신경영양인자, 뉴트린(neuturin), 부갑상선 호르몬, 릴랙신, 시크레틴, 소마토메딘, 인슐린 유사 성장인자, 부신피질 호르몬, 글루카곤, 콜레시스토키닌, 췌장 폴리펩타이드, 가스트린 방출 펩타이드, 코티코트로핀 방출인자, 갑상선 자극호르몬, 오토탁신(autotaxin), 락토페린(lactoferrin), 미오스타틴(myostatin), ADNP(activity-dependent neuroprotective protein), BACE1(beta-secretase1), APP(Amyloid Precursor Protein), NCAM(Neural cell adhesion molecule), 아밀로이드 베타(Amyloid beta), 타우(Tau), RAGE(receptor for advanced glycation endproducts), 알파-시누클레인(alpha-synuclein), 또는 이들의 아고니스트 또는 안타고니스트, 이들의 수용체류(예: TNFR(P75), TNFR(P55), IL-1 수용체, VEGF 수용체, B 세포 활성인자 수용체 등), 수용체 길항물질(예: IL1-Ra 등), 세포표면항원(예: CD 2, 3, 4, 5, 7, 11a, 11b, 18, 19, 20, 23, 25, 33, 38, 40, 45, 69 등), 단일클론 항체, 다중클론 항체, 항체 단편류(예: scFv, Fab, Fab', F(ab')2 및 Fd), 바이러스 유래 백신 항원, 하나 이상의 수용체 아고니스트를 활성화 시키는 하이브리드 폴리펩타이드 혹은 키메릭 (chimeric) 폴리펩타이드 등을 예시할 수 있으나, 이에 한정되는 것은 아니다. Specifically, the physiologically active polypeptide includes a GLP-1 receptor agonist, a glucagon receptor agonist, a Gastric inhibitory polypeptide (GIP) receptor agonist, a Fibroblast growth factor (FGF) receptor agonist (FGF1, FGF19, FGF21, FGF23, etc.), Cholecystokinin receptor agonist, gastrin receptor agonist, melanocortin receptor agonist, human growth hormone, growth hormone-releasing hormone, growth hormone-releasing peptide, interferons and interferon receptors (e.g. interferon) -alpha, -beta and -gamma, soluble type I interferon receptors, etc.), colony stimulating factors, interleukins (eg, interleukin-1, -2, -3, -4, -5, -6, -7, -8 , -9, -10, -11, -12, -13, -14, -15, -16, -17, -18, -19, -20, -21, -22, -23, -24, - 25, -26, -27, -28, -29, -30, etc.) and interleukin receptors (eg, IL-1 receptor, IL-4 receptor, etc.), enzymes (eg, beta-glucosidase ), alpha-galactosidase, beta-galactosidase, iduronidase, iduronate-2-sulfatase, galactose-6 -Sulfatase (Galactose-6-sulfatase), acid alpha-glucosidase (acid alpha-glucosidase), acid ceramidase (acid ceramidase), acid sphingomyelinsase (acid sphingomyelinsase), galactocerebrosidase ( galactocerebrosidsase), arylsulfatase A, B, beta-hexosaminidase A, B, heparin-N-sulfatase (hepari) n N-sulfatase), alpha-D-mannosidase, beta-glucuronidase, N-acetylgalactosamine-6-sulfatase (N-acetylgalactosamine- 6 sulfatase), lysosomal acid lipase, alpha-N-acetyl-glucosaminidase, glucocerebrosidase, butyrylcholinesterase ), chitinase, glutamate decarboxylase, imiglucerase, lipase, uricase, platelet-activating factor acetylhydrolase , neutral endopeptidase, myeloperoxidase, alpha-galactosidase-A, agalsidase alpha, beta, alpha-L-iduronidase (alpha-) L-iduronidase, butyrylcholinesterase, chitinase, glutamate decarboxylase, imiglucerase, lipase, uricase, platelet-activating factor acetylhydrolase, neutral endopeptidase, and myeloperoxidase, etc.), interleukins and cytokine binding proteins (e.g. IL- 18bp, TNF-binding protein, etc.), macrophage activator, macrophage peptide, B cell factor, T cell factor, protein A, allergy suppressor, cell Necrotizing glycoprotein, immunotoxin, lymphotoxin, tumor necrosis factor, tumor suppressor, metastatic growth factor, alpha-1 antitrypsin, albumin, alpha-lactalbumin, apolipoprotein-E, erythropoietin, High glycosylated erythropoietin, angiopoietin, hemoglobin, thrombin, thrombin receptor activating peptide, thrombomodulin, blood factor VII, blood factor VIIa, blood factor VIII, blood factor IX , blood factor XIII, plasminogen activator, fibrin-binding peptide, urokinase, streptokinase, hirudin, protein C, C-reactive protein, renin inhibitor, collagenase inhibitor, superoxide dismutase, leptin , platelet-derived growth factor, epidermal growth factor, epidermal growth factor, angiostatin, angiotensin, bone growth factor, bone growth promoting protein, calcitonin, insulin, attriopeptin, cartilage inducer, elkato nin, connective tissue activator, tissue factor pathway inhibitor, follicle stimulating hormone, luteinizing hormone, luteinizing hormone releasing hormone, nerve growth factors (e.g., nerve growth factor, ciliary neurotrophic factor ( cilliary neurotrophic factor, axogenesis factor-1, brain-natriuretic peptide, glial derived neurotrophic factor, netrin, neutrophil inhibitor ( neurophil inhibitor factor), neurotrophic factor, neuturin, parathyroid hormone, relaxin, secretin, somatomedin, insulin-like growth factor, corticosteroid, glucagon, cholecystokinin, pancreatic polypeptide, gastrin-releasing peptide, corticotropin pin-releasing factor, thyroid-stimulating hormone , autotaxin, lactoferrin, myostatin, ADNP (activity-dependent neuroprotective protein), BACE1 (beta-secretase1), APP (Amyloid Precursor Protein), NCAM (Neural cell adhesion molecule), amyloid Beta (Amyloid beta), Tau (Tau), RAGE (receptor for advanced glycation endproducts), alpha-synuclein (alpha-synuclein), or their agonist or antagonist, their receptors (eg, TNFR (P75); TNFR (P55), IL-1 receptor, VEGF receptor, B cell activator receptor, etc.), receptor antagonist (eg IL1-Ra, etc.), cell surface antigen (eg CD 2, 3, 4, 5, 7, 11a, 11b, 18, 19, 20, 23, 25, 33, 38, 40, 45, 69, etc.), monoclonal antibodies, polyclonal antibodies, antibody fragments (eg scFv, Fab, Fab', F(ab) ')2 and Fd), virus-derived vaccine antigens, hybrid polypeptides or chimeric polypeptides that activate one or more receptor agonists, but are not limited thereto.

본 발명에서 적용 가능한 생리활성 폴리펩타이드는 천연형이거나, 대장균과 같은 원핵세포나 효모세포, 곤충세포 또는 동물세포와 같은 진핵세포에서 유전자 재조합에 의해 생산된 것일 수 있으며, 또한 천연형과 동등한 활성 또는 동종의 활성을 보유하는 아날로그일 수 있으며, 예컨대 하나 이상의 아미노산 위치에서 돌연변이가 일어난 유도체일 수 있으나, 이에 제한되지 않는다.The physiologically active polypeptide applicable in the present invention may be in its native form, or may be produced by genetic recombination in prokaryotic cells such as E. coli or eukaryotic cells such as yeast cells, insect cells or animal cells, and also have the same activity or It may be an analog having homologous activity, for example, a derivative in which one or more amino acid positions are mutated, but is not limited thereto.

한편, 상기 GLP-1 수용체 아고니스트는 천연형 엑센딘-4, 엑센딘-4의 N-말단 아민 그룹이 제거된 엑센딘-4 유도체, 엑센딘-4의 N-말단 아민 그룹이 하이드록실 그룹으로 치환된 엑센딘-4 유도체, 엑센딘-4의 N-말단 아민 그룹이 디메틸기로 수식된 엑센딘-4 유도체, 엑센딘-4의 첫 번째 아미노산(히스티딘)의 알파 탄소를 제거 (deletion)한 엑센딘-4 유도체, 엑센딘-4의 열두 번째 아미노산(라이신)이 세린으로 치환된 엑센딘-4 유도체, 및 엑센딘-4의 열두 번째 아미노산(라이신)이 알지닌으로 치환된 엑센딘-4 유도체로 이루어진 군에서 선택될 수 있으나, 특별히 이에 제한되지 않는다. On the other hand, the GLP-1 receptor agonist is a native exendin-4, an exendin-4 derivative in which the N-terminal amine group of exendin-4 is removed, and the N-terminal amine group of exendin-4 is a hydroxyl group. Exendin-4 derivatives substituted with , exendin-4 derivatives in which the N-terminal amine group of exendin-4 is modified with a dimethyl group, alpha carbon of the first amino acid (histidine) of exendin-4 is removed (deletion) exendin-4 derivatives, exendin-4 derivatives in which the twelfth amino acid (lysine) of exendin-4 is substituted with serine, and exendin-4 in which the twelfth amino acid (lysine) of exendin-4 is substituted with arginine It may be selected from the group consisting of derivatives, but is not particularly limited thereto.

본 발명에서 용어, "L1 및/또는 L2"는 상기 뇌 표적 지속형 결합체의 모이어티 (moiety)를 이루는 일 구성요소로, F1 또는 F2, 예를 들어, 면역글로불린 Fc 영역에 뇌 표적 펩타이드 또는 생리활성 물질을 결합시키는 링커를 의미한다. 상기 링커(linker)란 기본적으로는 두 개의 융합 파트너를 공유결합 등을 이용하여 연결할 수 있는 연결체를 의미한다. 링커는 융합 파트너를 연결하는 역할 외에도 융합 파트너 사이에 일정한 크기의 간격을 부여하는 역할을 수행하거나, 유연성 또는 강직정을 제공하는 역할을 수행할 수 있다. 그러나, 특별히 이에 제한되는 것은 아니다. In the present invention, the term "L 1 and/or L 2 "is a component constituting the moiety of the brain-targeting long-acting conjugate, and refers to a linker that binds a brain-targeting peptide or a physiologically active substance to F1 or F2, for example, an immunoglobulin Fc region. The linker basically means a linker that can connect two fusion partners using a covalent bond, etc. In addition to the role of connecting the fusion partners, the linker provides a gap of a certain size between the fusion partners. It may perform a role, or a role that provides flexibility or rigidity, but is not particularly limited thereto.

L1 및 L2는 각각 독립적으로 펩타이드성 링커 또는 비펩타이드성 링커일 수 있다. 구체적으로, 상기 L1 및 L2 중 하나는 펩타이드성 링커이고, 또 다른 하나는 비펩타이드성 링커일 수 있고, 상기 L1 및 L2 모두가 펩타이드성 링커일 수 있으며, 다른 한편으로는 상기 L1 및 L2 중 모두가 비펩타이드성 링커일 수 있으나, 특별히 이에 제한되지 않는다. L 1 and L 2 may each independently be a peptidic linker or a non-peptidyl linker. Specifically, one of L 1 and L 2 may be a peptidic linker, the other may be a non-peptidyl linker, and both L 1 and L 2 may be a peptidic linker, and on the other hand, the L All of 1 and L 2 may be a non-peptidyl linker, but is not particularly limited thereto.

하나의 구체적인 양태에서, 상기 뇌 표적 지속형 결합체에서, 상기 L1 및 L2 중 어느 하나 또는 둘 다가 펩타이드성 링커일 때, 상기 X와 F1 및 Y와 F2는 각각 독립적으로 공유 화학결합, 비공유 화학결합 또는 이들의 조합으로 L1 및 L2 에 의해 서로 결합되고, L1 및 L2는 각각 독립적으로 0개부터 1000개의 아미노산을 포함하는 것일 수 있다. 펩타이드성 링커가 0개의 아미노산인 경우는 공유 화학결합인 펩타이드 결합에 의해 결합된 것일 수 있다.In one specific embodiment, in the brain-targeting long-acting conjugate, when any one or both of L 1 and L 2 is a peptidic linker, X and F1 and Y and F2 are each independently a covalent chemical bond, a non-covalent chemical bond A bond or a combination thereof is coupled to each other by L 1 and L 2 , and L 1 and L 2 may each independently include 0 to 1000 amino acids. When the peptidic linker is 0 amino acids, it may be bound by a peptide bond, which is a covalent chemical bond.

구체적으로, 상기 뇌 표적 지속형 결합체에서, L1 및 L2 중 어느 하나가 펩타이드성 링커이고, 이 중 다른 하나는 비펩타이드성 링커이며, 이때 상기 펩타이드성 링커는 0부터 1000개의 아미노산을 포함하는 링커이며, 상기 비펩타이드성 링커는 폴리에틸렌글리콜, 폴리프로필렌 글리콜, 에틸렌 글리콜-프로필렌 글리콜 공중합체, 폴리옥시에틸화폴리올, 폴리비닐알콜, 다당류, 덱스트란, 폴리비닐에틸에테르, 생분해성 고분자, 지질 중합체, 키틴, 히알루론산, 지방산, 고분자 중합체, 저분자 화합물, 뉴클레오타이드 및 이들의 조합으로 이루어진 군으로부터 선택되는 비펩타이드성 링커일 수 있다. 그러나, 이에 제한되지는 않는다. Specifically, in the brain target long-acting conjugate, any one of L 1 and L 2 is a peptidic linker, and the other is a non-peptidyl linker, wherein the peptidic linker contains 0 to 1000 amino acids. A linker, and the non-peptide linker is polyethylene glycol, polypropylene glycol, ethylene glycol-propylene glycol copolymer, polyoxyethylated polyol, polyvinyl alcohol, polysaccharide, dextran, polyvinyl ethyl ether, biodegradable polymer, lipid polymer , chitin, hyaluronic acid, fatty acids, high molecular weight polymers, low molecular weight compounds, may be a non-peptidyl linker selected from the group consisting of nucleotides and combinations thereof. However, it is not limited thereto.

예를 들어, 상기 화학식 1의 L1 및 L2 중 어느 하나는 펩타이드성 링커이고, 이 중 다른 하나는 비펩타이드성 링커일 때, 펩타이드성 링커는 0부터 1000개의 아미노산을 포함하는 링커이며, 비펩타이드성 링커는 폴리에틸렌 글리콜일 수 있다. 그러나, 이에 제한되지는 않는다. For example, when any one of L 1 and L 2 in Formula 1 is a peptidic linker, and the other one is a non-peptidyl linker, the peptidic linker is a linker containing 0 to 1000 amino acids, and The peptidic linker may be polyethylene glycol. However, it is not limited thereto.

또한, 구체적으로 상기 뇌 표적 지속형 결합체에서, L1 및 L2 모두가 펩타이드성 링커이고, 이때 L1 및 L2는 각각 독립적으로 0부터 1000개의 아미노산을 포함하는 링커일 수 있다. 그러나, 이에 제한되지는 않는다. In addition, specifically, in the brain-targeting long-acting conjugate, both L 1 and L 2 are peptidic linkers, wherein L 1 and L 2 may each independently be a linker comprising 0 to 1000 amino acids. However, it is not limited thereto.

또한, L1 및 L2 중 어느 하나 또는 둘 다가 펩타이드성 링커일 때, L1 및 L2 는 0개의 아미노산으로 이루어지고, 상기 결합체는 (i) X와 F1 간의 펩타이드 결합, (ii) Y와 F2 간의 펩타이드 결합; 또는 (iii) X와 F1 간의 펩타이드 결합 및 Y와 F2 간의 펩타이드 결합을 포함할 수 있다. In addition, when any one or both of L 1 and L 2 is a peptidic linker, L 1 and L 2 consist of 0 amino acids, and the conjugate is (i) a peptide bond between X and F1, (ii) Y and peptide bond between F2; or (iii) a peptide bond between X and F1 and a peptide bond between Y and F2.

즉, X와 F1; 및 Y와 F2는 펩타이드 결합에 의하여 직접적으로 융합될 수 있다. i.e. X and F1; and Y and F2 may be directly fused by a peptide bond.

또한, 구체적으로 상기 뇌 표적 지속형 결합체에서, L1 및 L2 모두가 비펩타이드성 링커이고, 이때 L1 및 L2는 각각 독립적으로 폴리에틸렌글리콜, 폴리프로필렌 글리콜, 에틸렌 글리콜-프로필렌 글리콜 공중합체, 폴리옥시에틸화폴리올, 폴리비닐알콜, 다당류, 덱스트란, 폴리비닐에틸에테르, 생분해성 고분자, 지질 중합체, 키틴, 히알루론산, 지방산, 고분자 중합체, 저분자 화합물, 뉴클레오타이드 및 이들의 조합으로 이루어진 군으로부터 선택되는 링커일 수 있다. 그러나, 이에 제한되지는 않는다. In addition, specifically, in the brain-targeting long-acting conjugate, both L 1 and L 2 are non-peptidyl linkers, wherein L 1 and L 2 are each independently polyethylene glycol, polypropylene glycol, ethylene glycol-propylene glycol copolymer, Polyoxyethylated polyol, polyvinyl alcohol, polysaccharide, dextran, polyvinyl ethyl ether, biodegradable polymer, lipid polymer, chitin, hyaluronic acid, fatty acid, high molecular weight polymer, low molecular weight compound, selected from the group consisting of nucleotides and combinations thereof It may be a linker that becomes However, it is not limited thereto.

본 발명에서 "펩타이드성 링커"는 두 개의 융합 파트너 연결하는 펩타이드 결합 또는 아미노산의 중합체를 포함한다. 구체적으로, 상기 펩타이드성 링커는 0개 내지 1000개의 아미노산 서열을 포함할 수 있으며, 보다 구체적으로 0개 내지 900개, 0개 내지 800개, 0개 내지 700개, 0개 내지 600개, 0개 내지 500개, 0개 내지 400개, 0개 내지 300개, 0개 내지 250개, 0개 내지 200개, 0개 내지 150개, 0개 내지 100개, 0개 내지 90개, 0개 내지 80개, 0개 내지 70개, 0개 내지 60개, 0개 내지 50개, 0개 내지 40개, 0개 내지 30개, 0개 내지 25개, 0개 내지 20개, 0개 내지 15개, 또는 0개 내지 10개의 아미노산 서열을 포함할 수 있으나, 특별히 이에 제한되지 않는다. In the present invention, "peptidyl linker" includes a peptide bond or a polymer of amino acids connecting two fusion partners. Specifically, the peptidic linker may include a sequence of 0 to 1000 amino acids, more specifically 0 to 900, 0 to 800, 0 to 700, 0 to 600, 0 to 500, 0 to 400, 0 to 300, 0 to 250, 0 to 200, 0 to 150, 0 to 100, 0 to 90, 0 to 80 0 to 70, 0 to 60, 0 to 50, 0 to 40, 0 to 30, 0 to 25, 0 to 20, 0 to 15, Or it may include a 0 to 10 amino acid sequence, but is not particularly limited thereto.

또한, 상기 펩타이드성 링커의 예로는, GGGGS (서열번호: 47) 모티프, GS 모티프, GGGS (서열번호: 48) 모티프, 또는 GGSG (서열번호: 49) 모티프가 반복되는 형태의 아미노산 서열로 구성되는 펩타이드를 들 수 있으며, 상기 모티프가 1 내지 10번 반복될 수 있으나, 특별히 이에 제한되는 것은 아니다. In addition, examples of the peptidic linker include a GGGGS (SEQ ID NO: 47) motif, a GS motif, a GGGS (SEQ ID NO: 48) motif, or an amino acid sequence in which the GGSG (SEQ ID NO: 49) motif is repeated. and peptides, and the motif may be repeated 1 to 10 times, but is not particularly limited thereto.

본 발명에서 상기 "비펩타이드성 링커"는 반복 단위가 2개 이상 결합된 생체적합성 링커를 의미하며, 상기 반복 단위들은 펩타이드 결합이 아닌 임의의 공유결합을 통해 서로 연결된다.In the present invention, the "non-peptidyl linker" refers to a biocompatible linker in which two or more repeating units are bonded, and the repeating units are linked to each other through any covalent bond rather than a peptide bond.

상기 비펩타이드성 링커는 폴리에틸렌 글리콜, 폴리프로필렌 글리콜, 에틸렌 글리콜과 프로필렌 글리콜의 공중합체, 폴리옥시 에틸화 폴리올, 폴리비닐 알콜, 다당류, 덱스트란, 폴리비닐 에틸 에테르, PLA(폴리락트산, polylactic acid) 및 PLGA(폴리락틱-글리콜산, polylactic-glycolic acid)와 같은 생분해성 고분자, 지질 중합체, 키틴, 히알루론산, 올리고뉴클레오타이드 및 이들의 조합으로 구성된 군으로부터 선택될 수 있으며, 그 예로 폴리에틸렌글리콜일 수 있으나, 이에 제한되지 않는다. 당해 분야에 이미 알려진 이들의 유도체 및 당해 분야의 기술 수준에서 용이하게 제조할 수 있는 유도체들도 본 발명의 범위에 포함된다.The non-peptidyl linker is polyethylene glycol, polypropylene glycol, a copolymer of ethylene glycol and propylene glycol, polyoxyethylated polyol, polyvinyl alcohol, polysaccharide, dextran, polyvinyl ethyl ether, PLA (polylactic acid, polylactic acid) And it may be selected from the group consisting of biodegradable polymers such as PLGA (polylactic-glycolic acid), lipid polymers, chitin, hyaluronic acid, oligonucleotides, and combinations thereof, for example, polyethylene glycol, but , but not limited thereto. Derivatives thereof already known in the art and derivatives that can be easily prepared at the level of skill in the art are also included in the scope of the present invention.

본 발명에서 사용될 수 있는 비펩타이드성 링커는 생체 내 단백질 분해 효소에 저항성 있는 중합체이면 제한 없이 사용될 수 있다. 비펩타이드성 중합체의 분자량은 0 초과 약 100 kDa 범위, 구체적으로 약 1 내지 약 100 kDa 범위, 보다 더 구체적으로 약 1 내지 약 20 kDa 범위이나, 이에 제한되지 않는다. The non-peptidyl linker that can be used in the present invention may be used without limitation as long as it is a polymer resistant to proteolytic enzymes in vivo. The molecular weight of the non-peptidyl polymer is, but is not limited to, greater than 0 in the range of about 100 kDa, specifically in the range of about 1 to about 100 kDa, and even more specifically in the range of about 1 to about 20 kDa.

본 발명에서 용어, "약"은 ±0.5, ±0.4, ±0.3, ±0.2, ±0.1 등을 모두 포함하는 범위로, 약 이란 용어 뒤에 나오는 수치와 동등하거나 유사한 범위의 수치를 모두 포함하나, 이에 제한되지 않는다.In the present invention, the term “about” includes all values within a range including ±0.5, ±0.4, ±0.3, ±0.2, ±0.1, etc., and includes all values in a range equal to or similar to the value following the term about, but not limited

또한, 상기 비펩타이드성 링커는 한 종류의 중합체뿐만 아니라 상이한 종류의 중합체들의 조합이 사용될 수도 있다. In addition, as the non-peptidyl linker, not only one type of polymer, but also a combination of different types of polymers may be used.

한편, F1 또는 F2; 그리고 X 또는 Y와 공유 결합을 형성할 수 있도록, 결합체를 형성하기 전, 비펩타이드성 링커는 F1 또는 F2; 그리고 X 또는 Y의 작용기와 결합될 수 있는 작용기를 보유할 수 있다. On the other hand, F1 or F2; And, before forming a conjugate, the non-peptidyl linker is F1 or F2; And it may have a functional group capable of bonding to the functional group of X or Y.

구체적으로, 상기 비펩타이드성 링커는 적어도 2개의 말단 작용기를 가질 수 있으며, 구체적으로는 2개 또는 3개의 말단 작용기를 가질 수 있고, 보다 더 구체적으로는 2개의 말단 작용기를 가질 수 있다. Specifically, the non-peptidyl linker may have at least two terminal functional groups, specifically, may have two or three terminal functional groups, and more specifically, may have two terminal functional groups.

상기 작용기는 알데히드기, 말레이미드기 및 석시니미드 유도체로 구성된 군으로부터 선택될 수 있으나, 이에 제한되지 않는다. The functional group may be selected from the group consisting of an aldehyde group, a maleimide group and a succinimide derivative, but is not limited thereto.

상기에서, 알데히드기로 프로피온 알데히드기 또는 부틸 알데히드기를 예로서 들 수 있으나, 이에 제한되지 않는다. In the above, the aldehyde group may be exemplified by a propionaldehyde group or a butyl aldehyde group, but is not limited thereto.

상기에서, 석시니미드 유도체로는 석시니미딜 발레르에이트, 석시니미딜 메틸부타노에이트, 석시니미딜 메틸프로피온에이트, 석시니미딜 부타노에이트, 석시니미딜 프로피오네이트, N-하이드록시석시니미드, 히드록시 석시니미딜, 석시니미딜 카르복시메틸 또는 석시니미딜 카보네이트가 이용될 수 있으나, 이에 제한되지 않는다. In the above, as the succinimide derivative, succinimidyl valerate, succinimidyl methylbutanoate, succinimidyl methylpropionate, succinimidyl butanoate, succinimidyl propionate, N-hydroxysuccini Mead, hydroxy succinimidyl, succinimidyl carboxymethyl or succinimidyl carbonate may be used, but are not limited thereto.

상기 비펩타이드성 링커의 양 말단 작용기는 서로 같거나 다를 수 있다.The functional groups at both ends of the non-peptidyl linker may be the same as or different from each other.

예를 들어, 한쪽 말단에는 말레이미드기를, 다른 쪽 말단에는 알데히드기, 예컨대, 프로피온 알데히드기, 또는 부틸 알데히드기를 가질 수 있다. 양쪽 말단에 히드록시 작용기를 갖는 폴리에틸렌 글리콜을 비펩타이드성 중합체로 이용하는 경우에는 공지의 화학반응에 의해 상기 히드록시기를 상기 다양한 반응기로 활성화하거나, 상업적으로 입수 가능한 변형된 반응기를 갖는 폴리에틸렌 글리콜을 이용하여 본 발명의 결합체를 제조할 수 있다.For example, it may have a maleimide group at one end and an aldehyde group at the other end, such as a propion aldehyde group, or a butyl aldehyde group. When polyethylene glycol having a hydroxyl functional group at both ends is used as a non-peptidyl polymer, the hydroxyl group can be activated into the various reactive groups by a known chemical reaction, or by using a commercially available polyethylene glycol having a modified reactive group. The conjugates of the invention can be prepared.

또한, 상기 비펩타이드성 링커의 양 말단 또는 세 말단이 모두 알데히드기인 동종 기능성 비펩타이드성 중합체일 수 있다. In addition, the non-peptidyl linker may be a homogeneous functional non-peptidyl polymer in which both or all three ends of the non-peptidyl linker are aldehyde groups.

예컨대, 상기 비펩타이드성 링커는 양 말단에 프로피온 알데하이드기를 가지는 비펩타이드성 중합체, 구체적으로 양 말단에 프로피온 알데하이드기를 가지는 PEG일 수 있으나, 특별히 이에 제한되지 않는다. For example, the non-peptidyl linker may be a non-peptidyl polymer having propion aldehyde groups at both ends, specifically, PEG having propion aldehyde groups at both ends, but is not particularly limited thereto.

상기 비펩타이드성 링커가 양 말단에 반응 알데히드기의 작용기를 갖는 경우, 비특이적 반응을 최소화하고, 비펩타이드성 중합체의 양 말단에서 생리 활성 폴리펩타이드 및 면역글로불린과 각각 결합하는데 효과적이다. 알데히드 결합에 의한 환원성 아민화로 생성된 최종 산물은 아미드 결합으로 연결된 것보다 훨씬 안정적이다. 알데히드 작용기는 낮은 pH에서 N-말단에 선택적으로 반응하며, 높은 pH, 예를 들어 pH9.0 조건에서는 라이신 잔기와 공유결합을 형성할 수 있다.When the non-peptidyl linker has functional groups of reactive aldehyde groups at both ends, it is effective to minimize non-specific reactions and bind to bioactive polypeptides and immunoglobulins at both ends of the non-peptidyl polymer, respectively. The final product from reductive amination by aldehyde bonds is much more stable than those linked by amide bonds. The aldehyde functional group selectively reacts with the N-terminus at a low pH, and can form a covalent bond with a lysine residue at a high pH, for example, pH9.0.

본 발명에서 "F1 및 F2"는 면역글로불린 불변 영역을 포함하며, FcRn 결합부위를 포함하는 물질을 말한다. 구체적으로, 본 발명의 뇌 표적 지속형 결합체를 구성하는 하나의 모이어티에 해당한다. 그 예로, 상기 F1 및 F2는 FcRn 결합부위를 함유하는 면역글로불린 Fc 영역일 수 있다. In the present invention, "F1 and F2" refers to a substance including an immunoglobulin constant region and an FcRn binding site. Specifically, it corresponds to one moiety constituting the brain-targeting long-acting conjugate of the present invention. For example, the F1 and F2 may be an immunoglobulin Fc region containing an FcRn binding site.

상기 “면역글로불린 불변 영역”은 면역글로불린의 중쇄와 경쇄 가변영역, 중쇄 불변영역 1(CH1)과 경쇄 불변영역(CL1)을 제외한, 중쇄 불변영역 2 (CH2) 및 중쇄 불변영역 3 (CH3) 부분을 포함한다. 상기 면역글로불린 불변 영역은 면역글로불린 Fc 영역일 수 있다. 또한, 상기 면역글로불린 불변 영역은 중쇄 불변영역에 힌지(hinge) 부분을 포함하기도 한다.The “immunoglobulin constant region” refers to the heavy and light chain variable regions of immunoglobulin, heavy chain constant region 2 (CH2) and heavy chain constant region 3 (CH3) except for heavy chain constant region 1 (CH1) and light chain constant region (CL1) includes The immunoglobulin constant region may be an immunoglobulin Fc region. In addition, the immunoglobulin constant region may include a hinge portion to the heavy chain constant region.

상기 F1과 F2의 면역글로불린 불변 영역은 면역글로불린 CH1, CH2, CH3, 및 CH4 도메인으로 이루어진 군으로부터 선택된 1개 내지 4개의 도메인을 포함하는 것일 수 있다. The immunoglobulin constant regions of F1 and F2 may include one to four domains selected from the group consisting of immunoglobulin CH1, CH2, CH3, and CH4 domains.

구체적으로, 1) CH1 도메인, CH2 도메인, CH3 도메인 및 CH4 도메인, 2) CH1 도메인 및 CH2 도메인, 3) CH1 도메인 및 CH3 도메인, 4) CH2 도메인 및 CH3 도메인, 5) CH1 도메인, CH2 도메인, CH3 도메인 및 CH4 도메인 중 1개 또는 2개의 이상의 도메인과 면역글로불린 힌지 영역(또는 힌지 영역의 일부)와의 조합, 6) 중쇄 불변 영역 각 도메인과 경쇄 불변영역의 이량체일 수 있다.Specifically, 1) CH1 domain, CH2 domain, CH3 domain and CH4 domain, 2) CH1 domain and CH2 domain, 3) CH1 domain and CH3 domain, 4) CH2 domain and CH3 domain, 5) CH1 domain, CH2 domain, CH3 a combination of one or two or more domains of a domain and a CH4 domain with an immunoglobulin hinge region (or a part of a hinge region), 6) a heavy chain constant region, and a dimer of each domain and a light chain constant region.

구체적으로, 상기 F1의 면역글로불린 불변 영역 및 F2의 면역글로불린 불변 영역 각각은 힌지 영역, CH2 도메인 및 CH3 도메인을 포함할 수 있으나, 특별히 이에 제한되지는 않는다. Specifically, each of the immunoglobulin constant region of F1 and the immunoglobulin constant region of F2 may include a hinge region, a CH2 domain, and a CH3 domain, but is not particularly limited thereto.

보다 구체적으로, X-L1-F1 및 Y-L2-F2 간의 결합, 구체적으로 화학 결합 (예, 이황화 결합)을 효과적으로 형성하기 위하여, 상기 F1은 IgG1의 힌지 영역, CH2 도메인, 및 CH3 도메인을 포함하고, 여기서 CH3 도메인은 야생형 IgG1의 CH3 도메인의 아미노산 서열에서 26번 아미노산인 트레오닌(Thr)의 류신(Leu)으로의 치환 및/또는 59번 아미노산인 아스파르트산 (Asp)의 아르기닌(Arg)으로의 치환을 포함하며; 상기 F2는 IgG1의 힌지 영역, CH2 도메인 및 CH3 도메인을 포함하고, 상기 CH3 도메인은 야생형 IgG1의 CH3 도메인의 아미노산 서열에서 11번 아미노산인 류신(Leu)의 글루탐산(Glu)으로의 치환 및/또는 67번 아미노산인 티로신(Tyr)의 류신(Leu)으로의 치환 및/또는 69번 아미노산인 라이신(Lys)의 발린(Val)으로의 치환을 포함하는 것일 수 있으나, 특별히 이에 제한되는 것은 아니다. More specifically, in order to effectively form a bond between XL 1 -F1 and YL 2 -F2, specifically a chemical bond (eg, a disulfide bond), the F1 comprises a hinge region, a CH2 domain, and a CH3 domain of IgG1, Wherein the CH3 domain is the amino acid sequence of the CH3 domain of wild-type IgG1, amino acid 26 threonine (Thr) to leucine (Leu) and / or 59 amino acid aspartic acid (Asp) to arginine (Arg) includes; wherein F2 includes a hinge region, a CH2 domain and a CH3 domain of IgG1, wherein the CH3 domain is amino acid 11 in the amino acid sequence of the CH3 domain of wild-type IgG1, leucine (Leu) is substituted with glutamic acid (Glu) and/or 67 It may include substitution of amino acid tyrosine (Tyr) with leucine (Leu) and/or substitution of lysine (Lys) with valine (Val) as amino acid 69, but is not particularly limited thereto.

이와 같은 변이를 보유하는 면역글로불린 Fc 영역은 X-L1-F1 및 Y-L2-F2 간의 이종 이량체 (heterodimer) 형성을 촉진함으로써, 본 발명의 뇌 표적 지속형 단백질 결합체를 생산할 수 있다. The immunoglobulin Fc region having such a mutation promotes the formation of a heterodimer between XL 1 -F1 and YL 2 -F2, thereby producing the brain-targeting long-acting protein conjugate of the present invention.

상술한 변이 외에도 이종 이량체 형성을 촉진시킬수 있는 기타 다른 아미노산 변이는 제한 없이 포함되며, 이러한 변이들의 여러 조합이 본 발명의 범주에 포함된다. 본 발명의 실시예에서는 대표적인 예로 Fc 영역으로 IgG1을 이용하여 생산하였으나, IgG2, IgG3, IgG4등이 제한 없이 포함된다.In addition to the above-described mutations, other amino acid mutations capable of promoting heterodimer formation are included without limitation, and various combinations of these mutations are included in the scope of the present invention. In the embodiment of the present invention, as a representative example, IgG1 was produced as an Fc region, but IgG2, IgG3, IgG4, etc. are included without limitation.

천연형 IgG1의 아미노산 서열은 NCBI 또는 Unitprot과 같은 공지된 데이터 베이스를 통하여 수득할 수 있다. 상술한 야생형 IgG1의 CH3 도메인의 아미노산 서열을 서열번호: 50에 표시하였으나, 특별히 이에 제한되지는 않는다. The amino acid sequence of native IgG1 can be obtained through a known database such as NCBI or Unitprot. The amino acid sequence of the CH3 domain of the aforementioned wild-type IgG1 is shown in SEQ ID NO: 50, but is not particularly limited thereto.

또한, 본 발명의 면역글로불린 불변 영역은 천연형 아미노산 서열뿐만 아니라 이의 서열 유도체를 포함한다. 아미노산 서열 유도체란 천연 아미노산 서열 중의 하나 이상의 아미노산 잔기가 결실, 삽입, 비보전적 또는 보전적 치환 또는 이들의 조합에 의하여 상이한 서열을 가지는 것을 의미한다.In addition, the immunoglobulin constant region of the present invention includes a native amino acid sequence as well as a sequence derivative thereof. An amino acid sequence derivative means that one or more amino acid residues in a natural amino acid sequence have a different sequence by deletion, insertion, non-conservative or conservative substitution, or a combination thereof.

예를 들면, IgG Fc의 경우 결합에 중요하다고 알려진 214 내지 238, 297 내지 299, 318 내지 322 또는 327 내지 331번 아미노산 잔기들이 변형을 위해 적당한 부위로서 이용될 수 있다.For example, in the case of IgG Fc, amino acid residues 214 to 238, 297 to 299, 318 to 322, or 327 to 331 known to be important for binding may be used as suitable sites for modification.

또한, 이황화 결합을 형성할 수 있는 부위가 제거되거나, 천연형 Fc에서 N-말단의 몇몇 아미노산이 제거되거나 또는 천연형 Fc의 N-말단에 메티오닌 잔기가 부가될 수도 있는 등 다양한 종류의 유도체가 가능하다. 또한, 이펙터 기능을 없애기 위해 보체결합부위, 예로 C1q 결합부위가 제거될 수도 있고, ADCC (antibody dependent cell mediated cytotoxicity) 부위가 제거될 수도 있다. 이러한 면역글로불린 불변 영역의 서열 유도체를 제조하는 기술은 국제특허공개 제WO 97/34631호, 국제특허공개 제96/32478호 등에 개시되어 있다.In addition, various types of derivatives are possible, such as a site capable of forming a disulfide bond is removed, some amino acids at the N-terminus of native Fc are removed, or a methionine residue may be added to the N-terminus of native Fc do. In addition, in order to eliminate the effector function, the complement binding site, eg, the C1q binding site, may be removed, or the ADCC (antibody dependent cell mediated cytotoxicity) site may be removed. Techniques for preparing such an immunoglobulin constant region sequence derivative are disclosed in International Patent Publication Nos. WO 97/34631 and International Patent Publication No. 96/32478.

분자의 활성을 전체적으로 변경시키지 않는 단백질 및 펩타이드에서의 아미노산 교환은 당해 분야에 공지되어 있다 (H.Neurath, R.L.Hill, The Proteins, Academic Press, New York, 1979). 가장 통상적으로 일어나는 교환은 아미노산 잔기 Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Thy/Phe, Ala/Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Ala/Glu, Asp/Gly 간의 교환이다. 경우에 따라서는 인산화(phosphorylation), 황화(sulfation), 아크릴화(acrylation), 당화(glycosylation), 메틸화(methylation), 파네실화(farnesylation), 아세틸화(acetylation) 및 아미드화(amidation) 등으로 수식(modification)될 수도 있다.Amino acid exchanges in proteins and peptides that do not entirely alter the activity of the molecule are known in the art (H.Neurath, R.L.Hill, The Proteins, Academic Press, New York, 1979). The most common exchanges are amino acid residues Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Thy/Phe, Ala/ It is an exchange between Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Ala/Glu, Asp/Gly. In some cases, the formula (phosphorylation, sulfation, acrylation, glycosylation, methylation, farnesylation, acetylation, amidation, etc.) may be modified).

상기 기술한 면역글로불린 불변 영역 유도체는 본 발명의 면역글로불린 불변 영역 영역과 동등한 생물학적 활성을 나타내며 면역글로불린 불변 영역의 열, pH 등에 대한 구조적 안정성을 증대시킨 것일 수 있다. The above-described immunoglobulin constant region derivative may exhibit biological activity equivalent to that of the immunoglobulin constant region of the present invention and increase the structural stability of the immunoglobulin constant region against heat, pH, and the like.

또한, 이러한 면역글로불린 불변 영역은 인간, 소, 염소, 돼지, 마우스, 래빗, 햄스터, 랫트 또는 기니아 픽 등의 동물의 생체 내에서 분리한 천연형으로부터 얻어질 수도 있고, 형질전환된 동물세포 또는 미생물로부터 얻어진 재조합형 또는 이의 유도체일 수 있다. 여기서, 천연형으로부터 획득하는 방법은 전체 면역글로불린을 인간 또는 동물의 생체로부터 분리한 후, 단백질 분해효소를 처리하여 획득하는 방법일 수 있다. 파파인을 처리할 경우에는 Fab 및 Fc로 절단되고, 펩신을 처리할 경우에는 pF'c 및 F(ab)2로 절단된다. 이를 크기 배제 크로마토그래피 (size-exclusion chromatography) 등을 이용하여 Fc 또는 pF'c를 분리할 수 있다. 더 구체적인 실시 형태에서는 인간 유래의 Fc 영역을 미생물로부터 수득한 재조합형 면역글로불린 Fc 영역이다.In addition, the immunoglobulin constant region may be obtained from a native type isolated in vivo from animals such as humans, cattle, goats, pigs, mice, rabbits, hamsters, rats, or guinea pigs, transformed animal cells or microorganisms It may be a recombinant obtained from or a derivative thereof. Here, the method of obtaining from the native type may be a method of obtaining whole immunoglobulin by isolating it from a living body of a human or animal and then treating it with a proteolytic enzyme. When treated with papain, it is cleaved into Fab and Fc, and when treated with pepsin, it is cleaved into pF'c and F(ab) 2 . In this case, Fc or pF'c may be separated using size-exclusion chromatography or the like. In a more specific embodiment, it is a recombinant immunoglobulin Fc region obtained from a human-derived Fc region from a microorganism.

또한, 면역글로불린 불변 영역은 천연형 당쇄, 천연형에 비해 증가된 당쇄, 천연형에 비해 감소한 당쇄 또는 당쇄가 제거된 형태일 수 있다. 이러한 면역글로불린 Fc 당쇄의 증감 또는 제거에는 화학적 방법, 효소학적 방법 및 미생물을 이용한 유전 공학적 방법과 같은 통상적인 방법이 이용될 수 있다. 여기서, Fc에서 당쇄가 제거된 면역글로불린 Fc 영역은 보체(c1q)와의 결합력이 현저히 저하되고, 항체-의존성 세포독성 또는 보체-의존성 세포 독성이 감소 또는 제거되므로, 생체 내에서 불필요한 면역 반응을 유발하지 않는다. 이런 점에서 약물의 캐리어로서의 본래의 목적에 보다 부합하는 형태는 당쇄가 제거되거나 비당쇄화된 면역글로불린 불변 영역이라 할 것이다.In addition, the immunoglobulin constant region may have a native sugar chain, an increased sugar chain compared to the native type, a decreased sugar chain compared to the native type, or a form in which the sugar chain is removed. Conventional methods such as chemical methods, enzymatic methods, and genetic engineering methods using microorganisms may be used for the increase or decrease or removal of such immunoglobulin Fc sugar chains. Here, the immunoglobulin Fc region from which the sugar chains are removed from the Fc has significantly reduced binding to complement (c1q) and reduced or eliminated antibody-dependent cytotoxicity or complement-dependent cytotoxicity, so that unnecessary immune responses in vivo are not induced. does not In this respect, a form more suitable for the original purpose as a drug carrier will be an immunoglobulin constant region in which sugar chains are removed or non-glycosylated.

본 발명에서 "당쇄의 제거(Deglycosylation)"는 효소로 당을 제거한 Fc 영역을 말하며, 비당쇄화(Aglycosylation)는 원핵동물, 더 구체적인 실시 형태에서는 대장균에서 생산하여 당쇄화되지 않은 면역글로불린 불변 영역을 의미한다.In the present invention, "deglycosylation" refers to an Fc region from which sugars are removed with an enzyme, and aglycosylation refers to an immunoglobulin constant region that is not glycosylated produced in prokaryotes, and in a more specific embodiment, E. coli. it means.

한편, 면역글로불린 불변 영역은 인간 또는 소, 염소, 돼지, 마우스, 래빗, 햄스터, 랫트, 기니아 픽 등의 동물기원일 수 있으며, 더 구체적인 실시 형태에서는 인간기원이다.Meanwhile, the immunoglobulin constant region may be of human or animal origin, such as cattle, goats, pigs, mice, rabbits, hamsters, rats, and guinea pigs, and in a more specific embodiment, it is of human origin.

또한, 면역글로불린 불변 영역은 IgG, IgA, IgD, IgE, IgM 유래 또는 이들의 조합(combination) 또는 이들의 혼성(hybrid)에 의한 면역글로불린 불변 영역일 수 있다. 더 구체적인 실시 형태에서는 인간 혈액에 가장 풍부한 IgG 또는 IgM유래이며 보다 더 구체적인 실시 형태에서는 리간드 결합 단백질의 반감기를 향상시키는 것으로 공지된 IgG 유래이다. 더욱 더 구체적인 실시 형태에서 상기 면역글로불린 Fc 영역은 IgG1 Fc 영역 또는 IgG4 Fc 영역이나, 이에 제한되는 것은 아니다. In addition, the immunoglobulin constant region may be an immunoglobulin constant region derived from IgG, IgA, IgD, IgE, or IgM, or a combination or hybrid thereof. In a more specific embodiment, it is derived from IgG or IgM, which is most abundant in human blood, and in a more specific embodiment it is derived from IgG, which is known to enhance the half-life of ligand binding proteins. In an even more specific embodiment, the immunoglobulin Fc region is an IgG1 Fc region or an IgG4 Fc region, but is not limited thereto.

한편, 본 발명에서 "조합(combination)"이란 이량체 또는 다량체를 형성할 때, 동일 기원 단쇄 면역글로불린 불변 영역을 암호화하는 폴리펩타이드가 상이한 기원의 단쇄 폴리펩타이드와 결합을 형성하는 것을 의미한다. 즉, IgG Fc, IgA Fc, IgM Fc, IgD Fc 및 IgE의 Fc 단편으로 이루어진 그룹으로부터 선택된 2개 이상의 단편으로부터 이량체 또는 다량체의 제조가 가능하다.Meanwhile, in the present invention, "combination" means that when forming a dimer or a multimer, a polypeptide encoding a single-chain immunoglobulin constant region of the same origin forms a bond with a single-chain polypeptide of a different origin. That is, it is possible to prepare a dimer or multimer from two or more fragments selected from the group consisting of IgG Fc, IgA Fc, IgM Fc, IgD Fc and IgE Fc fragment.

본 발명에서 "하이브리드(hybrid)"란 단쇄의 면역글로불린 불변 영역 내에 2개 이상의 상이한 기원의 면역글로불린 불변 영역에 해당하는 서열이 존재함을 의미하는 용어이다. 본 발명의 경우 여러 형태의 하이브리드가 가능하다. 즉, IgG Fc, IgM Fc, IgA Fc, IgE Fc 및 IgD Fc의 CH1, CH2, CH3 및 CH4로 이루어진 그룹으로부터 1개 내지 4개 도메인으로 이루어진 도메인의 하이브리드가 가능하며, 힌지를 포함할 수 있다.In the present invention, "hybrid" is a term meaning that sequences corresponding to immunoglobulin constant regions of two or more different origins exist in a single-chain immunoglobulin constant region. In the case of the present invention, various types of hybrids are possible. That is, a hybrid of domains consisting of 1 to 4 domains from the group consisting of CH1, CH2, CH3 and CH4 of IgG Fc, IgM Fc, IgA Fc, IgE Fc and IgD Fc is possible, and may include a hinge.

본 발명을 구현하는 다른 하나의 양태는 상기 뇌 표적 지속형 단백질 결합체를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 발현 벡터, 및 상기 발현 벡터를 포함하는 형질전환체를 제공한다. Another aspect embodying the present invention provides a polynucleotide encoding the brain target long-acting protein conjugate, an expression vector comprising the polynucleotide, and a transformant comprising the expression vector.

상기 뇌 표적 지속형 단백질 결합체에 대해서는 앞서 설명한 바와 같다. The brain-targeting long-acting protein conjugate is the same as described above.

상기 결합체를 코딩하는 분리된 폴리뉴클레오티드는 해당 서열과 75% 이상, 구체적으로는 85% 이상, 보다 구체적으로는 90% 이상, 더욱 구체적으로는 95% 이상의 서열 동일성을 가지는 폴리뉴클레오티드 서열을 본 발명의 범주에 포함한다. The isolated polynucleotide encoding the conjugate comprises a polynucleotide sequence having 75% or more, specifically 85% or more, more specifically 90% or more, and more specifically 95% or more sequence identity to the corresponding sequence. included in the category.

하나의 구체예로서, In one embodiment,

본 발명은 X-L1-F1를 코딩하는 폴리뉴클레오티드를 포함하는 발현 카세트 및 Y-L2-F2를 코딩하는 폴리뉴클레오티드를 포함하는 발현 카세트를 포함하며, The present invention includes an expression cassette comprising a polynucleotide encoding XL 1 -F1 and an expression cassette comprising a polynucleotide encoding YL 2 -F2,

X 및 Y는 각각 독립적으로 생리활성 물질 또는 뇌 표적 펩타이드로, X 및 Y 중 하나가 생리활성 물질이면 다른 하나는 뇌 표적 펩타이드이고; L1 및 L2는 각각 펩타이드성 링커이고, L1 및 L2중 어느 하나 또는 이들 둘 다가 펩타이드성 링커일 때, 상기 펩타이드성 링커는 0개부터 1000개의 아미노산을 포함하며, F1 및 F2는 각각 독립적으로 면역글로불린 불변 영역을 포함하며, FcRn 결합부위를 포함하는 물질인 것을 특징으로 하는 뇌 표적 지속형 결합체를 발현하는 발현벡터를 제공한다. X and Y are each independently a physiologically active substance or a brain-targeting peptide, and if one of X and Y is a physiologically active substance, the other is a brain-targeting peptide; L 1 and L 2 are each a peptidic linker, and when either or both of L 1 and L 2 are peptidic linkers, the peptidic linker contains 0 to 1000 amino acids, and F1 and F2 are each It provides an expression vector expressing a brain-targeting sustained-type conjugate, characterized in that it is a material that independently includes an immunoglobulin constant region and includes an FcRn binding site.

상기 발현 카세트는 목적하는 단백질, 구체적으로 X-L1-F1 또는 Y-L2-F2의 발현을 위하여 필요한 구성요소, 예컨대 프로모터 등을 포함할 수 있다. The expression cassette may include elements necessary for expression of a desired protein, specifically XL 1 -F1 or YL 2 -F2, such as a promoter.

본 발명에 따른 재조합 벡터는 전형적으로 클로닝을 위한 벡터 또는 발현을 위한 벡터로서 구축될 수 있고, 원핵세포 또는 진핵세포를 숙주세포로 하여 구축될 수 있다.The recombinant vector according to the present invention may be typically constructed as a vector for cloning or as a vector for expression, and may be constructed using a prokaryotic or eukaryotic cell as a host cell.

본 발명에서 용어, "벡터"란 적당한 숙주세포에서 목적 단백질을 발현할 수 있는 재조합 벡터로서, 핵산 삽입물이 발현되도록 작동 가능하게 연결된 필수적인 조절요소를 포함하는 핵산 구조물(construct)을 의미한다. As used herein, the term "vector" refers to a recombinant vector capable of expressing a target protein in a suitable host cell, and refers to a nucleic acid construct including essential regulatory elements operably linked to express a nucleic acid insert.

상기 재조합 벡터를 숙주세포에 형질전환(transformation) 또는 형질감염(transfection) 시킴으로써, 본 발명의 뇌 표적 지속형 결합체를 수득할 수 있다. By transforming or transfecting the recombinant vector into a host cell, the brain-targeting sustained-type conjugate of the present invention can be obtained.

본 발명에서 상기 X-L1-F1를 코딩하는 폴리뉴클레오티드 및 Y-L2-F2를 코딩하는 폴리뉴클레오티드는 프로모터에 작동 가능하게 연결될 수 있다. In the present invention, the polynucleotide encoding XL 1 -F1 and the polynucleotide encoding YL 2 -F2 may be operably linked to a promoter.

본 발명에 따른 폴리뉴클레오티드를 포함하는 재조합 벡터를 형질전환시키기 위한 방법은 상기 예들에 국한되지 않으며, 당업계에서 통상적으로 사용되는 형질전환 또는 형질감염 방법이 제한 없이 사용될 수 있다. The method for transforming the recombinant vector including the polynucleotide according to the present invention is not limited to the above examples, and transformation or transfection methods commonly used in the art may be used without limitation.

본 발명에 따른 폴리뉴클레오티드를 포함하는 재조합 벡터를 숙주세포 내로 도입함으로써 본 발명의 형질전환체(transformant)를 획득할 수 있다. The transformant of the present invention can be obtained by introducing a recombinant vector containing the polynucleotide according to the present invention into a host cell.

본 발명에 적합한 숙주는 본 발명에 따른 폴리뉴클레오티드를 발현하도록 하는 한 특별히 제한되지 않는다. 본 발명에 사용될 수 있는 숙주의 특정한 예로는 대장균(E. coli)과 같은 에스케리키아(Escherichia) 속 세균; 바실러스 서브틸리스(Bacillus subtilis)와 같은 바실러스(Bacillus) 속 세균; 슈도모나스 푸티다(Pseudomonas putida)와 같은 슈도모나스(Pseudomonas) 속 세균; 피키아 파스토리스(Pichia pastoris), 사카로마이세스 세레비지애(Saccharomyces cerevisiae), 스키조사카로마이세스 폼베(Schizosaccharomyces pombe)와 같은 효모; 스포도프테라 프루기페르다(SF9)와 같은 곤충세포; 및 CHO, COS, BSC 등과 같은 동물세포가 있다. A host suitable for the present invention is not particularly limited as long as it allows expression of the polynucleotide according to the present invention. Specific examples of the host that can be used in the present invention include Escherichia bacteria such as E. coli ; Bacillus subtilis ( Bacillus subtilis ), such as Bacillus ( Bacillus ) genus bacteria; Bacteria of the genus Pseudomonas , such as Pseudomonas putida ; Pichia pastoris , Saccharomyces cerevisiae cerevisiae ), Schizosaccharomyces yeast such as pombe ); insect cells such as Spodoptera frugiperda (SF9); and animal cells such as CHO, COS, and BSC.

본 발명을 구현하는 다른 하나의 양태는 상기 뇌 표적 지속형 단백질 결합체의 제조 방법을 제공한다. Another aspect embodying the present invention provides a method for producing the brain target long-acting protein conjugate.

상기 뇌 표적 지속형 단백질 결합체에 대해서는 앞서 설명한 바와 같다. The brain-targeting long-acting protein conjugate is the same as described above.

구체적으로, 상기 제조 방법은 본 발명은 하기 단계를 포함할 수 있다:Specifically, the method of the present invention may include the following steps:

(a) X-L1-F1 및 L2-Y-F2를 각각 제공하는 단계; 및 (a) providing XL 1 -F1 and L 2 -Y-F2, respectively; and

(b) X-L1-F1 및 L2-Y-F2을 서로 접촉시켜 이들 간에 화학 결합을 형성하는 단계; (b) contacting XL 1 -F1 and L 2 -Y-F2 with each other to form a chemical bond therebetween;

여기서, here,

X 및 Y는 각각 독립적으로 생리활성 물질 또는 뇌 표적 펩타이드로, X 및 Y 중 하나가 생리활성 물질이면 다른 하나는 뇌 표적 펩타이드이고; X and Y are each independently a physiologically active substance or a brain-targeting peptide, and if one of X and Y is a physiologically active substance, the other is a brain-targeting peptide;

L1 및 L2는 각각 독립적으로 펩타이드성 링커 또는 비펩타이드성 링커이고,L 1 and L 2 are each independently a peptidic linker or a non-peptidyl linker,

L1 및 L2중 어느 하나 또는 이들 둘 다가 펩타이드성 링커일 때, 상기 펩타이드성 링커는 0개부터 1000개의 아미노산을 포함하고;when either or both of L 1 and L 2 are peptidic linkers, the peptidic linker comprises 0 to 1000 amino acids;

F1 및 F2는 각각 독립적으로 면역글로불린 불변 영역을 포함하며, FcRn 결합부위를 포함하는 물질임F1 and F2 each independently include an immunoglobulin constant region, and is a substance comprising an FcRn binding site

또한, 상기 제조방법은 (a) 상기 형질전환체를 배양하여 뇌 표적 지속형 결합체를 발현하는 단계; 및 (b) 상기 (a) 단계에서 발현된 뇌 표적 지속형 결합체를 회수하는 단계를 포함할 수 있으나, 이에 제한되지는 않는다. In addition, the manufacturing method comprises the steps of (a) culturing the transformant to express a brain-targeting long-acting conjugate; and (b) recovering the brain target long-acting conjugate expressed in step (a), but is not limited thereto.

구체적으로, X-L1-F1 및 L2-Y-F2 각각이 융합 단백질인 경우, 상기와 같은 방법을 통하여 본 발명의 뇌 표적 지속형 단백질 결합체를 제조할 수 있다. Specifically, when each of XL 1 -F1 and L 2 -Y-F2 is a fusion protein, the brain-targeting long-acting protein conjugate of the present invention can be prepared through the same method as described above.

상기 F1 및 F2가 힌지 영역을 포함하는 면역글로불린 불변 영역인 경우, 발현 숙주를 통해 생산되는 X-L1-F1 및 L2-Y-F2 각각 발현 후 접힘 과정에서 Fc 영역 간에 화학 결합, 구체적으로 이황화 결합을 형성함으로써 본 발명에 따른 뇌 표적 지속형 단백질 결합체가 제조될 수 있다.When F1 and F2 are immunoglobulin constant regions including a hinge region, chemical bonds, specifically disulfide bonds, between the Fc regions during folding after expression of XL 1 -F1 and L 2 -Y-F2 produced through an expression host, respectively By forming a brain target long-acting protein conjugate according to the present invention can be prepared.

본 발명을 구현하는 다른 하나의 양태는 상기 뇌 표적 지속형 단백질 결합체를 포함하는 조성물을 제공한다. Another aspect embodying the present invention provides a composition comprising the brain target long-acting protein conjugate.

상기 뇌 표적 지속형 단백질 결합체에 대해서는 앞서 설명한 바와 같다. The brain-targeting long-acting protein conjugate is the same as described above.

본 발명을 구현하는 다른 하나의 양태는 약제의 제조에 있어 상기 뇌 표적 지속형 단백질 결합체의 용도를 제공한다. Another aspect embodying the present invention provides the use of the brain-targeting long-acting protein conjugate in the manufacture of a medicament.

상기 뇌 표적 지속형 단백질 결합체에 대해서는 앞서 설명한 바와 같다. The brain-targeting long-acting protein conjugate is the same as described above.

이하, 하기 실시예에 의하여 본 발명을 보다 상세하게 설명한다. 단, 하기 실시예는 본 발명을 예시하기 위한 것일 뿐 본 발명의 범위가 이들로 한정되는 것은 아니다.Hereinafter, the present invention will be described in more detail by way of Examples. However, the following examples are only for illustrating the present invention, and the scope of the present invention is not limited thereto.

실시예Example 1: 발현 숙주 세포를 통한 면역글로불린 1: Immunoglobulin via expression host cell FcFc 영역이 변이된 area has been changed 신규한new 뇌 표적 지속형 단백질 결합체의 제조 Preparation of brain-targeting long-acting protein conjugate

이두로네이트-2-설파타제 (iduronate-2-sulfatase, IDS) 및 BTP5 (brain-targeting peptide 5) 각각에 면역글로불린 Fc 영역을 유전자 수준에서 융합하여 발현 벡터에 각각 삽입하였다.The immunoglobulin Fc region was fused to each of iduronate-2-sulfatase (IDS) and brain-targeting peptide 5 (BTP5) at the gene level and inserted into expression vectors, respectively.

구체적으로, 하기와 같은 IDS와 BTP5가 각각 포함된 결합체를 합성하였다 (표 1). IDS에 결합하는 면역글로불린 Fc 영역으로는 구체적으로 CH3 영역의 26번 아미노산인 트레오닌(Thr)이 류신(Leu)으로, 59번 아미노산인 아스파르트산(Asp)이 알지닌(Arg)으로 치환된 면역글로불린 Fc 영역을 사용하였으며, BTP5에 결합하는 면역글로불린 Fc 영역으로는 구체적으로 CH3 영역의 11번 아미노산인 류신(Leu)을 글루탐산(Glu)으로, 67번 아미노산인 티로신(Tyr)을 류신(Leu)으로, 69번 아미노산인 라이신(Lys)을 발린(Val)으로 치환된 면역글로불린 영역을 사용하여 합성하였다.Specifically, a conjugate containing each of IDS and BTP5 as shown below was synthesized (Table 1). In the immunoglobulin Fc region binding to IDS, specifically, immunoglobulin in which threonine (Thr), amino acid 26 of the CH3 region, is substituted with leucine (Leu), and amino acid aspartic acid (Asp), amino acid number 59, is substituted with arginine (Arg). The Fc region was used, and specifically, as an immunoglobulin Fc region binding to BTP5, leucine (Leu), amino acid 11 of the CH3 region, was used as glutamic acid (Glu), and amino acid tyrosine (Tyr), amino acid number 67, was changed to leucine (Leu). , was synthesized using an immunoglobulin region in which lysine (Lys), amino acid 69, was substituted with valine (Val).

Figure pat00001
Figure pat00001

Figure pat00002
Figure pat00002

Figure pat00003
Figure pat00003

Figure pat00004
Figure pat00004

Figure pat00005
Figure pat00005

실시예Example 2: 뇌 표적 2: brain target IDSIDS 지속형 결합체의 제조 Preparation of long-acting conjugates

상기 실시예 1 에서 합성한 IDS-IgG1 Fc 결합체와 BTP5-IgG1 Fc 결합체를 코딩하는 폴리뉴클레오티드 서열을 발현 벡터인 X0GC 벡터에 제한효소를 이용하여 각각 삽입하였다. Polynucleotide sequences encoding the IDS-IgG1 Fc conjugate and the BTP5-IgG1 Fc conjugate synthesized in Example 1 were respectively inserted into an expression vector, X0GC, using a restriction enzyme.

하나의 벡터에 상기 두 결합체를 코딩하는 서열들을 모두 삽입하기 위하여 먼저 BTP5-IgG1 Fc 결합체를 코딩하는 폴리뉴클레오티드 서열이 포함된 발현벡터에서 프로모터부터 폴리 A부분까지를 PCR로 증폭하였다. 이때 정방향 프라이머 끝에는 XhoI, 역방향 프라이머 끝에는 XbaI 제한효소 위치를 삽입하였다. 상기 XhoI과 XbaI은 IDS-IgG1 Fc 결합체를 코딩하는 폴리뉴클레오티드 서열과 BTP5-IgG1 Fc 결합체를 코딩하는 폴리뉴클레오티드 서열을 모두 자르지 않는 제한효소이다. IDS-IgG1 Fc 결합체를 코딩하는 폴리뉴클레오티드가 삽입된 발현벡터와 프로모터-BTP5-IgG1 Fc-Poly A PCR 산물을 각각 XhoI 및 XbaI으로 처리하여 절단시킨 후 리게이션(Ligation)을 하여 IDS-IgG1 Fc 결합체와 BTP5-IgG1 Fc 결합체를 각각 발현하는 하나의 발현벡터를 완성하였다.In order to insert both sequences encoding the two conjugates into one vector, first, in an expression vector containing a polynucleotide sequence encoding the BTP5-IgG1 Fc conjugate, from the promoter to the poly A part was amplified by PCR. At this time, XhoI was inserted at the end of the forward primer and XbaI restriction enzyme was inserted at the end of the reverse primer. The XhoI and XbaI are restriction enzymes that do not cut both the polynucleotide sequence encoding the IDS-IgG1 Fc conjugate and the polynucleotide sequence encoding the BTP5-IgG1 Fc conjugate. The expression vector into which the polynucleotide encoding the IDS-IgG1 Fc conjugate is inserted and the promoter-BTP5-IgG1 Fc-Poly A PCR product are treated with XhoI and XbaI, respectively, and cleaved, followed by ligation to perform ligation to the IDS-IgG1 Fc conjugate. and one expression vector expressing each of the BTP5-IgG1 Fc conjugates was completed.

상기 바이시스트로닉 발현 벡터를 숙주세포인 CHO 세포에서 발현하면 하나의 벡터에서 IDS-IgG1 Fc 결합체와 BTP5-IgG1 Fc 결합체에 대한 두 개의 mRNA 및 두 개의 단백질이 발현된다. 이때 발현되는 IDS-IgG1 Fc 결합체와 BTP5-IgG1 Fc 결합체들은 서로 이황화 결합을 하게 되는데 IgG1 CH3에 변이된 부분이 상기 결합체 간의 결합을 촉진시키는 역할을 하여 IDS-IgG1 Fc 결합체와 BTP5-IgG1 Fc 결합체가 서로 이종 이량체를 형성하는 뇌 표적 IDS 지속형 단백질 결합체를 제조할 수 있다. 또한, 상기와 같이 Fc 변이를 통한 이종 이량체의 형성 촉진을 통하여 신규한 뇌 표적 지속성 단백질 생산 수율을 높일 수 있다.When the bicistronic expression vector is expressed in CHO cells, which are host cells, two mRNAs and two proteins for the IDS-IgG1 Fc conjugate and the BTP5-IgG1 Fc conjugate are expressed in one vector. At this time, the expressed IDS-IgG1 Fc conjugate and BTP5-IgG1 Fc conjugate form disulfide bonds with each other, and the mutated portion of IgG1 CH3 serves to promote binding between the conjugates, so that the IDS-IgG1 Fc conjugate and the BTP5-IgG1 Fc conjugate Brain-targeted IDS long-acting protein conjugates that form heterodimers with each other can be prepared. In addition, as described above, it is possible to increase the production yield of a novel brain target persistent protein by promoting the formation of heterodimers through Fc mutation.

이상의 설명으로부터, 본 발명이 속하는 기술분야의 당업자는 본 발명이 그 기술적 사상이나 필수적 특징을 변경하지 않고서 다른 구체적인 형태로 실시될 수 있다는 것을 이해할 수 있을 것이다. 이와 관련하여, 이상에서 기술한 실시 예들은 모든 면에서 예시적인 것이며 한정적인 것이 아닌 것으로서 이해해야만 한다. 본 발명의 범위는 상기 상세한 설명보다는 후술하는 특허 청구범위의 의미 및 범위 그리고 그 등가 개념으로부터 도출되는 모든 변경 또는 변형된 형태가 본 발명의 범위에 포함되는 것으로 해석되어야 한다.From the above description, those skilled in the art to which the present invention pertains will understand that the present invention may be embodied in other specific forms without changing the technical spirit or essential characteristics thereof. In this regard, it should be understood that the embodiments described above are illustrative in all respects and not restrictive. The scope of the present invention should be construed as being included in the scope of the present invention, rather than the above detailed description, all changes or modifications derived from the meaning and scope of the following claims and their equivalents.

<110> HANMI PHARM. CO., LTD. <120> Novel long-acting protein conjugates for brain targeting and a preparation method thereof <130> KPA201596-KR <160> 51 <170> KoPatentIn 3.0 <210> 1 <211> 75 <212> DNA <213> Artificial Sequence <220> <223> signal sequence <400> 1 atgccgccac cccggaccgg ccgaggcctt ctctggctgg gtctggttct gagctccgtc 60 tgcgtcgccc tcgga 75 <210> 2 <211> 1578 <212> DNA <213> Artificial Sequence <220> <223> IDS <400> 2 tccgaaacgc aggccaactc gaccacagat gctctgaacg ttcttctcat catcgtggat 60 gacctgcgcc cctccctggg ctgttatggg gataagctgg tgaggtcccc aaatattgac 120 caactggcat cccacagcct cctcttccag aatgcctttg cgcagcaagc agtgtgcgcc 180 ccgagccgcg tttctttcct cactggcagg agacctgaca ccacccgcct gtacgacttc 240 aactcctact ggagggtgca cgctggaaac ttctccacca tcccccagta cttcaaggag 300 aatggctatg tgaccatgtc ggtgggaaaa gtctttcacc ctgggatatc ttctaaccat 360 accgatgatt ctccgtatag ctggtctttt ccaccttatc atccttcctc tgagaagtat 420 gaaaacacta agacatgtcg agggccagat ggagaactcc atgccaacct gctttgccct 480 gtggatgtgc tggatgttcc cgagggcacc ttgcctgaca aacagagcac tgagcaagcc 540 atacagttgt tggaaaagat gaaaacgtca gccagtcctt tcttcctggc cgttgggtat 600 cataagccac acatcccctt cagatacccc aaggaatttc agaagttgta tcccttggag 660 aacatcaccc tggcccccga tcccgaggtc cctgatggcc taccccctgt ggcctacaac 720 ccctggatgg acatcaggca acgggaagac gtccaagcct taaacatcag tgtgccgtat 780 ggtccaattc ctgtggactt tcagcggaaa atccgccaga gctactttgc ctctgtgtca 840 tatttggata cacaggtcgg ccgcctcttg agtgctttgg acgatcttca gctggccaac 900 agcaccatca ttgcatttac ctcggatcat gggtgggctc taggtgaaca tggagaatgg 960 gccaaataca gcaattttga tgttgctacc catgttcccc tgatattcta tgttcctgga 1020 aggacggctt cacttccgga ggcaggcgag aagcttttcc cttacctcga cccttttgat 1080 tccgcctcac agttgatgga gccaggcagg caatccatgg accttgtgga acttgtgtct 1140 ctttttccca cgctggctgg acttgcagga ctgcaggttc cacctcgctg ccccgttcct 1200 tcatttcacg ttgagctgtg cagagaaggc aagaaccttc tgaagcattt tcgattccgt 1260 gacttggaag aggatccgta cctccctggt aatccccgtg aactgattgc ctatagccag 1320 tatccccggc cttcagacat ccctcagtgg aattctgaca agccgagttt aaaagatata 1380 aagatcatgg gctattccat acgcaccata gactataggt atactgtgtg ggttggcttc 1440 aatcctgatg aatttctagc taacttttct gacatccatg caggggaact gtattttgtg 1500 gattctgacc cattgcagga tcacaatatg tataatgatt cccaaggtgg agatcttttc 1560 cagttgttga tgccttga 1578 <210> 3 <211> 45 <212> DNA <213> Artificial Sequence <220> <223> IgG1 hinge <400> 3 gaacccaagt cctgcgataa gacccacaca tgccctccct gtcct 45 <210> 4 <211> 330 <212> DNA <213> Artificial Sequence <220> <223> IgG1 CH2 <400> 4 gctcccgaac tgctgggagg accctccgtc ttcctgttcc cccccaagcc caaagacaca 60 ctgatgatca gcaggacccc tgaagtgacc tgcgtggtcg tggacgtgag ccacgaggac 120 cccgaggtca agtttaactg gtacgtggac ggcgtggagg tccacaacgc caagaccaag 180 cccagggagg agcagtacaa cagcacctac agggtcgtgt ccgtgctgac cgtgctccac 240 caagattggc tcaacggcaa ggagtataag tgcaaagtca gcaacaaggc cctccccgcc 300 cccatcgaga aaaccatcag caaggccaag 330 <210> 5 <211> 321 <212> DNA <213> Artificial Sequence <220> <223> Modified IgG1 CH3 <400> 5 ggccaaccgc gggaacctca agtgtatacc ctccctccca gccgggatga gctgaccaag 60 aaccaagtct ccctcttgtg cctggtcaag ggattctacc cttccgacat tgccgtcgaa 120 tgggagagca atggccagcc cgagaacaac tacaagacaa ccccccccgt cctgcgcagc 180 gacggatcct tcttcctgta ctccaagctc accgtggaca agagccggtg gcaacagggc 240 aacgtgttct cctgtagcgt gatgcacgaa gccctccaca accactatac ccagaagagc 300 ctgagcctca gccccggcaa a 321 <210> 6 <211> 25 <212> PRT <213> Artificial Sequence <220> <223> signal sequence <400> 6 Met Pro Pro Pro Arg Thr Gly Arg Gly Leu Leu Trp Leu Gly Leu Val 1 5 10 15 Leu Ser Ser Val Cys Val Ala Leu Gly 20 25 <210> 7 <211> 525 <212> PRT <213> Artificial Sequence <220> <223> IDS <400> 7 Ser Glu Thr Gln Ala Asn Ser Thr Thr Asp Ala Leu Asn Val Leu Leu 1 5 10 15 Ile Ile Val Asp Asp Leu Arg Pro Ser Leu Gly Cys Tyr Gly Asp Lys 20 25 30 Leu Val Arg Ser Pro Asn Ile Asp Gln Leu Ala Ser His Ser Leu Leu 35 40 45 Phe Gln Asn Ala Phe Ala Gln Gln Ala Val Cys Ala Pro Ser Arg Val 50 55 60 Ser Phe Leu Thr Gly Arg Arg Pro Asp Thr Thr Arg Leu Tyr Asp Phe 65 70 75 80 Asn Ser Tyr Trp Arg Val His Ala Gly Asn Phe Ser Thr Ile Pro Gln 85 90 95 Tyr Phe Lys Glu Asn Gly Tyr Val Thr Met Ser Val Gly Lys Val Phe 100 105 110 His Pro Gly Ile Ser Ser Asn His Thr Asp Asp Ser Pro Tyr Ser Trp 115 120 125 Ser Phe Pro Pro Tyr His Pro Ser Ser Glu Lys Tyr Glu Asn Thr Lys 130 135 140 Thr Cys Arg Gly Pro Asp Gly Glu Leu His Ala Asn Leu Leu Cys Pro 145 150 155 160 Val Asp Val Leu Asp Val Pro Glu Gly Thr Leu Pro Asp Lys Gln Ser 165 170 175 Thr Glu Gln Ala Ile Gln Leu Leu Glu Lys Met Lys Thr Ser Ala Ser 180 185 190 Pro Phe Phe Leu Ala Val Gly Tyr His Lys Pro His Ile Pro Phe Arg 195 200 205 Tyr Pro Lys Glu Phe Gln Lys Leu Tyr Pro Leu Glu Asn Ile Thr Leu 210 215 220 Ala Pro Asp Pro Glu Val Pro Asp Gly Leu Pro Pro Val Ala Tyr Asn 225 230 235 240 Pro Trp Met Asp Ile Arg Gln Arg Glu Asp Val Gln Ala Leu Asn Ile 245 250 255 Ser Val Pro Tyr Gly Pro Ile Pro Val Asp Phe Gln Arg Lys Ile Arg 260 265 270 Gln Ser Tyr Phe Ala Ser Val Ser Tyr Leu Asp Thr Gln Val Gly Arg 275 280 285 Leu Leu Ser Ala Leu Asp Asp Leu Gln Leu Ala Asn Ser Thr Ile Ile 290 295 300 Ala Phe Thr Ser Asp His Gly Trp Ala Leu Gly Glu His Gly Glu Trp 305 310 315 320 Ala Lys Tyr Ser Asn Phe Asp Val Ala Thr His Val Pro Leu Ile Phe 325 330 335 Tyr Val Pro Gly Arg Thr Ala Ser Leu Pro Glu Ala Gly Glu Lys Leu 340 345 350 Phe Pro Tyr Leu Asp Pro Phe Asp Ser Ala Ser Gln Leu Met Glu Pro 355 360 365 Gly Arg Gln Ser Met Asp Leu Val Glu Leu Val Ser Leu Phe Pro Thr 370 375 380 Leu Ala Gly Leu Ala Gly Leu Gln Val Pro Pro Arg Cys Pro Val Pro 385 390 395 400 Ser Phe His Val Glu Leu Cys Arg Glu Gly Lys Asn Leu Leu Lys His 405 410 415 Phe Arg Phe Arg Asp Leu Glu Glu Asp Pro Tyr Leu Pro Gly Asn Pro 420 425 430 Arg Glu Leu Ile Ala Tyr Ser Gln Tyr Pro Arg Pro Ser Asp Ile Pro 435 440 445 Gln Trp Asn Ser Asp Lys Pro Ser Leu Lys Asp Ile Lys Ile Met Gly 450 455 460 Tyr Ser Ile Arg Thr Ile Asp Tyr Arg Tyr Thr Val Trp Val Gly Phe 465 470 475 480 Asn Pro Asp Glu Phe Leu Ala Asn Phe Ser Asp Ile His Ala Gly Glu 485 490 495 Leu Tyr Phe Val Asp Ser Asp Pro Leu Gln Asp His Asn Met Tyr Asn 500 505 510 Asp Ser Gln Gly Gly Asp Leu Phe Gln Leu Leu Met Pro 515 520 525 <210> 8 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> IgG1 hinge <400> 8 Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro 1 5 10 15 <210> 9 <211> 110 <212> PRT <213> Artificial Sequence <220> <223> IgG1 CH2 <400> 9 Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys 1 5 10 15 Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val 20 25 30 Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr 35 40 45 Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu 50 55 60 Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His 65 70 75 80 Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys 85 90 95 Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys 100 105 110 <210> 10 <211> 107 <212> PRT <213> Artificial Sequence <220> <223> Modified IgG1 CH3 <400> 10 Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp 1 5 10 15 Glu Leu Thr Lys Asn Gln Val Ser Leu Leu Cys Leu Val Lys Gly Phe 20 25 30 Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu 35 40 45 Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Arg Ser Asp Gly Ser Phe 50 55 60 Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly 65 70 75 80 Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr 85 90 95 Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 100 105 <210> 11 <211> 63 <212> DNA <213> Artificial Sequence <220> <223> Signal sequence <400> 11 atggagacag acacactcct gctatgggta ctgctgctct gggttccagg ttccactggt 60 gac 63 <210> 12 <211> 123 <212> DNA <213> Artificial Sequence <220> <223> BTP5 2X <400> 12 cttcgcaagt tacgtaaacg cttactgtta cgtaaacttc ggaagcgctt actgggtgga 60 ggcggttcac tgcgtaaact gcgcaaacgt ctgttactgc gtaaactgcg caaacgtctg 120 tta 123 <210> 13 <211> 45 <212> DNA <213> Artificial Sequence <220> <223> IgG1 hinge <400> 13 gaacccaagt cctgcgataa gacccacaca tgcccccctt gtcct 45 <210> 14 <211> 330 <212> DNA <213> Artificial Sequence <220> <223> IgG1 CH2 <400> 14 gcccctgaac tgctcggagg ccctagcgtg ttcctcttcc ctcccaaacc caaggacacc 60 ctcatgatct ccaggacccc tgaggtgacc tgcgtcgtgg tggacgtcag ccacgaggac 120 cccgaggtga agttcaactg gtacgtggac ggcgtcgagg tccacaacgc caagacaaag 180 cccagggagg aacagtacaa cagcacctac agggtggtca gcgtgctgac cgtgctgcac 240 caggattggc tcaacggcaa ggagtacaag tgcaaagtct ccaacaaggc cctgcccgcc 300 cccatcgaga agaccatctc caaggctaag 330 <210> 15 <211> 321 <212> DNA <213> Artificial Sequence <220> <223> IgG1 CH3 <400> 15 ggacagccca gggagcccca agtgtacacc gagcctccca gccgggatga gctgaccaag 60 aaccaagtct ccctcacctg cctggtcaag ggattctacc cttccgacat tgccgtcgaa 120 tgggagagca atggccagcc cgagaacaac tacaagacaa ccccccccgt cctggatagc 180 gacggatcct tcttcctgct ctccgtgctc accgtcgaca agagcagatg gcagcagggc 240 aacgtgttca gctgtagcgt gatgcacgag gccctgcaca accactacac ccagaagagc 300 ctgtccctca gccccggcaa g 321 <210> 16 <211> 21 <212> PRT <213> Artificial Sequence <220> <223> signal sequence <400> 16 Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val Pro 1 5 10 15 Gly Ser Thr Gly Asp 20 <210> 17 <211> 41 <212> PRT <213> Artificial Sequence <220> <223> BTP5 2X <400> 17 Leu Arg Lys Leu Arg Lys Arg Leu Leu Leu Arg Lys Leu Arg Lys Arg 1 5 10 15 Leu Leu Gly Gly Gly Gly Ser Leu Arg Lys Leu Arg Lys Arg Leu Leu 20 25 30 Leu Arg Lys Leu Arg Lys Arg Leu Leu 35 40 <210> 18 <211> 107 <212> PRT <213> Artificial Sequence <220> <223> Modified IgG1 CH3 <400> 18 Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Glu Pro Pro Ser Arg Asp 1 5 10 15 Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe 20 25 30 Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu 35 40 45 Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe 50 55 60 Phe Leu Leu Ser Val Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly 65 70 75 80 Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr 85 90 95 Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 100 105 <210> 19 <211> 45 <212> DNA <213> Artificial Sequence <220> <223> linker <400> 19 ggtggaggcg gttcaggcgg aggtggctct ggcggtggcg gatcg 45 <210> 20 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> linker <400> 20 Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser 1 5 10 15 <210> 21 <211> 696 <212> DNA <213> Artificial Sequence <220> <223> Fc construct (1) <400> 21 gaacccaagt cctgcgataa gacccacaca tgccctccct gtcctgctcc cgaactgctg 60 ggaggaccct ccgtcttcct gttccccccc aagcccaaag acacactgat gatcagcagg 120 acccctgaag tgacctgcgt ggtcgtggac gtgagccacg aggaccccga ggtcaagttt 180 aactggtacg tggacggcgt ggaggtccac aacgccaaga ccaagcccag ggaggagcag 240 tacaacagca cctacagggt cgtgtccgtg ctgaccgtgc tccaccaaga ttggctcaac 300 ggcaaggagt ataagtgcaa agtcagcaac aaggccctcc ccgcccccat cgagaaaacc 360 atcagcaagg ccaagggcca accgcgggaa cctcaagtgt ataccctccc tcccagccgg 420 gatgagctga ccaagaacca agtctccctc ttgtgcctgg tcaagggatt ctacccttcc 480 gacattgccg tcgaatggga gagcaatggc cagcccgaga acaactacaa gacaaccccc 540 cccgtcctgc gcagcgacgg atccttcttc ctgtactcca agctcaccgt ggacaagagc 600 cggtggcaac agggcaacgt gttctcctgt agcgtgatgc acgaagccct ccacaaccac 660 tatacccaga agagcctgag cctcagcccc ggcaaa 696 <210> 22 <211> 232 <212> PRT <213> Artificial Sequence <220> <223> Fc construct (1) <400> 22 Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala 1 5 10 15 Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro 20 25 30 Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val 35 40 45 Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val 50 55 60 Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln 65 70 75 80 Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln 85 90 95 Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala 100 105 110 Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro 115 120 125 Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr 130 135 140 Lys Asn Gln Val Ser Leu Leu Cys Leu Val Lys Gly Phe Tyr Pro Ser 145 150 155 160 Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr 165 170 175 Lys Thr Thr Pro Pro Val Leu Arg Ser Asp Gly Ser Phe Phe Leu Tyr 180 185 190 Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe 195 200 205 Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys 210 215 220 Ser Leu Ser Leu Ser Pro Gly Lys 225 230 <210> 23 <211> 696 <212> DNA <213> Artificial Sequence <220> <223> Fc construct (2) <400> 23 gaacccaagt cctgcgataa gacccacaca tgcccccctt gtcctgcccc tgaactgctc 60 ggaggcccta gcgtgttcct cttccctccc aaacccaagg acaccctcat gatctccagg 120 acccctgagg tgacctgcgt cgtggtggac gtcagccacg aggaccccga ggtgaagttc 180 aactggtacg tggacggcgt cgaggtccac aacgccaaga caaagcccag ggaggaacag 240 tacaacagca cctacagggt ggtcagcgtg ctgaccgtgc tgcaccagga ttggctcaac 300 ggcaaggagt acaagtgcaa agtctccaac aaggccctgc ccgcccccat cgagaagacc 360 atctccaagg ctaagggaca gcccagggag ccccaagtgt acaccgagcc tcccagccgg 420 gatgagctga ccaagaacca agtctccctc acctgcctgg tcaagggatt ctacccttcc 480 gacattgccg tcgaatggga gagcaatggc cagcccgaga acaactacaa gacaaccccc 540 cccgtcctgg atagcgacgg atccttcttc ctgctctccg tgctcaccgt cgacaagagc 600 agatggcagc agggcaacgt gttcagctgt agcgtgatgc acgaggccct gcacaaccac 660 tacacccaga agagcctgtc cctcagcccc ggcaag 696 <210> 24 <211> 232 <212> PRT <213> Artificial Sequence <220> <223> Fc construct (2) <400> 24 Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala 1 5 10 15 Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro 20 25 30 Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val 35 40 45 Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val 50 55 60 Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln 65 70 75 80 Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln 85 90 95 Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala 100 105 110 Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro 115 120 125 Arg Glu Pro Gln Val Tyr Thr Glu Pro Pro Ser Arg Asp Glu Leu Thr 130 135 140 Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser 145 150 155 160 Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr 165 170 175 Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Leu 180 185 190 Ser Val Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe 195 200 205 Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys 210 215 220 Ser Leu Ser Leu Ser Pro Gly Lys 225 230 <210> 25 <211> 757 <212> PRT <213> Artificial Sequence <220> <223> IDS-IgG1 Fc construct <400> 25 Ser Glu Thr Gln Ala Asn Ser Thr Thr Asp Ala Leu Asn Val Leu Leu 1 5 10 15 Ile Ile Val Asp Asp Leu Arg Pro Ser Leu Gly Cys Tyr Gly Asp Lys 20 25 30 Leu Val Arg Ser Pro Asn Ile Asp Gln Leu Ala Ser His Ser Leu Leu 35 40 45 Phe Gln Asn Ala Phe Ala Gln Gln Ala Val Cys Ala Pro Ser Arg Val 50 55 60 Ser Phe Leu Thr Gly Arg Arg Pro Asp Thr Thr Arg Leu Tyr Asp Phe 65 70 75 80 Asn Ser Tyr Trp Arg Val His Ala Gly Asn Phe Ser Thr Ile Pro Gln 85 90 95 Tyr Phe Lys Glu Asn Gly Tyr Val Thr Met Ser Val Gly Lys Val Phe 100 105 110 His Pro Gly Ile Ser Ser Asn His Thr Asp Asp Ser Pro Tyr Ser Trp 115 120 125 Ser Phe Pro Pro Tyr His Pro Ser Ser Glu Lys Tyr Glu Asn Thr Lys 130 135 140 Thr Cys Arg Gly Pro Asp Gly Glu Leu His Ala Asn Leu Leu Cys Pro 145 150 155 160 Val Asp Val Leu Asp Val Pro Glu Gly Thr Leu Pro Asp Lys Gln Ser 165 170 175 Thr Glu Gln Ala Ile Gln Leu Leu Glu Lys Met Lys Thr Ser Ala Ser 180 185 190 Pro Phe Phe Leu Ala Val Gly Tyr His Lys Pro His Ile Pro Phe Arg 195 200 205 Tyr Pro Lys Glu Phe Gln Lys Leu Tyr Pro Leu Glu Asn Ile Thr Leu 210 215 220 Ala Pro Asp Pro Glu Val Pro Asp Gly Leu Pro Pro Val Ala Tyr Asn 225 230 235 240 Pro Trp Met Asp Ile Arg Gln Arg Glu Asp Val Gln Ala Leu Asn Ile 245 250 255 Ser Val Pro Tyr Gly Pro Ile Pro Val Asp Phe Gln Arg Lys Ile Arg 260 265 270 Gln Ser Tyr Phe Ala Ser Val Ser Tyr Leu Asp Thr Gln Val Gly Arg 275 280 285 Leu Leu Ser Ala Leu Asp Asp Leu Gln Leu Ala Asn Ser Thr Ile Ile 290 295 300 Ala Phe Thr Ser Asp His Gly Trp Ala Leu Gly Glu His Gly Glu Trp 305 310 315 320 Ala Lys Tyr Ser Asn Phe Asp Val Ala Thr His Val Pro Leu Ile Phe 325 330 335 Tyr Val Pro Gly Arg Thr Ala Ser Leu Pro Glu Ala Gly Glu Lys Leu 340 345 350 Phe Pro Tyr Leu Asp Pro Phe Asp Ser Ala Ser Gln Leu Met Glu Pro 355 360 365 Gly Arg Gln Ser Met Asp Leu Val Glu Leu Val Ser Leu Phe Pro Thr 370 375 380 Leu Ala Gly Leu Ala Gly Leu Gln Val Pro Pro Arg Cys Pro Val Pro 385 390 395 400 Ser Phe His Val Glu Leu Cys Arg Glu Gly Lys Asn Leu Leu Lys His 405 410 415 Phe Arg Phe Arg Asp Leu Glu Glu Asp Pro Tyr Leu Pro Gly Asn Pro 420 425 430 Arg Glu Leu Ile Ala Tyr Ser Gln Tyr Pro Arg Pro Ser Asp Ile Pro 435 440 445 Gln Trp Asn Ser Asp Lys Pro Ser Leu Lys Asp Ile Lys Ile Met Gly 450 455 460 Tyr Ser Ile Arg Thr Ile Asp Tyr Arg Tyr Thr Val Trp Val Gly Phe 465 470 475 480 Asn Pro Asp Glu Phe Leu Ala Asn Phe Ser Asp Ile His Ala Gly Glu 485 490 495 Leu Tyr Phe Val Asp Ser Asp Pro Leu Gln Asp His Asn Met Tyr Asn 500 505 510 Asp Ser Gln Gly Gly Asp Leu Phe Gln Leu Leu Met Pro Glu Pro Lys 515 520 525 Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 530 535 540 Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 545 550 555 560 Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 565 570 575 Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 580 585 590 Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser 595 600 605 Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 610 615 620 Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 625 630 635 640 Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 645 650 655 Gln Val Tyr Thr Glu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln 660 665 670 Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala 675 680 685 Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 690 695 700 Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Leu Ser Val Leu 705 710 715 720 Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 725 730 735 Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 740 745 750 Leu Ser Pro Gly Lys 755 <210> 26 <211> 273 <212> PRT <213> Artificial Sequence <220> <223> BTP5 2x-IgG1 Fc contruct <400> 26 Leu Arg Lys Leu Arg Lys Arg Leu Leu Leu Arg Lys Leu Arg Lys Arg 1 5 10 15 Leu Leu Gly Gly Gly Gly Ser Leu Arg Lys Leu Arg Lys Arg Leu Leu 20 25 30 Leu Arg Lys Leu Arg Lys Arg Leu Leu Glu Pro Lys Ser Cys Asp Lys 35 40 45 Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro 50 55 60 Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 65 70 75 80 Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 85 90 95 Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 100 105 110 Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val 115 120 125 Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu 130 135 140 Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys 145 150 155 160 Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr 165 170 175 Glu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr 180 185 190 Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 195 200 205 Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu 210 215 220 Asp Ser Asp Gly Ser Phe Phe Leu Leu Ser Val Leu Thr Val Asp Lys 225 230 235 240 Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu 245 250 255 Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 260 265 270 Lys <210> 27 <211> 772 <212> PRT <213> Artificial Sequence <220> <223> IDS-L15-IgG1 Fc contruct <400> 27 Ser Glu Thr Gln Ala Asn Ser Thr Thr Asp Ala Leu Asn Val Leu Leu 1 5 10 15 Ile Ile Val Asp Asp Leu Arg Pro Ser Leu Gly Cys Tyr Gly Asp Lys 20 25 30 Leu Val Arg Ser Pro Asn Ile Asp Gln Leu Ala Ser His Ser Leu Leu 35 40 45 Phe Gln Asn Ala Phe Ala Gln Gln Ala Val Cys Ala Pro Ser Arg Val 50 55 60 Ser Phe Leu Thr Gly Arg Arg Pro Asp Thr Thr Arg Leu Tyr Asp Phe 65 70 75 80 Asn Ser Tyr Trp Arg Val His Ala Gly Asn Phe Ser Thr Ile Pro Gln 85 90 95 Tyr Phe Lys Glu Asn Gly Tyr Val Thr Met Ser Val Gly Lys Val Phe 100 105 110 His Pro Gly Ile Ser Ser Asn His Thr Asp Asp Ser Pro Tyr Ser Trp 115 120 125 Ser Phe Pro Pro Tyr His Pro Ser Ser Glu Lys Tyr Glu Asn Thr Lys 130 135 140 Thr Cys Arg Gly Pro Asp Gly Glu Leu His Ala Asn Leu Leu Cys Pro 145 150 155 160 Val Asp Val Leu Asp Val Pro Glu Gly Thr Leu Pro Asp Lys Gln Ser 165 170 175 Thr Glu Gln Ala Ile Gln Leu Leu Glu Lys Met Lys Thr Ser Ala Ser 180 185 190 Pro Phe Phe Leu Ala Val Gly Tyr His Lys Pro His Ile Pro Phe Arg 195 200 205 Tyr Pro Lys Glu Phe Gln Lys Leu Tyr Pro Leu Glu Asn Ile Thr Leu 210 215 220 Ala Pro Asp Pro Glu Val Pro Asp Gly Leu Pro Pro Val Ala Tyr Asn 225 230 235 240 Pro Trp Met Asp Ile Arg Gln Arg Glu Asp Val Gln Ala Leu Asn Ile 245 250 255 Ser Val Pro Tyr Gly Pro Ile Pro Val Asp Phe Gln Arg Lys Ile Arg 260 265 270 Gln Ser Tyr Phe Ala Ser Val Ser Tyr Leu Asp Thr Gln Val Gly Arg 275 280 285 Leu Leu Ser Ala Leu Asp Asp Leu Gln Leu Ala Asn Ser Thr Ile Ile 290 295 300 Ala Phe Thr Ser Asp His Gly Trp Ala Leu Gly Glu His Gly Glu Trp 305 310 315 320 Ala Lys Tyr Ser Asn Phe Asp Val Ala Thr His Val Pro Leu Ile Phe 325 330 335 Tyr Val Pro Gly Arg Thr Ala Ser Leu Pro Glu Ala Gly Glu Lys Leu 340 345 350 Phe Pro Tyr Leu Asp Pro Phe Asp Ser Ala Ser Gln Leu Met Glu Pro 355 360 365 Gly Arg Gln Ser Met Asp Leu Val Glu Leu Val Ser Leu Phe Pro Thr 370 375 380 Leu Ala Gly Leu Ala Gly Leu Gln Val Pro Pro Arg Cys Pro Val Pro 385 390 395 400 Ser Phe His Val Glu Leu Cys Arg Glu Gly Lys Asn Leu Leu Lys His 405 410 415 Phe Arg Phe Arg Asp Leu Glu Glu Asp Pro Tyr Leu Pro Gly Asn Pro 420 425 430 Arg Glu Leu Ile Ala Tyr Ser Gln Tyr Pro Arg Pro Ser Asp Ile Pro 435 440 445 Gln Trp Asn Ser Asp Lys Pro Ser Leu Lys Asp Ile Lys Ile Met Gly 450 455 460 Tyr Ser Ile Arg Thr Ile Asp Tyr Arg Tyr Thr Val Trp Val Gly Phe 465 470 475 480 Asn Pro Asp Glu Phe Leu Ala Asn Phe Ser Asp Ile His Ala Gly Glu 485 490 495 Leu Tyr Phe Val Asp Ser Asp Pro Leu Gln Asp His Asn Met Tyr Asn 500 505 510 Asp Ser Gln Gly Gly Asp Leu Phe Gln Leu Leu Met Pro Gly Gly Gly 515 520 525 Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Pro Lys Ser 530 535 540 Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu 545 550 555 560 Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu 565 570 575 Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser 580 585 590 His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu 595 600 605 Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr 610 615 620 Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn 625 630 635 640 Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro 645 650 655 Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln 660 665 670 Val Tyr Thr Glu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val 675 680 685 Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val 690 695 700 Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro 705 710 715 720 Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Leu Ser Val Leu Thr 725 730 735 Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val 740 745 750 Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu 755 760 765 Ser Pro Gly Lys 770 <210> 28 <211> 288 <212> PRT <213> Artificial Sequence <220> <223> BTP5 2x-L15-IgG1 Fc contruct <400> 28 Leu Arg Lys Leu Arg Lys Arg Leu Leu Leu Arg Lys Leu Arg Lys Arg 1 5 10 15 Leu Leu Gly Gly Gly Gly Ser Leu Arg Lys Leu Arg Lys Arg Leu Leu 20 25 30 Leu Arg Lys Leu Arg Lys Arg Leu Leu Gly Gly Gly Gly Ser Gly Gly 35 40 45 Gly Gly Ser Gly Gly Gly Gly Ser Glu Pro Lys Ser Cys Asp Lys Thr 50 55 60 His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser 65 70 75 80 Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg 85 90 95 Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro 100 105 110 Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala 115 120 125 Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 130 135 140 Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr 145 150 155 160 Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 165 170 175 Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Glu 180 185 190 Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys 195 200 205 Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 210 215 220 Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp 225 230 235 240 Ser Asp Gly Ser Phe Phe Leu Leu Ser Val Leu Thr Val Asp Lys Ser 245 250 255 Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala 260 265 270 Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 275 280 285 <210> 29 <211> 19 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 29 Thr Phe Phe Tyr Gly Gly Ser Arg Gly Lys Arg Asn Asn Phe Lys Thr 1 5 10 15 Glu Glu Tyr <210> 30 <211> 38 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 30 Ser Val Ile Asp Ala Leu Gln Tyr Lys Leu Glu Gly Thr Thr Arg Leu 1 5 10 15 Thr Arg Lys Arg Gly Leu Lys Leu Ala Thr Ala Leu Ser Leu Ser Asn 20 25 30 Lys Phe Val Glu Gly Ser 35 <210> 31 <211> 8 <212> PRT <213> Artificial Sequence <220> <223> BTP <220> <221> MISC_FEATURE <222> (1) <223> Xaa1 is acetylated <400> 31 Cys Met Pro Arg Leu Arg Gly Cys 1 5 <210> 32 <211> 12 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 32 Thr His Arg Pro Pro Met Trp Ser Pro Val Trp Pro 1 5 10 <210> 33 <211> 12 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 33 Pro Trp Val Pro Ser Trp Met Pro Pro Arg His Thr 1 5 10 <210> 34 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 34 Cys Arg Thr Ile Gly Pro Ser Val Cys 1 5 <210> 35 <211> 30 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 35 Tyr Gln Gln Ile Leu Thr Ser Met Pro Ser Arg Asn Val Ile Gln Ile 1 5 10 15 Ser Asn Asp Leu Glu Asn Leu Arg Asp Leu Leu His Val Leu 20 25 30 <210> 36 <211> 29 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 36 Tyr Thr Ile Trp Met Pro Glu Asn Pro Arg Pro Gly Thr Pro Cys Asp 1 5 10 15 Ile Phe Thr Asn Ser Arg Gly Lys Arg Ala Ser Asn Gly 20 25 <210> 37 <211> 16 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 37 Gly Arg Glu Ile Arg Thr Gly Arg Ala Glu Arg Trp Ser Glu Lys Phe 1 5 10 15 <210> 38 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 38 Cys Asn Cys Lys Ala Pro Glu Thr Ala Leu Cys Ala Arg Arg Cys Gln 1 5 10 15 Gln His <210> 39 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> BTP <220> <221> MISC_FEATURE <222> (1) <223> Xaa is diaminopropionic acid <400> 39 Xaa Lys Ala Pro Glu Thr Ala Leu Asp 1 5 <210> 40 <211> 13 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 40 His Leu Asn Ile Leu Ser Thr Leu Trp Lys Tyr Arg Cys 1 5 10 <210> 41 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> BTP <220> <221> MISC_FEATURE <222> (7) <223> O-beta-Glc is attaced thereto <400> 41 Gly Phe Thr Gly Phe Leu Ser 1 5 <210> 42 <211> 12 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 42 Thr Gly Asn Tyr Lys Ala Leu His Pro His Asn Gly 1 5 10 <210> 43 <211> 11 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 43 Tyr Gly Arg Lys Lys Arg Arg Gln Arg Arg Arg 1 5 10 <210> 44 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 44 Arg Gly Gly Arg Leu Ser Tyr Ser Arg Arg Arg Phe Ser Thr Ser Thr 1 5 10 15 Gly Arg <210> 45 <211> 8 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 45 Phe Pro Phe Pro Phe Pro Phe Pro 1 5 <210> 46 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 46 His Ala Ile Tyr Pro Arg His 1 5 <210> 47 <211> 5 <212> PRT <213> Artificial Sequence <220> <223> Peptide linker motif <400> 47 Gly Gly Gly Gly Ser 1 5 <210> 48 <211> 4 <212> PRT <213> Artificial Sequence <220> <223> Peptide linker motif <400> 48 Gly Gly Gly Ser 1 <210> 49 <211> 4 <212> PRT <213> Artificial Sequence <220> <223> Peptide linker motif <400> 49 Gly Gly Ser Gly 1 <210> 50 <211> 107 <212> PRT <213> Homo sapiens <400> 50 Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp 1 5 10 15 Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe 20 25 30 Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu 35 40 45 Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe 50 55 60 Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly 65 70 75 80 Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr 85 90 95 Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 100 105 <210> 51 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 51 Leu Arg Lys Leu Arg Lys Arg Leu Leu Leu Arg Lys Leu Arg Lys Arg 1 5 10 15 Leu Leu <110> HANMI PHARM. CO., LTD. <120> Novel long-acting protein conjugates for brain targeting and a preparation method thereof <130> KPA201596-KR <160> 51 <170> KoPatentIn 3.0 <210> 1 <211> 75 <212> DNA <213> Artificial Sequence < 220> <223> signal sequence <400> 1 atgccgccac cccggaccgg ccgaggcctt ctctggctgg gtctggttct gagctccgtc 60 tgcgtcgccc tcgga 75 <210> 2 <211> 1578 <212> DNA <213> Artificial Sequence <220> <223> IDS <400> 2 tccgaaacgc aggccaactc gaccacagat gctctgaacg ttcttctcat catcgtggat 60 gacctgcgcc cctccctggg ctgttatggg gataagctgg tgaggtcccc aaatattgac 120 caactggcat cccacagcct cctcttccag aatgcctttg cgcagcaagc agtgtgcgcc 180 ccgagccgcg tttctttcct cactggcagg agacctgaca ccacccgcct gtacgacttc 240 aactcctact ggagggtgca cgctggaaac ttctccacca tcccccagta cttcaaggag 300 aatggctatg tgaccatgtc ggtgggaaaa gtctttcacc ctgggatatc ttctaaccat 360 accgatgatt ctccgtatag ctggtctttt ccaccttatc atccttcctc tgagaagtat 420 gaaaacacta agacatgtcg agggccagat ggagaactcc atgccaacct gctttgccct 480 gtggatgtgc tggatgttcc cgagggcacc ttgcct gaca aacagagcac tgagcaagcc 540 atacagttgt tggaaaagat gaaaacgtca gccagtcctt tcttcctggc cgttgggtat 600 cataagccac acatcccctt cagatacccc aaggaatttc agaagttgta tcccttggag 660 aacatcaccc tggcccccga tcccgaggtc cctgatggcc taccccctgt ggcctacaac 720 ccctggatgg acatcaggca acgggaagac gtccaagcct taaacatcag tgtgccgtat 780 ggtccaattc ctgtggactt tcagcggaaa atccgccaga gctactttgc ctctgtgtca 840 tatttggata cacaggtcgg ccgcctcttg agtgctttgg acgatcttca gctggccaac 900 agcaccatca ttgcatttac ctcggatcat gggtgggctc taggtgaaca tggagaatgg 960 gccaaataca gcaattttga tgttgctacc catgttcccc tgatattcta tgttcctgga 1020 aggacggctt cacttccgga ggcaggcgag aagcttttcc cttacctcga cccttttgat 1080 tccgcctcac agttgatgga gccaggcagg caatccatgg accttgtgga acttgtgtct 1140 ctttttccca cgctggctgg acttgcagga ctgcaggttc cacctcgctg ccccgttcct 1200 tcatttcacg ttgagctgtg cagagaaggc aagaaccttc tgaagcattt tcgattccgt 1260 gacttggaag aggatccgta cctccctggt aatccccgtg aactgattgc ctatagccag 1320 tatccccggc cttcagacat ccctcagtgg aattctgaca agccgagtt t aaaagatata 1380 aagatcatgg gctattccat acgcaccata gactataggt atactgtgtg ggttggcttc 1440 aatcctgatg aatttctagc taacttttct gacatccatg caggggaact gtattttgtg 1500 gattctgacc cattgcagga tcacaatatg tataatgatt cccaaggtgg agatcttttc 1560 cagttgttga tgccttga 1578 <210> 3 <211> 45 <212> DNA <213> Artificial Sequence <220> <223> IgG1 hinge <400> 3 gaacccaagt cctgcgataa gacccacaca tgccctccct gtcct 45 <210> 4 <211> 330 <212> DNA <213> Artificial Sequence <220> <223> IgG1 CH2 <400> 4 gctcccgaac tgctgggagg accctccgtc ttcctgttcc cccccaagcc caaagacaca 60 ctgatgatca gcaggacccc tgaagtgacc tgcgtggtcg tggacgtgag ccacgaggac 120 cccgaggtca agtttaactg gtacgtggac ggcgtggagg tccacaacgc caagaccaag 180 cccagggagg agcagtacaa cagcacctac agggtcgtgt ccgtgctgac cgtgctccac 240 caagattggc tcaacggcaa ggagtataag tgcaaagtca gcaacaaggc cctccccgcc 300 cccatcgaga aaaccatcag caaggccaag 330 <210> 5 <211> 321 <212> DNA <213> Artificial Sequence <220> <223> Modified IgG1 CH3 <400> 5 ggccaaccgc gggaacctca agtgtatacc ctccctccca gccgggatga gctgaccaag 60 aaccaagtct ccctcttgtg cctggtcaag ggattctacc cttccgacat tgccgtcgaa 120 tgggagagca atggccagcc cgagaacaac tacaagacaa ccccccccgt cctgcgcagc 180 gacggatcct tcttcctgta ctccaagctc accgtggaca agagccggtg gcaacagggc 240 aacgtgttct cctgtagcgt gatgcacgaa gccctccaca accactatac ccagaagagc 300 ctgagcctca gccccggcaa a 321 <210> 6 <211> 25 <212> PRT <213> Artificial Sequence <220> <223> signal sequence <400> 6 Met Pro Pro Pro Arg Thr Gly Arg Gly Leu Leu Trp Leu Gly Leu Val 1 5 10 15 Leu Ser Ser Val Cys Val Ala Leu Gly 20 25 <210> 7 <211> 525 <212> PRT <213> Artificial Sequence <220> <223> IDS <400> 7 Ser Glu Thr Gln Ala Asn Ser Thr Thr Asp Ala Leu Asn Val Leu Leu 1 5 10 15 Ile Ile Val Asp Asp Leu Arg Pro Ser Leu Gly Cys Tyr Gly Asp Lys 20 25 30 Leu Val Arg Ser Pro Asn Ile Asp Gln Leu Ala Ser His Ser Leu Leu 35 40 45 Phe Gln Asn Ala Phe Ala Gln Gln Ala Val Cys Ala Pro Ser Arg Val 50 55 60 Ser Phe Leu Thr Gly Arg Arg Pro Asp Thr Thr Arg Leu Tyr Asp Phe 65 70 75 80 Asn Ser Tyr Trp Arg Val His Ala Gly Asn Phe Ser Thr Ile Pro Gln 85 90 95 Tyr Phe Lys Glu Asn Gly Tyr Val Thr Met Ser Val Gly Lys Val Phe 100 105 110 His Pro Gly Ile Ser Ser Asn His Thr Asp Asp Ser Pro Tyr Ser Trp 115 120 125 Ser Phe Pro Pro Tyr His Pro Ser Ser Glu Lys Tyr Glu Asn Thr Lys 130 135 140 Thr Cys Arg Gly Pro Asp Gly Glu Leu His Ala Asn Leu Leu Cys Pro 145 150 155 160 Val Asp Val Leu Asp Val Pro Glu Gly Thr Leu Pro Asp Lys Gln Ser 165 170 175 Thr Glu Gln Ala Ile Gln Leu Leu Glu Lys Met Lys Thr Ser Ala Ser 180 185 190 Pro Phe Phe Leu Ala Val Gly Tyr His Lys Pro His Ile Pro Phe Arg 195 200 205 Tyr Pro Lys Glu Phe Gln Lys Leu Tyr Pro Leu Glu Asn Ile Thr Leu 210 215 220 Ala Pro Asp Pro Glu Val Pro Asp Gly Leu Pro Pro Val Ala Tyr Asn 225 230 235 240 Pro Trp Met Asp Ile Arg Gln Arg Glu Asp Val Gln Ala Leu Asn Ile 245 250 255 Ser Val Pro Tyr Gly Pro Ile Pro Val Asp Phe Gln Arg Lys Ile Arg 260 265 270 Gln Ser Tyr Phe Ala Ser Val Ser Tyr Leu Asp Thr Gln Val Gly Arg 275 280 285 Leu Leu Ser Ala Leu Asp Asp Leu Gln Leu Ala Asn Ser Thr Ile Ile 290 295 300 Ala Phe Thr Ser Asp His Gly Trp Ala Leu Gly Glu His Gly Glu Trp 305 310 315 320 Ala Lys Tyr Ser Asn Phe Asp Val Ala Thr His Val Pro Leu Ile Phe 325 330 335 Tyr Val Pro Gly Arg Thr Ala Ser Leu Pro Glu Ala Gly Glu Lys Leu 340 345 350 Phe Pro Tyr Leu Asp Pro Phe Asp Ser Ala Ser Gln Leu Met Glu Pro 355 360 365 Gly Arg Gln Ser Met Asp Leu Val Glu Leu Val Ser Leu Phe Pro Thr 370 375 380 Leu Ala Gly Leu Ala Gly Leu Gln Val Pro Pro Arg Cys Pro Val Pro 385 390 395 400 Ser Phe His Val Glu Leu Cys Arg Glu Gly Lys Asn Leu Leu Lys His 405 410 415 Phe Arg Phe Arg Asp Leu Glu Glu Asp Pro Tyr Leu Pro Gly Asn Pro 420 425 430 Arg Glu Leu Ile Ala Tyr Ser Gln Tyr Pro Arg Pro Ser Asp Ile Pro 435 440 445 Gln Trp Asn Ser Asp Lys Pro Ser Leu Lys Asp Ile Lys Ile Met Gly 450 455 460 Tyr Ser Ile Arg Thr Ile Asp Tyr Arg Tyr Thr Val Trp Val Gly Phe 465 470 475 480 Asn Pro Asp Glu Phe Leu Ala Asn Phe Ser Asp Ile His Ala Gly Glu 485 490 495 Leu Tyr Phe Val Asp Ser Asp Pro Leu Gln Asp His Asn Met Tyr Asn 500 505 510 Asp Ser Gln Gly Gly Asp Leu Phe Gln Leu Leu Met Pro 515 520 525 <210> 8 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> IgG1 hinge <400> 8 Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro 1 5 10 15 < 210> 9 <211> 110 <212> PRT <213> Artificial Sequence <220> <223> IgG1 CH2 <400> 9 Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys 1 5 10 15 Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu V al Thr Cys Val 20 25 30 Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr 35 40 45 Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu 50 55 60 Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His 65 70 75 80 Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys 85 90 95 Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys 100 105 110 <210> 10 <211> 107 <212> PRT <213> Artificial Sequence <220> <223> Modified IgG1 CH3 <400> 10 Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp 1 5 10 15 Glu Leu Thr Lys Asn Gln Val Ser Leu Leu Cys Leu Val Lys Gly Phe 20 25 30 Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu 35 40 45 Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Arg Ser Asp Gly Ser Phe 50 55 60 Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly 65 70 75 80 Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr 85 90 95 Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 100 105 <210> 11 <211> 63 <212> DNA <213> Artificial Sequence <220> <223> Signal sequence <400> 11 atggagacag acacactcct gctatgggta ctgctgctct gggttccagg ttccactggt 60 gac 63 <210> 12 <211> 123 <212> DNA <213> Artificial Sequence <220> <223> BTP5 2X <400> 12 cttcgcaagt tacgtaaacg cttactgtta cgtaaacttc ggaagcgctt actgggtgga 60 ggcggttcac tgc gtaaacgt gcgt t 123 g taa acact gct gtt <211> 45 <212> DNA <213> Artificial Sequence <220> <223> IgG1 hinge <400> 13 gaacccaagt cctgcgataa gacccacaca tgcccccctt gtcct 45 <21 0> 14 <211> 330 <212> DNA <213> Artificial Sequence <220> <223> IgG1 CH2 <400> 14 gcccctgaac tgctcggagg ccctagcgtg ttcctcttcc ctcccaaacc caaggacacc 60 ctcatgatct ccaggacccc tgaggtgacc tgcgtcgtgg tggacgtcag ccacgaggac 120 cccgaggtga agttcaactg gtacgtggac ggcgtcgagg tccacaacgc caagacaaag 180 cccagggagg aacagtacaa cagcacctac agggtggtca gcgtgctgac cgtgctgcac 240 caggattggc tcaacggcaa ggagtacaag tgcaaagtct ccaacaaggc cctgcccgcc 300 cccatcgaga agaccatctc caaggctaag 330 <210> 15 <211> 321 <212> DNA <213> Artificial Sequence <220> <223> IgG1 CH3 <400> 15 ggacagccca gggagcccca agtgtacacc gagcctccca gccgggatga gctgaccaag 60 aaccaagtct ccctcacctg cctggtcaag ggattctacc cttccgacat tgccgtcgaa 120 tgggagagca atggccagcc cgagaacaac tacaagacaa ccccccccgt cctggatagc 180 gacggatcct tcttcctgct ctccgtgctc accgtcgaca agagcagatg gcagcagggc 240 aacgtgttca gctgtagcgt gatgcacgag gccctgcaca accactacac ccagaagagc 300 ctgtccctca gccccggcaa g 321 <210> 16 <211> 21 <212> PRT <213> Artificial Sequence <220> <223> signal sequence <400> 16 Met Glu Thr Asp Thr Leu Leu Leu Trp Val Leu Leu Leu Trp Val P ro 1 5 10 15 Gly Ser Thr Gly Asp 20 <210> 17 <211> 41 <212> PRT <213> Artificial Sequence <220> <223> BTP5 2X <400> 17 Leu Arg Lys Leu Arg Lys Arg Leu Leu Leu Arg Lys Leu Arg Lys Arg 1 5 10 15 Leu Leu Gly Gly Gly Gly Ser Leu Arg Lys Leu Arg Lys Arg Leu Leu 20 25 30 Leu Arg Lys Leu Arg Lys Arg Leu Leu 35 40 <210> 18 <211> 107 <212 > PRT <213> Artificial Sequence <220> <223> Modified IgG1 CH3 <400> 18 Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Glu Pro Pro Ser Arg Asp 1 5 10 15 Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe 20 25 30 Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu 35 40 45 Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe 50 55 60 Phe Leu Leu Ser Val Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly 65 70 75 80 Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr 85 90 95 Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 100 105 <210> 19 <211> 45 <212> DNA <213> Artificial Sequence <220> <223> linker <400> 19 ggtggaggcg gttcaggcgg aggtggctct ggcggtggcg gatcg 45 <210> 20 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> linker <400> 20 Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser 1 5 10 15 <210> 21 <211 > 696 <212> DNA <213> Artificial Sequence <220> <223> Fc construct (1) <400> 21 gaacccaagt cctgcgataa gacccacaca tgccctccct gtcctgctcc cgaactgctg 60 ggaggaccct ccgtcttcct gttccccccc aagcccaaag accacactgat 120 acccaaag accacactgat aag tgacctgcgt ggtcgtggac gtgagccacg aggaccccga ggtcaagttt 180 aactggtacg tggacggcgt ggaggtccac aacgccaaga ccaagcccag ggaggagcag 240 tacaacagca cctacagggt cgtgtccgtg ctgaccgtgc tccaccaaga ttggctcaac 300 ggcaaggagt ataagtgcaa agtcagcaac aaggccctcc ccgcccccat cgagaaaacc 360 atcagcaagg ccaagggcca accgcgggaa cctcaagtgt ataccctccc tcccagccgg 420 gatgagctga ccaagaacca agtctccctc ttgtgcctgg tcaagggatt ctacccttcc 480 gacattgccg tcgaatggga gagcaatggc cagcccgaga acaactacaa gacaaccccc 540 cccgtcctgc gcagcgacgg atccttcttc ctgtactcca agctcaccgt ggacaagagc 600 cggtggcaac agggcaacgt gttctcctgt agcgtgatgc acgaagccct ccacaaccac 660 tatacccaga agagcctgag cctcagcctgag cctcag 223 Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala 1 5 10 15 Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Lys Pro 20 25 30 Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val 35 40 45 Val As p Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val 50 55 60 Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln 65 70 75 80 Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln 85 90 95 Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala 100 105 110 Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro 115 120 125 Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr 130 135 140 Lys Asn Gln Val Ser Leu Leu Cys Leu Val Lys Gly Phe Tyr Pro Ser 145 150 155 160 Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr 165 170 175 Lys Thr Thr Pro Pro Val Leu Arg Ser Asp Gly Ser Phe Phe Leu Tyr 180 185 190 Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe 195 200 205 Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys 210 215 220 Ser Leu Ser Leu Ser Pro Gly Lys 225 230 <210> 23 <211> 696 <212> DNA <213> Artificial Sequence <220> <223> Fc construct (2) <400> 23 gaacccaagt cctgcgataa gacccacaca tgcccccctt gtcctgcccc tgaactgctc 60 ggaggcccta gcgtgttcct cttccctccc aaacccaagg acaccctcat gatctccagg 120 acccctgagg tgacctgcgt cgtggtggac gtcagccacg aggaccccga ggtgaagttc 180 aactggtacg tggacggcgt cgaggtccac aacgccaaga caaagcccag ggaggaacag 240 tacaacagca cctacagggt ggtcagcgtg ctgaccgtgc tgcaccagga ttggctcaac 300 ggcaaggagt acaagtgcaa agtctccaac aaggccctgc ccgcccccat cgagaagacc 360 atctccaagg ctaagggaca gcccagggag ccccaagtgt acaccgagcc tcccagccgg 420 gatgagctga ccaagaacca agtctccctc acctgcctgg tcaagggatt ctacccttcc 480 gacattgccg tcgaatggga gagcaatggc cagcccgaga acaactacaa gacaaccccc 540 cccgtcctgg atagcgacgg atccttcttc ctgctctccg tgctcaccgt cgacaagagc 600 agatggcagc agggcaacgt gttcagctgt agcgtgatgc acgaggcc ct gcacaaccac 660 tacacccaga agagcctgtc cctcagcccc ggcaag 696 <210> 24 <211> 232 <212> PRT <213> Artificial Sequence <220> <223> Fc construct (2) <400> 24 Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala 1 5 10 15 Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro 20 25 30 Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val 35 40 45 Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val 50 55 60 Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln 65 70 75 80 Tyr Asn Ser Thr Tyr Arg Val Val Val Ser Val Leu Thr Val Leu His Gln 85 90 95 Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala 100 105 110 Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro 115 120 125 Arg Glu Pro Gln Val Tyr Thr Glu Pro Pro Ser Arg Asp Glu Leu Thr 130 135 140 Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser 1 45 150 155 160 Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr 165 170 175 Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Leu 180 185 190 Ser Val Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe 195 200 205 Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys 210 215 220 Ser Leu Ser Leu Ser Pro Gly Lys 225 230 <210> 25 <211> 757 <212 > PRT <213> Artificial Sequence <220> <223> IDS-IgG1 Fc construct <400> 25 Ser Glu Thr Gln Ala Asn Ser Thr Thr Asp Ala Leu Asn Val Leu Leu 1 5 10 15 Ile Ile Val Asp Asp Leu Arg Pro Ser Leu Gly Cys Tyr Gly Asp Lys 20 25 30 Leu Val Arg Ser Pro Asn Ile Asp Gln Leu Ala Ser His Ser Leu Leu 35 40 45 Phe Gln Asn Ala Phe Ala Gln Gln Ala Val Cys Ala Pro Ser Arg Val 50 55 60 Ser Phe Leu Thr Gly Arg Arg Pro Asp Thr Thr Arg Leu Tyr Asp Phe 65 70 75 80 Asn Ser Tyr Trp Arg Val His Ala Gly Asn Phe Ser Thr Ile Pro Gln 85 90 95 Tyr Phe Lys Glu Asn Gly Tyr Val Thr Met Ser Val Gly Lys Val Phe 100 105 110 His Pro Gly Ile Ser Ser Asn His Thr Asp Asp Ser Pro Tyr Ser Trp 115 120 125 Ser Phe Pro Tyr His Pro Ser Ser Glu Lys Tyr Glu Asn Thr Lys 130 135 140 Thr Cys Arg Gly Pro Asp Gly Glu Leu His Ala Asn Leu Leu Cys Pro 145 150 155 160 Val Asp Val Leu Asp Val Pro Glu Gly Thr Leu Pro A sp Lys Gln Ser 165 170 175 Thr Glu Gln Ala Ile Gln Leu Leu Glu Lys Met Lys Thr Ser Ala Ser 180 185 190 Pro Phe Phe Leu Ala Val Gly Tyr His Lys Pro His Ile Pro Phe Arg 195 200 205 Tyr Pro Lys Glu Phe Gln Lys Leu Tyr Pro Leu Glu Asn Ile Thr Leu 210 215 220 Ala Pro Asp Pro Glu Val Pro Asp Gly Leu Pro Pro Val Ala Tyr Asn 225 230 235 240 Pro Trp Met Asp Ile Arg Gln Arg Glu Asp Val Gln Ala Leu Asn Ile 245 250 255 Ser Val Pro Tyr Gly Pro Ile Pro Val Asp Phe Gln Arg Lys Ile Arg 260 265 270 Gln Ser Tyr Phe Ala Ser Val Ser Tyr Leu Asp Thr Gln Val Gly Arg 275 280 285 Leu Leu Ser Ala Leu Asp Asp Leu Gln Leu Ala Asn Ser Thr Ile Ile 290 295 300 Ala Phe Thr Ser Asp His Gly Trp Ala Leu Gly Glu His Gly G lu Trp 305 310 315 320 Ala Lys Tyr Ser Asn Phe Asp Val Ala Thr His Val Pro Leu Ile Phe 325 330 335 Tyr Val Pro Gly Arg Thr Ala Ser Leu Pro Glu Ala Gly Glu Lys Leu 340 345 350 Phe Pro Tyr Leu Asp Pro Phe Asp Ser Ala Ser Gln Leu Met Glu Pro 355 360 365 Gly Arg Gln Ser Met Asp Leu Val Glu Leu Val Ser Leu Phe Pro Thr 370 375 380 Leu Ala Gly Leu Ala Gly Leu Gln Val Pro Arg Cys Pro Val Pro 385 390 395 400 Ser Phe His Val Glu Leu Cys Arg Glu Gly Lys Asn Leu Leu Lys His 405 410 415 Phe Arg Phe Arg Asp Leu Glu Glu Asp Pro Tyr Leu Pro Gly Asn Pro 420 425 430 Arg Glu Leu Ile Ala Tyr Ser Gln Tyr Pro Arg Pro Ser Asp Ile Pro 435 440 445 Gln Trp Asn Ser Asp Lys Pro Ser Leu Lys Asp I le Lys Ile Met Gly 450 455 460 Tyr Ser Ile Arg Thr Ile Asp Tyr Arg Tyr Thr Val Trp Val Gly Phe 465 470 475 480 Asn Pro Asp Glu Phe Leu Ala Asn Phe Ser Asp Ile His Ala Gly Glu 485 490 495 Leu Tyr Phe Val Asp Ser Asp Pro Leu Gln Asp His Asn Met Tyr Asn 500 505 510 Asp Ser Gln Gly Gly Asp Leu Phe Gln Leu Leu Met Pro Glu Pro Lys 515 520 525 Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 530 535 540 Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 545 550 555 560 Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 565 570 575 Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 580 585 590 Glu Val His Asn Ala Lys Thr Lys P ro Arg Glu Glu Gln Tyr Asn Ser 595 600 605 Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 610 615 620 Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 625 630 635 640 Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 645 650 655 Gln Val Tyr Thr Glu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln 660 665 670 Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala 675 680 685 Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 690 695 700 Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Leu Ser Val Leu 705 710 715 720 Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 725 730 735 Val Met His Glu Ala L eu His Asn His Tyr Thr Gln Lys Ser Leu Ser 740 745 750 Leu Ser Pro Gly Lys 755 <210> 26 <211> 273 <212> PRT <213> Artificial Sequence <220> <223> BTP5 2x-IgG1 Fc contruct < 400> 26 Leu Arg Lys Leu Arg Lys Arg Leu Leu Leu Arg Lys Leu Arg Lys Arg 1 5 10 15 Leu Leu Gly Gly Gly Gly Ser Leu Arg Lys Leu Arg Lys Arg Leu Leu 20 25 30 Leu Arg Lys Leu Arg Lys Arg Leu Leu Glu Pro Lys Ser Cys Asp Lys 35 40 45 Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro 50 55 60 Ser Val Phe Leu Phe Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 65 70 75 80 Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 85 90 95 Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 100 105 110 Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val 115 120 125 Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu 130 135 140 Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys 145 150 155 160 Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr 165 170 175 Glu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr 180 185 190 Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 195 200 205 Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu 210 215 220 Asp Ser Asp Gly Ser Phe Phe Leu Leu Ser Val Leu Thr Val Asp Lys 225 230 235 240 Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu 245 250 255 Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 260 265 270 Lys <210> 27 <211> 772 <212> PRT <213> Artificial Sequence <220> <223> IDS-L15-IgG1 Fc contract <400> 27 Ser Glu Thr Gln Ala Asn Ser Thr Thr Asp Ala Leu Asn Val Leu Leu 1 5 10 15 Ile Ile Val Asp Asp Leu Arg Pro Ser Leu Gly Cys Tyr Gly Asp Lys 20 25 30 Leu Val Arg Ser Pro Asn Ile Asp Gln Leu Ala Ser His Ser Leu Leu 35 40 45 Phe Gln Asn Ala Phe Ala Gln Gln Ala Val Cys Ala Pro Ser Arg Val 50 55 60 Ser Phe Leu Thr Gly Arg Arg Pro Asp Thr Thr Arg Leu Tyr Asp Phe 65 70 75 80 Asn Ser Tyr Trp Arg Val His Ala Gly Asn Phe Ser Thr Ile Pro Gln 85 90 95 Tyr Phe Lys Glu Asn Gly Tyr Val Thr Met Ser Val Gly Lys Val Phe 100 105 110 His Pro Gly Ile Ser Ser Asn His Thr Asp Asp Ser Pro Tyr Ser Trp 115 120 125 Ser Phe Pro Pro Tyr His Pro Ser Ser Glu Lys Tyr Glu Asn Thr Lys 130 135 140 Thr Cys Arg Gly Pro Asp Gly Glu Leu His Ala Asn Leu Leu Cys Pro 145 150 155 160 Val Asp Val Leu Asp Val Pro Glu Gly Thr Leu Pro Asp Lys Gln Ser 165 170 175 Thr Glu Gln Ala Ile Gln Leu Leu Glu Lys Met Lys Thr Ser Ala Ser 180 185 190 Pro Phe Phe Leu Ala Val Gly Tyr His Lys Pro His Ile Pro Phe Arg 195 200 205 Tyr Pro Lys Glu Phe Gln Lys Leu Tyr Pro Leu Glu Asn Ile Thr Leu 210 215 220 Ala Pro Asp Pro Glu Val Pro Asp Gly Leu Pro Pro Val Ala Tyr Asn 225 230 235 240 Pro Trp Met Asp Ile Arg Gln Arg Glu Asp Val Gln Ala Leu Asn Ile 245 250 255 Ser Val Pro Tyr Gly Pro Ile Pro Val Asp Phe Gln Arg Lys Ile Arg 260 265 270 Gln Ser Tyr Phe Ala Ser Val Ser Tyr Leu Asp Thr Gln Val Gly Arg 275 280 285 Leu Leu Ser Ala Leu Asp Asp Leu Gln Leu Ala Asn Ser Thr Ile Ile 290 295 300 Ala Phe Thr Ser Asp His Gly Trp Ala Leu Gly Glu His Gly Glu Trp 305 310 315 320 Ala Lys Tyr Ser Asn Phe Asp Val Ala Thr His Val Pro Leu Ile Phe 325 330 335 Tyr Val Pro Gly Arg Thr Ala Ser Leu Pro Glu Ala Gly Glu Lys Leu 340 345 350 Phe Pro Tyr Leu Asp Pro Phe Asp Ser Ala Ser Gln Leu Met Glu Pro 355 360 365 Gly Arg Gln Ser Met Asp Leu Val Glu Leu Val Ser Leu Phe Pro Thr 370 375 380 Leu Ala Gly Leu Ala Gly Leu Gln Val Pro Arg Cys Pro Val Pro 385 390 395 400 Ser Phe His Val Glu Leu Cys Arg Glu Gly Lys Asn Leu Leu Lys His 405 410 415 Phe Arg Phe Arg Asp Leu Glu Glu Asp Pro Tyr Leu Pro Gly Asn Pro 420 425 430 Arg Glu Leu Ile Ala Tyr Ser Gln Tyr Pro Arg Pro Ser Asp Ile Pro 435 440 445 Gln Trp Asn Ser Asp Lys Pro Ser Leu Lys Asp Ile Lys Ile Met Gly 450 455 460 Tyr Ser Ile Arg Thr Ile Asp Tyr Arg Tyr Thr Val Trp Val Gly Phe 465 470 475 480 Asn Pro Asp Glu Phe Leu Ala Asn Phe Ser Asp Ile His Ala Gly Glu 485 490 495 Leu Tyr Phe Val Asp Ser Asp Pro Leu Gln Asp His Asn Met Tyr Asn 500 505 510 Asp Ser Gln Gly Gly Asp Leu Phe Gln Leu Leu Met Pro Gly Gly Gly 515 520 525 Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Gly Ser Glu Pro Lys Ser 530 535 540 Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu 545 550 555 560 Gly Gly Pro Ser Val Phe Leu Phe Pro Lys Pro Lys Asp Thr Leu 565 570 575 Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser 580 585 590 His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu 595 600 605 Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr 610 615 620 Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn 625 630 635 640 Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro 645 650 655 Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln 660 665 670 Val Tyr Thr Glu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val 675 680 685 Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val 690 695 700 Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro 705 710 715 720 Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Leu Ser Val Leu Thr 725 730 735 Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val 740 745 750 Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu 755 760 765 Ser Pro Gly Lys 770 <210> 28 <211> 288 <212> PRT <213> Artificial Sequence <220> <223> BTP5 2x-L15-IgG1 Fc contruct <400> 28 Leu Arg Lys Leu Arg Lys Arg Leu Leu Leu Arg Lys Leu Arg Lys Arg 1 5 10 15 Leu Leu Gly Gly Gly Gly Ser Leu Arg Lys Leu Arg Lys Arg Leu Leu 20 25 30 Leu Arg Lys Leu Arg Lys Arg Leu Leu Gly Gly Gly Gly Ser Gly Gly 35 40 45 Gly Gly Ser Gly Gly Gly Gly Ser Glu Pro Lys Ser Cys Asp Lys Thr 50 55 60 His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser 65 70 75 80 Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg 85 90 95 Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro 100 105 110 Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala 115 120 125 Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Ty r Arg Val Val 130 135 140 Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr 145 150 155 160 Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 165 170 175 Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Glu 180 185 190 Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys 195 200 205 Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 210 215 220 Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp 225 230 235 240 Ser Asp Gly Ser Phe Phe Leu Leu Ser Val Leu Thr Val Asp Lys Ser 245 250 255 Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala 260 265 270 Leu His Asn His Tyr Thr Gln Lys Ser Le u Ser Leu Ser Pro Gly Lys 275 280 285 <210> 29 <211> 19 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 29 Thr Phe Phe Tyr Gly Gly Ser Arg Gly Lys Arg Asn Asn Phe Lys Thr 1 5 10 15 Glu Glu Tyr <210> 30 <211> 38 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 30 Ser Val Ile Asp Ala Leu Gln Tyr Lys Leu Glu Gly Thr Thr Arg Leu 1 5 10 15 Thr Arg Lys Arg Gly Leu Lys Leu Ala Thr Ala Leu Ser Leu Ser Asn 20 25 30 Lys Phe Val Glu Gly Ser 35 <210> 31 <211> 8 <212> PRT <213> Artificial Sequence <220> <223> BTP <220> <221> MISC_FEATURE <222> (1) <223> Xaa1 is acetylated <400> 31 Cys Met Pro Arg Leu Arg Gly Cys 1 5 <210> 32 <211> 12 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 32 Thr His Arg Pro Pro Met Trp Ser Pro Val Trp Pro 1 5 10 <210> 33 <211> 12 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 33 Pro Trp Val Pro Ser Trp Met Pro Pro Arg His Thr 1 5 10 <210> 34 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 34 Cys Arg Thr Ile Gly Pro Ser Val Cys 1 5 <210> 35 <211> 30 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 35 Tyr Gln Gln Ile Leu Thr Ser Met Pro Ser Arg Asn Val Ile Gln Ile 1 5 10 15 Ser Asn Asp Leu Glu Asn Leu Arg Asp Leu Leu His Val Leu 20 25 30 <210> 36 <211> 29 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 36 Tyr Thr Ile Trp Met Pro Glu Asn Pro Arg Pro Gly Thr Pro Cys Asp 1 5 10 15 Ile Phe Thr Asn Ser Arg Gly Lys Arg Ala Ser Asn Gly 20 25 <210> 37 <211> 16 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 37 Gly Arg Glu Ile Arg Thr Gly Arg Ala Glu Arg Trp Ser Glu Lys Phe 1 5 10 15 <210> 38 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 38 Cys Asn Cys Lys Ala Pro Glu Thr Ala Leu Cys Ala Arg Arg Arg Cys Gln 1 5 10 15 Gln His <210> 39 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> BTP <220> <221> MISC_FEATURE <222 > (1) <223> Xaa is diaminopropionic acid <400> 39 Xaa Lys Ala Pro Glu Thr Ala Leu Asp 1 5 <210> 40 <211> 13 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 40 His Leu Asn Ile Leu Ser Thr Leu Trp Lys Tyr Arg Cys 1 5 10 <210> 41 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> BTP <220> <221> MISC_FEATURE <222> (7) <223> O-beta-Glc is attaced thereto <400 > 41 Gly Phe Thr Gly Phe Leu Ser 1 5 <210> 42 <211> 12 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 42 Thr Gly Asn Tyr Lys Ala Leu His Pro His Asn Gly 1 5 10 <210> 43 <211> 11 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 43 Tyr Gly Arg Lys Lys Arg Arg Gln Arg Arg Arg 1 5 10 <210> 44 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 44 Arg Gly Gly Arg Leu Ser Tyr Ser Arg Arg Arg Phe Ser Thr Ser Thr 1 5 10 15 Gly Arg <210> 45 <211> 8 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 45 Phe Pro Phe Pro Phe Pro Phe Pro 1 5 <210> 46 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 46 His Ala Ile Tyr Pro Arg His 1 5 <210> 47 <211> 5 <212> PRT <213> Artificial Sequence <220> <223> Peptide linker motif <400> 47 Gly Gly Gly Gly Ser 1 5 <210> 48 <211> 4 <212> PRT <213> Artificial Sequence <220> <223> Peptide linker motif <400> 48 Gly Gly Gly Ser 1 <210> 49 <211> 4 <212> PRT <213> Artificial Sequence <220> <223> Peptide linker motif <400> 49 Gly Gly Ser Gly 1 <210> 50 <211> 107 <212> PRT <213> Homo sapiens <400 > 50 Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp 1 5 10 15 Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe 20 25 30 Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu 35 40 45 Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe 50 55 60 Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly 65 70 75 80 Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr 85 90 95 Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 100 105 <210> 51 <211> 18 <212> PRT <213> Artificial Sequence <220> <223> BTP <400> 51 Leu Arg Lys Leu Arg Lys Arg Leu Leu Leu Arg Lys Leu Arg Lys Arg 1 5 10 15Leu Leu

Claims (34)

하기 화학식 1로 표시되는 뇌 표적 지속형 결합체:
[화학식 1]
X-L1-F1 : Y-L2-F2
여기에서,
X 및 Y는 각각 독립적으로 생리활성 물질 또는 뇌 표적 펩타이드로, X 및 Y 중 하나가 생리활성 물질이면 다른 하나는 뇌 표적 펩타이드이고;
L1 및 L2는 각각 독립적으로 펩타이드성 링커 또는 비펩타이드성 링커이고,
L1 및 L2중 어느 하나 또는 이들 둘 다가 펩타이드성 링커일 때, 상기 펩타이드성 링커는 0개부터 1000개의 아미노산을 포함하고;
:는 X-L1-F1 및 Y-L2-F2 간의 화학결합이며;
F1 및 F2는 각각 독립적으로 면역글로불린 불변 영역을 포함하며, FcRn 결합부위를 포함하는 물질임.
A brain-targeting long-acting conjugate represented by Formula 1 below:
[Formula 1]
XL 1 -F1 : YL 2 -F2
From here,
X and Y are each independently a physiologically active substance or a brain-targeting peptide, and if one of X and Y is a physiologically active substance, the other is a brain-targeting peptide;
L 1 and L 2 are each independently a peptidic linker or a non-peptidyl linker,
when either or both of L 1 and L 2 are peptidic linkers, the peptidic linker comprises 0 to 1000 amino acids;
: is a chemical bond between XL 1 -F1 and YL 2 -F2;
F1 and F2 each independently include an immunoglobulin constant region, and is a substance comprising an FcRn binding site.
 제1항에 있어서, 상기 F1과 F2의 면역글로불린 불변 영역은 면역글로불린 CH1, CH2, CH3, 및 CH4 도메인으로 이루어진 군으로부터 선택된 1개 내지 4개의 도메인을 포함하는, 뇌 표적 지속형 결합체.
According to claim 1, wherein the immunoglobulin constant region of F1 and F2 comprises 1 to 4 domains selected from the group consisting of immunoglobulin CH1, CH2, CH3, and CH4 domains, brain target long-acting conjugate.
 제2항에 있어서, 상기 면역글로불린 불변 영역은 힌지 영역을 포함하는, 뇌 표적 지속형 결합체.
The brain-targeted long-acting conjugate of claim 2 , wherein the immunoglobulin constant region comprises a hinge region.
 제1항에 있어서, 상기 F1의 면역글로불린 불변 영역 및 F2의 면역글로불린 불변 영역 각각은 힌지 영역, CH2 도메인 및 CH3 도메인을 포함하는, 뇌 표적 지속형 결합체.
The brain-targeting long-acting conjugate of claim 1, wherein each of the immunoglobulin constant region of F1 and the immunoglobulin constant region of F2 comprises a hinge region, a CH2 domain and a CH3 domain.
 제1항에 있어서, 상기 면역글로불린 불변 영역은 면역글로불린 Fc 영역인, 뇌 표적 지속형 결합체.
The brain-targeting long-acting conjugate of claim 1, wherein the immunoglobulin constant region is an immunoglobulin Fc region.
 제1항에 있어서, 상기 면역글로불린 불변 영역은 IgG 유래인, 뇌 표적 지속형 결합체.
The brain-targeting long-acting conjugate of claim 1, wherein the immunoglobulin constant region is derived from IgG.
 제6항에 있어서, 상기 IgG는 IgG1, IgG2, IgG3, 및 IgG4로 이루어진 군에서 선택되는, 뇌 표적 지속형 결합체.
The brain-targeting long-acting conjugate of claim 6, wherein the IgG is selected from the group consisting of IgG1, IgG2, IgG3, and IgG4.
 제6항에 있어서, 상기 면역글로불린 불변 영역은 IgG1 또는 IgG4 유래인, 뇌 표적 지속형 결합체.
The brain-targeting long-acting conjugate according to claim 6, wherein the immunoglobulin constant region is derived from IgG1 or IgG4.
 제6항에 있어서, 상기 면역글로불린 불변 영역은 비당쇄화되고, 인간 IgG1 또는 IgG4 Fc 영역 유래의 아미노산 서열을 가지는, 뇌 표적 지속형 결합체.
The brain-targeting long-acting conjugate according to claim 6, wherein the immunoglobulin constant region is non-glycosylated and has an amino acid sequence derived from a human IgG1 or IgG4 Fc region.
 제1항에 있어서,
상기 F1은 IgG1의 힌지 영역, CH2 도메인, 및 CH3 도메인을 포함하고, 여기서 CH3 도메인은 야생형 IgG1의 CH3 도메인의 아미노산 서열에서 26번 아미노산인 트레오닌(Thr)의 류신(Leu)으로의 치환 및 59번 아미노산인 아스파르트산 (Asp)의 아르기닌(Arg)으로의 치환을 포함하며;
상기 F2는 IgG1의 힌지 영역, CH2 도메인 및 CH3 도메인을 포함하고, 상기 CH3 도메인은 야생형 IgG1의 CH3 도메인의 아미노산 서열에서 11번 아미노산인 류신(Leu)의 글루탐산(Glu)으로의 치환, 67번 아미노산인 티로신(Tyr)의 류신(Leu)으로의 치환, 및 69번 아미노산인 라이신(Lys)의 발린(Val)으로의 치환을 포함하는, 뇌 표적 지속형 결합체.
According to claim 1,
wherein F1 includes a hinge region, a CH2 domain, and a CH3 domain of IgG1, wherein the CH3 domain is amino acid 26 in the amino acid sequence of the CH3 domain of wild-type IgG1, threonine (Thr) is substituted with leucine (Leu), and substitution of the amino acid aspartic acid (Asp) with arginine (Arg);
The F2 includes a hinge region, a CH2 domain and a CH3 domain of IgG1, wherein the CH3 domain is amino acid 11 in the amino acid sequence of the CH3 domain of wild-type IgG1, leucine (Leu) is substituted with glutamic acid (Glu), amino acid 67 A brain-targeting long-acting conjugate comprising a substitution of tyrosine (Tyr) with leucine (Leu) and a substitution of valine (Val) for lysine (Lys) at amino acid 69.
 제1항에 있어서, 상기 지속형 결합체는 뇌 혈관 장벽을 통과하여, 뇌 조직 내로 생리 활성 물질을 전달하는, 뇌 표적 지속형 결합체.
The brain-targeting long-acting conjugate according to claim 1, wherein the long-acting conjugate passes the blood-brain barrier and delivers a physiologically active substance into brain tissue.
 제1항에 있어서, 상기 뇌 표적 펩타이드는 뇌 혈관 장벽을 통과할 수 있는 아미노산 서열을 포함하는 펩타이드, 단백질, 또는 항체의 형태인, 뇌 표적 지속형 결합체.
The brain-targeting long-acting conjugate according to claim 1, wherein the brain-targeting peptide is in the form of a peptide, protein, or antibody comprising an amino acid sequence capable of crossing the blood-brain barrier.
 제12항에 있어서, 상기 뇌 표적 펩타이드는 수동전달(passive transport)에 의한 경로 또는 수용체 매개 전달(receptor-mediated transport)에 의한 경로를 통해 뇌 혈관 장벽을 통과하는, 뇌 표적 지속형 결합체.
The brain-targeting long-acting conjugate of claim 12 , wherein the brain-targeting peptide crosses the blood-brain barrier via a pathway by passive transport or a pathway by receptor-mediated transport.
 제13항에 있어서,
인슐린 수용체(insulin receptor), 트랜스페린 수용체(transferrin receptor), 저밀도 지질단백질 수용체(low density lipoprotein receptor), 저밀도 지질단백질 수용체 관련 단백질(Low density lipoprotein receptor-related protein), 렙틴 수용체(leptin receptor), 니코틴성 아세틸콜린 수용체(nicotinic acetylcholine receptor), 글루타티온 수송체(Glutathione transporter), 칼슘의존성 칼륨통로(calcium-activated potassium channel), 및 RAGE (receptor for advanced glycation endproducts), 및 상기 수용체들의 리간드 및 상기 수용체 또는 리간드에 결합하는 항체로 이루어진 군으로부터 선택된 어느 하나를 통하여 수용체 매개 전달 경로에 의해 뇌 혈관 장벽을 통과하는, 뇌 표적 지속형 결합체.
14. The method of claim 13,
Insulin receptor, transferrin receptor, low density lipoprotein receptor, low density lipoprotein receptor-related protein, leptin receptor, nicotinic nicotinic acetylcholine receptor, glutathione transporter, calcium-activated potassium channel, and receptor for advanced glycation endproducts (RAGE), and ligands of the receptors and the receptors or ligands A brain-targeting long-acting conjugate that crosses the blood-brain barrier by a receptor-mediated transduction pathway through any one selected from the group consisting of a binding antibody.
 제1항에 있어서,
상기 생리활성 물질은 톡신; 또는 GLP-1(Glucagon like peptide-1) 수용체 아고니스트; 글루카곤 수용체 아고니스트; GIP(Gastric inhibitory polypeptide) 수용체 아고니스트; FGF(Fibroblast growth factor) 수용체 아고니스트; 콜레키스토키닌 (Cholecystokinin) 수용체 아고니스트; 가스트린(gastrin) 수용체 아고니스트; 멜라노코르틴(melanocortin) 수용체 아고니스트; 인간 성장호르몬; 성장호르몬 방출 호르몬; 성장호르몬 방출 펩타이드; 인터페론; 인터페론 수용체; 콜로니 자극인자; 인터루킨; 인터루킨 수용체; 효소; 인터루킨 결합 단백질; 사이토카인 결합 단백질; 마크로파지 활성인자; 마크로파지 펩타이드; B 세포인자; T 세포인자; 단백질 A; 알러지 억제인자; 세포 괴사 당단백질; 면역독소; 림포독소; 종양 괴사인자; 종양 억제인자; 전이 성장인자; 알파-1 안티트립신; 알부민; 알파-락트알부민(alpha-lactalbumin); 아포리포 단백질-E; 적혈구 생성 인자; 고 당쇄화 적혈구 생성인자; 안지오포이에틴(angiopoietin); 헤모글로빈; 트롬빈(thrombin); 트롬빈 수용체 활성 펩타이드; 트롬보모듈린(thrombomodulin); 혈액인자 VII; 혈액인자 VIIa; 혈액인자 VIII; 혈액인자 IX; 혈액인자 XIII; 플라즈미노겐 활성인자; 피브린-결합 펩타이드; 유로키나제; 스트렙토키나제; 히루딘(hirudin); 단백질 C; C-반응성 단백질; 레닌 억제제; 콜라게나제 억제제; 수퍼옥사이드 디스뮤타제; 렙틴; 혈소판 유래 성장인자; 상피세포 성장인자; 표피세포 성장인자; 안지오스타틴(angiostatin); 안지오텐신(angiotensin); 골 형성 성장인자; 골 형성 촉진 단백질; 칼시토닌; 인슐린; 아트리오펩틴; 연골 유도인자; 엘카토닌(elcatonin); 결합조직 활성인자; 조직인자 경로 억제제(tissue factor pathway inhibitor); 여포 자극 호르몬; 황체 형성 호르몬; 황체 형성 호르몬 방출 호르몬; 신경 성장인자류; 악소제네시스 인자-1(axogenesis factor-1); 뇌-나트륨 이뇨 펩타이드(brain-natriuretic peptide); 신경교 유래 신경영양인자(glial derived neurotrophic factor); 네트린(netrin); 중성구 억제인자(neurophil inhibitor factor); 신경영양인자; 뉴트린(neuturin); 부갑상선 호르몬; 릴랙신; 시크레틴; 소마토메딘; 인슐린 유사 성장인자; 부신피질 호르몬; 글루카곤; 콜레시스토키닌; 췌장 폴리펩타이드; 가스트린 방출 펩타이드; 코티코트로핀 방출인자; 갑상선 자극호르몬; 오토탁신(autotaxin); 락토페린(lactoferrin); 미오스타틴(myostatin); ADNP(activity-dependent neuroprotective protein), BACE1(beta-secretase1), APP(Amyloid Precursor Protein), NCAM(Neural cell adhesion molecule), 아밀로이드 베타(Amyloid beta), 타우(Tau), RAGE(receptor for advanced glycation endproducts), 알파-시누클레인(alpha-synuclein), 또는 이들의 아고니스트 또는 안타고니스트; 수용체류, 수용체 아고니스트; 세포표면항원; 단일클론 항체; 다중클론 항체; 항체 단편; 바이러스 유래 백신 항원; 하나 이상의 수용체 아고니스트를 활성화 시키는 하이브리드 폴리펩타이드 또는 키메릭 (chimeric) 폴리펩타이드; 및 이들의 아날로그를 포함하는 군으로 이루어진 군에서 선택된 생리활성 물질인, 뇌 표적 지속형 결합체.
According to claim 1,
The physiologically active substance is a toxin; or a GLP-1 (Glucagon like peptide-1) receptor agonist; glucagon receptor agonists; Gastric inhibitory polypeptide (GIP) receptor agonists; Fibroblast growth factor (FGF) receptor agonists; Cholecystokinin receptor agonist; gastrin receptor agonists; melanocortin receptor agonists; human growth hormone; growth hormone releasing hormone; growth hormone releasing peptide; interferon; interferon receptor; colony stimulating factor; interleukin; interleukin receptor; enzyme; interleukin binding protein; cytokine binding protein; macrophage activator; macrophage peptides; B cell factor; T cell factor; protein A; allergy suppressors; cell necrosis glycoprotein; immunotoxins; lymphotoxin; tumor necrosis factor; tumor suppressors; metastatic growth factor; alpha-1 antitrypsin; albumin; alpha-lactalbumin; apolipoprotein-E; erythropoietin; high glycosylated erythropoietin; angiopoietin; hemoglobin; thrombin; thrombin receptor activating peptide; thrombomodulin; blood factor VII; blood factor VIIa; blood factor VIII; blood factor IX; blood factor XIII; plasminogen activator; fibrin-binding peptide; urokinase; streptokinase; hirudin; protein C; C-reactive protein; renin inhibitors; collagenase inhibitors; superoxide dismutase; leptin; platelet-derived growth factor; epidermal growth factor; epidermal growth factor; angiostatin; angiotensin; osteogenic growth factor; bone-promoting protein; calcitonin; insulin; atriopeptin; cartilage inducer; elcatonin; connective tissue activator; tissue factor pathway inhibitors; follicle stimulating hormone; luteinizing hormone; luteinizing hormone releasing hormone; nerve growth factors; axogenesis factor-1; brain-natriuretic peptide; glial derived neurotrophic factor; netrin; neutrophil inhibitor factor; neurotrophic factor; nutrin; parathyroid hormone; relaxin; secretin; somatomedin; insulin-like growth factor; adrenocortical hormone; glucagon; cholecystokinin; pancreatic polypeptide; gastrin releasing peptide; corticotropin releasing factor; thyroid stimulating hormone; autotaxin; lactoferrin; myostatin; ADNP (activity-dependent neuroprotective protein), BACE1 (beta-secretase1), APP (Amyloid Precursor Protein), NCAM (Neural cell adhesion molecule), Amyloid beta, Tau, RAGE (receptor for advanced glycation endproducts) ), alpha-synuclein, or an agonist or antagonist thereof; receptor class, receptor agonist; cell surface antigen; monoclonal antibody; polyclonal antibodies; antibody fragments; virus-derived vaccine antigens; hybrid polypeptides or chimeric polypeptides that activate one or more receptor agonists; and a physiologically active substance selected from the group consisting of analogs thereof, a brain-targeting long-acting conjugate.
 제15항에 있어서,
상기 톡신은 메이탄신(Maytansine) 또는 이의 유도체, 오리스타틴 (Auristatin) 또는 이의 유도체, 듀오카마이신(Duocarmycin) 또는 이의 유도체, 및 PBD(Pyrrolobenzodiazepine) 또는 이의 유도체로 이루어진 군에서 선택되고,GLP-1(Glucagon like peptide-1) 수용체 아고니스트는 천연형 엑센딘-3 또는 천연형 엑센딘-4, 및 이들의 아날로그로 이루어진 군에서 선택된 것이며, FGF 수용체 아고니스트는 FGF1 또는 이의 아날로그, FGF19 또는 이의 아날로그, FGF21 또는 이의 아날로그, 및 FGF23 또는 이의 아날로그로 이루어진 군에서 선택되고,
인터페론은 인터페론-알파, 인터페론-베타 및 인터페론-감마로 이루어진 군에서 선택되고,
인터페론 수용체는 인터페론-알파 수용체, 인터페론-베타 수용체, 인터페론-감마 수용체, 및 수용성 타입 I 인터페론 수용체로 이루어진 군에서 선택되고,
인터루킨은 인터루킨-1, 인터루킨-2, 인터루킨-3, 인터루킨-4, 인터루킨-5, 인터루킨-6, 인터루킨-7, 인터루킨-8, 인터루킨-9, 인터루킨-10, 인터루킨-11, 인터루킨-12, 인터루킨-13, 인터루킨-14, 인터루킨-15, 인터루킨-16, 인터루킨-17, 인터루킨-18, 인터루킨-19, 인터루킨-20, 인터루킨-21, 인터루킨-22, 인터루킨-23, 인터루킨-24, 인터루킨-25, 인터루킨-26, 인터루킨-27, 인터루킨-28, 인터루킨-29, 및 인터루킨-30으로 이루어진 군에서 선택되고,
인터루킨 수용체는 인터루킨- 1 수용체 또는 인터루킨-4 수용체이고,
효소는 베타글루코시다제(beta-glucosidase), 알파갈락토시다제(alpha-galactosidase), 베타갈락토시다제(beta-galactosidase), 이두로니다제(iduronidase), 이두로네이트 2-설파타제(iduronate-2-sulfatase), 갈락토스-6-설파타제(Galactose-6-sulfatase), 산성 알파-글루코시다제(acid alpha-glucosidase), 산성 세라미다제(acid ceramidase), 산성 스핑고미엘리나제(acid sphingomyelinsase), 갈락토세레브로시다제(galactocerebrosidsase), 아릴설파타제(arylsulfatase) A, 아릴설파타제 B, 베타-헥소사미니다제 (beta-hexosaminidase) A, 베타-헥소사미니다제 B, 헤파린-N-설파타제(heparin N-sulfatase), 알파-D-마노시다제(alpha-D-mannosidase), 베타-글루쿠로니다제(beta-glucuronidase), N-아세틸갈락토사민-6-설파타제(N-acetylgalactosamine-6 sulfatase), 리소좀 산성 리파제(lysosomal acid lipase), 알파-N-아세틸-글루코사미니다제(alpha-N-acetyl-glucosaminidase), 글루코세레브로시다제(glucocerebrosidase), 부티릴콜린에스터라제(butyrylcholinesterase), 키티나제(Chitinase), 글루타메이트 디카르복실라제(glutamate decarboxylase), 이미글루세라제(imiglucerase), 리파아제(lipase), 우리카제(Uricase), 혈소판활성인자 아세틸하이드로라제(Platelet-Activating Factor Acetylhydrolase), 뉴트럴 엔도펩티다제(neutral endopeptidase), 미엘로퍼옥시다제(myeloperoxidase), 알파-갈락토시다제-A, 아갈시다제 알파(agalsidase alpha), 아갈시다제 베타, 알파-L-이두로니다제(alpha-L-iduronidase), 뷰티릴콜린에스터라제(butyrylcholinesterase), 키티나제(chitinase), 글루타메이트 디카르복실라제(glutamate decarboxylase), 및 이미글루세라제(imiglucerase)로 이루어진 군에서 선택되고,
인터루킨 결합 단백질은 IL-18bp이고,
사이토카인 결합 단백질은 TNF (Tumor necrosis factor) 결합 단백질이고,
신경 성장인자류는 신경 성장인자, 모양체 신경영양인자(cilliary neurotrophic factor), 악소제네시스 인자-1(axogenesis factor-1), 뇌-나트륨 이뇨 펩타이드(brain-natriuretic peptide), 신경교 유래 신경영양인자(glial derived neurotrophic factor), 네트린(netrin), 중성구 억제인자(neurophil inhibitor factor), 신경영양인자, 및 뉴트린(neuturin)으로 이루어진 군에서 선택되고,
미오스타틴 수용체는 TNFR(P75), TNFR(P55), IL-1 수용체, VEGF 수용체, 및 B 세포 활성인자 수용체로 이루어진 군에서 선택되고,
미오스타틴 수용체 안타고니스트는 IL1-Ra이고,
세포표면 항원은 CD2, CD3, CD4, CD5, CD7, CD11a, CD11b, CD18, CD19, CD20, CD23, CD25, CD33, CD38, CD40, CD45 및 CD69로 이루어진 군에서 선택되고,
항체 단편류는 scFv, Fab, Fab', F(ab')2 및 Fd로 이루어진 군에서 선택되는, 뇌 표적 지속형 결합체.
16. The method of claim 15,
The toxin is selected from the group consisting of maytansine or a derivative thereof, auristatin or a derivative thereof, duocarmycin or a derivative thereof, and Pyrrolobenzodiazepine (PBD) or a derivative thereof, GLP-1 ( Glucagon like peptide-1) receptor agonist is selected from the group consisting of native exendin-3 or native exendin-4, and analogs thereof, and the FGF receptor agonist is FGF1 or an analog thereof, FGF19 or analog thereof; selected from the group consisting of FGF21 or an analog thereof, and FGF23 or an analog thereof,
the interferon is selected from the group consisting of interferon-alpha, interferon-beta and interferon-gamma;
the interferon receptor is selected from the group consisting of an interferon-alpha receptor, an interferon-beta receptor, an interferon-gamma receptor, and a soluble type I interferon receptor,
Interleukin is interleukin-1, interleukin-2, interleukin-3, interleukin-4, interleukin-5, interleukin-6, interleukin-7, interleukin-8, interleukin-9, interleukin-10, interleukin-11, interleukin-12, Interleukin-13, Interleukin-14, Interleukin-15, Interleukin-16, Interleukin-17, Interleukin-18, Interleukin-19, Interleukin-20, Interleukin-21, Interleukin-22, Interleukin-23, Interleukin-24, Interleukin- 25, interleukin-26, interleukin-27, interleukin-28, interleukin-29, and interleukin-30;
the interleukin receptor is an interleukin-1 receptor or an interleukin-4 receptor,
Enzymes are beta-glucosidase, alpha-galactosidase, beta-galactosidase, iduronidase, iduronate 2-sulfatase ( iduronate-2-sulfatase, galactose-6-sulfatase, acid alpha-glucosidase, acid ceramidase, acid sphingomyelinase sphingomyelinsase), galactocerebrosidsase, arylsulfatase A, arylsulfatase B, beta-hexosaminidase A, beta-hexosaminidase B, heparin-N -sulfatase (heparin N-sulfatase), alpha-D-mannosidase (alpha-D-mannosidase), beta-glucuronidase (beta-glucuronidase), N-acetylgalactosamine-6-sulfatase ( N-acetylgalactosamine-6 sulfatase, lysosomal acid lipase, alpha-N-acetyl-glucosaminidase, glucocerebrosidase, butyrylcholine Butyrylcholinesterase, Chitinase, glutamate decarboxylase, imiglucerase, lipase, Uricase, platelet activator acetylhydrolase (Platelet-) Activating Factor Acetylhydrolase, neutral endopeptidase, myeloperoxidase, alpha-galactosidase-A, agalsidase alpha, agalsidase beta, alpha-L-iduronidase, butyrylcholinesterase, chitinase, glutamate decarboxylase, and imiglucerase selected from the group consisting of
the interleukin binding protein is IL-18bp,
The cytokine binding protein is a TNF (Tumor necrosis factor) binding protein,
Nerve growth factors include nerve growth factor, cilliary neurotrophic factor, axogenesis factor-1, brain-natriuretic peptide, glial derived neurotrophic factor factor), netrin (netrin), neutrophil inhibitor factor (neurophil inhibitor factor), neurotrophic factor, and selected from the group consisting of nutrin (neuturin),
Myostatin receptor is selected from the group consisting of TNFR (P75), TNFR (P55), IL-1 receptor, VEGF receptor, and B cell activator receptor,
The myostatin receptor antagonist is IL1-Ra,
the cell surface antigen is selected from the group consisting of CD2, CD3, CD4, CD5, CD7, CD11a, CD11b, CD18, CD19, CD20, CD23, CD25, CD33, CD38, CD40, CD45 and CD69,
The antibody fragment is selected from the group consisting of scFv, Fab, Fab', F(ab') 2 and Fd, a brain-targeting long-acting conjugate.
 제15항에 있어서,
상기 GLP-1 수용체 아고니스트는 천연형 엑센딘-4, 천연형 엑센딘-4의 N-말단 아민 그룹이 제거된 엑센딘-4, 천연형 엑센딘-4의 N-말단 아민 그룹이 하이드록실 그룹으로 치환된 엑센딘-4, 천연형 엑센딘-4의 N-말단 아민 그룹이 디메틸기로 수식된 엑센딘-4, 천연형 엑센딘-4의 N-말단 아민기가 카르복실기로 치환된 엑센딘-4, 천연형 엑센딘-4의 첫 번째 아미노산(히스티딘)의 알파 탄소가 제거된 엑센딘-4; 및 상기 엑센딘-4의 열두 번째 아미노산(라이신)이 세린으로 치환된 엑센딘-4 및 상기 엑센딘-4의 열두 번째 아미노산(라이신)이 알지닌으로 치환된 엑센딘-4로 이루어진 군에서 선택되는, 뇌 표적 지속형 결합체.
16. The method of claim 15,
The GLP-1 receptor agonist includes native exendin-4, exendin-4 from which the N-terminal amine group of native exendin-4 has been removed, and the N-terminal amine group of native exendin-4 with hydroxyl. exendin-4 substituted with a group, exendin-4 in which the N-terminal amine group of native exendin-4 is modified with a dimethyl group, exendin- in which the N-terminal amine group of natural exendin-4 is substituted with a carboxyl group 4, exendin-4 from which the alpha carbon of the first amino acid (histidine) of native exendin-4 has been removed; and exendin-4 in which the twelfth amino acid (lysine) of exendin-4 is substituted with serine and exendin-4 in which the twelfth amino acid (lysine) of exendin-4 is substituted with arginine. A brain-targeted long-acting conjugate.
 제1항에 있어서,
상기 L1 및 L2 중 어느 하나 또는 둘 다가 비펩타이드성 링커일 때, 상기 비펩타이드성 링커는 폴리에틸렌글리콜, 폴리프로필렌 글리콜, 에틸렌 글리콜-프로필렌 글리콜 공중합체, 폴리옥시에틸화폴리올, 폴리비닐알콜, 다당류, 덱스트란, 폴리비닐에틸에테르, 생분해성 고분자, 지질 중합체, 키틴, 히알루론산, 지방산, 고분자 중합체, 저분자 화합물, 뉴클레오타이드 및 이들의 조합으로 이루어진 군으로부터 선택되는, 뇌 표적 지속형 결합체.
According to claim 1,
When any one or both of L 1 and L 2 is a non-peptide linker, the non-peptide linker is polyethylene glycol, polypropylene glycol, ethylene glycol-propylene glycol copolymer, polyoxyethylated polyol, polyvinyl alcohol, Polysaccharides, dextran, polyvinyl ethyl ether, biodegradable polymers, lipid polymers, chitin, hyaluronic acid, fatty acids, high molecular weight polymers, low molecular weight compounds, selected from the group consisting of nucleotides and combinations thereof, brain target long-acting conjugate.
 제1항에 있어서,
상기 L1 및 L2 중 어느 하나 또는 둘 다가 펩타이드성 링커일 때, 상기 X와 F1 및 Y와 F2는 각각 독립적으로 공유 화학결합, 비공유 화학결합 또는 이들의 조합으로 L1 및 L2 에 의해 서로 결합되고, L1 및 L2는 각각 독립적으로 0개부터 1000개의 아미노산을 포함하는, 뇌 표적 지속형 결합체.
According to claim 1,
When any one or both of L 1 and L 2 is a peptidic linker, X and F1 and Y and F2 are each independently a covalent chemical bond, a non-covalent chemical bond, or a combination thereof by L 1 and L 2 bound, and L 1 and L 2 are each independently 0 to 1000 amino acids.
 제1항에 있어서,
L1 및 L2 중 어느 하나 또는 둘 다가 펩타이드성 링커일 때, L1 및 L2 는 0개의 아미노산으로 이루어지고,
상기 결합체는
(i) X와 F1 간의 펩타이드 결합, (ii) Y와 F2 간의 펩타이드 결합; 또는 (iii) X와 F1 간의 펩타이드 결합 및 Y와 F2 간의 펩타이드 결합을 포함하는,
뇌 표적 지속형 결합체.
The method of claim 1,
when either or both of L 1 and L 2 are peptidic linkers, L 1 and L 2 consist of 0 amino acids,
The combination is
(i) a peptide bond between X and F1, (ii) a peptide bond between Y and F2; or (iii) a peptide bond between X and F1 and a peptide bond between Y and F2,
Brain-targeted long-acting conjugate.
 제1항에 있어서,
L1 및 L2 중 어느 하나가 펩타이드성 링커이고, 이 중 다른 하나는 비펩타이드성 링커이며,
이때 상기 펩타이드성 링커는 0부터 1000개의 아미노산을 포함하는 링커이며,
상기 비펩타이드성 링커는 폴리에틸렌 글리콜인, 뇌 표적 지속형 결합체.
According to claim 1,
Any one of L 1 and L 2 is a peptidic linker, and the other is a non-peptidyl linker,
In this case, the peptidic linker is a linker containing 0 to 1000 amino acids,
The non-peptidyl linker is polyethylene glycol, the brain-targeting long-acting conjugate.
 제1항에 있어서, 상기 비펩타이드성 링커는 1kDa 내지 100kDa의 분자량을 가지는, 뇌 표적 지속형 결합체.
According to claim 1, wherein the non-peptidyl linker has a molecular weight of 1 kDa to 100 kDa, brain-targeting long-acting conjugate.
 제1항에 있어서,
L1에 의해 X의 C-말단 영역 및 F1의 N-말단 영역이 연결되고, L2에 의해 Y의 C-말단 영역 및 F2의 N-말단 영역이 연결되는, 뇌 표적 지속형 결합체.
According to claim 1,
A brain-targeting long-acting conjugate, wherein the C-terminal region of X and the N-terminal region of F1 are connected by L 1 , and the C-terminal region of Y and the N-terminal region of F2 are connected by L 2 .
 제1항에 있어서,
L1의 일 말단은 X의 라이신 잔기 또는 시스테인 잔기에, L1의 다른 말단은 F1의 N-말단 영역에 연결되고,
L2의 일 말단은 Y의 라이신 잔기 또는 시스테인 잔기에, L2의 다른 말단은 F2의 N-말단 영역에 연결되는,
뇌 표적 지속형 결합체.
According to claim 1,
One end of L 1 is linked to a lysine residue or cysteine residue of X, and the other end of L 1 is linked to the N-terminal region of F1,
One end of L 2 is connected to a lysine residue or cysteine residue of Y, and the other end of L 2 is connected to the N-terminal region of F2,
Brain-targeted long-acting conjugate.
 제3항에 있어서,
X-L1-F1 및 Y-L2-F2 간의 화학결합은 F1의 면역글로불린 불변영역의 힌지 영역 및 F2의 면역글로불린 불변영역의 힌지 영역 간에 형성된 이황화 결합인,
뇌 표적 지속형 결합체.
4. The method of claim 3,
The chemical bond between XL 1 -F1 and YL 2 -F2 is a disulfide bond formed between the hinge region of the immunoglobulin constant region of F1 and the hinge region of the immunoglobulin constant region of F2,
Brain-targeted long-acting conjugate.
 X-L1-F1를 코딩하는 폴리뉴클레오티드를 포함하는 발현 카세트 및 Y-L2-F2를 코딩하는 폴리뉴클레오티드를 포함하는 발현 카세트를 포함하며,
X 및 Y는 각각 독립적으로 생리활성 물질 또는 뇌 표적 펩타이드로, X 및 Y 중 하나가 생리활성 물질이면 다른 하나는 뇌 표적 펩타이드이고;
L1 및 L2는 각각 펩타이드성 링커이고,
L1 및 L2중 어느 하나 또는 이들 둘 다가 펩타이드성 링커일 때, 상기 펩타이드성 링커는 0개부터 1000개의 아미노산을 포함하며,
F1 및 F2는 각각 독립적으로 면역글로불린 불변 영역을 포함하며, FcRn 결합부위를 포함하는 물질인,
제1항의 뇌 표적 지속형 결합체를 발현하는 발현벡터.
an expression cassette comprising a polynucleotide encoding XL 1 -F1 and an expression cassette comprising a polynucleotide encoding YL 2 -F2,
X and Y are each independently a physiologically active substance or a brain-targeting peptide, and if one of X and Y is a physiologically active substance, the other is a brain-targeting peptide;
L 1 and L 2 are each a peptidic linker,
When any one or both of L 1 and L 2 is a peptidic linker, the peptidic linker comprises 0 to 1000 amino acids,
F1 and F2 are each independently comprising an immunoglobulin constant region, a substance comprising an FcRn binding site,
An expression vector expressing the brain-targeting long-acting conjugate of claim 1.
 제26항의 발현벡터를 포함하는, 인간을 제외한 형질전환체.
A transformant other than a human comprising the expression vector of claim 26 .
 하기 단계를 포함하는 제1항 내지 제25항 중 어느 한 항의 뇌 표적 지속형 결합체의 제조방법:
(a) X-L1-F1 및 L2-Y-F2를 각각 제공하는 단계; 및
(b) X-L1-F1 및 L2-Y-F2을 서로 접촉시켜 이들 간에 화학 결합을 형성하는 단계;
여기서,
X 및 Y는 각각 독립적으로 생리활성 물질 또는 뇌 표적 펩타이드로, X 및 Y 중 하나가 생리활성 물질이면 다른 하나는 뇌 표적 펩타이드이고;
L1 및 L2는 각각 독립적으로 펩타이드성 링커 또는 비펩타이드성 링커이고,
L1 및 L2중 어느 하나 또는 이들 둘 다가 펩타이드성 링커일 때, 상기 펩타이드성 링커는 0개부터 1000개의 아미노산을 포함하고;
F1 및 F2는 각각 독립적으로 면역글로불린 불변 영역을 포함하며, FcRn 결합부위를 포함하는 물질임.
A method for preparing the brain-targeting long-acting conjugate of any one of claims 1 to 25, comprising the steps of:
(a) providing XL 1 -F1 and L 2 -Y-F2, respectively; and
(b) contacting XL 1 -F1 and L 2 -Y-F2 with each other to form a chemical bond therebetween;
here,
X and Y are each independently a physiologically active substance or a brain-targeting peptide, and if one of X and Y is a physiologically active substance, the other is a brain-targeting peptide;
L 1 and L 2 are each independently a peptidic linker or a non-peptidyl linker,
when either or both of L 1 and L 2 are peptidic linkers, the peptidic linker comprises 0 to 1000 amino acids;
F1 and F2 each independently include an immunoglobulin constant region, and is a substance comprising an FcRn binding site.
 제28항에 있어서,
상기 L1 및 L2는 각각 독립적으로 펩타이드성 링커 또는 비펩타이드성 링커인, 제조방법.
29. The method of claim 28,
The L 1 and L 2 are each independently a peptide linker or a non-peptidyl linker.
 제28항에 있어서,
상기 L1 및 L2는 모두 펩타이드성 링커인, 제조방법.
29. The method of claim 28,
The L 1 and L 2 are all peptidic linkers, the production method.
 제28항에 있어서, 상기 L1 및 L2 각각은 0개의 아미노산을 가지는 펩타이드성 링커인 펩타이드 결합인, 제조방법.
The method of claim 28, wherein each of L 1 and L 2 is a peptide bond that is a peptidic linker having 0 amino acids.
 제28항에 있어서, 상기 L1 및 L2은 모두 비펩타이드성 링커인, 제조방법.
The method of claim 28, wherein L 1 and L 2 are both non-peptidyl linkers.
 제28항에 있어서, 상기 L1 또는 L2은 비펩타이드성 링커이며, 상기 비펩타이드성 링커는 알데히드 기, 말레이미드(maleimide) 기 및 석시니미드 유도체(succinimide derivative)로 이루어진 군에서 선택되는 작용기를 통하여 X 또는 Y의 작용기와 공유 결합을 형성하는, 제조방법.
29. The method of claim 28, wherein L 1 or L 2 is a non-peptide linker, wherein the non-peptide linker is a functional group selected from the group consisting of an aldehyde group, a maleimide group, and a succinimide derivative. A method for forming a covalent bond with a functional group of X or Y through
 (a) 제27항의 형질전환체를 배양하여 뇌 표적 지속형 결합체를 발현하는 단계; 및
(b) 상기 (a) 단계에서 발현된 뇌 표적 지속형 결합체를 회수하는 단계를 포함하는, 제1항의 뇌 표적 지속형 결합체를 제조하는 방법.(a) culturing the transformant of claim 27 to express the brain target long-acting conjugate; and
(b) a method for preparing the brain-targeting long-acting conjugate of claim 1, comprising the step of recovering the brain-targeting long-acting conjugate expressed in step (a).
KR1020200161534A 2020-11-26 2020-11-26 Novel long-acting protein conjugates for brain targeting and a preparation method thereof KR20220073454A (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
KR1020200161534A KR20220073454A (en) 2020-11-26 2020-11-26 Novel long-acting protein conjugates for brain targeting and a preparation method thereof
PCT/KR2021/017597 WO2022114838A1 (en) 2020-11-26 2021-11-26 Novel brain-targeting, long-acting protein conjugate and preparation method therefor

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
KR1020200161534A KR20220073454A (en) 2020-11-26 2020-11-26 Novel long-acting protein conjugates for brain targeting and a preparation method thereof

Publications (1)

Publication Number Publication Date
KR20220073454A true KR20220073454A (en) 2022-06-03

Family

ID=81754828

Family Applications (1)

Application Number Title Priority Date Filing Date
KR1020200161534A KR20220073454A (en) 2020-11-26 2020-11-26 Novel long-acting protein conjugates for brain targeting and a preparation method thereof

Country Status (2)

Country Link
KR (1) KR20220073454A (en)
WO (1) WO2022114838A1 (en)

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2014312190A1 (en) * 2013-08-28 2016-02-18 Bioasis Technologies Inc. CNS-targeted conjugates of antibodies
JP2018508504A (en) * 2015-02-17 2018-03-29 ハンミ ファーマシューティカル カンパニー リミテッド Sustained insulin or insulin analogue conjugate
EP3556399A1 (en) * 2016-12-19 2019-10-23 Hanmi Pharm. Co., Ltd. Brain targeting long-acting protein conjugate
EP3904389A1 (en) * 2017-10-02 2021-11-03 Denali Therapeutics Inc. Fusion proteins comprising enzyme replacement therapy enzymes
WO2019190293A1 (en) * 2018-03-30 2019-10-03 한미약품 주식회사 Brain-targeting, long-acting protein conjugate, preparation method therefor, and composition comprising same

Also Published As

Publication number Publication date
WO2022114838A1 (en) 2022-06-02

Similar Documents

Publication Publication Date Title
JP6976400B2 (en) A conjugate of a bioactive polypeptide monomer and an immunoglobulin Fc fragment having reduced receptor-mediated clearance, and a method for producing the same.
US20190352335A1 (en) Brain targeting long-acting protein conjugate
JP7307773B2 (en) Protein Conjugates Using Specific Positions of Immunoglobulin Fragments as Linking Sites
JP2020501611A5 (en)
JP6880278B2 (en) An immunoglobulin Fc conjugate that maintains the binding affinity of an immunoglobulin Fc fragment for FcRn.
US20210046189A1 (en) Long-acting protein conjugates for brain targeting, a preparation method thereof, and a composition comprising the same
KR20220073454A (en) Novel long-acting protein conjugates for brain targeting and a preparation method thereof
NZ716251B2 (en) Conjugate of biologically active polypeptide monomer and immunoglobulin fc fragment with reduced receptor-mediated clearance, and the method for preparing the same