KR20210110252A - Pharmaceutical composition for preventing or treating nonalcoholic fatty liver disease comprising a polypeptide - Google Patents

Pharmaceutical composition for preventing or treating nonalcoholic fatty liver disease comprising a polypeptide Download PDF

Info

Publication number
KR20210110252A
KR20210110252A KR1020210110117A KR20210110117A KR20210110252A KR 20210110252 A KR20210110252 A KR 20210110252A KR 1020210110117 A KR1020210110117 A KR 1020210110117A KR 20210110117 A KR20210110117 A KR 20210110117A KR 20210110252 A KR20210110252 A KR 20210110252A
Authority
KR
South Korea
Prior art keywords
polypeptide
fatty liver
liver disease
pharmaceutical composition
preventing
Prior art date
Application number
KR1020210110117A
Other languages
Korean (ko)
Other versions
KR102394681B1 (en
Inventor
이강춘
박옥이
안형태
박은지
신재희
임성묵
Original Assignee
㈜ 디앤디파마텍
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by ㈜ 디앤디파마텍 filed Critical ㈜ 디앤디파마텍
Priority to KR1020210110117A priority Critical patent/KR102394681B1/en
Publication of KR20210110252A publication Critical patent/KR20210110252A/en
Application granted granted Critical
Publication of KR102394681B1 publication Critical patent/KR102394681B1/en

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical & Material Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)

Abstract

The present invention relates to a pharmaceutical composition for preventing or treating nonalcoholic fatty liver disease comprising a polypeptide. More specifically, the present invention relates to a pharmaceutical composition in which the polypeptide has effects of reducing food intake, promoting insulin secretion, suppressing gastric emptying, promoting lipolysis, and reducing triglycerides, and is safe by having no side effects such as vomiting or nausea.

Description

폴리펩티드를 포함하는 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물{Pharmaceutical composition for preventing or treating nonalcoholic fatty liver disease comprising a polypeptide}TECHNICAL FIELD [0001] Pharmaceutical composition for preventing or treating nonalcoholic fatty liver disease comprising a polypeptide, comprising a polypeptide

본 발명은 폴리펩티드를 포함하는 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물에 관한 것으로 더욱 상세하게는 상기 폴리펩티드는 음식물 섭취량을 감소시키고, 인슐린 분비를 촉진시키고, 위공복을 억제하며, 지방분해 촉진 및 중성지방 감소 효과를 가지면서 구토 또는 메스꺼움 등 부작용이 없어 안전한 비알코올성 지방간 질환 예방 또는 치료용 약학 조성물에 관한 것이다.The present invention relates to a pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease comprising a polypeptide, and more particularly, the polypeptide reduces food intake, promotes insulin secretion, suppresses gastric emptying, promotes lipolysis and It relates to a pharmaceutical composition for the prevention or treatment of non-alcoholic fatty liver disease that is safe without side effects such as vomiting or nausea while having a triglyceride reduction effect.

최근 경제 발전과 함께 과학기술의 고도성장을 통하여 선진국형 고령화로 접어드는 동시에 성인병이 급격히 증가하고 있다. 이의 원인으로서 현대인들의 스트레스 가중과 식생활 습관이 서구화되고 과도한 영양섭취, 신체 활동량의 감소가 있으며, 실제 비만을 동반한 합병증인 심장 및 뇌혈관성 질환 사망률이 1, 2위를 기록하고 있으며, 비만은 각종 성인병의 원인으로 제시되고 있다.With the recent economic development and the rapid growth of science and technology, the number of adult diseases is rapidly increasing at the same time as the aging of the advanced countries. The causes of this are the stress of modern people and the westernization of eating habits, excessive nutritional intake, and a decrease in the amount of physical activity. It has been suggested as a cause of adult disease.

인체 내에는 약 200억 개나 되는 지방세포가 존재하고 있으며, 이는 포유류의 생체 내에서 에너지를 축적하거나 방출하는 역할을 담당하고 있다. 지방세포는 소모되고 남은 에너지를 중성지방 형태로 저장한 후 에너지가 고갈되었을 때 이를 다시 유리지방산과 포도당으로 분해하여 사용한다.There are about 20 billion fat cells in the human body, and they are responsible for accumulating or releasing energy in the living body of mammals. Fat cells store the consumed and remaining energy in the form of triglycerides, and when the energy is depleted, they are broken down into free fatty acids and glucose again for use.

비알코올성 지방간 질환(nonalcoholic fatty liver disease, NAFLD)은 알코올 섭취와 관련없이 간세포에 지방의 과도한 축적만 있는 단순 지방증(simple steatosis), 간세포 손상(풍선변성)과 염증 및 섬유화를 동반하는 비알코올성 지방간염(nonalcoholic steatohepatitis, NASH) 및 더 진행된 형태인 간경변증(cirrhosis)을 포함하는 일련의 질환군을 의미한다. 비알코올성 지방간 질환은 비만 유병률의 증가와 더불어 전 세계적으로 유병률이 급격하게 증가하고 있으며 국가마다 차이가 있지만 서구에서는 전체 인구의 약 20~30%에 이르고 있으며, 우리나라에서도 발병률이 약 16%에 이르고 있다.Nonalcoholic fatty liver disease (NAFLD) is characterized by simple steatosis in which there is only excessive accumulation of fat in hepatocytes regardless of alcohol intake, nonalcoholic steatohepatitis with hepatocyte damage (balloon degeneration) and inflammation and fibrosis. (nonalcoholic steatohepatitis, NASH) and a more advanced form of cirrhosis. The prevalence of nonalcoholic fatty liver disease is rapidly increasing worldwide along with the increase in the prevalence of obesity, and although there are differences between countries, it accounts for about 20-30% of the total population in the West, and the incidence rate is about 16% in Korea. .

이러한 비알코올성 지방간 질환은 인슐린 저항성을 근간으로 한 비만, 제2형 당뇨병, 이상지질혈증 등을 포함한 대사증후군(metabolic syndrome)과 밀접한 연관성을 보인다. 실제로 당뇨병 전기 및 제2형 당뇨병 환자에서 비알코올성 지방간/비알코올성 지방간염이 동반되는 경우가 많고 이러한 환자에서 간경변증과 간암(hepatocellular carcinoma)으로 진행하는 비율이 높은 것으로 알려져 있다. 한편, 비알코올성 지방간 질환 환자에서 당뇨병의 유병률이 높고, 특히 이러한 현상은 비알코올성 지방간염 환자에서 더욱 뚜렷하게 나타나고 있다.Such nonalcoholic fatty liver disease is closely related to metabolic syndrome including obesity, type 2 diabetes, dyslipidemia, etc. based on insulin resistance. In fact, it is known that nonalcoholic fatty liver/nonalcoholic steatohepatitis is often accompanied by prediabetes and type 2 diabetes patients, and the rate of progression to cirrhosis and hepatocellular carcinoma in these patients is high. On the other hand, the prevalence of diabetes is high in patients with nonalcoholic steatohepatitis, and this phenomenon is particularly evident in patients with nonalcoholic steatohepatitis.

당뇨병은 인슐린 의존형 당뇨병(제1형 당뇨병), 인슐린 비의존형 당뇨병(제2형 당뇨병) 및 영양실조성 당뇨병(MRDM)으로 분류되는데, 우리나라 당뇨환자의 90% 이상을 차지하는 제2형 당뇨병은 고혈당을 특징으로 하는 대사 질환으로 유전적, 대사적, 환경적인 요인에 의한 췌장 베타 세포의 인슐린 분비 저하 또는 말초 조직에서의 인슐린 저항성 증가로 인해 발생되는 것으로 보고되고 있다. 이와 관련하여 비만에 따라 체지방이 증가하면 인슐린 감수성이 저하되는 증상을 보이며, 특히 복부지방의 축적은 글루코스 내성(glucose intolerance)과 관련이 있는 것으로 알려져 있다. 그리고 제2형 당뇨병이 발생된 환자에 있어서 비만과 인슐린 저항성은 밀접한 상관관계가 있어 비만이 심할수록 인슐린 저항성도 심해지는 것으로 알려져 있다.Diabetes is classified into insulin-dependent diabetes mellitus (type 1 diabetes), non-insulin-dependent diabetes mellitus (type 2 diabetes) and malnutrition diabetes (MRDM). It is reported to be caused by a decrease in insulin secretion of pancreatic beta cells or an increase in insulin resistance in peripheral tissues due to genetic, metabolic, and environmental factors as a characteristic metabolic disease. In this regard, when body fat increases with obesity, insulin sensitivity decreases, and in particular, the accumulation of abdominal fat is known to be related to glucose intolerance. In addition, in patients with type 2 diabetes, obesity and insulin resistance are closely correlated, and it is known that the greater the obesity, the more severe the insulin resistance.

비알코올성 지방간 질환을 치료하는 약물요법에는 인슐린 저항성(insulin resistance), 산화 스트레스(oxidative stress), 세포자멸사(apoptosis), 염증성 시토카인(cytokine) 등 비알코올성 지방간 질환을 악화시키는 기전에 작용하여 비알코올성 지방간 질환을 치료 혹은 진행을 억제하는 약제들이 사용되고 있다. 그 중 당뇨병 치료제가 지방간 발생의 공통적인 병태생리 부분을 개선시킴으로써 혈당강하 효과 이외에 지방간의 개선 효과를 가지는 것으로 알려져 있다.Drug therapy for nonalcoholic fatty liver disease includes insulin resistance, oxidative stress, apoptosis, and inflammatory cytokines, which act on mechanisms that exacerbate nonalcoholic fatty liver disease. Drugs that treat or inhibit the progression of the disease are being used. Among them, it is known that antidiabetic drugs have an effect of improving fatty liver in addition to a hypoglycemic effect by improving the common pathophysiology of fatty liver development.

한편, 최근에는 글루카곤 유도체에 관심이 집중되고 있다. 글루카곤은 약물 치료 또는 질병, 호르몬이나 효소 결핍 등의 원인으로 혈당이 떨어지기 시작하면 췌장에서 생산된다. 글루카곤은 간에 글리코겐을 분해하여 글루코오스를 방출하도록 신호하고, 혈당 수준을 정상 수준까지 높이는 역할을 한다. 뿐만 아니라, 글루카곤은 혈당 상승효과 이외에 식욕억제 및 지방세포의 호르몬 민감성 리파아제(hormone sensitive lipase)를 활성화시켜 지방 분해를 촉진하여 항비만 효과를 나타냄이 보고되었다. 이러한 글루카곤의 유도체 중의 하나인 글루카곤-유사 펩티드-1(glucagon-like peptide-1, GLP-1)은 당뇨 환자의 고혈당증을 감소시키는 치료제로 개발 중인 물질로서, 인슐린 합성과 분비 촉진, 글루카곤의 분비 저해, 위공복 억제, 글루코오스 사용 증진과 더불어 음식물 섭취를 저해하는 기능을 가진다. GLP-1과 대략 50% 아미노산 상동성을 가지는 도마뱀 독액(lizard venom)으로부터 만들어지는 엑센딘-4(exendin-4) 또한 GLP-1 수용체를 활성화시켜 당뇨 환자의 고혈당증을 감소시키는 것으로 알려져 있다. 그러나, 상기 GLP-1를 포함하는 비만 또는 당뇨병 치료용 의약은 구토와 메스꺼움의 부작용을 발생시킨다는 문제점을 나타내는 것으로 보고되었다.On the other hand, recently, attention has been focused on glucagon derivatives. Glucagon is produced by the pancreas when blood sugar begins to drop due to reasons such as medication or disease, hormone or enzyme deficiency. Glucagon is responsible for signaling the liver to break down glycogen to release glucose and raise blood sugar levels to normal levels. In addition, it has been reported that glucagon exhibits an anti-obesity effect by promoting lipolysis by activating hormone-sensitive lipase in adipocytes and suppressing appetite in addition to a blood glucose-increasing effect. One of these glucagon derivatives, glucagon-like peptide-1 (GLP-1), is a substance being developed as a therapeutic agent for reducing hyperglycemia in diabetic patients. It promotes insulin synthesis and secretion, and inhibits glucagon secretion. , suppresses gastric emptying, promotes glucose use, and inhibits food intake. Exendin-4, made from lizard venom with approximately 50% amino acid homology to GLP-1, is also known to reduce hyperglycemia in diabetic patients by activating GLP-1 receptors. However, it has been reported that the drug for the treatment of obesity or diabetes containing GLP-1 presents a problem of generating side effects of vomiting and nausea.

이에, 상기 GLP-1의 대안으로서, GLP-1과 글루카곤의 두 펩티드의 수용체에 모두 결합할 수 있는 옥신토모듈린(oxyntomodulin)이 각광받고 있다. 상기 옥신토모듈린은 글루카곤의 전구체인 프리-글루카곤(pre-glucagon)으로부터 만들어지는 펩티드로서, GLP-1의 음식물 섭취 저해, 간에서의 당 신생을 억제하여 혈당조절, 포만감 증진 효력과 글루카곤의 지방분해 기능을 보여 당뇨 및 항-비만 치료제로서의 가능성을 높이고 있다.Accordingly, as an alternative to the GLP-1, oxyntomodulin, which can bind to the receptors of both peptides of GLP-1 and glucagon, is in the spotlight. The oxyntomodulin is a peptide made from pre-glucagon, which is a precursor of glucagon, and inhibits food intake of GLP-1 and glucose production in the liver to control blood sugar, improve satiety, and increase the fat content of glucagon. Its anti-obesity function is increasing its potential as a treatment for diabetes and anti-obesity.

이러한 옥신토모듈린 펩티드의 이중 기능성(dual function)에 기반하여 당뇨 및 비만 치료 목적의 약제를 개발하기 위한 연구가 활발하게 진행 중에 있다. 예를 들어, 특허등록 제925017호에는 옥신토모듈린을 유효성분으로 포함하는, 인간에서 과체중을 치료하기 위한, 경구, 비경구, 점막(mucosal), 직장, 피하 또는 경피성 투여용 약학적 조성물이 개시되어 있다. 그러나, 옥신토모듈린을 포함하는 비만치료제는 생체내에서 반감기가 짧고, 하루에 3번씩 고용량을 투여하여도 비만 치료효과 또한 낮은 수준을 나타내는 것으로 보고되고 있다.Based on the dual function of the oxyntomodulin peptide, research for developing drugs for the treatment of diabetes and obesity is being actively conducted. For example, Patent Registration No. 925017 discloses a pharmaceutical composition for oral, parenteral, mucosal, rectal, subcutaneous or transdermal administration for treating overweight in humans, containing oxyntomodulin as an active ingredient. This is disclosed. However, it is reported that the anti-obesity agent containing oxyntomodulin has a short half-life in vivo, and exhibits a low level of anti-obesity effect even when administered at a high dose three times a day.

한편, 치료용 펩티드의 생체내 짧은 반감기를 극복하여 약효를 오래동안 높게 지속시키고 이를 통한 약효를 극대화하려는 노력이 계속되어 왔다. US 7,141,547은 재조합 유전자 기술을 이용한 GLP-1 및 그 유사체와 알부민과의 융합 단백질에 대해 기술하고 있으며, US 8,273,854는 GLP-1 및 그 유사체와 면역글로불린 단편(Fc)와의 융합 단백질에 대해 기술하고 있다. 이러한 기술은 펩티드의 생체내 짧은 반감기를 일부 개선시켰으나 체내에 존재하지 않는 단백질을 투여함으로써 야기되는 면역원성 문제에서 자유로울 수 없으며 이로 인하여 장기간 투여시 약물의 효과가 감소하는 현상이 발생할 수 있다. 또한, 생산을 위해 대규모 세포배양 및 정제시설이 필요하며 재조합 단백질의 특성상 숙주세포에서 유래되는 불순물의 노출에 대한 우려와 생산되는 배치마다 완벽하게 동일할 수 없기 때문에 의약품의 품질관리에 문제점이 있다. 또한, 칼시토닌(calcitonin)과 같이 디설파이드 결합(disulfide bond)을 가지고 있는 펩티드를 이용할 경우 미스폴딩(misfolding)에 의한 생산성 저하의 문제점과 천연에 존재하지 않는 아미노산 잔기가 있는 경우 유전자 재조합의 형태로 생산이 어렵다는 문제점이 있다.On the other hand, efforts have been made to overcome the short half-life of therapeutic peptides in vivo to maintain high drug efficacy for a long time and to maximize drug efficacy through this. US 7,141,547 describes a fusion protein of GLP-1 and its analogue and albumin using recombinant genetic technology, and US 8,273,854 describes a fusion protein of GLP-1 and its analogue and an immunoglobulin fragment (Fc). . Although this technique has partially improved the short half-life of the peptide in vivo, it cannot be free from the immunogenicity problem caused by administering a protein that does not exist in the body, and this may result in a decrease in the effect of the drug when administered for a long period of time. In addition, large-scale cell culture and purification facilities are required for production, and there is a problem in quality control of pharmaceuticals because of the nature of the recombinant protein, concerns about exposure of host cell-derived impurities and the fact that it cannot be perfectly identical for every batch produced. In addition, when a peptide having a disulfide bond, such as calcitonin, is used, there is a problem of productivity decrease due to misfolding and when there is an amino acid residue that does not exist in nature, it is produced in the form of genetic recombination. There is a difficult problem.

한편, US 8,110,665는 비펩티드성 중합체와 면역글로불린 단편(Fc)을 이용하여 결합체를 만들어 펩티드의 짧은 반감기를 개선하였다. 하지만, 생리활성 펩티드, 비펩티드성 중합체, 면역글로불린 단편을 각각 생산하고, 이후 이를 다시 결합시키는 복잡한 생산과정과 이에 따른 부산물들의 잔류 및 생산성 저하라는 문제점이 있다.On the other hand, US 8,110,665 improved the short half-life of peptides by making a conjugate using a non-peptidic polymer and an immunoglobulin fragment (Fc). However, there is a problem in that a complex production process of producing a bioactive peptide, a non-peptidic polymer, and an immunoglobulin fragment, respectively, and then rejoining them, and residual by-products and lowering of productivity.

한편, 치료용 펩티드 및 단백질 페길화(PEGylation)는 약제학적인 기술 중에서 가장 유효한 기술이다. 펩티드 및 단백질의 페길화는 그들의 분자량 증가, 단백질 분해부위 방어, 면역원성 부위 방어를 증가시키고, 이는 결국 생체 내 약물의 반감기를 증가시키며 펩티드와 단백질의 면역원성을 감소시킨다. 따라서, 페길화 기술은 펩티드 약품의 문제점을 해결함으로써 치료효과를 증가시키는 효과가 있고, 이러한 장점 때문에, 펩티드 및 단백질의 페길화는 약물 전달시스템에 있어서 그 효과를 증가시키는데 중요한 역할을 한다.On the other hand, therapeutic peptide and protein PEGylation (PEGylation) is the most effective technology among pharmaceutical technologies. Pegylation of peptides and proteins increases their molecular weight, proteolytic site defense, and immunogenic site defense, which in turn increases the half-life of drugs in vivo and reduces the immunogenicity of peptides and proteins. Therefore, the pegylation technique has the effect of increasing the therapeutic effect by solving the problems of the peptide drug, and because of these advantages, the pegylation of peptides and proteins plays an important role in increasing the effect in drug delivery systems.

그러나, PEG를 이용하는 방법은 PEG 분자량이 증가할수록 펩티드 약물의 역가가 현저히 낮아지고, 또한 펩티드와의 반응성이 낮아져 수율이 감소하는 문제가 있다. 이에 생산공정이 단순하고, 선택성이 높은 반응을 통해 페길화하는 방법이 요구되고 있다.However, the method using PEG has a problem in that as the molecular weight of PEG increases, the titer of the peptide drug is significantly lowered, and the reactivity with the peptide is lowered, thereby reducing the yield. Accordingly, a method for pegylation through a simple production process and high selectivity reaction is required.

따라서, 음식물 섭취량을 감소시키고, 인슐린 분비를 촉진시키고, 위공복을 억제하며, 지방분해 촉진 및 중성지방 감소 효과를 가지면서 구토 또는 메스꺼움 등 부작용 없는 안전한 비알코올성 지방간 질환의 치료제이면서 제조방법을 최적화하여 높은 수율로 얻기 가능한 비알코올성 지방간 질환의 치료제가 필요한 실정이다.Therefore, it is a safe treatment for nonalcoholic fatty liver disease without side effects such as vomiting or nausea while reducing food intake, promoting insulin secretion, suppressing gastric emptying, promoting lipolysis and reducing triglycerides, and optimizing the manufacturing method. There is a need for a therapeutic agent for non-alcoholic fatty liver disease that can be obtained in high yield.

한국등록특허 제0925017호(명칭: 과체중의 예방 또는 치료를 위한 옥신토모듈린)Korean Patent No. 0925017 (Name: Oxyntomodulin for the prevention or treatment of overweight) 미국등록특허 제7141547호(명칭: Albumin fusion proteins comprising GLP-1 polypeptides)US Patent No. 7141547 (Name: Albumin fusion proteins comprising GLP-1 polypeptides) 미국등록특허 제8273854호(명칭: GLP-1 analog fusion proteins)US Patent No. 8273854 (Name: GLP-1 analog fusion proteins) 미국등록특허 제8110665호(명칭: Pharmaceutical composition comprising an immunoglobulin FC region as a carrier)US Patent No. 8110665 (Name: Pharmaceutical composition comprising an immunoglobulin FC region as a carrier) 한국등록특허 제1665009호(명칭: 비알콜성 지방간 질환의 예방 또는 치료용 약학적 조성물)Korean Patent No. 1665009 (Name: Pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease)

본 발명자들은 상기와 같은 문제점을 해결하기 위하여, 음식물 섭취량을 감소시키고, 인슐린 분비를 촉진시키고, 위공복을 억제하며, 지방분해 촉진 및 중성지방 감소 효과를 가지면서 구토 또는 메스꺼움 등 부작용 없는 안전한 비알코올성 지방간 질환 치료제이면서 높은 수율로 제조가 가능한 제조방법을 개발하고자 연구노력한 결과, 하기 일반식 1의 아미노산 서열인 폴리펩티드를 제조하였고, 상기 폴리펩티드를 포함하는 조성물은 우수한 비알코올성 지방간 질환의 예방 또는 치료 효과를 나타냈으며, 더 나아가 상기 폴리펩티드에 비펩티드성 중합체를 선택적으로 결합시켜 제조한 결합체가 생체내에서 활성을 유지하면서도, 혈중 반감기를 증가시켜서, 보다 우수한 비알코올성 지방간 질환의 예방 또는 치료 효과를 나타낼 수 있음을 확인하고 본 발명을 완성하였다.In order to solve the above problems, the present inventors reduce food intake, promote insulin secretion, suppress gastric emptying, promote lipolysis and reduce triglycerides while having the effect of promoting lipolysis and reducing triglycerides while having no side effects such as vomiting or nausea. As a result of research efforts to develop a preparation method that can be produced in high yield while being a therapeutic agent for fatty liver disease, a polypeptide having an amino acid sequence of the following general formula 1 was prepared, and a composition comprising the polypeptide has excellent preventive or therapeutic effect on non-alcoholic fatty liver disease. Furthermore, the conjugate prepared by selectively linking a non-peptidic polymer to the polypeptide maintains its activity in vivo, and increases the blood half-life, thereby exhibiting a better preventive or therapeutic effect on nonalcoholic fatty liver disease. was confirmed and the present invention was completed.

[일반식 1][General formula 1]

R1-X1-QGTFTSDYSKYLD-R2-EFVQWLMNT-R3R1-X1-QGTFTSDYSKYLD-R2-EFVQWLMNT-R3

R1은 히스티딘, 데스아미노-히스티딜(desamino-histidyl), N-디메틸-히스티딜(N-dimethyl-histidyl), 베타-히드록시-이미다조-프로피오닐(beta-hydroxy-imidazo-propionyl), 4-이미다조아세틸(4-imidazoacetyl) 또는 베타-카르복시-이미다조-프로피오닐(beta-carboxy-imidazo-propionyl)이며;R1 is histidine, desamino-histidyl, N-dimethyl-histidyl, beta-hydroxy-imidazo-propionyl, 4 -imidazoacetyl (4-imidazoacetyl) or beta-carboxy-imidazo-propionyl (beta-carboxy-imidazo-propionyl);

X1은 결실, 글라이신 또는 Aib(aminoisobutyric acid)이고;X1 is a deletion, glycine or Aib (aminoisobutyric acid);

R2는 EKRAK, EQAAK 또는 EEAVK이며;R2 is EKRAK, EQAAK or EEAVK;

R3는 결실, 시스테인, 라이신 또는 메티오닌이다.R3 is a deletion, cysteine, lysine or methionine.

따라서, 본 발명의 목적은 폴리펩티드를 포함하는 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물을 제공하는 것이다. Accordingly, an object of the present invention is to provide a pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease comprising a polypeptide.

상기 목적을 달성하기 위해, 본 발명의 일 실시예에 따른 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물은 하기 일반식 1의 아미노산 서열인 폴리펩티드를 포함한다.In order to achieve the above object, the pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease according to an embodiment of the present invention includes a polypeptide having an amino acid sequence of the following general formula 1.

[일반식 1] [General formula 1]

R1-X1-QGTFTSDYSKYLD-R2-EFVQWLMNT-R3R1-X1-QGTFTSDYSKYLD-R2-EFVQWLMNT-R3

여기서, R1은 히스티딘, 데스아미노-히스티딜(desamino-histidyl), N-디메틸-히스티딜(N-dimethyl-histidyl), 베타-히드록시-이미다조-프로피오닐(beta-hydroxy-imidazo-propionyl), 4-이미다조아세틸(4-imidazoacetyl) 또는 베타-카르복시-이미다조-프로피오닐(beta-carboxy-imidazo-propionyl)이며; X1은 결실, 글라이신 또는 Aib(aminoisobutyric acid)이고; R2는 EKRAK, EQAAK 또는 EEAVK이며; R3는 결실, 시스테인, 라이신 또는 메티오닌이다.Here, R1 is histidine, desamino-histidyl, N-dimethyl-histidyl, beta-hydroxy-imidazo-propionyl (beta-hydroxy-imidazo-propionyl) , 4-imidazoacetyl or beta-carboxy-imidazo-propionyl; X1 is a deletion, glycine or Aib (aminoisobutyric acid); R2 is EKRAK, EQAAK or EEAVK; R3 is a deletion, cysteine, lysine or methionine.

상기 폴리펩티드는 비펩티드성 중합체, 지방산, 콜레스테롤, 항체, 항체 단편, 알부민 및 이의 단편, 뉴클레오티드, 피브로넥틱(fibronectin), 트렌스페린, FcRn 결합물질, 사카라이드(saccharide), 엘라스틴, 헤파린 및 이들의 유도체로 이루어진 군에서 선택된 어느 하나 이상과 공유결합하거나 봉입체(microsphere)를 형성할 수 있다.The polypeptides include non-peptidic polymers, fatty acids, cholesterol, antibodies, antibody fragments, albumin and fragments thereof, nucleotides, fibronectin, transferrin, FcRn binding substances, saccharides, elastin, heparin and their It may covalently bond with at least one selected from the group consisting of derivatives or form a microsphere.

상기 R2은 글루타민 산(E) 및 라이신(K)을 포함하며, 상기 글루타민 산 및 라이신은 아미드 결합(Amide bonding)으로 링을 형성할 수 있으며 이는 폴리펩티드의 알파 헬릭스 구조에 도움을 줄 수 있다.The R2 includes glutamic acid (E) and lysine (K), and the glutamic acid and lysine may form a ring by amide bonding, which may help in the alpha helix structure of the polypeptide.

상기 비펩티드성 중합체는 폴리에틸렌글리콜(PEG), 폴리프로필렌글리콜, 에틸렌글리콜과 프로필렌글리콜의 공중합체, 폴리옥시에틸화폴리올, 폴리비닐알콜(PVA), 폴리사카라이드, 덱스트란, 폴리비닐에틸에테르, 폴리락트산(polylactic acid, PLA), 폴리락틱-글리콜산(polylactic-glycolic acid, PLGA), 지질 중합체, 키틴, 히아루론산 및 이들의 조합으로 구성된 군으로부터 선택될 수 있다. 당해 분야에 이미 알려진 이들의 유도체 및 당해 분야의 기술 수준에서 용이하게 제조할 수 있는 유도체들도 본 발명의 범위에 포함된다.The non-peptidic polymer is polyethylene glycol (PEG), polypropylene glycol, a copolymer of ethylene glycol and propylene glycol, polyoxyethylated polyol, polyvinyl alcohol (PVA), polysaccharide, dextran, polyvinyl ethyl ether, polylactic acid (PLA), polylactic-glycolic acid (PLGA), lipid polymers, chitin, hyaluronic acid, and combinations thereof. Derivatives thereof already known in the art and derivatives that can be easily prepared at the level of skill in the art are also included in the scope of the present invention.

바람직하게, 상기 비펩티드성 중합체는 폴리에틸렌글리콜 또는 이의 유도체일 수 있다.Preferably, the non-peptidic polymer may be polyethylene glycol or a derivative thereof.

상기 비펩티드성 중합체는 분자량이 3,000 내지 100,000Da일 수 있다.The non-peptidic polymer may have a molecular weight of 3,000 to 100,000 Da.

이때, 상기 폴리에틸렌글리콜 유도체는 메톡시폴리에틸렌글리콜, 메톡시폴리에틸렌글리콜 N-히드록시숙신이미드, 메톡시폴리에틸렌글리콜 프로피온알데히드, 메톡시폴리에틸렌글리콜 말레이미드, 폴리에틸렌글리콜 숙신이미딜 프로피오네이트(PEG succinimidyl propionate), 메톡시 폴리에틸렌글리콜 숙신이미딜 프로피오네이트(metoxy PEG succinimidyl propionate), 아클릴레이트 폴리에틸렌글리콜 숙신이미딜 프로피오네이트(Acrylate PEG succinimidyl propionate), 티올 폴리에틸렌글리콜 숙신이미딜 프로피오네이트(Thiol PEG succinimidyl propionate), 히드록시 숙신이미딜 폴리에틸렌글리콜(hydroxy succinimidyl PEG), 메톡시폴리에틸렌글리콜 숙신이미딜 카르복시메틸 에스터(mPEG succinimidyl carboxymethyl ester), 아클릴레이트 폴리에틸렌글리콜 숙신이미딜 카르복시메틸 에스터(Acrylate PEG succinimidyl carboxymethyl ester), 폴리에틸렌글리콜 숙신이미딜 카르보네이트(PEG succinimidyl carbonate), 폴리에틸렌글리콜 프로피온 알데히드(PEG propion aldehyde), 폴리에틸렌글리콜 부틸 알데히드(PEG butyl aldehyde) 또는 이들 유도체의 다중가지형일 수 있다.At this time, the polyethylene glycol derivative is methoxy polyethylene glycol, methoxy polyethylene glycol N-hydroxysuccinimide, methoxy polyethylene glycol propionaldehyde, methoxy polyethylene glycol maleimide, polyethylene glycol succinimidyl propionate (PEG succinimidyl propionate) ), methoxy PEG succinimidyl propionate, acrylate polyethylene glycol succinimidyl propionate, thiol polyethylene glycol succinimidyl propionate. propionate), hydroxy succinimidyl polyethylene glycol (hydroxy succinimidyl PEG), methoxypolyethylene glycol succinimidyl carboxymethyl ester (mPEG succinimidyl carboxymethyl ester), acrylate polyethylene glycol succinimidyl carboxymethyl ester (Acrylate PEG succinimidyl carboxymethyl ester) ), polyethylene glycol succinimidyl carbonate (PEG succinimidyl carbonate), polyethylene glycol propion aldehyde (PEG propion aldehyde), polyethylene glycol butyl aldehyde (PEG butyl aldehyde) or a multi-branched form of these derivatives.

상기 폴리에틸렌글리콜 또는 이의 유도체는 선형 또는 가지형일 수 있다.The polyethylene glycol or its derivative may be linear or branched.

상기 비알코올성 지방간 질환은 비알코올성 지방간, 비알코올성 지방간염, 간경변 및 간암으로 이루어진 군에서 선택되는 1종 이상일 수 있다.The nonalcoholic fatty liver disease may be at least one selected from the group consisting of nonalcoholic fatty liver, nonalcoholic steatohepatitis, cirrhosis and liver cancer.

본 발명의 다른 실시예에 따른 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물의 제조방법은 하기 일반식 1의 아미노산 서열인 폴리펩티드와 비펩티드성 중합체를 혼합하여 반응시키는 단계를 포함한다.The method for preparing a pharmaceutical composition for the prevention or treatment of non-alcoholic fatty liver disease according to another embodiment of the present invention includes the step of reacting a mixture of a polypeptide having an amino acid sequence of Formula 1 and a non-peptidic polymer.

[일반식 1] [General formula 1]

R1-X1-QGTFTSDYSKYLD-R2-EFVQWLMNT-R3R1-X1-QGTFTSDYSKYLD-R2-EFVQWLMNT-R3

여기서, R1은 히스티딘, 데스아미노-히스티딜(desamino-histidyl), N-디메틸-히스티딜(N-dimethyl-histidyl), 베타-히드록시-이미다조-프로피오닐(beta-hydroxy-imidazo-propionyl), 4-이미다조아세틸(4-imidazoacetyl) 또는 베타-카르복시-이미다조-프로피오닐(beta-carboxy-imidazo-propionyl)이며; X1은 결실, 글라이신 또는 Aib(aminoisobutyric acid)이고; R2는 EKRAK, EQAAK 또는 EEAVK이며; R3는 결실, 시스테인, 라이신 또는 메티오닌이다. Here, R1 is histidine, desamino-histidyl, N-dimethyl-histidyl, beta-hydroxy-imidazo-propionyl (beta-hydroxy-imidazo-propionyl) , 4-imidazoacetyl or beta-carboxy-imidazo-propionyl; X1 is a deletion, glycine or Aib (aminoisobutyric acid); R2 is EKRAK, EQAAK or EEAVK; R3 is a deletion, cysteine, lysine or methionine.

상기 비펩티드성 중합체는 폴리에틸렌글리콜(PEG), 폴리프로필렌글리콜, 에틸렌글리콜과 프로필렌글리콜의 공중합체, 폴리옥시에틸화폴리올, 폴리비닐알콜(PVA), 폴리사카라이드, 덱스트란, 폴리비닐에틸에테르, 폴리락트산(polylactic acid, PLA), 폴리락틱-글리콜산(polylactic-glycolic acid, PLGA), 지질 중합체, 키틴, 히아루론산 및 이들의 조합으로 구성된 군으로부터 선택될 수 있다. 당해 분야에 이미 알려진 이들의 유도체 및 당해 분야의 기술 수준에서 용이하게 제조할 수 있는 유도체들도 본 발명의 범위에 포함된다.The non-peptidic polymer is polyethylene glycol (PEG), polypropylene glycol, a copolymer of ethylene glycol and propylene glycol, polyoxyethylated polyol, polyvinyl alcohol (PVA), polysaccharide, dextran, polyvinyl ethyl ether, polylactic acid (PLA), polylactic-glycolic acid (PLGA), lipid polymers, chitin, hyaluronic acid, and combinations thereof. Derivatives thereof already known in the art and derivatives that can be easily prepared at the level of skill in the art are also included in the scope of the present invention.

바람직하게, 상기 비펩티드성 중합체는 폴리에틸렌글리콜 또는 이의 유도체일 수 있다.Preferably, the non-peptidic polymer may be polyethylene glycol or a derivative thereof.

이때, 상기 폴리에틸렌글리콜 유도체는 메톡시폴리에틸렌글리콜, 메톡시폴리에틸렌글리콜 N-히드록시숙신이미드, 메톡시폴리에틸렌글리콜 프로피온알데히드, 메톡시폴리에틸렌글리콜 말레이미드, 폴리에틸렌글리콜 숙신이미딜 프로피오네이트(PEG succinimidyl propionate), 메톡시 폴리에틸렌글리콜 숙신이미딜 프로피오네이트(metoxy PEG succinimidyl propionate), 아클릴레이트 폴리에틸렌글리콜 숙신이미딜 프로피오네이트(Acrylate PEG succinimidyl propionate), 티올 폴리에틸렌글리콜 숙신이미딜 프로피오네이트(Thiol PEG succinimidyl propionate), 히드록시 숙신이미딜 폴리에틸렌글리콜(hydroxy succinimidyl PEG), 메톡시폴리에틸렌글리콜 숙신이미딜 카르복시메틸 에스터(mPEG succinimidyl carboxymethyl ester), 아클릴레이트 폴리에틸렌글리콜 숙신이미딜 카르복시메틸 에스터(Acrylate PEG succinimidyl carboxymethyl ester), 폴리에틸렌글리콜 숙신이미딜 카르보네이트(PEG succinimidyl carbonate), 폴리에틸렌글리콜 프로피온 알데히드(PEG propion aldehyde), 폴리에틸렌글리콜 부틸 알데히드(PEG butyl aldehyde) 또는 이들 유도체의 다중가지형일 수 있다.At this time, the polyethylene glycol derivative is methoxy polyethylene glycol, methoxy polyethylene glycol N-hydroxysuccinimide, methoxy polyethylene glycol propionaldehyde, methoxy polyethylene glycol maleimide, polyethylene glycol succinimidyl propionate (PEG succinimidyl propionate) ), methoxy PEG succinimidyl propionate, acrylate polyethylene glycol succinimidyl propionate, thiol polyethylene glycol succinimidyl propionate. propionate), hydroxy succinimidyl polyethylene glycol (hydroxy succinimidyl PEG), methoxypolyethylene glycol succinimidyl carboxymethyl ester (mPEG succinimidyl carboxymethyl ester), acrylate polyethylene glycol succinimidyl carboxymethyl ester (Acrylate PEG succinimidyl carboxymethyl ester) ), polyethylene glycol succinimidyl carbonate (PEG succinimidyl carbonate), polyethylene glycol propion aldehyde (PEG propion aldehyde), polyethylene glycol butyl aldehyde (PEG butyl aldehyde) or a multi-branched form of these derivatives.

상기 폴리펩티드와 비펩티드성 중합체를 혼합하여 반응시키는 단계는 폴리펩티드와 비펩티드성 중합체를 1:1 내지 1:5의 몰비로 반응시킬 수 있다.In the step of mixing and reacting the polypeptide and the non-peptidic polymer, the polypeptide and the non-peptidic polymer may be reacted in a molar ratio of 1:1 to 1:5.

상기 폴리펩티드와 비펩티드성 중합체를 혼합하여 반응시키는 단계는 pH 4.0 내지 9.0에서 수행될 수 있다.The step of mixing and reacting the polypeptide and the non-peptidic polymer may be performed at a pH of 4.0 to 9.0.

상기 폴리펩티드와 비펩티드성 중합체를 혼합하여 반응시키는 단계의 반응 시간은 0.5 내지 24시간일 수 있다.The reaction time of the step of mixing and reacting the polypeptide and the non-peptidic polymer may be 0.5 to 24 hours.

상기 비알코올성 지방간 질환은 비알코올성 지방간, 비알코올성 지방간염, 간경변 및 간암으로 이루어진 군에서 선택되는 1종 이상일 수 있다.The nonalcoholic fatty liver disease may be at least one selected from the group consisting of nonalcoholic fatty liver, nonalcoholic steatohepatitis, cirrhosis and liver cancer.

본 발명의 다른 실시예에 따른 비알코올성 지방간 질환의 예방 또는 치료방법은 상기 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물을 인간을 제외한 개체에게 투여하는 단계를 포함한다.The method for preventing or treating non-alcoholic fatty liver disease according to another embodiment of the present invention includes administering the pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease to an individual other than a human.

본 발명에 따른 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물은 폴리펩티드를 포함함으로써 음식물 섭취량을 감소시키고, 인슐린 분비를 촉진시키고, 위공복을 억제하며, 지방분해 촉진 및 중성지방 감소 효과를 가질 수 있다.The pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease according to the present invention contains a polypeptide, thereby reducing food intake, promoting insulin secretion, suppressing gastric emptying, promoting lipolysis and reducing triglycerides. .

또한, 본 발명에 따른 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물은 폴리펩티드를 포함함으로써 구토 또는 메스꺼움 등 부작용을 억제할 수 있다. In addition, the pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease according to the present invention can suppress side effects such as vomiting or nausea by including the polypeptide.

또한, 본 발명에 따른 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물은 폴리펩티드와의 반응성이 높은 비펩티드성 중합체를 포함함으로써, 높은 수율로 제조될 수 있다. In addition, the pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease according to the present invention can be prepared in high yield by including a non-peptidic polymer having high reactivity with a polypeptide.

또한, 본 발명에 따른 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물은 폴리펩티드 및 비펩티드성 중합체가 포함된 결합체를 포함함으로써 생체내에서 반감기가 길고 저용량을 투여하여도 중성지방을 효과적으로 감소시킬 수 있다.In addition, the pharmaceutical composition for preventing or treating nonalcoholic fatty liver disease according to the present invention has a long half-life in vivo and can effectively reduce triglycerides even at low doses by including a conjugate containing a polypeptide and a non-peptidic polymer. .

도 1은 본 발명에 따른 폴리펩티드 및 비펩티드성 중합체를 포함하는 결합체의 HPLC결과이다.
도 2는 본 발명에 따른 폴리펩티드 및 비펩티드성 중합체를 포함하는 결합체의 MALDI-TOF 결과이다.
도 3은 실시예 2의 투여에 따른 혈청 (serum) 콜레스테롤의 함량 변화를 측정한 결과이다.
도 4는 실시예 2의 투여에 따른 간의 무게 변화를 측정한 결과이다.
도 5는 실시예 2의 투여에 따른 마우스의 간조직을 확인한 결과이다(보라색으로 염색된 부분: 정상적인 간조직, 흰색으로 염생된 부분: 지방구(Lipid droplet)).
도 6은 실시예 2의 투여에 따른 혈청 (serum) 콜레스테롤의 함량 변화를 측정한 결과이다.
도 7은 실시예 2의 투여에 따른 간의 무게 변화를 측정한 결과이다.
도 8은 실시예 2의 투여에 따른 간 조직 중성지방(Hepatic Triglyceride)의 무게 변화를 측정한 결과이다.
도 9는 실시예 2의 투여에 따른 마우스의 간조직을 확인한 결과이다(보라색으로 염색된 부분: 정상적인 간조직, 흰색으로 염생된 부분: 지방구(Lipid droplet)).
도 10은 실시예 2의 투여에 따른 NAFLD Activity Score(NAS)를 측정한 결과이다.
1 is an HPLC result of a conjugate comprising a polypeptide and a non-peptidic polymer according to the present invention.
2 is a MALDI-TOF result of a conjugate comprising a polypeptide according to the present invention and a non-peptidic polymer.
3 is a result of measuring the change in the content of serum (serum) cholesterol according to the administration of Example 2.
4 is a result of measuring the weight change of the liver according to the administration of Example 2.
5 is a result of confirming the liver tissue of the mouse according to the administration of Example 2 (part stained in purple: normal liver tissue, part stained in white: fat globules (Lipid droplet)).
6 is a result of measuring the change in the content of serum (serum) cholesterol according to the administration of Example 2.
7 is a result of measuring the weight change of the liver according to the administration of Example 2.
8 is a result of measuring the weight change of liver tissue triglyceride (Hepatic Triglyceride) according to the administration of Example 2.
9 is a result of confirming the liver tissue of the mouse according to the administration of Example 2 (part stained in purple: normal liver tissue, part stained in white: lipid droplet).
10 is a result of measuring the NAFLD Activity Score (NAS) according to the administration of Example 2.

본 발명은 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물로서, 하기 일반식 1의 아미노산 서열인 폴리펩티드를 포함한다.The present invention is a pharmaceutical composition for the prevention or treatment of non-alcoholic fatty liver disease, and includes a polypeptide having an amino acid sequence of the following general formula (1).

[일반식 1][General formula 1]

R1-X1-QGTFTSDYSKYLD-R2-EFVQWLMNT-R3R1-X1-QGTFTSDYSKYLD-R2-EFVQWLMNT-R3

여기서, R1은 히스티딘, 데스아미노-히스티딜(desamino-histidyl), N-디메틸-히스티딜(N-dimethyl-histidyl), 베타-히드록시-이미다조-프로피오닐(beta-hydroxy-imidazo-propionyl), 4-이미다조아세틸(4-imidazoacetyl) 또는 베타-카르복시-이미다조-프로피오닐(beta-carboxy-imidazo-propionyl)이며;Here, R1 is histidine, desamino-histidyl, N-dimethyl-histidyl, beta-hydroxy-imidazo-propionyl (beta-hydroxy-imidazo-propionyl) , 4-imidazoacetyl or beta-carboxy-imidazo-propionyl;

X1은 결실, 글라이신 또는 Aib(aminoisobutyric acid)이고;X1 is a deletion, glycine or Aib (aminoisobutyric acid);

R2는 EKRAK, EQAAK 또는 EEAVK이며;R2 is EKRAK, EQAAK or EEAVK;

R3는 결실, 시스테인, 라이신 또는 메티오닌이다.R3 is a deletion, cysteine, lysine or methionine.

본 명세서에서 언급된 아미노산은 IUPAC-IUB 명명법에 따라 하기 표 1과 같이 약어로 기재하였다.The amino acids mentioned herein are abbreviated as shown in Table 1 below according to the IUPAC-IUB nomenclature.

아미노산amino acid 약어Abbreviation 아미노산amino acid 약어Abbreviation 알라닌alanine AA 아르기닌arginine RR 아스파라긴asparagine NN 아스파르트 산aspartic acid DD 시스테인cysteine CC 글루타민 산glutamic acid EE 글루타민glutamine QQ 글라이신glycine GG 히스티딘histidine HH 아이소루이신isoleucine II 루이신leucine LL 라이신lysine KK 메티오닌methionine MM 페닐알라닌phenylalanine FF 프롤린proline PP 세린serine SS 트레오닌threonine TT 트립토판tryptophan WW 타이로신Tyrosine YY 발린valine VV

상기 일반식 1에서 R1은 폴리펩티드의 N-말단으로 히스티딘인 것이 바람직하나, 이에 제한되지 않는다. In Formula 1, R1 is preferably histidine as the N-terminus of the polypeptide, but is not limited thereto.

상기 X1는 글라이신 또는 Aib인 것이 바람직하며, 더욱 바람직하게는 Aib으로, 폴리펩티드의 화학안정성을 높일 수 있는 것이라면 특별히 제한되지 않는다.X1 is preferably glycine or Aib, and more preferably Aib, and is not particularly limited as long as it can improve the chemical stability of the polypeptide.

또한, 상기 X1는 DPP-4(Dipeptidyl peptidase-4)에 대한 저항성을 가져 효소 안정성(Enzyme stability)을 증가시킬 수 있는 것이라면 바람직하다. In addition, it is preferable that X1 has resistance to DPP-4 (Dipeptidyl peptidase-4) and can increase enzyme stability.

상기 R2은 EQAAK 또는 EEAVK인 것이 바람직하며, 더욱 바람직하게는 EQAAK이나, 이에 제한되지 않는다.R2 is preferably EQAAK or EEAVK, more preferably EQAAK, but is not limited thereto.

상기 R2은 글루타민 산(E) 및 라이신(K)을 포함하며, 상기 글루타민 산 및 라이신은 아미드 결합(Amide bonding)으로 링을 형성한 것이 바람직하나, 이에 제한되지 않는다. 이와 같이, 상기 폴리펩티드의 아미노산 서열 내에서 두 잔기가 아미드 결합의 공유결합 고리를 형성함으로써, 체내 안정성을 높이고 글루카곤 수용체 또는 글루카곤 유도체 수용체와의 결합효과를 높일 수 있다. 또한, 폴리펩티드의 알파 헬릭스 구조에 도움을 줄 수 있다.The R2 includes glutamic acid (E) and lysine (K), and the glutamic acid and lysine preferably form a ring by amide bonding, but is not limited thereto. As described above, by forming a covalent bond of an amide bond between two residues in the amino acid sequence of the polypeptide, it is possible to increase the stability in the body and enhance the binding effect with the glucagon receptor or the glucagon derivative receptor. It can also help with the alpha helix structure of the polypeptide.

상기 R3은 폴리펩티드의 C-말단으로써 혈중 반감기 또는 체내 지속성을 증가시키 위한 물질과 결합가능한 위치이며, 상기 R3은 시스테인인 것이 바람직하나 이에 제한되지 않는다.R3 is the C-terminus of the polypeptide and is a position capable of binding to a substance for increasing the blood half-life or persistence in the body, and R3 is preferably cysteine, but is not limited thereto.

상기 폴리펩티드는 서열번호 1에 기재된 아미노산 서열과 70% 내지 90%의 서열 상동성을 가질 수 있다. (서열번호 1: HSQGTFTSDYSKYLDSRRAQDFVQWLMNT)The polypeptide may have 70% to 90% sequence homology with the amino acid sequence set forth in SEQ ID NO: 1. (SEQ ID NO: 1: HSQGTFTSDYSKYLDSRRAQDFVQWLMNT)

여기서, 상기 서열번호 1에 기재된 아미노산 서열은 천연 글루카곤 아미노산 서열과 일부 또는 전부 일치하며, 천연 글루카곤은 글리코겐과 인슐린의 분해를 촉진하고 항비만 효과를 나타냄이 보고되어 있다. 그러나, 천연 글루카곤은 낮은 용해도와 중성 pH에서의 침전으로 인해 치료제로서 그 사용이 제한적이다.Here, the amino acid sequence set forth in SEQ ID NO: 1 is partially or completely identical to the native glucagon amino acid sequence, and it has been reported that natural glucagon promotes the degradation of glycogen and insulin and exhibits an anti-obesity effect. However, natural glucagon has limited use as a therapeutic agent due to its low solubility and precipitation at neutral pH.

즉, 상기 서열번호 1에 기재된 아미노산 서열과 70% 내지 90%의 서열 상동성을 가지는 아미노산 서열을 포함하는 폴리펩티드는 글루카곤 유도체 또는 옥신토모듈린 유도체일 수 있다. 이때, 상기 옥신토모듈린 유도체는 글루카곤의 전구체인 프리-글루카곤(pre-glucagon)으로부터 만들어지는 펩티드이다.That is, the polypeptide comprising an amino acid sequence having 70% to 90% sequence homology with the amino acid sequence set forth in SEQ ID NO: 1 may be a glucagon derivative or an oxyntomodulin derivative. In this case, the oxyntomodulin derivative is a peptide made from pre-glucagon, which is a precursor of glucagon.

바람직하게, 상기 폴리펩티드는 서열번호 1에 기재된 아미노산 서열과 73%~90%, 더욱 바람직하게는 75%~90%의 서열 상동성을 가질 수 있으나, 이에 제한되지 않는다.Preferably, the polypeptide may have 73% to 90%, more preferably 75% to 90% sequence homology with the amino acid sequence set forth in SEQ ID NO: 1, but is not limited thereto.

본 명세서에서, "상동성"이란 야생형 (wild type) 아미노산 서열 및 야생형 핵산 서열과의 유사한 정도를 나타내기 위한 것으로서, 이러한 상동성의 비교는 육안으로나 구입이 용이한 비교 프로그램을 이용하여 수행한다. 시판되는 컴퓨터 프로그램은 2개 이상의 서열 간의 상동성을 백분율 (%)로 계산할 수 있다. 상동성(%)은 인접한 서열에 대해 계산될 수 있다. 상기 펩티드를 코딩하는 폴리뉴클레오티드를 벡터에 삽입하여 이를 발현시킴으로써 상기 펩티드를 다량으로 확보할 수 있다.As used herein, "homology" is intended to indicate a degree of similarity to a wild type amino acid sequence and a wild type nucleic acid sequence, and the comparison of such homology is performed visually or using an easily purchased comparison program. Commercially available computer programs can calculate the homology between two or more sequences as a percentage (%). Homology (%) can be calculated for contiguous sequences. A large amount of the peptide can be secured by inserting a polynucleotide encoding the peptide into a vector and expressing it.

본 명세서에서, "펩티드"란 2개 이상의 α-아미노산이 펩티드결합으로 연결된 형태의 화합물을 의미한다.As used herein, the term “peptide” refers to a compound in which two or more α-amino acids are linked by a peptide bond.

한편, 상기 폴리펩티드는 비펩티드성 중합체, 지방산, 콜레스테롤, 항체, 항체 단편, 알부민 및 이의 단편, 뉴클레오티드, 피브로넥틴(fibronectin), 트렌스페린, FcRn 결합물질, 사카라이드(saccharide), 엘라스틴, 헤파린 및 이들의 유도체로 이루어진 군에서 선택된 어느 하나 이상과 공유결합하거나 봉입체(microsphere)를 형성할 수 있다.On the other hand, the polypeptide is a non-peptidic polymer, fatty acid, cholesterol, antibody, antibody fragment, albumin and fragments thereof, nucleotides, fibronectin, transferrin, FcRn binding material, saccharide (saccharide), elastin, heparin and their It may covalently bond with at least one selected from the group consisting of derivatives or form a microsphere.

바람직하게는 상기 폴리펩티드와 비펩티드성 중합체를 공유결합하는 것이나, 이에 제한되지 않는다.Preferably, the polypeptide and the non-peptidic polymer are covalently linked, but not limited thereto.

상기 폴리펩티드는 앞서 서술한 물질과 공유결합 또는 봉입체를 형성함으로써 혈중안정성을 증가시키고, 신장으로의 배출을 지연시킬 수 있으며, 수용체와의 결합력 변화를 유도할 수 있는 효과를 가진다.The polypeptide has the effect of increasing blood stability by forming a covalent bond or inclusion body with the above-described material, delaying excretion to the kidney, and inducing a change in binding force with a receptor.

상기 폴리펩티드는 비펩티드성 중합체와 공유결합으로 결합시킴으로써 생체내에서 반감기를 늘릴 수 있으며, 체내 체류시간을 연장시킬 수 있다. 이때, 상기 비펩티드성 중합체와 폴리펩티드가 결합되는 위치는 비펩티드성 중합체의 작용기 및 폴리펩티드의 아미노산 서열에 따라 달라질 수 있으며, 바람직하게는 폴리펩티드 C-말단에 비펩티드성 중합체가 중합되는 것이나, 반응율이 높아 우수한 수율로 제조될 수 있는 것이라면 특별히 제한되지 않는다.The polypeptide may increase its half-life in vivo by covalently binding it to a non-peptidic polymer, and may extend its residence time in the body. In this case, the binding position of the non-peptidic polymer and the polypeptide may vary depending on the functional group of the non-peptidic polymer and the amino acid sequence of the polypeptide. Preferably, the non-peptidic polymer is polymerized at the C-terminus of the polypeptide, but the reaction rate is low. It is not particularly limited as long as it can be prepared in high yield with excellent yield.

상기 폴리펩티드에 비펩티드성 중합체를 결합함에 있어서, 폴리펩티드 C-말단 시스테인의 SH기를 이용하여 말레이미드기를 가진 비펩티드성 중합체를 결합할 수 있으며, 또는 폴리펩티드의 라이신(K)의 아민기를 이용하여 숙신이미드 유도체를 가진 비펩티드성 중합체를 결합시킬 수 있다.In binding the non-peptidic polymer to the polypeptide, the non-peptidic polymer having a maleimide group may be bound using the SH group of the C-terminal cysteine of the polypeptide, or the succinic may be substituted by using the amine group of the lysine (K) of the polypeptide. Non-peptidic polymers with mid derivatives can be incorporated.

상기 비펩티드성 중합체는 폴리에틸렌글리콜(PEG), 폴리프로필렌글리콜, 에틸렌글리콜과 프로필렌글리콜의 공중합체, 폴리옥시에틸화폴리올, 폴리비닐알콜(PVA), 폴리사카라이드, 덱스트란, 폴리비닐에틸에테르, 폴리락트산(polylactic acid, PLA), 폴리락틱-글리콜산(polylactic-glycolic acid, PLGA), 지질 중합체, 키틴, 히아루론산 및 이들의 조합으로 구성된 군으로부터 선택될 수 있다. 바람직하게는 폴리에틸렌글리콜 또는 이의 유도체이나, 이에 제한되지 않는다. 당해 분야에 이미 알려진 이들의 유도체 및 당해 분야의 기술 수준에서 용이하게 제조할 수 있는 유도체들도 본 발명의 범위에 포함된다.The non-peptidic polymer is polyethylene glycol (PEG), polypropylene glycol, a copolymer of ethylene glycol and propylene glycol, polyoxyethylated polyol, polyvinyl alcohol (PVA), polysaccharide, dextran, polyvinyl ethyl ether, polylactic acid (PLA), polylactic-glycolic acid (PLGA), lipid polymers, chitin, hyaluronic acid, and combinations thereof. Preferably, polyethylene glycol or a derivative thereof, but is not limited thereto. Derivatives thereof already known in the art and derivatives that can be easily prepared at the level of skill in the art are also included in the scope of the present invention.

상기 폴리에틸렌글리콜 유도체는 메톡시폴리에틸렌글리콜, 메톡시폴리에틸렌글리콜 N-히드록시숙신이미드, 메톡시폴리에틸렌글리콜 프로피온알데히드, 메톡시폴리에틸렌글리콜 말레이미드, 폴리에틸렌글리콜 숙신이미딜 프로피오네이트(PEG succinimidyl propionate), 메톡시 폴리에틸렌글리콜 숙신이미딜 프로피오네이트(metoxy PEG succinimidyl propionate), 아클릴레이트 폴리에틸렌글리콜 숙신이미딜 프로피오네이트(Acrylate PEG succinimidyl propionate), 티올 폴리에틸렌글리콜 숙신이미딜 프로피오네이트(Thiol PEG succinimidyl propionate), 히드록시 숙신이미딜 폴리에틸렌글리콜(hydroxy succinimidyl PEG), 메톡시폴리에틸렌글리콜 숙신이미딜 카르복시메틸 에스터(mPEG succinimidyl carboxymethyl ester), 아클릴레이트 폴리에틸렌글리콜 숙신이미딜 카르복시메틸 에스터(Acrylate PEG succinimidyl carboxymethyl ester), 폴리에틸렌글리콜 숙신이미딜 카르보네이트(PEG succinimidyl carbonate), 폴리에틸렌글리콜 프로피온 알데히드(PEG propion aldehyde), 폴리에틸렌글리콜 부틸 알데히드(PEG butyl aldehyde) 또는 이들 유도체의 다중가지형일 수 있다. 바람직하게는 상기 폴리에틸렌글리콜 유도체는 선형 메톡시폴리에틸렌글리콜 말레이미드, 이중가지형 메톡시폴리에틸렌글리콜 말레이미드 또는 삼중가지형 메톡시폴리에틸렌글리콜 말레이미드이고, 더욱 바람직하게는 삼중가지형 메톡시 폴리에틸렌글리콜 말레이미드이다.The polyethylene glycol derivative is methoxy polyethylene glycol, methoxy polyethylene glycol N-hydroxysuccinimide, methoxy polyethylene glycol propionaldehyde, methoxy polyethylene glycol maleimide, polyethylene glycol succinimidyl propionate (PEG succinimidyl propionate), Methoxy PEG succinimidyl propionate, Acrylate PEG succinimidyl propionate, Thiol PEG succinimidyl propionate , hydroxy succinimidyl polyethylene glycol (hydroxy succinimidyl PEG), methoxypolyethylene glycol succinimidyl carboxymethyl ester (mPEG succinimidyl carboxymethyl ester), acrylate polyethylene glycol succinimidyl carboxymethyl ester (Acrylate PEG succinimidyl carboxymethyl ester), Polyethylene glycol succinimidyl carbonate (PEG succinimidyl carbonate), polyethylene glycol propion aldehyde (PEG propion aldehyde), polyethylene glycol butyl aldehyde (PEG butyl aldehyde) or a multi-branched form of these derivatives. Preferably, the polyethylene glycol derivative is a linear methoxy polyethylene glycol maleimide, a double branched methoxy polyethylene glycol maleimide or a triple branched methoxy polyethylene glycol maleimide, and more preferably a triple branched methoxy polyethylene glycol maleimide. am.

상기 폴리에틸렌글리콜 또는 이의 유도체는 선형 또는 가지형이며, 바람직하게는 이중가지형 또는 삼중가지형인 것을 사용할 수 있고, 더욱 바람직하게는 삼중가지형인 것을 사용할 수 있다.The polyethylene glycol or its derivatives may be linear or branched, preferably double-branched or triple-branched, and more preferably triple-branched.

상기 비펩티드성 중합체는 분자량이 3,000 내지 100,000Da일 수 있으며, 바람직하게는 20,000 내지 70,000Da이며, 더욱 바람직하게는 40,000 내지 60,000Da이다. 상기 비펩티드성 중합체는 해당 범위 내의 분자량을 가질 경우 폴리펩티드와 결합하여 얻은 결합체의 용해도 증가 및 체내 지속시간을 늘릴 수 있다.The non-peptidic polymer may have a molecular weight of 3,000 to 100,000 Da, preferably 20,000 to 70,000 Da, and more preferably 40,000 to 60,000 Da. When the non-peptidic polymer has a molecular weight within the corresponding range, it is possible to increase the solubility of the conjugate obtained by binding to the polypeptide and increase the duration in the body.

따라서, 본 발명에 따른 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물은 폴리펩티드에 비펩티드성 중합체가 결합된 결합체를 포함함으로써, 생체안전성을 높일 수 있으며, 생체 내 반감기를 늘릴 수 있다.Accordingly, the pharmaceutical composition for preventing or treating nonalcoholic fatty liver disease according to the present invention includes a conjugate in which a non-peptidic polymer is bound to a polypeptide, thereby increasing biosafety and increasing in vivo half-life.

또한, 본 발명은 폴리펩티드 또는 상기 폴리펩티드 및 비펩티드성 중합체를 포함하는 결합체를 포함하는 인슐린의 분비량이 부족하거나 인슐린 작용의 결함에 의해 유발되는 질환의 예방 또는 치료용 약학 조성물을 제공할 수 있다.In addition, the present invention can provide a pharmaceutical composition for preventing or treating a disease caused by insufficient secretion of insulin or a defect in insulin action, comprising a polypeptide or a conjugate comprising the polypeptide and a non-peptidic polymer.

상기 인슐린의 분비량이 부족하거나 인슐린 작용의 결함에 의해 유발되는 질환으로는 제1형 당뇨병, 제2형 당뇨병 및 당뇨병 합병증 등을 포함할 수 있다.Diseases caused by insufficient secretion of insulin or defective insulin action may include type 1 diabetes, type 2 diabetes, and complications of diabetes.

또한, 본 발명의 폴리펩티드를 포함하는 약학 조성물은 고지혈증, 심혈관 질환, 동맥경화증 및 지질 관련 대사증후군과 같은 질환을 예방, 개선 또는 치료하는데 유용한 소재로 사용될 수 있다.In addition, the pharmaceutical composition comprising the polypeptide of the present invention can be used as a material useful for preventing, improving or treating diseases such as hyperlipidemia, cardiovascular disease, arteriosclerosis and lipid-related metabolic syndrome.

또한, 본 발명의 폴리펩티드를 포함하는 약학 조성물은 비알코올성 지방간 뿐만 아니라 비알콜성 지방간염, 간경병, 간암 등과 같은 간질환을 예방, 개선 또는 치료하는데 유용한 소재로 사용될 수 있다. In addition, the pharmaceutical composition comprising the polypeptide of the present invention can be used as a material useful for preventing, improving or treating liver diseases such as nonalcoholic fatty liver as well as nonalcoholic steatohepatitis, cirrhosis, and liver cancer.

본 발명의 조성물을 의약품으로 사용하는 경우, 폴리펩티드를 포함하는 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물은 임상투여 시에 다양한 하기의 경구 또는 비경구 투여 형태로 제제화되어 투여될 수 있으나, 이에 한정되는 것은 아니다.When the composition of the present invention is used as a pharmaceutical, the pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease containing the polypeptide may be formulated and administered in various oral or parenteral dosage forms as follows during clinical administration, but limited thereto it's not going to be

경구 투여용 제형으로는 예를 들면 정제, 환제, 경/연질 캅셀제, 액제, 현탁제, 유화제, 시럽제, 과립제, 엘릭시르제, 트로키제 등이 있는데, 이들 제형은 유효성분 이외에 희석제(예: 락토즈, 덱스트로즈, 수크로즈, 만니톨, 솔비톨, 셀룰로즈 및/또는 글리신), 활택제(예: 실리카, 탈크, 스테아르산 및 그의 마그네슘 또는 칼슘염 및/또는 폴리에틸렌 글리콜)를 함유하고 있다. 정제는 또한 마그네슘 알루미늄 실리케이트, 전분 페이스트, 젤라틴, 메틸셀룰로즈, 나트륨 카복시메틸셀룰로즈 및/또는 폴리비닐피롤리딘과 같은 결합제를 함유할 수 있으며, 경우에 따라 전분, 한천, 알긴산 또는 그의 나트륨 염과 같은 붕해제 또는 비등 혼합물 및/또는 흡수제, 착색제, 향미제, 및 감미제를 함유할 수 있다.Formulations for oral administration include, for example, tablets, pills, hard/soft capsules, solutions, suspensions, emulsifiers, syrups, granules, elixirs, troches, and the like. , dextrose, sucrose, mannitol, sorbitol, cellulose and/or glycine), lubricants (eg silica, talc, stearic acid and its magnesium or calcium salts and/or polyethylene glycol). Tablets may also contain binders such as magnesium aluminum silicate, starch paste, gelatin, methylcellulose, sodium carboxymethylcellulose and/or polyvinylpyrrolidine, optionally starch, agar, alginic acid or its sodium salt. disintegrants or effervescent mixtures and/or absorbents, colorants, flavoring agents, and sweetening agents.

상기 폴리펩티드를 포함하는 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물은 비경구 투여할 수 있으며, 비경구 투여는 피하주사, 정맥주사, 근육 내 주사, 비강내 분무, 점막을 통한 비강 또는 창자에의 투여, 흡입 투여 또는 흉부 내 주사를 주입하는 방법에 의한다.The pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease comprising the polypeptide can be administered parenterally, and parenteral administration includes subcutaneous injection, intravenous injection, intramuscular injection, intranasal spray, nasal passage through the mucosa or intestine. by administration, inhalation administration, or intrathoracic injection.

이때, 비경구 투여용 제형으로 제제화하기 위하여 상기 폴리펩티드를 안정화제 또는 완충제와 함께 물에 혼합하여 용액 또는 현탁액으로 제조하고, 이를 앰플, 프리필드 주사기(PFS) 또는 바이알 단위 투여형으로 제조할 수 있다. 상기 조성물은 멸균되고/되거나 방부제, 안정화제, 수화제 또는 유화 촉진제, 삼투압 조절을 위한 염 및/또는 완충제 등의 보조제, 및 기타 치료적으로 유용한 물질을 함유할 수 있으며, 통상적인 방법인 혼합, 과립화 또는 코팅 방법에 따라 제제화할 수 있다.At this time, in order to formulate a formulation for parenteral administration, the polypeptide is mixed with water together with a stabilizer or buffer to prepare a solution or suspension, which may be prepared in an ampoule, prefilled syringe (PFS) or vial unit dosage form. . The composition may be sterilized and/or contain adjuvants such as preservatives, stabilizers, wetting agents or emulsification accelerators, salts and/or buffers for regulating osmotic pressure, and other therapeutically useful substances, and mixing, granulation, in a conventional manner. It can be formulated according to the method of formulation or coating.

본 발명에 따른 폴리펩티드를 포함하는 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물의 인체에 대한 투여량은 환자의 나이, 몸무게, 성별, 투여형태, 건강상태 및 질환 정도에 따라 달라질 수 있다. 예를 들어 상기 약학 조성물은 0.001 내지 200 ㎎/㎏/일의 양으로 의사 또는 약사의 판단에 따라 경구 또는 비경구적 경로를 통해 투여할 수 있다.The dose to the human body of the pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease comprising the polypeptide according to the present invention may vary depending on the patient's age, weight, sex, dosage form, health status and disease degree. For example, the pharmaceutical composition may be administered in an amount of 0.001 to 200 mg/kg/day through oral or parenteral routes according to the judgment of a doctor or pharmacist.

또한, 본 발명은 폴리펩티드 및 비펩티드성 중합체를 포함하는 결합체를 포함하는 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물의 제조방법을 제공한다.In addition, the present invention provides a method for preparing a pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease, comprising a conjugate comprising a polypeptide and a non-peptidic polymer.

먼저, 상기 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물의 제조방법에 있어, 폴리펩티드는 앞서 설명한 일반식 1의 아미노산 서열을 가진다. 비펩티드성 중합체 역시 앞서 설명한 바와 동일한 것으로 폴리펩티드 및 비펩티드성 중합체에 대한 자세한 설명은 생략한다.First, in the method for preparing a pharmaceutical composition for the prevention or treatment of non-alcoholic fatty liver disease, the polypeptide has the amino acid sequence of Formula 1 as described above. Non-peptidic polymers are also the same as described above, and detailed descriptions of polypeptides and non-peptidic polymers will be omitted.

구체적으로, 상기 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물의 제조방법은 폴리펩티드와 비펩티드성 중합체를 혼합하여 반응시키는 단계를 포함한다. 이때, 상기 폴리펩티드와 비펩티드성 중합체를 1:1로 결합시키기 위하여 각각 1:1 내지 1:5의 몰비로 반응시킬 수 있으며, 바람직한 혼합 몰비는 1:1 내지 1:2이다. 더욱 바람직하게는 1:1.2인 것이나, 이에 제한되지 않는다. 해당 범위 내의 혼합 몰비를 사용할 경우 수율을 높일 수 있으며 고순도의 폴리펩티드 및 비펩티드성 중합체를 포함하는 결합체를 제조할 수 있다.Specifically, the method for preparing a pharmaceutical composition for the prevention or treatment of non-alcoholic fatty liver disease includes the step of reacting by mixing a polypeptide and a non-peptidic polymer. In this case, the polypeptide and the non-peptidic polymer may be reacted in a molar ratio of 1:1 to 1:5, respectively, in order to bind 1:1, and a preferred mixing molar ratio is 1:1 to 1:2. More preferably, it is 1:1.2, but is not limited thereto. When a mixing molar ratio within the range is used, the yield can be increased and a conjugate including a high-purity polypeptide and a non-peptidic polymer can be prepared.

또한, 본 발명의 일 실시예로, 상기 폴리펩티드 C-말단에 비펩티드성 중합체를 공유결합시켜 결합체를 제조할 수 있으며, 일 예로, 비펩티드성 중합체는 말레이미드 그룹을 가진 메톡시폴리에틸렌글리콜을 사용하고, 폴리펩티드는 C-말단에 시스테인인 것을 사용하여 높은 반응성으로 제조되어 수율이 높고, 혈중 반감기를 늘릴 수 있다.In one embodiment of the present invention, a conjugate can be prepared by covalently bonding a non-peptidic polymer to the C-terminus of the polypeptide. For example, the non-peptidic polymer is methoxy polyethylene glycol having a maleimide group. And, the polypeptide is prepared with high reactivity using a cysteine at the C-terminus, so that the yield is high and the half-life in blood can be increased.

상기 폴리펩티드와 비펩티드성 중합체를 혼합하여 반응시키는 단계는 pH 4.0 내지 9.0에서 수행될 수 있으며, 바람직하게는 pH 5.5 내지 7.5이나 이에 제한되지 않는다. 상기 pH의 범위를 벗어나는 경우, 수율이 떨어지는 문제점이 있다. 일 예로, 비펩티드성 중합체는 말레이미드 그룹을 가진 메톡시폴리에틸렌글리콜을 사용하고, 폴리펩티드는 C-말단에 시스테인을 사용할 경우에는 pH 6 내지 8인 것이 바람직하며, 해당 pH 범위 내에서 폴리펩티드와 메톡시폴리에틸렌글리콜을 반응시키면 폴리펩티드의 아민기(amine group)에 의한 부반응이 일어나지 않으면서, 말레이미드의 ring opening 현상과 같은 부반응을 억제할 수 있다. The step of mixing and reacting the polypeptide and the non-peptidic polymer may be performed at pH 4.0 to 9.0, preferably pH 5.5 to 7.5, but is not limited thereto. When out of the range of the pH, there is a problem in that the yield is lowered. For example, the non-peptidic polymer uses methoxypolyethylene glycol having a maleimide group, and when using cysteine at the C-terminus of the polypeptide, the pH is preferably 6 to 8, and within the corresponding pH range, the polypeptide and methoxyl group When polyethylene glycol is reacted, side reactions such as ring opening of maleimide can be suppressed without causing side reactions due to amine groups of the polypeptide.

상기 폴리펩티드와 비펩티드성 중합체를 혼합하여 반응시키는 단계는 수율이 85 내지 95%으로, 매우 수율이 높아 경제적이며 재현성이 높으므로 의약품에 유용하게 사용될 수 있다.In the step of mixing and reacting the polypeptide and the non-peptidic polymer, the yield is 85 to 95%, and the yield is very high, so it is economical and highly reproducible, so it can be usefully used in pharmaceuticals.

상기 폴리펩티드와 비펩티드성 중합체를 혼합하여 반응시키는 단계의 반응 시간은 0.5 내지 24시간일 수 있으며, 1 내지 24시간일 수 있다. 바람직하게는 2시간이나, 이에 제한되지 않는다. 상기 반응 시간이 0.5시간 미만일 경우는 수율이 떨어지고 순도가 낮아질 수 있으며, 한편 24시간 초과할 경우 폴리펩티드의 화학안정성이 떨어지거나 공정시간이 길어짐에 따른 경제적 효과가 떨어지는 문제점이 있다. The reaction time of the step of mixing and reacting the polypeptide and the non-peptidic polymer may be 0.5 to 24 hours, and may be 1 to 24 hours. Preferably 2 hours, but is not limited thereto. If the reaction time is less than 0.5 hours, the yield may be reduced and the purity may be lowered. On the other hand, if the reaction time exceeds 24 hours, there is a problem in that the chemical stability of the polypeptide falls or the economic effect due to the prolonged process time is reduced.

또한, 상기 폴리펩티드와 비펩티드성 중합체를 혼합하여 반응시키는 단계의 온도는 0 내지 100℃ 일 수 있다. 바람직하게는 4 내지 40℃이나, 이에 제한되지 않는다. 또한, 상기 폴리펩티드 또는 비펩티드성 중합체가 화학적 변이가 일어나지 않는 수준의 온도라면 특별히 제한되지 않는다. In addition, the temperature of the step of mixing and reacting the polypeptide and the non-peptidic polymer may be 0 to 100 ℃. Preferably 4 to 40 ℃, but is not limited thereto. In addition, the polypeptide or non-peptidic polymer is not particularly limited as long as the temperature is at a level at which chemical transformation does not occur.

상기 폴리펩티드와 비펩티드성 중합체를 혼합하여 반응시키는 단계에서, 각각 폴리펩티드 및 비펩티드성 중합체는 서로 동일하거나 상이한 용매를 이용할 수 있으며, 바람직하게 상기 용매는 완충액, 알코올, 디메틸술폭시드(Diemthyl sulfoxide, DMSO) 또는 이들의 혼합물이나, 이에 제한되지 않는다. 또한 상기 용매는 해당 분야에서 용이하게 이용할 수 있는 것을 포함한다. In the step of mixing and reacting the polypeptide and the non-peptidic polymer, the polypeptide and the non-peptidic polymer may use the same or different solvents, preferably, the solvent is a buffer, alcohol, or dimethyl sulfoxide (DMSO). ) or a mixture thereof, but is not limited thereto. In addition, the solvent includes those readily available in the art.

이하, 본 발명이 속하는 기술 분야에서 통상의 지식을 가진 자가 용이하게 실시할 수 있도록 본 발명의 실시 예에 대하여 첨부한 도면을 참고로 하여 상세히 설명한다. 그러나 본 발명은 여러 가지 상이한 형태로 구현될 수 있으며 여기에서 설명하는 실시예에 한정되지 않는다. 명세서 전체를 통하여 유사한 부분에 대해서는 동일한 도면 부호를 붙였다.Hereinafter, embodiments of the present invention will be described in detail with reference to the accompanying drawings so that those of ordinary skill in the art to which the present invention pertains can easily carry out the present invention. However, the present invention may be embodied in many different forms and is not limited to the embodiments described herein. Throughout the specification, like reference numerals are assigned to similar parts.

실시예Example 1. One.

시스테인이 도입된 폴리펩티드(분자량: 3509Da, 서열번호 2:H(Aib)QGTFTSDYSKYLD E QAA K EFVQWLMNTC).Cysteine introduced polypeptide (molecular weight: 3509 Da, SEQ ID NO: 2:H(Aib)QGTFTSDYSKYLD E QAA K EFVQWLMNTC).

여기서, 상기 서열번호 2의 아미노산 서열에서 밑줄 및 볼드로 표시된 두 잔기는 잔기 사이에 공유결합 고리가 형성된 것을 나타낸다.Here, in the amino acid sequence of SEQ ID NO: 2, two residues marked with an underline and bold indicates that a covalent bond is formed between the residues.

제조예 1. 폴리펩티드 및 비펩티드성 중합체를 포함하는 결합체 합성Preparation Example 1. Synthesis of a conjugate comprising a polypeptide and a non-peptidic polymer

폴리펩티드 및 비펩티드성 중합체를 포함하는 결합체를 제조하기 위해, 폴리펩티드는 C-말단 부위(30번 위치)에 시스테인이 도입된 폴리펩티드(분자량: 3509Da, 서열번호 2:H(Aib)QGTFTSDYSKYLDEQAAKEFVQWLMNTC)를 사용하였다.To prepare a conjugate comprising a polypeptide and a non-peptidic polymer, a polypeptide having a cysteine introduced at the C-terminal site (position 30) (molecular weight: 3509 Da, SEQ ID NO: 2:H(Aib)QGTFTSDYSKYLDEQAAKEFVQWLMNTC) was used. .

한편 비펩티드성 중합체는 하기 표 2와 같이 말레이미드로 활성화된 mPEG-MAL(Maleimide activated monomethoxy PEG)를 사용하였다.Meanwhile, as the non-peptidic polymer, mPEG-MAL (Maleimide activated monomethoxy PEG) activated with maleimide was used as shown in Table 2 below.

실시예 2 내지 7을 제조하기 위해 하기 표 2와 같이 준비하였으며, 폴리펩티드는 DMSO(Dimethyl sulfoxide)에, mPEG-MAL는 50 mM 인산완충식염수(phosphate buffer saline, pH 6)에 각각 용해하였다.Examples 2 to 7 were prepared as shown in Table 2 below, and the polypeptide was dissolved in DMSO (dimethyl sulfoxide) and mPEG-MAL was dissolved in 50 mM phosphate buffer saline (pH 6), respectively.

구분division 폴리펩티드polypeptide 비펩티드성non-peptidic 중합체 polymer 실시예Example 2 2 서열번호 2:H(Aib)QGTFTSDYSKYLD E QAA K EFVQWLMNTC의 아미노산 서열을 갖는 폴리펩티드SEQ ID NO: 2: H(Aib)QGTFTSDYSKYLD E QAA K EFVQWLMNTC A polypeptide having the amino acid sequence 3중 가지형 mPEG-MAL(MW: 50 kDa)Triple branched mPEG-MAL (MW: 50 kDa) 실시예Example 3 3 서열번호 2:H(Aib)QGTFTSDYSKYLD E QAA K EFVQWLMNTC의 아미노산 서열을 갖는 폴리펩티드SEQ ID NO: 2: H(Aib)QGTFTSDYSKYLD E QAA K EFVQWLMNTC A polypeptide having the amino acid sequence 이중 가지형 mPEG-MAL(MW: 20 kDa)Double branched mPEG-MAL (MW: 20 kDa) 실시예Example 4 4 서열번호 2:H(Aib)QGTFTSDYSKYLD E QAA K EFVQWLMNTC의 아미노산 서열을 갖는 폴리펩티드SEQ ID NO: 2: H(Aib)QGTFTSDYSKYLD E QAA K EFVQWLMNTC A polypeptide having the amino acid sequence 선형 mPEG-MAL(MW: 20 kDa)Linear mPEG-MAL (MW: 20 kDa) 실시예Example 5 5 서열번호 3:HGQGTFTSDYSKYLD E KRA K EFVQWLMNTC의 아미노산 서열을 갖는 폴리펩티드SEQ ID NO: 3: Polypeptide having the amino acid sequence of HGQGTFTSDYSKYLD E KRA K EFVQWLMNTC 3중 가지형 mPEG-MAL(MW: 50 kDa)Triple branched mPEG-MAL (MW: 50 kDa) 실시예Example 6 6 서열번호 4:H(Aib)QGTFTSDYSKYLD E EAV K EFVQWLMNTC의 아미노산 서열을 갖는 폴리펩티드SEQ ID NO: 4: a polypeptide having the amino acid sequence of H(Aib)QGTFTSDYSKYLD E EAV K EFVQWLMNTC 3중 가지형 mPEG-MAL(MW: 50 kDa)Triple branched mPEG-MAL (MW: 50 kDa) 실시예Example 7 7 서열번호 5:HGQGTFTSDYSKYLD E EAV K EFVQWLMNTC의 아미노산 서열을 갖는 폴리펩티드SEQ ID NO: 5: Polypeptide having the amino acid sequence of HGQGTFTSDYSKYLD E EAV K EFVQWLMNTC 3중 가지형 mPEG-MAL(MW: 50 kDa)Triple branched mPEG-MAL (MW: 50 kDa)

상기 표 2에 기재된 서열번호 2 내지 4의 아미노산 서열에서 밑줄 및 볼드로 표시된 두 잔기는 잔기 사이에 공유결합 고리가 형성된 것을 나타낸다.폴리펩티드와 비펩티드성 결합체를 1:1.2의 몰비율로 혼합하여 2 시간 동안 실온에서 반응시켰다. 반응 종결 후, 반응액을 TSK SP-5PW 컬럼(7.5 Х 75 mm, Tosoh, 일본)을 유속 0.8 ㎖/min으로하여 이온 교환 크로마토그래피로 분리하였다. 분리는 자외선 파장 280 nm에서 모니터링 하였다. 이동상은 20 mM 아세테이트 완충용액(pH 4)(이동상 A)와 1M 염화나트륨용액(in 20 mM 아세테이트 완충용액(pH 4)(이동상 B)를 선형 농도구배법(0-100% B over 30 min)을 이용하여 분리하였다. 이와 같이 분리하여 얻은 페길화된 폴리펩티드의 순도를 측정하기 위하여 HPLC를 수행하였다(도 1 참조). 그 다음 MALDI-TOF 질량분석기를 이용하여 페길화된 폴리펩티드의 질량값을 측정하였다(도 2참조). 또한, 반응 종결 후 크로마토그래피 분리과정에서 얻어진 크로마토그램에서 폴리펩티드와 결합체의 면적비율로 각 실시예 2 내지 7에 대한 수율을 계산하여 표 3에 나타냈다.In the amino acid sequence of SEQ ID NOs: 2 to 4 shown in Table 2, two residues indicated by an underline and a bold line indicate that a covalent bond is formed between the residues. The polypeptide and the non-peptidic conjugate are mixed in a molar ratio of 1:1.2 to obtain 2 for hours at room temperature. After completion of the reaction, the reaction solution was separated by ion exchange chromatography using a TSK SP-5PW column (7.5 Х 75 mm, Tosoh, Japan) at a flow rate of 0.8 ml/min. Separation was monitored at an ultraviolet wavelength of 280 nm. For the mobile phase, 20 mM acetate buffer (pH 4) (mobile phase A) and 1 M sodium chloride solution (in 20 mM acetate buffer (pH 4) (mobile phase B)) were subjected to a linear gradient method (0-100% B over 30 min). In order to measure the purity of the pegylated polypeptide obtained by the separation, HPLC was performed (see Fig. 1).Then, the mass value of the pegylated polypeptide was measured using MALDI-TOF mass spectrometry. (See Fig. 2.) In addition, the yields for each of Examples 2 to 7 were calculated as the area ratio of the polypeptide and the conjugate in the chromatogram obtained in the chromatographic separation process after the completion of the reaction, and are shown in Table 3.

구분division 수율transference number 실시예Example 2 2 90%90% 실시예Example 3 3 92%92% 실시예Example 4 4 91%91% 실시예Example 5 5 89%89% 실시예Example 6 6 91%91% 실시예Example 7 7 90%90%

표 3에 나타낸 바와 같이, 90% 이상의 수율로 제조될 수 있음을 확인하였다. 이에 따라, 본 발명에 따른 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물의 제조방법은 펩티드와의 반응성이 높아 수율이 높고, 제조공정이 단순하여 경제적이면서 재현성이 높으므로 의약품에 유용하게 사용될 수 있는 이점을 가진다.As shown in Table 3, it was confirmed that it can be prepared in a yield of 90% or more. Accordingly, the method for preparing the pharmaceutical composition for the prevention or treatment of non-alcoholic fatty liver disease according to the present invention has a high yield due to high reactivity with a peptide, and is economical and reproducible because of a simple manufacturing process. have an advantage

실험예 1. 실시예 2의 in vitro 활성 측정Experimental Example 1. Measurement of in vitro activity of Example 2

상기 실시예 2의 비알코올성 지방간 질환의 예방 또는 치료 효과를 측정하기 위해 GLP-1(글루카곤 유도체) 수용체(Receptor)와 글루카곤 수용체(GCGR)를 발현하는 세포주를 이용하여 실험을 진행하였다.In order to measure the preventive or therapeutic effect of the nonalcoholic fatty liver disease of Example 2, an experiment was conducted using cell lines expressing GLP-1 (glucagon derivative) receptor (Receptor) and glucagon receptor (GCGR).

먼저, GLP-1 수용체에 대한 효력을 확인하기 위하여 GenScript에서 HEK293/CRE-Luc세포에 인간 글루카곤 GLP-1의 수용체가 발현되는 세포를 구매하여 이용하였으며 96웰 플레이트에 각 웰당 5 x 104개의 세포를 분주하고, 각 웰에 실시예 1(0.001 ~ 300 nM), 실시예 2(0.001 ~ 300 nM), 천연 글루카곤(서열번호 1: HSQGTFTSDYSKYLDSRRAQDFVQWLMNT, 0.014 ~ 300 nM) 및 GLP-1(서열번호 6:HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR, 0.001 ~ 300 nM) 을 처리한 후 4시간 동안 37℃의 온도조건으로 CO2 배양기에서 배양하였다. 그런 다음 One-GloTM Luciferase assay system(Promega)을 사용하여 cAMP(Luciferase reporter)의 생성양을 측정하여 GLP-1의 수용체에 대한 EC50 값을 산출하여 하기 표 4에 나타냈다.First, in order to check the effect on the GLP-1 receptor, cells expressing the human glucagon GLP-1 receptor were purchased and used in HEK293/CRE-Luc cells from GenScript, and 5 x 10 4 cells per well in a 96-well plate. was dispensed, and Example 1 (0.001 to 300 nM), Example 2 (0.001 to 300 nM), native glucagon (SEQ ID NO: 1: HSQGTFTSDYSKYLDSRRAQDFVQWLMNT, 0.014 to 300 nM) and GLP-1 (SEQ ID NO: 6: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR, 0.001 ~ 300 nM) was treated and then cultured in a CO 2 incubator at 37° C. for 4 hours. Then, the production amount of cAMP (Luciferase reporter) was measured using the One-Glo™ Luciferase assay system (Promega), and the EC 50 value for the GLP-1 receptor was calculated and shown in Table 4 below.

두번째로, 글루카곤 수용체(GCGR)에 대한 효력을 확인하기 위하여 DiscoverX 사의 cAMP HunterTM eXpress GCGR CHO-K1 GPCR Assay kit을 사용하였다. CHO-K1 세포에 인간 글루카곤 수용체가 발현되는 세포를 이용하였으며 96웰 플레이트에 각 웰당 3 x 104개의 세포를 분주하고, 각 웰에 실시예 1(0.013 ~ 300 nM), 실시예 2(0.013 ~ 300 nM), 천연 글루카곤(0.015 ~ 33.33 nM) 및 GLP-1(0.001 ~ 30.00 nM)을 처리한 후 30분 동안 37℃의 온도조건으로 CO2 배양기에서 배양하였다. 그런 다음 cAMP의 생성양을 측정하여 글루카곤 수용체(GCGR)에 대한 EC50 값을 산출하여 하기 표 4에 나타냈다.Second, in order to confirm the effect on the glucagon receptor (GCGR), DiscoverX's cAMP Hunter TM eXpress GCGR CHO-K1 GPCR Assay kit was used. Cells expressing human glucagon receptor in CHO-K1 cells were used, and 3 x 10 4 cells were seeded per well in a 96-well plate, and Example 1 (0.013 ~ 300 nM), Example 2 (0.013 ~) in each well. 300 nM), natural glucagon (0.015 ~ 33.33 nM) and GLP-1 (0.001 ~ 30.00 nM) were treated and then cultured in a CO 2 incubator at a temperature of 37 °C for 30 minutes. Then, the amount of cAMP production was measured to calculate the EC 50 value for the glucagon receptor (GCGR), and are shown in Table 4 below.

구분division GLP-1의 수용체 GLP-1 receptor
ECEC 5050 (nM)(nM)
글루카곤 수용체(glucagon receptor ( GCGRGCGR ))
ECEC 5050 (nM)(nM)
실시예 1Example 1 0.130.13 38.6538.65 실시예 2Example 2 2.122.12 46.9846.98 천연 글루카곤natural glucagon 11.4211.42 0.150.15 GLP-1GLP-1 0.070.07 > 1,000> 1,000

상기 표 4에 나타낸 바와 같이, GLP-1 경우, GLP-1의 수용체에서 높은 결합력을 보였으나, 글루카곤 수용체에 대한 결합력은 매우 낮아 측정이 불가하였다. 반면에, 천연 글루카곤은 글루카곤 수용체에 대한 결합력은 매우 높았으나 GLP-1의 수용체에 대해서는 낮은 결합력을 보였다. 이에 따라 이러한 결과를 바탕으로 시험법의 선택성이 높음을 확인하였다. 한편, 실시예 1의 폴리펩티드는 GLP-1의 수용체에 대한 EC50 값이 0.13으로, GLP-1와 거의 유사한 EC50 값을 나타내어 GLP-1 수용체와 매우 높은 결합력을 나타냄을 확인하였으며, 글루카곤 수용체에 대한 결합력도 확보하고 있음을 확인하였다.As shown in Table 4, in the case of GLP-1, the GLP-1 receptor showed a high binding force, but the binding force to the glucagon receptor was very low, so measurement was impossible. On the other hand, natural glucagon showed a very high binding affinity to the glucagon receptor, but a low binding affinity to the GLP-1 receptor. Accordingly, it was confirmed that the selectivity of the test method was high based on these results. On the other hand, the polypeptide of Example 1 was shown to substantially similar EC 50 values and the EC 50 value is 0.13, GLP-1 to the receptor of the GLP-1 check indicates a very high affinity and GLP-1 receptor, a glucagon receptor It was confirmed that the binding force was also secured.

또한, 실시예 2의 결합체도 실시예 1의 폴리펩티드와 비교하여 GLP-1의 수용체와 글루카곤 수용체에 대하여 유사한 결합력을 유지하고 있음을 확인하였다. 일반적으로 폴리펩티드에 비펩티드성 중합체(예: PEG)를 결합하는 경우 폴리펩티드에 비펩티드성 중합체를 결합하기 전에 비하여 수용체 결합력이 매우 감소하는 반면 실시예 2는 비펩티드성 중합체를 결합하더라도 수용체 결합력이 감소되는 정도가 작아 높은 수용체 결합력을 유지하면서 체내 반감기가 연장될 수 있음을 확인하였다.In addition, it was confirmed that the conjugate of Example 2 also maintains similar binding affinity to the GLP-1 receptor and the glucagon receptor as compared to the polypeptide of Example 1. In general, when a non-peptidic polymer (eg, PEG) is bound to a polypeptide, the receptor avidity is significantly reduced compared to before binding of the non-peptidic polymer to the polypeptide, whereas in Example 2, the receptor avidity is reduced even when the non-peptidic polymer is bound. It was confirmed that the half-life in the body can be extended while maintaining high receptor binding force due to the small degree of oxidative activity.

따라서, 본 발명에 따른 비알코올성 지방간 질환의 예방 또는 치료용 조성물은 글루카곤 수용체 및 GLP-1의 수용체의 결합력이 우수하여, 식욕억제 및 지방세포의 지방 분해를 촉진시킴으로써 중성지방 감소 효과를 나타내는 것을 확인하였다.Therefore, it was confirmed that the composition for preventing or treating non-alcoholic fatty liver disease according to the present invention exhibits a triglyceride reduction effect by suppressing appetite and promoting lipolysis of adipocytes by having excellent binding ability between the glucagon receptor and the GLP-1 receptor. did.

실험예Experimental example 2. 2. 실시예Example 2의 in 2 in vivoin vivo 활성 측정 1 Activity Measurement 1

상기 실시예 2의 비알코올성 지방간 질환의 예방 또는 치료 효과를 측정하기 위해 C57BL/6 마우스에 실시예 2를 투여하여 혈청 콜레스테롤의 수치 및 간의 무게 변화와 간 조직검사를 실시하여 도 3 내지 도 5에 도시하였다.In order to measure the preventive or therapeutic effect of non-alcoholic fatty liver disease of Example 2, Example 2 was administered to C57BL/6 mice, and serum cholesterol levels and liver weight changes and liver biopsies were performed, as shown in FIGS. 3 to 5 shown.

구체적으로, 먼저 약 6주령 정상 C57BL/6 마우스에 60% 고지방식이(high fat diet)를 약 24주 동안 급이 하여 평균적으로 체중을 약 50g으로 증가시켜 비알코올성 지방간 질환 실험 동물 모델을 준비하였다. 그 다음 상기 실시예 2를 20 nmol/kg으로 이틀에 한번 피하주사로 2주 동안 투여하였다. 또한, 양성 대조군으로 GLP-1 작용제인 리라글루타이드(liraglutide)을 100 nmol/kg으로 매일 피하주사로 2주 동안 투여하였다. 2주간의 약제 투여가 끝난 후 마우스의 혈액을 채취하여 혈청(serum)내 콜레스테롤 농도를 측정하고, 간을 적출하여 간의 무게를 측정하고, 파라핀으로 고정시키고 얇은 절편을 만든 후 일반적으로 사용하는 H&E (hematoxylin & eosin) 염색을 이용하여 간 조직검사를 수행하였다.Specifically, first, a 60% high fat diet was fed to about 6-week-old normal C57BL/6 mice for about 24 weeks, and the average body weight was increased to about 50 g to prepare a non-alcoholic fatty liver disease experimental animal model. . Then, Example 2 was administered by subcutaneous injection once every two days at 20 nmol/kg for 2 weeks. In addition, as a positive control, liraglutide, a GLP-1 agonist, was administered by subcutaneous injection daily at 100 nmol/kg for 2 weeks. After 2 weeks of drug administration, blood from mice is collected, cholesterol concentration in serum is measured, liver is removed, liver is weighed, fixed with paraffin and thin section is made, and then generally used H&E ( Hematoxylin & eosin) staining was used for liver biopsy.

혈청 콜레스테롤의 수치 및 간의 무게를 측정한 도 3 및 도 4를 참고하면, 실시예 2를 투여한 마우스는 PBS를 투여한 무처리군 대비 혈청 콜레스테롤의 수치 및 간의 무게가 유의적으로 감소하였을 뿐만 아니라, 양성 대조군인 liraglutide 군에 비하여도 감소한 것을 확인할 수 있다. 또한, 간 조직검사 결과인 도 5를 참고하면, PBS를 투여한 무처리군 대비 실시예 2를 투여한 군에서 간의 지방증(steatosis)이 현저하게 감소하였으며, 양성 대조군인 liraglutide 군에 비하여도 감소한 것을 확인할 수 있다.Referring to FIGS. 3 and 4 measuring the level of serum cholesterol and the weight of the liver, the mice administered with Example 2 not only significantly decreased the level of serum cholesterol and the weight of the liver compared to the untreated group administered with PBS , it can be confirmed that the decrease was also compared to the liraglutide group, which is a positive control group. In addition, referring to FIG. 5, which is a liver biopsy result, the steatosis of the liver was significantly reduced in the group administered with Example 2 compared to the untreated group administered with PBS, and it was also reduced compared to the liraglutide group, which is a positive control group. can be checked

이와 같이 본 발명에 따른 비알코올성 지방간 질환 예방 또는 치료용 약학 조성물은 비알코올성 지방간 질환 동물 모델에서 간의 무게, 혈청 콜레스테롤 및 간의 지방증을 감소시켜, 비알코올성 지방간 질환의 예방 또는 치료에 효과가 있음을 보여주고 있다.As such, the pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease according to the present invention reduces liver weight, serum cholesterol and liver steatosis in an animal model of non-alcoholic fatty liver disease, thereby showing that it is effective in preventing or treating non-alcoholic fatty liver disease. are giving

실험예Experimental example 3. 3. 실시예Example 2의 in 2 in vivoin vivo 활성 측정 2 Activity measurement 2

상기 실시예 2의 비알코올성 지방간 질환의 예방 또는 치료 효과를 측정하기 위해 C57BL/6 마우스에 실시예 2를 투여하여 혈청 콜레스테롤의 수치, 간의 무게 및 간내 중성지방의 변화를 측정하여 도 6 내지 도 8에 도시하였다.6 to 8 by administering Example 2 to C57BL/6 mice to measure the preventive or therapeutic effect of the nonalcoholic fatty liver disease of Example 2, measuring changes in serum cholesterol levels, liver weight, and intrahepatic triglycerides shown in

구체적으로, 먼저 약 6주령 정상 C57BL/6 마우스에 고지방 40%, 프록토즈 20%, 콜레스테롤 2%가 함유된 고트랜스지방식이(high trans-fat diet)를 약 16주 동안 급이 하여 비알코올성 지방간 질환 실험 동물 모델을 준비하였다. 그 다음 상기 실시예 2를 20 nmol/kg으로 삼일에 한번 피하주사로 4주 동안 투여하였다. 또한, 양성 대조군으로 GLP-1 작용제인 리라글루타이드(liraglutide)를 53 nmol/kg으로 매일 피하주사로 4주 동안 투여하였다. 4주간의 실험이 끝난 후 혈청(serum) 콜레스테롤의 수치, 간의 무게 및 간내 중성지방 (hepatic triglyceride, hepatic TG)을 측정하였다.Specifically, first, a high trans-fat diet containing 40% high fat, 20% fructose, and 2% cholesterol was fed to about 6-week-old normal C57BL/6 mice for about 16 weeks to achieve non-alcoholic fatty liver disease. Disease experimental animal models were prepared. Then, Example 2 was administered by subcutaneous injection once every 3 days at 20 nmol/kg for 4 weeks. In addition, as a positive control, liraglutide, a GLP-1 agonist, was administered by subcutaneous injection daily at 53 nmol/kg for 4 weeks. After 4 weeks of experiment, serum cholesterol level, liver weight, and hepatic triglyceride (hepatic TG) were measured.

혈청 콜레스테롤의 수치, 간의 무게 및 간내 중성지방을 측정한 도 6 내지 도 8을 참고하면, 실시예 2를 투여한 마우스는 vehicle을 투여한 무처리군 대비 혈청 콜레스테롤의 수치, 간의 무게 및 간내 중성지방이 유의적으로 감소하였을 뿐만 아니라, 양성 대조군인 liraglutide 군에 비하여도 감소한 것을 확인할 수 있다. 이와 같이 본 발명에 따른 비알코올성 지방간 질환 예방 또는 치료용 약학 조성물은 비알코올성 지방간 질환 동물 모델에서 혈청 콜레스테롤, 간의 무게 및 간내 중성지방을 감소시켜, 비알코올성 지방간 질환의 예방 또는 치료에 효과가 있음을 보여주고 있다.6 to 8, which measured the level of serum cholesterol, the weight of the liver, and the triglycerides in the liver, the mice administered with Example 2 had the level of serum cholesterol, the weight of the liver and the triglycerides in the liver compared to the vehicle-administered untreated group It can be confirmed that not only was this significantly decreased, but also decreased compared to the liraglutide group, which is a positive control. As described above, the pharmaceutical composition for preventing or treating nonalcoholic fatty liver disease according to the present invention reduces serum cholesterol, liver weight, and intrahepatic triglycerides in an animal model of nonalcoholic fatty liver disease, indicating that it is effective in preventing or treating nonalcoholic fatty liver disease. is showing

실험예Experimental example 4. 4. 실시예Example 2의 in 2 in vivoin vivo 활성 측정 3 Activity Measurement 3

상기 실험예 3과 같이 실험을 진행한 후, 간 조직검사 및 NAFLD activity score (NAS)를 측정하여 비알코올성 지방간질환의 예방 및 치료효과를 확인하였다. 구체적인 실험방법은 상기 실험예 3과 같이 4주간의 투여가 끝난 후 마우스의 간을 적출하여 파라핀으로 고정시키고 얇은 절편을 만든 후 일반적으로 사용하는 H&E (hematoxylin & eosin) 염색 및 oil-red-O 염색을 이용하였다.After the experiment was carried out as in Experimental Example 3, a liver biopsy and NAFLD activity score (NAS) were measured to confirm the prevention and treatment effect of nonalcoholic fatty liver disease. As in Experimental Example 3, the specific experimental method is as in Experimental Example 3, after 4 weeks of administration is finished, the liver of a mouse is removed, fixed with paraffin, and a thin section is made. was used.

그 결과, 4주간 투여 후 간 조직검사 및 NAS 결과는 도 9 및 도 10에 나타난 바와 같이, 실시예 2를 투여한 마우스는 vehicle을 투여한 무처리군 대비 간의 지방증 (steatosis)이 현저하게 감소하였으며 NAS가 유의적으로 감소하였을 뿐만 아니라, 양성 대조군인 liraglutide 군에 비하여도 감소한 것을 확인하였다. 이와 같이 본 발명에 따른 비알코올성 지방간 질환 예방 또는 치료용 약학 조성물은 비알코올성 지방간 질환 동물 모델에서 간의 지방증을 감소시키고 NAS가 감소되어, 비알코올성 지방간 질환의 예방 또는 치료에 효과가 있음을 보여주고 있다.As a result, liver biopsy and NAS results after administration for 4 weeks, as shown in FIGS. 9 and 10, the mice administered with Example 2 had significantly reduced liver steatosis compared to the vehicle-administered untreated group. It was confirmed that not only NAS was significantly reduced, but also decreased compared to the positive control liraglutide group. As such, the pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease according to the present invention reduces steatosis of the liver and NAS in an animal model of non-alcoholic fatty liver disease, thereby showing that it is effective in preventing or treating non-alcoholic fatty liver disease. .

이상에서 본 발명의 바람직한 실시예에 대하여 상세하게 설명하였지만 본 발명의 권리범위는 이에 한정되는 것은 아니고 다음의 청구범위에서 정의하고 있는 본 발명의 기본 개념을 이용한 당업자의 여러 변형 및 개량 형태 또한 본 발명의 권리범위에 속하는 것이다.Although the preferred embodiment of the present invention has been described in detail above, the scope of the present invention is not limited thereto, and various modifications and improvements by those skilled in the art using the basic concept of the present invention as defined in the following claims are also provided. is within the scope of the

<110> D&D Pharmatech Inc. <120> Pharmaceutical composition for preventing or treating nonalcoholic fatty liver disease comprising a polypeptide <130> CDP2021-0668 <160> 6 <170> KoPatentIn 3.0 <210> 1 <211> 29 <212> PRT <213> Unknown <220> <223> Glucagon <400> 1 His Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Ser 1 5 10 15 Arg Arg Ala Gln Asp Phe Val Gln Trp Leu Met Asn Thr 20 25 <210> 2 <211> 30 <212> PRT <213> Artificial Sequence <220> <223> Artificial Sequence <220> <221> VARIANT <222> (2) <223> Xaa = Aib <400> 2 His Xaa Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu 1 5 10 15 Gln Ala Ala Lys Glu Phe Val Gln Trp Leu Met Asn Thr Cys 20 25 30 <210> 3 <211> 30 <212> PRT <213> Artificial Sequence <220> <223> Artificial Sequence <400> 3 His Gly Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu 1 5 10 15 Lys Arg Ala Lys Glu Phe Val Gln Trp Leu Met Asn Thr Cys 20 25 30 <210> 4 <211> 30 <212> PRT <213> Artificial Sequence <220> <223> Artificial Sequence <220> <221> VARIANT <222> (2) <223> Xaa = Aib <400> 4 His Xaa Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu 1 5 10 15 Glu Ala Val Lys Glu Phe Val Gln Trp Leu Met Asn Thr Cys 20 25 30 <210> 5 <211> 30 <212> PRT <213> Artificial Sequence <220> <223> Artificial Sequence <400> 5 His Gly Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu 1 5 10 15 Glu Ala Val Lys Glu Phe Val Gln Trp Leu Met Asn Thr Cys 20 25 30 <210> 6 <211> 30 <212> PRT <213> Unknown <220> <223> GLP-1 <400> 6 His Ala Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly 1 5 10 15 Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Arg 20 25 30 <110> D&D Pharmatech Inc. <120> Pharmaceutical composition for preventing or treating nonalcoholic fatty liver disease comprising a polypeptide <130> CDP2021-0668 <160> 6 <170> KoPatentIn 3.0 <210> 1 <211> 29 <212> PRT <213> Unknown <220> <223> Glucagon <400> 1 His Ser Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Ser 1 5 10 15 Arg Arg Ala Gln Asp Phe Val Gln Trp Leu Met Asn Thr 20 25 <210> 2 <211> 30 <212> PRT <213> Artificial Sequence <220> <223> Artificial Sequence <220> <221> VARIANT <222> (2) <223> Xaa = Aib <400> 2 His Xaa Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu 1 5 10 15 Gln Ala Ala Lys Glu Phe Val Gln Trp Leu Met Asn Thr Cys 20 25 30 <210> 3 <211> 30 <212> PRT <213> Artificial Sequence <220> <223> Artificial Sequence <400> 3 His Gly Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu 1 5 10 15 Lys Arg Ala Lys Glu Phe Val Gln Trp Leu Met Asn Thr Cys 20 25 30 <210> 4 <211> 30 <212> PRT <213> Artificial Sequence <220> <223> Artificial Sequence <220> <221> VARIANT <222> (2) <223> Xaa = Aib <400> 4 His Xaa Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu 1 5 10 15 Glu Ala Val Lys Glu Phe Val Gln Trp Leu Met Asn Thr Cys 20 25 30 <210> 5 <211> 30 <212> PRT <213> Artificial Sequence <220> <223> Artificial Sequence <400> 5 His Gly Gln Gly Thr Phe Thr Ser Asp Tyr Ser Lys Tyr Leu Asp Glu 1 5 10 15 Glu Ala Val Lys Glu Phe Val Gln Trp Leu Met Asn Thr Cys 20 25 30 <210> 6 <211> 30 <212> PRT <213> Unknown <220> <223> GLP-1 <400> 6 His Ala Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly 1 5 10 15 Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Arg 20 25 30

Claims (9)

하기 일반식 1의 아미노산 서열인 폴리펩티드; 및 삼중가지형 메톡시폴리에틸렌글리콜 말레이미드 또는 이의 유도체가 결합한 결합체를 포함하는,
비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물:
[일반식 1]
R1-X1-QGTFTSDYSKYLD-R2-EFVQWLMNT-R3
여기서,
R1은 히스티딘이고, X1은 Aib(aminoisobutyric acid)이고, R2는 EQAAK이고, R3는 시스테인이고, 상기 R2의 글루타민산(E) 및 라이신(K)은 아미드 결합으로 링을 형성한다.
a polypeptide having an amino acid sequence of the following general formula 1; And a triple-branched methoxypolyethylene glycol maleimide or a derivative thereof comprising a binding body,
Pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease:
[General formula 1]
R1-X1-QGTFTSDYSKYLD-R2-EFVQWLMNT-R3
here,
R1 is histidine, X1 is Aib (aminoisobutyric acid), R2 is EQAAK, R3 is cysteine, and glutamic acid (E) and lysine (K) of R2 form a ring by an amide bond.
제1항에 있어서,
상기 삼중가지형 메톡시폴리에틸렌글리콜 말레이미드 또는 이의 유도체는 분자량이 3,000 내지 100,000Da인,
비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물.
According to claim 1,
The triple branched methoxypolyethylene glycol maleimide or derivative thereof has a molecular weight of 3,000 to 100,000Da,
A pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease.
제 1항에 있어서,
상기 비알코올성 지방간 질환은 비알코올성 지방간, 비알코올성 지방간염, 간경변 및 간암으로 이루어진 군에서 선택되는 1종 이상인,
비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물.
The method of claim 1,
The nonalcoholic fatty liver disease is at least one selected from the group consisting of nonalcoholic fatty liver, nonalcoholic steatohepatitis, cirrhosis and liver cancer,
A pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease.
하기 일반식 1의 아미노산 서열인 폴리펩티드; 및 삼중가지형 메톡시폴리에틸렌글리콜 말레이미드 또는 이의 유도체가 결합한 결합체를 포함하는 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물의 제조방법으로,
상기 폴리펩티드 및 삼중가지형 메톡시폴리에틸렌글리콜 말레이미드 또는 이의 유도체를 혼합하여 반응시키는 단계를 포함하는 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물의 제조방법:
[일반식 1]
R1-X1-QGTFTSDYSKYLD-R2-EFVQWLMNT-R3
여기서,
R1은 히스티딘이고, X1은 Aib(aminoisobutyric acid)이고, R2는 EQAAK이고, R3는 시스테인이고, 상기 R2의 글루타민산(E) 및 라이신(K)은 아미드 결합으로 링을 형성한다.
a polypeptide having an amino acid sequence of the following general formula 1; And a method for preparing a pharmaceutical composition for the prevention or treatment of non-alcoholic fatty liver disease comprising a conjugate to which triple branched methoxypolyethylene glycol maleimide or a derivative thereof is bound,
A method for preparing a pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease, comprising reacting a mixture of the polypeptide and a triple branched methoxypolyethylene glycol maleimide or derivative thereof:
[General formula 1]
R1-X1-QGTFTSDYSKYLD-R2-EFVQWLMNT-R3
here,
R1 is histidine, X1 is Aib (aminoisobutyric acid), R2 is EQAAK, R3 is cysteine, and glutamic acid (E) and lysine (K) of R2 form a ring by an amide bond.
제4항에 있어서,
상기 폴리펩티드와 삼중가지형 메톡시폴리에틸렌글리콜 말레이미드 또는 이의 유도체를 혼합하여 반응시키는 단계는 폴리펩티드와 삼중가지형 메톡시폴리에틸렌글리콜 말레이미드 또는 이의 유도체를 1:1 내지 1:5의 몰비로 반응시키는 것인,
비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물의 제조방법.
5. The method of claim 4,
The step of mixing and reacting the polypeptide and the triple branched methoxypolyethylene glycol maleimide or derivative thereof is reacting the polypeptide with the triple branched methoxypolyethylene glycol maleimide or derivative thereof in a molar ratio of 1:1 to 1:5. sign,
A method for preparing a pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease.
제4항에 있어서,
상기 폴리펩티드와 삼중가지형 메톡시폴리에틸렌글리콜 말레이미드 또는 이의 유도체를 혼합하여 반응시키는 단계는 pH 4.0 내지 9.0에서 수행되는 것인,
비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물의 제조방법.
5. The method of claim 4,
The step of mixing and reacting the polypeptide with triple branched methoxypolyethylene glycol maleimide or a derivative thereof is carried out at a pH of 4.0 to 9.0,
A method for preparing a pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease.
제4항에 있어서,
상기 폴리펩티드와 삼중가지형 메톡시폴리에틸렌글리콜 말레이미드 또는 이의 유도체를 혼합하여 반응시키는 단계의 반응 시간은 0.5 내지 24시간인,
비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물의 제조방법.
5. The method of claim 4,
The reaction time of the step of mixing and reacting the polypeptide and the triple branched methoxypolyethylene glycol maleimide or derivative thereof is 0.5 to 24 hours,
A method for preparing a pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease.
제4항에 있어서,
상기 비알코올성 지방간 질환은 비알코올성 지방간, 비알코올성 지방간염, 간경변 및 간암으로 이루어진 군에서 선택되는 1종 이상인 것인,
비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물의 제조방법.
5. The method of claim 4,
The non-alcoholic fatty liver disease is one or more selected from the group consisting of non-alcoholic fatty liver, non-alcoholic steatohepatitis, cirrhosis and liver cancer,
A method for preparing a pharmaceutical composition for preventing or treating non-alcoholic fatty liver disease.
제1항 내지 제3항 중 어느 한 항에 따른 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물을 인간을 제외한 개체에게 투여하는 단계를 포함하는,
비알코올성 지방간 질환의 예방 또는 치료방법.


A method for preventing or treating non-alcoholic fatty liver disease according to any one of claims 1 to 3, comprising administering the pharmaceutical composition to an individual other than a human.
A method for preventing or treating nonalcoholic fatty liver disease.


KR1020210110117A 2019-05-23 2021-08-20 Pharmaceutical composition for preventing or treating nonalcoholic fatty liver disease comprising a polypeptide KR102394681B1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
KR1020210110117A KR102394681B1 (en) 2019-05-23 2021-08-20 Pharmaceutical composition for preventing or treating nonalcoholic fatty liver disease comprising a polypeptide

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR1020190060513A KR20200135618A (en) 2019-05-23 2019-05-23 Pharmaceutical composition for preventing or treating nonalcoholic fatty liver disease comprising a polypeptide
KR1020210110117A KR102394681B1 (en) 2019-05-23 2021-08-20 Pharmaceutical composition for preventing or treating nonalcoholic fatty liver disease comprising a polypeptide

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
KR1020190060513A Division KR20200135618A (en) 2018-07-19 2019-05-23 Pharmaceutical composition for preventing or treating nonalcoholic fatty liver disease comprising a polypeptide

Publications (2)

Publication Number Publication Date
KR20210110252A true KR20210110252A (en) 2021-09-07
KR102394681B1 KR102394681B1 (en) 2022-05-06

Family

ID=73779399

Family Applications (2)

Application Number Title Priority Date Filing Date
KR1020190060513A KR20200135618A (en) 2018-07-19 2019-05-23 Pharmaceutical composition for preventing or treating nonalcoholic fatty liver disease comprising a polypeptide
KR1020210110117A KR102394681B1 (en) 2019-05-23 2021-08-20 Pharmaceutical composition for preventing or treating nonalcoholic fatty liver disease comprising a polypeptide

Family Applications Before (1)

Application Number Title Priority Date Filing Date
KR1020190060513A KR20200135618A (en) 2018-07-19 2019-05-23 Pharmaceutical composition for preventing or treating nonalcoholic fatty liver disease comprising a polypeptide

Country Status (1)

Country Link
KR (2) KR20200135618A (en)

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB202001024D0 (en) * 2020-01-24 2020-03-11 Key Bioscience Ag Oxyntomodulin mimetics
KR20230162178A (en) 2022-05-20 2023-11-28 중앙대학교 산학협력단 Composition Comprising Abietic acid and Metformin for Preventing or Treating of Fatty Liver Disease
KR20240008058A (en) 2022-07-11 2024-01-18 아주대학교산학협력단 Composition for preventing, improving or treating nonalcoholic fatty liver disease comprising MS-275 or a pharmaceutically acceptable salt thereof

Citations (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7141547B2 (en) 2001-12-21 2006-11-28 Human Genome Sciences, Inc. Albumin fusion proteins comprising GLP-1 polypeptides
KR100925017B1 (en) 2001-09-07 2009-11-03 임페리얼 이노베이션스 리미티드 Oxyntomodulin for preventing or treating excess weight
KR20090118879A (en) * 2008-05-14 2009-11-18 성균관대학교산학협력단 Human growth hormone derivative linked with polyethyleneglycol, method for the preparation thereof and pharmaceutical composition comprising the same
US20110152182A1 (en) * 2009-12-22 2011-06-23 Eli Lilly And Company Oxyntomodulin peptide analogue
US8110665B2 (en) 2003-11-13 2012-02-07 Hanmi Holdings Co., Ltd. Pharmaceutical composition comprising an immunoglobulin FC region as a carrier
US8273854B2 (en) 2003-06-12 2012-09-25 Eli Lilly And Company GLP-1 analog fusion proteins
KR20120139579A (en) * 2011-06-17 2012-12-27 한미사이언스 주식회사 A conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof
KR20130008665A (en) * 2011-06-28 2013-01-23 비앤엘델리팜 주식회사 Pegylated exendin-4 analogues or its derivatives, preparation method thereof and pharmaceutical composition containing the same for preventing and treating a diabetes
JP2013545724A (en) * 2010-09-28 2013-12-26 アミリン・ファーマシューティカルズ,リミテッド・ライアビリティ・カンパニー Modified polypeptides with increased duration of action
KR20140018462A (en) * 2012-07-25 2014-02-13 한미약품 주식회사 A composition for treating hyperlipidemia comprising oxyntomodulin analog
KR20140058104A (en) * 2012-11-06 2014-05-14 한미약품 주식회사 A composition for treating diabetes or diabesity comprising oxyntomodulin analog
KR101665009B1 (en) 2012-03-09 2016-10-11 한미사이언스 주식회사 Pharmaceutical composition for the prevention or treatment of non-alcoholic fatty liver disease
KR20170003466A (en) * 2015-06-30 2017-01-09 한미약품 주식회사 Novel glucagon derivative and a composition comprising a long acting conjugate of the same

Patent Citations (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR100925017B1 (en) 2001-09-07 2009-11-03 임페리얼 이노베이션스 리미티드 Oxyntomodulin for preventing or treating excess weight
US7141547B2 (en) 2001-12-21 2006-11-28 Human Genome Sciences, Inc. Albumin fusion proteins comprising GLP-1 polypeptides
US8273854B2 (en) 2003-06-12 2012-09-25 Eli Lilly And Company GLP-1 analog fusion proteins
US8110665B2 (en) 2003-11-13 2012-02-07 Hanmi Holdings Co., Ltd. Pharmaceutical composition comprising an immunoglobulin FC region as a carrier
KR20090118879A (en) * 2008-05-14 2009-11-18 성균관대학교산학협력단 Human growth hormone derivative linked with polyethyleneglycol, method for the preparation thereof and pharmaceutical composition comprising the same
US20110152182A1 (en) * 2009-12-22 2011-06-23 Eli Lilly And Company Oxyntomodulin peptide analogue
JP2013545724A (en) * 2010-09-28 2013-12-26 アミリン・ファーマシューティカルズ,リミテッド・ライアビリティ・カンパニー Modified polypeptides with increased duration of action
KR20120139579A (en) * 2011-06-17 2012-12-27 한미사이언스 주식회사 A conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof
KR20130008665A (en) * 2011-06-28 2013-01-23 비앤엘델리팜 주식회사 Pegylated exendin-4 analogues or its derivatives, preparation method thereof and pharmaceutical composition containing the same for preventing and treating a diabetes
KR101665009B1 (en) 2012-03-09 2016-10-11 한미사이언스 주식회사 Pharmaceutical composition for the prevention or treatment of non-alcoholic fatty liver disease
KR20140018462A (en) * 2012-07-25 2014-02-13 한미약품 주식회사 A composition for treating hyperlipidemia comprising oxyntomodulin analog
KR101968344B1 (en) * 2012-07-25 2019-04-12 한미약품 주식회사 A composition for treating hyperlipidemia comprising oxyntomodulin analog
KR20140058104A (en) * 2012-11-06 2014-05-14 한미약품 주식회사 A composition for treating diabetes or diabesity comprising oxyntomodulin analog
KR20170003466A (en) * 2015-06-30 2017-01-09 한미약품 주식회사 Novel glucagon derivative and a composition comprising a long acting conjugate of the same

Also Published As

Publication number Publication date
KR102394681B1 (en) 2022-05-06
KR20200135618A (en) 2020-12-03

Similar Documents

Publication Publication Date Title
KR102394681B1 (en) Pharmaceutical composition for preventing or treating nonalcoholic fatty liver disease comprising a polypeptide
CA3014641C (en) Insulin receptor partial agonists
US10953076B2 (en) Insulin receptor partial agonists and GLP-1 analogues
EP3080150B1 (en) Exendin-4 peptide analogues as dual glp-1/gip receptor agonists
CN106715466B (en) Exendin-4 derivatives as selective glucagon receptor agonists
EP3080154B1 (en) Dual glp-1/gip receptor agonists
EP2721062B1 (en) A conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof
US20150164996A1 (en) Non-acylated exendin-4 peptide analogues
EP3080149A1 (en) Dual glp-1/glucagon receptor agonists
TW201625669A (en) Peptidic dual GLP-1/glucagon receptor agonists derived from Exendin-4
EP2934569A1 (en) Exendin-4 derivatives
CN106661096B (en) Novel exenatide analogue and application thereof
JP7499305B2 (en) Acylated GLP-1 derivatives
CN110845601B (en) GLP-1 analog peptide modified dimer with different configurations and application of preparation method thereof in treating type II diabetes
TW202014433A (en) Glucagon like peptide 1 (glp-1) fusion peptide coupled cyclic peptide tyrosine tyrosine conjugates and uses thereof
CN109248323B (en) Acylated GLP-1 derivatives
US20230103631A1 (en) Peptides as selective gip receptor agonists
WO2016198628A1 (en) Non-acylated exendin-4 derivatives as dual glp-1/glucagon receptor agonists
KR102094103B1 (en) Pharmaceutical composition for preventing or treating diabetes comprising a polypeptide
KR101990075B1 (en) Pharmaceutical composition for preventing or treating obesity comprising a polypeptide
MX2012005912A (en) Polypeptide conjugate.
CN112608378A (en) GLP-1/cholecystokinin-1 receptor dual agonists and application thereof
RU2777095C1 (en) Pharmaceutical composition including a polypeptide
US20210317178A1 (en) Pharmaceutical composition comprising polypeptide
CA3230915A1 (en) New peptides as potent and selective gip receptor agonists

Legal Events

Date Code Title Description
A107 Divisional application of patent
E902 Notification of reason for refusal
E701 Decision to grant or registration of patent right
GRNT Written decision to grant