KR20200039898A - Pharmaceutical composition for preventing or treating aging-related diseases comprising decursin derivatives - Google Patents

Pharmaceutical composition for preventing or treating aging-related diseases comprising decursin derivatives Download PDF

Info

Publication number
KR20200039898A
KR20200039898A KR1020180119264A KR20180119264A KR20200039898A KR 20200039898 A KR20200039898 A KR 20200039898A KR 1020180119264 A KR1020180119264 A KR 1020180119264A KR 20180119264 A KR20180119264 A KR 20180119264A KR 20200039898 A KR20200039898 A KR 20200039898A
Authority
KR
South Korea
Prior art keywords
formula
preventing
aging
related diseases
progerin
Prior art date
Application number
KR1020180119264A
Other languages
Korean (ko)
Other versions
KR102230488B1 (en
Inventor
박범준
송규용
오유석
이지현
윤은주
Original Assignee
(주)피알지에스앤텍
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by (주)피알지에스앤텍 filed Critical (주)피알지에스앤텍
Priority to KR1020180119264A priority Critical patent/KR102230488B1/en
Publication of KR20200039898A publication Critical patent/KR20200039898A/en
Application granted granted Critical
Publication of KR102230488B1 publication Critical patent/KR102230488B1/en

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D493/00Heterocyclic compounds containing oxygen atoms as the only ring hetero atoms in the condensed system
    • C07D493/02Heterocyclic compounds containing oxygen atoms as the only ring hetero atoms in the condensed system in which the condensed system contains two hetero rings
    • C07D493/04Ortho-condensed systems
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/335Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
    • A61K31/365Lactones
    • A61K31/366Lactones having six-membered rings, e.g. delta-lactones
    • A61K31/37Coumarins, e.g. psoralen
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00Cosmetics or similar toiletry preparations
    • A61K8/18Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/49Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds containing heterocyclic compounds
    • A61K8/4973Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds containing heterocyclic compounds with oxygen as the only hetero atom
    • A61K8/498Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds containing heterocyclic compounds with oxygen as the only hetero atom having 6-membered rings or their condensed derivatives, e.g. coumarin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61QSPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q19/00Preparations for care of the skin
    • A61Q19/08Anti-ageing preparations

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Medicinal Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Birds (AREA)
  • Gerontology & Geriatric Medicine (AREA)
  • Dermatology (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)

Abstract

The present invention relates to a novel decursin derivative and a composition for preventing or treating aging-related diseases containing the same as an active component. The novel decursin derivative exhibits excellent progerin expression inhibitory effect and lamin A binding inhibitory effect. Therefore, a compound of the present invention can be effectively used for preventing or treating aging-related diseases such as progeria etc.

Description

데커신 유도체를 유효성분으로 함유하는 노화 관련 질환 예방 또는 치료용 약학조성물{Pharmaceutical composition for preventing or treating aging-related diseases comprising decursin derivatives}Pharmaceutical composition for preventing or treating aging-related diseases comprising decursin derivatives}

본 발명은 신규한 데커신 유도체 및 이를 유효성분으로 함유하는 노화 관련 질환 예방 또는 치료용 조성물에 관한 것이다.The present invention relates to a novel dekersin derivative and a composition for preventing or treating aging-related diseases containing the same as an active ingredient.

인간의 수명이 증가함에 따라, 노화의 진행 과정에 대한 관심이 활발히 제기되고 있으나, 아직도 명확히 밝혀지지 않은 부분이 많으며, 최근 연구는 주로 인간 조로증을 대상으로 유전적 또는 분자적인 노화 메커니즘에 대해 이루어지고 있다.As the lifespan of humans increases, interest in the progress of aging has been actively raised, but there are still many undiscovered areas, and recent studies have mainly focused on genetic or molecular aging mechanisms targeting human premature ejaculation. have.

조로증 또는 허친슨 길포드 증후군(Hutchinson Gilford progria syndrome, HGPS)은 어린 아이들에게 조기 노화 현상이 나타나는 치명적이고 희귀한 유전 질환으로, 조로증을 가진 소아의 경우, 초기 유아기에는 정상적인 모습을 보이지만 약 9-24개월이 되면 심각한 성장 지연을 보이기 시작하여 결국 키가 작고 몸무게가 적게 나가는 양상을 보인다. 특징적인 얼굴형을 갖고 있으며 전신 죽상경화증, 심혈관계 질환, 뇌졸증, 고관절 탈골 등이 나타나며, 피부 아래 지방층이 손실되고, 손톱의 결함, 관절의 경질, 골격 손상 등이 나타나게 된다. 이러한 조로증 소화 환자들은 심장 질환으로 인해 보통 8-21세에 사망하며 평균 수명이 13세 정도이다.Premature ejaculation or Hutchinson Gilford progria syndrome (HGPS) is a fatal and rare genetic disorder in which premature aging occurs in young children. In children with premature ejaculation, it appears normal in early childhood but about 9-24 months When this happens, it begins to show a serious delay in growth, and eventually shows a short stature and weight loss. It has a characteristic face shape, systemic atherosclerosis, cardiovascular disease, stroke, hip dislocation, etc., fat layer under the skin is lost, nail defects, joint hardness, and skeleton damage. Patients with premature digestion of heart disease usually die from 8 to 21 years of age due to heart disease and have an average life expectancy of 13 years.

HGPS는 매우 드문 상염색체 우성 유전적 질병으로, 라민 A(Lamin A, LMN A)의 G608G의 침묵 돌연변이에 의해 발생한다. 상기 돌연변이는 새로운 절단 도너 사이트를 생성하고, 라민 A의 C-말단 도메인의 50개의 아미노산이 결실된 선택적인 절단 부위 산물인 프로게린(Progerin, Prg)을 생산한다.HGPS is a very rare autosomal dominant genetic disease caused by the silent mutation of G608G of Lamin A (LMN A). This mutation creates a new cleavage donor site and produces a selective cleavage site product, Progerin (Prg), which is deleted of 50 amino acids of the C-terminal domain of Lamin A.

프로게린의 발현은 핵막 불규칙성 또는 핵-세포질 라민 A의 감소와 같은 형태학적인 변화를 유발하며, 프로게린의 발현을 저해할 경우 핵 변형의 감소가 유발되는 바, HGPS의 주요 인자로 확인되었다.The expression of progerin causes morphological changes such as nuclear membrane irregularity or a decrease in nuclear-cytoplasmic lamin A. When inhibition of progerin expression leads to a decrease in nuclear transformation, it has been identified as a major factor in HGPS.

이에 따라, 조로증 치료 방법으로 프로게닌의 파네실화(farnesylation)를 저해시키거나, 자가포식(autophage)을 이용하여 파네실화된 라민 A를 제거하여 프로게닌을 완화시키는 방법이 있으나, 두 경우 모두 부작용 문제가 있으며 현재까지는 조로증의 근본적인 치료 방법에 대해 보고되어 있지 않다.Accordingly, there is a method of relieving progenin by inhibiting farnesylation of progenin as a method of treating premature ejaculation, or removing panesylated lamin A using autophage, but in both cases, side effects There has been no report on the underlying treatment of premature ejaculation.

한국공개특허 제2012-0106286호 (2012.09.26 공개)Korean Patent Publication No. 2012-0106286 (published on September 26, 2012)

본 발명은 프로게린과 라민 A의 결합을 억제하는 신규한 화합물을 제공하며, 상기 화합물을 유효성분으로 포함하는 조성물을 조로증과 같은 노화관련 질환 예방 또는 치료용 약학조성물로 제공하고자 한다.The present invention provides a novel compound that inhibits the binding of progerin and lamin A, and to provide a composition comprising the compound as an active ingredient as a pharmaceutical composition for preventing or treating aging-related diseases such as premature ejaculation.

본 발명은 하기 화학식 1로 표시되는 화합물 또는 이의 약학적으로 허용가능한 염을 제공한다.The present invention provides a compound represented by Formula 1 below or a pharmaceutically acceptable salt thereof.

[화학식 1][Formula 1]

Figure pat00001
Figure pat00001

본 발명은 하기 화학식 1로 표시되는 화합물 또는 이의 약학적으로 허용가능한 염을 유효성분으로 함유하는 노화 관련 질환 예방 또는 치료용 약학조성물을 제공한다.The present invention provides a pharmaceutical composition for preventing or treating aging-related diseases containing the compound represented by Formula 1 or a pharmaceutically acceptable salt thereof as an active ingredient.

[화학식 1][Formula 1]

Figure pat00002
Figure pat00002

또한, 본 발명은 하기 화학식 1로 표시되는 화합물 또는 이의 약학적으로 허용가능한 염을 포함하는 주름 예방 또는 개선용 화장료조성물을 제공한다.In addition, the present invention provides a cosmetic composition for preventing or improving wrinkles comprising a compound represented by the following Chemical Formula 1 or a pharmaceutically acceptable salt thereof.

[화학식 1][Formula 1]

Figure pat00003
Figure pat00003

본 발명에 따른 신규한 화합물은 조로증이 유도된 세포에서 우수한 프로게린 발현 및 프로게린과 라민 A의 결합 억제 효과를 나타냄에 따라, 본 발명의 화합물은 허친슨 길포드 증후군(Hutchinson Gilford progria syndrome, HGPS) 및 베르너 증후군(werner syndrome)과 같은 노화관련 질환 치료에 효과적으로 사용될 수 있으며, 또한 상기 화합물이 피부 세포의 콜라겐 생성을 증가시키는 것으로 확인됨에 따라 주름 예방 또는 개선용 화장료조성물로도 활용될 수 있다.As the novel compound according to the present invention exhibits excellent progerin expression and progerin-lamin A binding inhibitory effect in cells with premature ejaculation, the compound of the present invention is Hutchinson Gilford progria syndrome (HGPS) And it can be effectively used in the treatment of aging-related diseases such as Werner syndrome (werner syndrome), it can also be used as a cosmetic composition for preventing or improving wrinkles as it is found that the compound increases collagen production in skin cells.

도 1은 프로게린-라민 A 결합 억제 효과를 확인한 결과로,
도 1A는 JH4의 생체 내 PK 분석결과로 JH4가 복강 내 주사된 프로게리아 모델 마우스에서 노화 표현형 억제가 확인되었으나, PO 처리 시 매우 빠르게 사라지는 것이 확인된 결과이다.
도 1B는 JH4 유도체 형성을 나타낸 모식도로, 생체 내에서 빠른 분해되는 것을 억제하기 위해 곁사슬을 아미노 결합(JH010) 또는 에테르 결합(SLC-D011: D011)으로 대체하여 합성된 JH4 유도체 화합물을 확인한 결과이다.
도 1C는 JH4 유도체가 라민 A(Lamin A; LMNA) 및 프로게린 상호작용을 억제하는 효과를 확인한 결과로, 비드가 결합된 LMNA를 GFP-프로게린으로 형질전환된 293 세포 용해물과 각각의 화합물을 함께 인큐베이션하여 결합 억제 분석을 수행한 결과이다.
도 1D는 프로게린 발현 분석을 통하여 JH010의 프로게린 발현 억제효과를 확인한 결과로,각 화합물을 프로게린으로 형질전환된 293 세포에 24시간 처리하고 프로게린 발현 억제효과를 확인한 결과이다. 도 1E는 JH010이 핵 형태를 개선하고 프로게린 발현을 억제시키는 효과를 확인한 결과로, HGPS 세포 (AG03198, 10-year-old female; AG03199; 10-year-old female)와 화합물을 48시간 동안 인큐베이션한 후 프로게린(적색)을 염색한 결과 화합물들은 비정상적인 핵의 형태를 개선시켰으며, DAPI는 DNA를 의미한다.
도 1F는 JH010에 의한 H3K9me3 발현 유도 효과를 확인한 면역염색 결과로, H3K9me3 억제는 조로증 세포에서 매우 잘 알려진 마커이며 면역염색 결과, 모든 화합물은 HGPS 세포에서 H3K9me3 발현을 효과적으로 dbehg하는 결과를 나타내었다.
도 2는 JH010의 생체 내 PK 분석 결과를 나타낸 것이다.
도 3은 사람 피부 케라틴세포인 HaCaT 세포에서 JH010의 처리에 따른 콜라겐 1A 발현량을 확인한 웨스턴 블롯 분석결과를 나타내었다(A: 6시간 JH010 처리, B: 12시간 JH010 처리).
1 is a result confirming the effect of inhibiting progerin-lamin A binding,
1A is a result of confirming that aging phenotype inhibition was confirmed in the progestia model mouse in which JH4 was injected intraperitoneally as a result of in vivo PK analysis of JH4, but disappeared very rapidly during PO treatment.
1B is a schematic diagram showing the formation of JH4 derivatives, and is a result of confirming a synthesized JH4 derivative compound by replacing a side chain with an amino bond (JH010) or an ether bond (SLC-D011: D011) to inhibit rapid decomposition in vivo. .
Figure 1C is a result of confirming the effect that the JH4 derivative inhibits Lamin A (Lamin A; LMNA) and progerin interactions, 293 cell lysate transformed with beads bound to GFP-progerin and each compound It is the result of performing the binding inhibition analysis by incubation together.
1D is a result of confirming the effect of inhibiting the expression of JH010 progerin through the analysis of progerin expression, and the result of confirming the effect of inhibiting progerin expression by treating each compound in 293 cells transformed with progerin for 24 hours. 1E is a result of confirming the effect that JH010 improves nuclear morphology and inhibits progerin expression, incubating HGPS cells (AG03198, 10-year-old female; AG03199; 10-year-old female) and compounds for 48 hours. After staining progerin (red), the compounds improved the shape of the abnormal nucleus, and DAPI stands for DNA.
1F is an immunostaining result confirming the effect of inducing H3K9me3 expression by JH010, H3K9me3 inhibition is a very well-known marker in premature ejaculation cells, and immunostaining results show that all compounds effectively result in dbehg H3K9me3 expression in HGPS cells.
Figure 2 shows the results of PK analysis in vivo of JH010.
Figure 3 shows the results of Western blot analysis confirming the expression level of collagen 1A according to the treatment of JH010 in human skin keratinocytes HaCaT cells (A: 6 hours JH010 treatment, B: 12 hours JH010 treatment).

본 발명은 하기 화학식 1로 표시되는 화합물 또는 이의 약학적으로 허용가능한 염을 제공할 수 있다.The present invention can provide a compound represented by Formula 1 below or a pharmaceutically acceptable salt thereof.

[화학식 1][Formula 1]

Figure pat00004
Figure pat00004

본 발명은 하기 화학식 1로 표시되는 화합물 또는 이의 약학적으로 허용가능한 염을 유효성분으로 함유하는 노화 관련 질환 예방 또는 치료용 약학조성물을 제공할 수 있다.The present invention can provide a pharmaceutical composition for preventing or treating aging-related diseases containing the compound represented by the following formula 1 or a pharmaceutically acceptable salt thereof as an active ingredient.

[화학식 1][Formula 1]

Figure pat00005
Figure pat00005

상기 노화 관련 질환은 조로증일 수 있다. The aging-related disease may be premature ejaculation.

보다 상세하게는 상기 조로증은 베르너 증후군 및 허친슨 길포드 증후군으로 이루어진 군에서 선택될 수 있다.More specifically, the premature ejaculation may be selected from the group consisting of Werner syndrome and Hutchinson Gilford syndrome.

상기 화학식 1로 표시되는 화합물 및 이의 약학적으로 허용가능한 염은 프로게린과 라민 A간의 결합을 억제할 수 있다.The compound represented by Chemical Formula 1 and a pharmaceutically acceptable salt thereof can inhibit the binding between progerin and lamin A.

본 발명의 한 구체예에서, 상기 약학조성물은 통상적인 방법에 따라 주사제, 과립제, 산제, 정제, 환제, 캡슐제, 좌제, 겔, 현탁제, 유제, 점적제 또는 액제로 이루어진 군에서 선택된 어느 하나의 제형을 사용할 수 있다.In one embodiment of the present invention, the pharmaceutical composition is any one selected from the group consisting of injections, granules, powders, tablets, pills, capsules, suppositories, gels, suspensions, emulsions, drops or liquids according to conventional methods. Can be used.

본 발명의 다른 구체예에서, 약학조성물은 약학조성물의 제조에 통상적으로 사용하는 적절한 담체, 부형제, 붕해제, 감미제, 피복제, 팽창제, 윤활제, 활택제, 향미제, 항산화제, 완충액, 정균제, 희석제, 분산제, 계면활성제, 결합제 및 윤활제로 이루어진 군에서 선택되는 하나 이상의 첨가제를 추가로 포함할 수 있다.In another embodiment of the present invention, the pharmaceutical composition is a suitable carrier, excipient, disintegrant, sweetener, coating agent, swelling agent, lubricant, lubricant, flavoring agent, antioxidant, buffer, bacteriostatic agent, commonly used in the manufacture of a pharmaceutical composition, It may further include one or more additives selected from the group consisting of diluents, dispersants, surfactants, binders and lubricants.

구체적으로 담체, 부형제 및 희석제는 락토즈, 덱스트로즈, 수크로스, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 미정질 셀룰로스, 폴리비닐 피롤리돈, 물, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 탈크, 마그네슘 스테아레이트 및 광물유를 사용할 수 있으며, 경구투여를 위한 고형제제에는 정제, 환제, 산제, 과립제, 캡슐제 등이 포함되며, 이러한 고형제제는 상기 조성물에 적어도 하나 이상의 부형제, 예를 들면, 전분, 칼슘카보네이트, 수크로스 또는 락토오스, 젤라틴 등을 섞어 조제할 수 있다. 또한 단순한 부형제 이외에 마그네슘 스티레이트, 탈크 같은 윤활제들도 사용할 수 있다. 경구를 위한 액상제제로는 현탁제, 내용액제, 유제, 시럽제 등이 있으며 흔히 사용되는 단순 희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다. 비경구 투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조제제, 좌제 등이 포함된다. 비수성용제, 현탁제로는 프로필렌글리콜, 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다. 좌제의 기재로는 위텝솔(witepsol), 마크로골, 트윈(tween) 61, 카카오지, 라우린지, 글리세로제라틴 등이 사용될 수 있다.Specifically, carriers, excipients and diluents are lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia rubber, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, microcrystalline Cellulose, polyvinyl pyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate and mineral oil can be used, and solid dosage forms for oral administration include tablets, pills, powders, granules and capsules. Agents, and the like, and these solid preparations may be prepared by mixing at least one excipient in the composition, for example, starch, calcium carbonate, sucrose or lactose, gelatin, and the like. In addition, lubricants such as magnesium stearate and talc may be used in addition to simple excipients. Liquid preparations for oral use include suspending agents, intravenous solutions, emulsions, syrups, etc. In addition to water and liquid paraffin, which are commonly used simple diluents, various excipients, such as wetting agents, sweeteners, fragrances, and preservatives, may be included. Formulations for parenteral administration include sterile aqueous solutions, non-aqueous solvents, suspensions, emulsions, lyophilized preparations, suppositories, and the like. Non-aqueous solvents and suspensions may include propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable esters such as ethyl oleate. As a base for suppositories, witepsol, macrogol, tween 61, cacao butter, laurin butter, and glycerogelatin may be used.

본 발명의 일실시예에 따르면 상기 약학 조성물은 정맥내, 동맥내, 복강내, 근육내, 동맥내, 복강내, 흉골내, 경피, 비측내, 흡입, 국소, 직장, 경구, 안구내 또는 피내 경로를 통해 통상적인 방식으로 대상체로 투여할 수 있다.According to an embodiment of the present invention, the pharmaceutical composition is intravenous, intraarterial, intraperitoneal, intramuscular, intraarterial, intraperitoneal, intrasternal, transdermal, intranasal, inhalation, topical, rectal, oral, intraocular or intradermal. Routes can be administered to a subject in a conventional manner.

상기 화학식 1로 표시되는 화합물의 바람직한 투여량은 대상체의 상태 및 체중, 질환의 종류 및 정도, 약물 형태, 투여경로 및 기간에 따라 달라질 수 있으며 당업자에 의해 적절하게 선택될 수 있다. 본 발명의 일실시예에 따르면 이에 제한되는 것은 아니지만 1일 투여량이 0.01 내지 200 mg/kg, 구체적으로는 0.1 내지 200 mg/kg, 보다 구체적으로는 0.1 내지 100 mg/kg 일 수 있다. 투여는 하루에 한 번 투여할 수도 있고 수회로 나누어 투여할 수도 있으며, 이에 의해 본 발명의 범위가 제한되는 것은 아니다.The preferred dosage of the compound represented by Formula 1 may vary depending on the condition and weight of the subject, the type and extent of the disease, the drug form, the route and duration of administration, and may be appropriately selected by those skilled in the art. According to one embodiment of the present invention is not limited thereto, the daily dosage may be 0.01 to 200 mg / kg, specifically 0.1 to 200 mg / kg, and more specifically 0.1 to 100 mg / kg. The administration may be administered once a day or divided into several times, and the scope of the present invention is not limited thereby.

본 발명에 있어서, 상기 '대상체'는 인간을 포함하는 포유동물일 수 있으나, 이들 예에 한정되는 것은 아니다.In the present invention, the 'subject' may be a mammal, including a human, but is not limited to these examples.

또한, 본 발명은 하기 화학식 1로 표시되는 화합물 또는 이의 약학적으로 허용가능한 염을 포함하는 주름 예방 또는 개선용 화장료조성물을 제공할 수 있다.In addition, the present invention can provide a cosmetic composition for preventing or improving wrinkles comprising a compound represented by the following Chemical Formula 1 or a pharmaceutically acceptable salt thereof.

[화학식 1][Formula 1]

Figure pat00006
Figure pat00006

상기 화학식 1로 표시되는 화합물 및 이의 약학적으로 허용가능한 염은 케라틴세포 및 섬유아세포에서 콜라겐 생성을 향상시킬 수 있다.The compound represented by Formula 1 and a pharmaceutically acceptable salt thereof may improve collagen production in keratinocytes and fibroblasts.

상기 화장료조성물은 유효성분인 화학식 1로 표시되는 화합물 외에 안정화제, 용해화제, 비타민, 안료 및 향료와 같은 통상적인 보조제, 그리고 담체를 포함할 수 있다.The cosmetic composition may include a stabilizing agent, a solubilizing agent, a common auxiliary agent such as vitamins, pigments and fragrances, and a carrier in addition to the compound represented by Chemical Formula 1 as an active ingredient.

상기 화장료 조성물은 당업계에서 통상적으로 제조되는 어떠한 제형으로도 제조될 수 있으며, 예를 들어, 용액, 현탁액, 유탁액, 페이스트, 겔, 크림, 로션, 파우더, 오일, 분말 파운데이션, 유탁액 파운데이션, 왁스 파운데이션 및 스프레이 등으로 제형화될 수 있으나, 이에 한정되는 것은 아니다. 보다 상세하게는, 썬 크림, 유연 화장수, 수렴 화장수, 영양 화장수, 영양 크림, 마사지 크림, 에센스, 아이 크림, 팩, 스프레이 또는 파우더의 제형으로 제조될 수 있다.The cosmetic composition may be prepared in any formulation conventionally prepared in the art, for example, solutions, suspensions, emulsions, pastes, gels, creams, lotions, powders, oils, powder foundations, emulsion foundations, It may be formulated as a wax foundation and spray, but is not limited thereto. More specifically, it can be prepared in the form of a sun cream, soft lotion, converging lotion, nutrition lotion, nutrition cream, massage cream, essence, eye cream, pack, spray or powder.

상기 제형이 페이스트, 크림 또는 겔인 경우에는 담체 성분으로서 동물성유, 식물성유, 왁스, 파라핀, 전분, 트라칸트, 셀룰로오스 유도체, 폴리에틸렌 글리콜,실리콘, 벤토나이트, 실리카, 탈크 또는 산화아연 등이 이용될 수 있다.When the formulation is a paste, cream or gel, animal oil, vegetable oil, wax, paraffin, starch, tracant, cellulose derivative, polyethylene glycol, silicon, bentonite, silica, talc or zinc oxide may be used as a carrier component. .

상기 제형이 파우더 또는 스프레이인 경우에는 담체 성분으로서 락토스, 탈크, 실리카, 알루미늄 히드록시드, 칼슘 실리케이트 또는 폴리아미드 파우더가 이용될 수 있고, 특히 스프레이인 경우에는 추가적으로 클로로플루오로히드로카본, 프로판/부탄 또는 디메틸 에테르와 같은 추진체를 포함할 수 있다.When the formulation is a powder or a spray, lactose, talc, silica, aluminum hydroxide, calcium silicate, or polyamide powder may be used as a carrier component. In particular, in the case of a spray, additionally chlorofluorohydrocarbon, propane / butane Or propellants such as dimethyl ether.

상기 제형이 용액 또는 유탁액인 경우에는 담체 성분으로서 용매, 용해 화제 또는 유탁화제가 이용되고, 예컨대 물, 에탄올, 이소프로판올, 에틸 카보네이트, 에틸 아세테이트, 벤질 알코올, 벤질 벤조에이트, 프로필렌 글리콜, 1,3-부틸글리콜 오일, 글리세롤 지방족 에스테르, 폴리에틸렌 글리콜 또는 소르비탄의 지방산 에스테르가 있다.When the formulation is a solution or emulsion, a solvent, solubilizer or emulsifier is used as a carrier component, such as water, ethanol, isopropanol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3 -Fatty acid esters of butyl glycol oil, glycerol aliphatic esters, polyethylene glycol or sorbitan.

상기 제형이 현탁액인 경우에는 담체 성분으로서 물, 에탄올 또는 프로필렌글리콜과 같은 액상의 희석제, 에톡실화 이소스테아릴 알코올, 폴리옥시에틸렌 소르비톨 에스테르 및 폴리옥시에틸렌 소르비탄 에스테르와 같은 현탁제, 미소결정성 셀룰로오스, 알루미늄 메타히드록시드, 벤토나이트, 아가 또는 트라칸트 등이 이용될 수 있다.When the formulation is a suspension, liquid diluents such as water, ethanol or propylene glycol as carrier components, ethoxylated isostearyl alcohol, suspensions such as polyoxyethylene sorbitol esters and polyoxyethylene sorbitan esters, microcrystalline cellulose , Aluminum metahydroxide, bentonite, agar or trakant, and the like.

이하, 본 발명의 이해를 돕기 위하여 실시예를 들어 상세하게 설명하기로 한다. 다만 하기의 실시예는 본 발명의 내용을 예시하는 것일 뿐 본 발명의 범위가 하기 실시예에 한정되는 것은 아니다. 본 발명의 실시예는 당업계에서 평균적인 지식을 가진 자에게 본 발명을 보다 완전하게 설명하기 위해 제공되는 것이다.Hereinafter, examples will be described in detail to help understanding of the present invention. However, the following examples are merely illustrative of the contents of the present invention, and the scope of the present invention is not limited to the following examples. The embodiments of the present invention are provided to more fully describe the present invention to those skilled in the art.

<< 참고예Reference example > 물질 및 장비> Materials and equipment

1H 및 13C NMR 스펙트럼은 JNM-AL 400 spectrometer (400MHz, JEOL, Japan)를 이용하여 측정되었고, 녹는점 (Melting point)은 Electrotheramal melting point apparatus (Yamaco. MD-S3)에서, 질량분석을 위한 기기로는 API 2000 LC/MS/MS spectrometer(PE Sciex, Canada)를 각각 사용하여 수행하였다. 1 H and 13 C NMR spectra were measured using a JNM-AL 400 spectrometer (400 MHz, JEOL, Japan), and the melting point was measured for mass spectrometry in an Electrotheramal melting point apparatus (Yamaco.MD-S3). The instrument was performed using an API 2000 LC / MS / MS spectrometer (PE Sciex, Canada), respectively.

또한, 편광도 (Optical rotations)는 JASCO DIP-360 automatic digital polarimeter에서 측정되었으며, 카이랄 물질에 대한 순도측정은 HPLC (Shimadzu LC-6AD, Japan), 컬럼(CHIRACEL OD-H 0.46cmф x 25cm, DAICEL CHEMICAL IND., Co. Osaka, Japan)을 사용하여 측정하였다. In addition, the optical rotations were measured on a JASCO DIP-360 automatic digital polarimeter, and the purity of chiral materials was measured by HPLC (Shimadzu LC-6AD, Japan), column (CHIRACEL OD-H 0.46 cmф x 25 cm, DAICEL CHEMICAL IND., Co. Osaka, Japan).

물질 분리를 위한 실리카겔(Silica gel)은 SiliaFlash®P60 (SILICYCLE, 230~400mesh)를 사용하였으며, 박막 TLC 판은 TLC silica gel 60 F254 (MERCK) 제품을 사용하였다. Silica gel for material separation was used as SiliaFlash® P60 (SILICYCLE, 230 ~ 400 mesh), and TLC silica gel 60 F254 (MERCK) product was used as the thin film TLC plate.

물질의 합성에 사용된 용매와 시약은 Sigma-Aldrich, Fluka, TCI, Junsei, Duksan pure chemical, SK Chemical 및 SAMCHUN chemical 사에서 Reagent 등급을 구입하여 사용하였다. The solvents and reagents used for the synthesis of the materials were purchased from Sigma-Aldrich, Fluka, TCI, Junsei, Duksan pure chemical, SK Chemical and SAMCHUN chemical, and used.

<< 실시예Example 1> 카바메이트형(Carbamate-form)의 (+)- 1> Carbamate-form (+)- 데커신Deckersin (( decursindecursin ) 유도체 합성[(7S)-(+)-(E)-2-(Pyridin-3-yl)ethenyl carbamic acid, 8,8-dimethyl-2-oxo-6,7-dihydro-) Synthesis of derivatives [(7S)-(+)-(E) -2- (Pyridin-3-yl) ethenyl carbamic acid, 8,8-dimethyl-2-oxo-6,7-dihydro- 2H,8H2H, 8H -pyrano[3,2--pyrano [3,2- gg ]chromen-7-yl-ester; JH010]] chromen-7-yl-ester; JH010]

하기 반응식 1과 같은 공정으로 JH010을 합성하였다.JH010 was synthesized in the same manner as in Scheme 1 below.

1. 합성과정 Ⅰ1. Synthesis process Ⅰ

[반응식 1][Scheme 1]

Figure pat00007
Figure pat00007

a. dry 벤젠, TEA, DPPA, 3hr; b. dry 벤젠, 환류, 5hr; c. TEA, 4-DMAP, 100℃, 3hr, 53%a. dry benzene, TEA, DPPA, 3hr; b. dry benzene, reflux, 5 hr; c. TEA, 4-DMAP, 100 ℃, 3hr, 53%

라운드 플라스크에 트랜스-3-(3-피리딜)아크릴산 (화합물 1, 1.5eq)를 Dry 벤젠에 용해시킨 후 트리에틸아민(TEA, 1.5eq), 디페닐 포스포릴 아자이드(DPPA, 1.5eq)을 넣고 80℃에서 3시간 반응시켰다. 물과 에틸아세테이트(EA)로 추출한 다음 소듐 설페이트(sodium sulfate)로 물을 제거한 후 감압 농축한 조 산물(crude product)를 다시 dry 벤젠에 녹여 80℃에서 하루 가열환류 시켰다. 여기에 (+)-데커시놀(화합물 4, 1eq)을 넣고 트리에틸아민(TEA, 1.2eq), 4-(디메틸아미노)피리딘(DMAP, 0.4eq)을 넣고 100℃에서 3시간 반응시켰다. 반응 용액을 감압 농축하여 얻은 잔사를 헥산과 에틸아세테이트를 이동상으로 하여 실리카겔 컬럼 분리를 통하여 정제하여 JH010을 얻었다. After dissolving trans-3- (3-pyridyl) acrylic acid (Compound 1, 1.5eq) in dry benzene in a round flask, triethylamine (TEA, 1.5eq), diphenyl phosphoryl azide (DPPA, 1.5eq) Was added and reacted at 80 ° C for 3 hours. After extracting with water and ethyl acetate (EA), and then removing water with sodium sulfate, the crude product concentrated under reduced pressure was dissolved in dry benzene again and heated to reflux at 80 ° C for a day. To this, (+)-deckersinol (Compound 4, 1eq) was added, triethylamine (TEA, 1.2eq), and 4- (dimethylamino) pyridine (DMAP, 0.4eq) were added and reacted at 100 ° C for 3 hours. The residue obtained by concentrating the reaction solution under reduced pressure was purified by silica gel column separation using hexane and ethyl acetate as mobile phases to obtain JH010.

Yield=53.0%; ivory-white solid, mp: 125.9℃, Rf = 0.12 (n-HX:EA=1:2);

Figure pat00008
+138.5667 (c=3, CHCl3); 1H NMR(400MHz, DMSO-d6): 10.038(d, J=10.4Hz, NH), 8.446(s, 1H), 8.301(dd, J=1.2, 4.8Hz, 1H), 7.923(d, J=9.6Hz, 1H), 7.756(d, J=7.6Hz, 1H), 7.498(s, 1H), 7.250(m, 2H), 6.809(s, 1H), 6.268(d, J=9.6Hz, 1H), 6.009(d, J=14.8Hz, 1H), 5.069(t, J=3.6Hz, 1H), 3.265(dd, J=4.4, 18.0Hz, 1H), 2.928(dd, J=3.2, 17.6Hz, 1H), 1.393(s, CH3), 1.323(s, CH3); IT-TOF/MS 415.1281[M+Na]+.Yield = 53.0%; ivory-white solid, mp: 125.9 ° C, Rf = 0.12 (n-HX: EA = 1: 2);
Figure pat00008
+138.5667 (c = 3, CHCl 3 ); 1 H NMR (400 MHz, DMSO-d6): 10.038 (d, J = 10.4 Hz, NH), 8.446 (s, 1H), 8.301 (dd, J = 1.2, 4.8 Hz, 1H), 7.923 (d, J = 9.6Hz, 1H), 7.756 (d, J = 7.6Hz, 1H), 7.498 (s, 1H), 7.250 (m, 2H), 6.809 (s, 1H), 6.268 (d, J = 9.6Hz, 1H) , 6.009 (d, J = 14.8Hz, 1H), 5.069 (t, J = 3.6Hz, 1H), 3.265 (dd, J = 4.4, 18.0Hz, 1H), 2.928 (dd, J = 3.2, 17.6Hz, 1H), 1.393 (s, CH3), 1.323 (s, CH3); IT-TOF / MS 415.1281 [M + Na] + .

<< 실시예Example 2>  2> 라민Lamin A( A ( LMNLMN A)- A)- 프로게린Progestin 결합 억제제로서 JH010의 효과 확인 Confirming the effect of JH010 as a binding inhibitor

1. 동물실험1. Animal Experiment

동물실험은 부산국립대학교에서 승인받은 동물 정책에 따라, 인증 평가 협회 및 실험실 동물 관리 인증 기관에서 수행되었다.Animal experiments were conducted by accreditation assessment associations and laboratory animal care accreditation bodies, in accordance with animal policies approved by Pusan National University.

Carlos Lopez-Otin (Universidad de Oviedo, Asturias, Oviedo, Spain)에서 제공받은 이형접합 Lmna+/ G609G의 적절한 교배를 통하여 LmnaG609G /609G 생쥐를 발생시켰다.Lmna G609G / 609G mice were generated through appropriate mating of heterozygous Lmna + / G609G provided by Carlos Lopez-Otin (Universidad de Oviedo, Asturias, Oviedo, Spain).

DMOS 및 PBS와 혼합한 JH010 또는 SLC-D011 20 mg/kg을 5주령 생쥐에 일주일에 두 번 복강내 주사하였다. 또한, 올레인 기반의 용액에 10mg/ml 농도로 용해시킨 JH010 또는 SLC-D011을 일주일에 5번 생쥐에 경구투여하였으며, 대조군 생쥐는 상기와 동일한 조건으로 올레인 기반 용액만 투여하였다.20 mg / kg of JH010 or SLC-D011 mixed with DMOS and PBS was injected intraperitoneally twice a week into 5 week old mice. In addition, JH010 or SLC-D011 dissolved in an olein-based solution at a concentration of 10 mg / ml was orally administered to mice 5 times a week, and the control mice were administered only an olein-based solution under the same conditions as above.

LmnaG609G /609G 생쥐는 5주령부터 투여를 시작하였으며, 수명 내내 신선한 화합물 용액을 처리하였다. Lmna+/G609G 생쥐는 32주령부터 복강내 처리를 시작하였다. Lmna G609G / 609G mice began administration at 5 weeks of age and treated with fresh compound solutions throughout their lifetime. Lmna + / G609G mice started intraperitoneal treatment at 32 weeks of age.

2. 세포 배양 및 시약2. Cell culture and reagents

HGPS 환자(AG03198, 10-year-old female; AG03199; 10-year-old female), WS patients (AG06300, 37-year-old male; AG03141, 30-year-old female; AG00780, 60-year-old male) 및 대조군(GM 00038, 9-year-old female)의 사람 섬유아 세포를 Coriell Cell Repositories (Camden, New Jersey, USA)로부터 얻었으며, 15% FBS, 2 mM 글루타민이 포함된 EMEM 배지 또는 항생제 없이 26 mM HEPES가 포함된 HEMEM에서 유지시켰다.HGPS patients (AG03198, 10-year-old female; AG03199; 10-year-old female), WS patients (AG06300, 37-year-old male; AG03141, 30-year-old female; AG00780, 60-year-old male) and control (GM 00038, 9-year-old female) human fibroblasts were obtained from Coriell Cell Repositories (Camden, New Jersey, USA), 15% FBS, EMEM medium containing 2 mM glutamine or antibiotic In HEMEM with 26 mM HEPES.

HEK293 세포 주는 ATCC에서 얻었으며, 10% FBS 및 1% 항생제가 포함된 DMEM 액체 배지를 이용하여 37℃에서 유지되었다.The HEK293 cell line was obtained from ATCC and maintained at 37 ° C. using DMEM liquid medium containing 10% FBS and 1% antibiotic.

3. 항체 및 시약3. Antibodies and reagents

GFP (Full name; 1:1000; sc-9996; Santa Cruz Biotechnology); 글루타티온 S-전이효소(Glutathione S-transferase; GST; 1:5000; sc-138; Santa Cruz Biotechnology); 액틴 (Actin; 1:10000; sc-47778; Santa Cruz Biotechnology); 라민 A/C (Lamin A/C; 1:10000; sc-376248; Santa Cruz Biotechnology); 프로게린 (Progerin; 1:300; sc-81611; Santa Cruz Biotechnology); 프로게린 (1:300; ab66587; Abcam); H3K9me3 (1;2000; Ab8898; Abcam)와 같은 항체를 실험에 사용하였다. GFP (Full name; 1: 1000; sc-9996; Santa Cruz Biotechnology); Glutathione S-transferase (Glutathione S-transferase; GST; 1: 5000; sc-138; Santa Cruz Biotechnology); Actin (Actin; 1: 10000; sc-47778; Santa Cruz Biotechnology); Lamin A / C (Lamin A / C; 1: 10000; sc-376248; Santa Cruz Biotechnology); Progerin (Progerin; 1: 300; sc-81611; Santa Cruz Biotechnology); Progerin (1: 300; ab66587; Abcam); Antibodies such as H3K9me3 (1; 2000; Ab8898; Abcam) were used in the experiment.

4. 재조합 단백질4. Recombinant protein

재조합 단백질을 생산하기 위해, PCR을 통하여 종결 코돈의 업스트림으로부터 100 AA의 클로닝하여 재조합 라민 A C-말단 영역(Lamin A-C) 및 프로게린 C-말단 영역(Progerin C)을 생산하였다.To produce a recombinant protein, 100 AA was cloned from the upstream of the termination codon via PCR to produce a recombinant lamin A C-terminal region (Lamin A-C) and a progerin C-terminal region (Progerin C).

WRN-R1 영역(hWRN 424-450) 및 WRN-R2 영역(hWRN 424-476)을 유사한 방법으로 생산하였다. 각 단편을 GSH-아가로스에 로딩한 후, 광범위하게 세척하고 20 mM 환원된 글루타티온이 함유된 버퍼를 이용하여 용출시켰다.The WRN-R1 region (hWRN 424-450) and WRN-R2 region (hWRN 424-476) were produced in a similar manner. After loading each fragment to GSH-agarose, it was washed extensively and eluted with a buffer containing 20 mM reduced glutathione.

용출된 단편을 음이온 교환 크로마토그래피(HitrapQ)를 이용하여 추가 정제하여 하기와 같은 WRN-R1 및 WRN-R2 아미노산 서열을 얻었다.The eluted fragments were further purified using anion exchange chromatography (HitrapQ) to obtain the following WRN-R1 and WRN-R2 amino acid sequences.

WRN-R1: HLSPNDNENDTSYVIESDEDELEMEMLKWRN-R1: HLSPNDNENDTSYVIESDEDELEMEMLK

WRN-R2: HLSPNDNENDTSYVIESDEDELEMEMLK HLSPNDNENDTSYVIESDEDELEMEMLKWRN-R2: HLSPNDNENDTSYVIESDEDELEMEMLK HLSPNDNENDTSYVIESDEDELEMEMLK

5. 5. 웨스턴Western 블롯Blot 분석 analysis

RIPA를 이용하여 전체 세포 용해물을 준비하였다.Whole cell lysates were prepared using RIPA.

15 ㎍ 세포 추출물을 SDS-PAGE에서 분리시키고 PVDF 막 위로 옮겼다.15 μg cell extract was isolated on SDS-PAGE and transferred onto PVDF membrane.

막을 1차 항체와 함께 1시간 내지 하룻밤 동안 4℃에서 인큐베이션한 후 이차 항체를 이용하여 실온에서 1시간 동안 반응시켰다.The membrane was incubated with the primary antibody for 1 hour to overnight at 4 ° C. and then reacted for 1 hour at room temperature using the secondary antibody.

ECL 키트(Intron, Seoul, Korea)를 사용하여 제조사의 설명서에 따라, 화학 발광으로 페록시다아제 활성을 확인하였다.Peroxidase activity was confirmed by chemiluminescence according to the manufacturer's instructions using the ECL kit (Intron, Seoul, Korea).

6. 단백질-단백질 상호작용 분석6. Protein-protein interaction analysis

단백질-단백질 상호작용을 분석하기 위해, 글루타티온 S-전이효소(Glutathione S-transferase; GST) 면역 침강(pull-down) 분석을 수행하였다. To analyze protein-protein interactions, glutathione S-transferase (GST) immune pull-down analysis was performed.

상호작용을 검출하기 위해, GST-기반 융합 라민 A-C-말단 영역, 프로게린-C-말단 영역, WRN-R1 영역 또는 WRN-R2 영역을 GFP 태그된 프로게린(GFP-Progerin) 및 라민 A(GFP-Lamin A)가 형질주입된 HEK293 세포 용해물과 실온에서 30분간 인큐베이션하였다. To detect the interaction, GST-based fused lamin AC-terminal region, progerin-C-terminal region, WRN-R1 region or WRN-R2 region are GFP-tagged progerin (GFP-Progerin) and lamin A (GFP) HEK293 cell lysate transfected with -Lamin A) was incubated at room temperature for 30 minutes.

그 후, PBS로 1회 세척하고, 침전된 물질을 수집하여 SDS-PAGE에서 분리시킨 후 항-GFP 및 GST로 웨스턴 블롯을 수행하였다. Then, washed once with PBS, the precipitated material was collected and separated on SDS-PAGE, followed by western blot with anti-GFP and GST.

프로게린과 라민 A 결합에 대한 WRN-R1 및 R2의 경쟁반응을 확인하기 위해, WRN-R1 또는 R2 재조합 단백질이 존재하거나 존재하지 않는 조건에서 GST-프로게린이 결합된 비드를 GFP-라민 A가 과발현된 293 용해물과 인큐베이션하였다.In order to confirm the competitive response of WRN-R1 and R2 to prominin and lamin A binding, GFP-ramine A was used for GST-progerin-coupled beads in the presence or absence of WRN-R1 or R2 recombinant protein. Incubated with overexpressed 293 lysate.

7. 7. 면역형광Immunofluorescence 염색 및 노화 특이적 산성의 β-갈락토시다아제 활성 염색 Staining and aging specific acid β-galactosidase activity staining

세포를 커버 글라스 위에 접종하고 적절한 벡터를 형질주입하였다.Cells were inoculated onto the cover glass and appropriate vectors were transfected.

100% 메탄올 또는 1% 파라포름알데하이드(PFA)를 이용하여 4℃에서 1시간 동안 고정시킨 후 세포를 블로킹 버퍼(PBS+anti-human-Ab; 1:400)로 인큐베이트하였다. After fixing for 1 hour at 4 ° C using 100% methanol or 1% paraformaldehyde (PFA), the cells were incubated with a blocking buffer (PBS + anti-human-Ab; 1: 400).

PBS로 두 번 세척한 후, 항-라민 A/C, 프로게린 또는 H3K9Me3를 블로킹 버퍼에 1:200으로 희석하여 세포와 하룻밤 동안 인큐베이트하고 연속하여 항-고트 Ab-FITC 또는 항-래빗 Ab-로다민(rhodamin)이 포함된 블로킹 버퍼(1:500)를 7시간 동안 인큐베이션하였으며, 핵은 DAPI로 염색하였다. 그 후 fluorescence microscopy (Zeiss and Logos)를 이용하여 면역 형광 신호를 검출하였다. After washing twice with PBS, anti-lamin A / C, progerin or H3K9Me3 was diluted 1: 200 in blocking buffer overnight, incubated with cells overnight and subsequently anti-goat Ab-FITC or anti-rabbit Ab- Blocking buffer (1: 500) containing rhodamine (rhodamin) was incubated for 7 hours, and nuclei were stained with DAPI. Thereafter, immunofluorescence signals were detected using fluorescence microscopy (Zeiss and Logos).

노화 특이적 산성-β-갈락토시다아제 활성 염색을 위해, 세포를 PBS (pH 7.2)로 한 번 세척하고 0.5% 글루타르알데하이드가 포함된 PBS로 고정하였다. For aging specific acid-β-galactosidase activity staining, cells were washed once with PBS (pH 7.2) and fixed with PBS containing 0.5% glutaraldehyde.

그 후 PBS로 세척하고 37℃에서 세포를 X-gal 용액으로 하룻밤 동안 염색하였다. Then washed with PBS and cells were stained overnight with X-gal solution at 37 ° C.

8. 8. 플라즈마plasma 형질주입 및 단백질 운반 Transfection and protein transport

GFP-프로게린 및 GFP-융합 라민 A 발현 벡터를 T. Misteli (National Cancer Institute [NCI], Bethesda, Maryland, USA)에게서 제공받았으며, Myc-사람 WRN 벡터 및 Myc-마우스 WRN 벡터는 Addgene에서 구입하였다. GFP-progerin and GFP-fusion lamin A expression vectors were provided by T. Misteli (National Cancer Institute [NCI], Bethesda, Maryland, USA), Myc-human WRN vector and Myc-mouse WRN vector were purchased from Addgene. .

jetPEI (Polyplus Transfection) 및 PULSin (Polyplus Transfection, New York, USA)를 이용하여 제조사의 설명서에 따라, 형질주입을 수행하였다.Transfection was performed according to the manufacturer's instructions using jetPEI (Polyplus Transfection) and PULSin (Polyplus Transfection, New York, USA).

WRN-R1 및 R2 단백질을 HGPS 세포 내로 전달하기 위해, 제조사의 설명서에 따라 PULSin (Polyplus Transfection, New York, USA)를 사용하였다.To deliver WRN-R1 and R2 proteins into HGPS cells, PULSin (Polyplus Transfection, New York, USA) was used according to the manufacturer's instructions.

20 mM Hepes 200 ㎕으로 재조합 단백질(2 ㎍)를 희석한 후 PULSin 시약(8 ㎕)를 첨가하였다. 상기 혼합물을 실온에서 15분간 인큐베이트한 후 세포를 첨가하였다. 3시간 후 무혈청 배지를 10% FBS가 포함된 배지로 교체하고 4시간 인큐베이션하였다. 그 후 배지가 포함된 혼합물을 웰에서 제거하고 혈청이 포함된 신선한 배지를 채웠다.After diluting the recombinant protein (2 μg) with 200 μl of 20 mM Hepes, PULSin reagent (8 μl) was added. Cells were added after the mixture was incubated for 15 minutes at room temperature. After 3 hours, the serum-free medium was replaced with a medium containing 10% FBS and incubated for 4 hours. The medium-containing mixture was then removed from the wells and fresh medium containing serum was filled.

9. 세포 계수9. Cell count

기형의 핵을 가진 세포를 계수하기 위해, 획득된 면역 형광 이미지를 사용하였다. 라민 A 염색 의존적으로 기형으로 보이는 핵막을 무작위로 선택된 구역에서 계수하고 계수된 세포를 백분율로 나타내었다. To count cells with malformed nuclei, acquired immunofluorescence images were used. Nuclear membranes that appeared to be malformed dependent on Lamin A staining were counted in randomly selected areas and the counted cells were expressed as a percentage.

세포 증식을 측정하기 위해, DAPI 염색된 세포를 면역 형광 이미지에서 계수하였다.To measure cell proliferation, DAPI stained cells were counted in immunofluorescence images.

10. 화합물 약동학(10. Compound pharmacokinetics pharmacokineticpharmacokinetic ; PK) 분석 및 in vitro ; PK) analysis and in vitro ADMEADME 확인 Confirm

약동학(PK) 분석을 위해 JH4 5mg/kg을 용해시킨 10% DMSO, 5% Tween 90 및 95% 생리식염수 용액을 복강내 주사하였으며, JH4 10mg/kg을 용해시킨 10% NMP 및 90% PEG400 용액을 경구 투여하였다. 정해진 시간마다 JH4의 혈액 농도를 LC-MS/MS로 분석하였으며, 다른 화합물들 역시 동일한 과정으로 PK 분석하였다.For pharmacokinetic (PK) analysis, 10% DMSO, 5% Tween 90 and 95% physiological saline solution in which JH4 was dissolved at 5 mg / kg was injected intraperitoneally, and 10% NMP and 90% PEG400 solution in which JH4 was dissolved at 10 mg / kg was added. It was administered orally. The blood concentration of JH4 was analyzed by LC-MS / MS every predetermined time, and other compounds were also PK analyzed in the same process.

In vitro ADME 연구(플라즈마 단백질 결합, CYP 억제, 마이크로솜(microsomal) 안정성, 플라즈마 안정성 및 hERG 억제)는 표준 방법으로 신규 약물 개발 센터에서 수행되었다. In vitro ADME studies (plasma protein binding, CYP inhibition, microsomal stability, plasma stability and hERG inhibition) were performed in a new drug development center by standard methods.

11. 11. 프로게린Progestin -- 라민Lamin A 결합 억제제로서의 JH010 효과 확인 Confirming the effect of JH010 as A binding inhibitor

허친슨 길포드 증후군은 잘 알려진 프로게린 증후군으로 매우 드문 유전질환이다. 유전적 원인으로는 라민 A 내 한점 돌연변이가 발생하여 비정상적인 공여부 접합이 나타나고 이에 따라, C-말단 50 아미노산이 내부에서 삭제된 프로게린을 생성하게 된다. Hutchinson Gilford syndrome is a well-known progerin syndrome, a very rare genetic disorder. As a genetic cause, a single point mutation in lamin A occurs, resulting in abnormal donor junction, and thus, 50 amino acids in the C-terminal end are deleted to produce progerin.

이전 보고에서 본 발명의 발명자들은 HGPS 세포의 핵 기형은 라민 A와 프로게린 사이의 매우 강력한 결합에 의한 것임을 확인하였으며, 라민 A 결합으로부터 프로게린 억제제(JH4)는 HGPS 세포의 핵 변형을 개선시켰으며, p16/INK4A, DNA-PK, 및 H3K9me3 발현과 같은 노화 관련 마커를 회복시켰다. 또한, 복강내주사(i.p)를 통한 JH4 처리는 프로게린 모델 마우스의 수명을 약 4주간 연장시켰다.In the previous report, the inventors of the present invention confirmed that the nuclear malformation of HGPS cells was due to a very strong binding between lamin A and progerin, and progerin inhibitor (JH4) from lamin A binding improved nuclear transformation of HGPS cells. , aging related markers such as p16 / INK4A, DNA-PK, and H3K9me3 expression were recovered. In addition, JH4 treatment via intraperitoneal injection (i.p) prolonged the lifespan of progestin model mice for about 4 weeks.

그러나 환자의 조건을 고려할 때 HGPS 환자는 매우 얇은 혈관벽을 가져 정맥 내 주사는 적절한 전달방법이 아니므로 JH4의 경구 투여 가능성을 확인하였다. However, considering the patient's condition, the HGPS patient has a very thin blood vessel wall, so intravenous injection is not an appropriate delivery method, so we confirmed the possibility of oral administration of JH4.

그 결과, 도 1A, 표 1 및 표 2와 같이 정맥 내 주사 및 경구투여된 JH4는 생체 내에서 매우 짧은 반감기를 나타내었으며, 이에 따라 생체 내 이용가능성(B.A)을 확인할 수 없었다. As a result, the intravenous injection and oral administration of JH4 as shown in FIG. 1A, Table 1 and Table 2 showed a very short half-life in vivo, and thus, in vivo availability (B.A) could not be confirmed.

Figure pat00009
Figure pat00009

Figure pat00010
Figure pat00010

이에 따라, 생체 내에서 안정적인 화합물을 얻기 위해 JH4로부터 다양하게 화합물을 변형시키고, GST-면역 침강 분석(pull down assay) 및 프로게린 발현 분석을 수행하여 다른 41가지 종류의 JH4 유도체를 확인한 결과, 도 1C와 같이 JH010 화합물이 JH4와 유사한 활성을 나타내었으며, 도 1D와 같이 프로게린 발현을 억제시키는 효과를 나타내는 것으로 확인되었다.Accordingly, in order to obtain a stable compound in vivo, various compounds were modified from JH4, and GST-immune sedimentation analysis and progerin expression analysis were performed to confirm 41 other types of JH4 derivatives. As shown in 1C, the JH010 compound exhibited activity similar to JH4, and was confirmed to exhibit an effect of inhibiting progerin expression as shown in FIG.

또한, 도 1E 및 1F를 참고하면, JH010 화합물이 H3K9me3 발현을 유도하였으며, HGPS 세포의 핵 기형을 개선시켰다.In addition, referring to FIGS. 1E and 1F, the JH010 compound induced H3K9me3 expression and improved the nuclear malformation of HGPS cells.

PK 분석 결과에서도 도 2A와 같이 JH010 화합물은 생체 내 이용가능성(B.A)을 70% 개선시켰다.In the PK analysis result, as shown in FIG. 2A, JH010 compound improved bioavailability (B.A) by 70%.

<< 실시예Example 3> JH010 화합물의 피부노화 개선 효과 확인 3> Confirm the effect of JH010 compound on skin aging improvement

앞선 실험에서 JH010 화합물이 노화관련 질환에 치료효과를 나타내는 것으로 확인됨에 따라, 사람 피부 케라틴세포인 HaCaT 세포에서 JH010의 영향을 확인하였다.As the previous experiment confirmed that the JH010 compound has a therapeutic effect on aging-related diseases, the effect of JH010 on the human skin keratinocytes HaCaT cells was confirmed.

사람 피부 케라틴세포인 HaCaT 세포에 2 μM 또는 5 μM JH010을 각각 처리하여 6시간 또는 24시간 인큐베이션한 후 HaCaT 세포에서 콜라겐 1A 발현량을 확인하였다.Human skin keratinocytes were treated with 2 μM or 5 μM JH010 for HaCaT cells, followed by incubation for 6 or 24 hours, and then the expression level of collagen 1A in HaCaT cells was confirmed.

그 결과, 도 3A 및 도 3B와 같이 JH010 화합물은 사람 케라틴 세포에서 콜라겐 발현을 증가시키는 효과를 나타내는 것을 확인할 수 있었다.As a result, it was confirmed that the JH010 compound shows an effect of increasing collagen expression in human keratinocytes as shown in FIGS. 3A and 3B.

상기 결과들로부터 JH010 화합물은 프로게린-라민 A 결합 억제제로 적합한 것으로 확인되었으며, 상기 JH010 화합물은 경구 투여용으로 제공될 수 있어 효과적인 조로증 치료제 또는 주름 개선용 조성물로 사용될 수 있다.From the above results, the JH010 compound was found to be suitable as a progerin-lamin A binding inhibitor, and the JH010 compound can be provided for oral administration, and thus can be used as an effective agent for treating premature aging or a wrinkle improving composition.

이상으로 본 발명 내용의 특정한 부분을 상세히 기술하였는 바, 당업계의 통상의 지식을 가진 자에게 있어서, 이러한 구체적 기술은 단지 바람직한 실시양태일 뿐이며, 이에 의해 본 발명의 범위가 제한되는 것이 아닌 점은 명백할 것이다. 따라서 본 발명의 실질적인 범위는 첨부된 청구항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.Since the specific parts of the present invention have been described in detail above, it is obvious to those skilled in the art that this specific technique is only a preferred embodiment, whereby the scope of the present invention is not limited. something to do. Therefore, the substantial scope of the present invention will be defined by the appended claims and their equivalents.

Claims (7)

하기 화학식 1로 표시되는 화합물 또는 이의 약학적으로 허용가능한 염:
[화학식 1]
Figure pat00011
A compound represented by Formula 1 or a pharmaceutically acceptable salt thereof:
[Formula 1]
Figure pat00011
하기 화학식 1로 표시되는 화합물 또는 이의 약학적으로 허용가능한 염을 포함하는 노화 관련 질환 예방 또는 치료용 약학조성물:
[화학식 1]
Figure pat00012
A pharmaceutical composition for the prevention or treatment of aging-related diseases, including a compound represented by Formula 1 or a pharmaceutically acceptable salt thereof:
[Formula 1]
Figure pat00012
청구항 2에 있어서, 상기 노화 관련 질환은 조로증인 것을 특징으로 하는 노화 관련 질환 예방 또는 치료용 약학조성물.The method according to claim 2, wherein the aging-related disease is a pharmaceutical composition for preventing or treating aging-related diseases, characterized in that the premature ejaculation. 청구항 3에 있어서, 상기 조로증은 베르너 증후군(werner syndrome) 및 허친슨 길포드 증후군(Hutchinson Gilford progria syndrome)으로 이루어진 군에서 선택되는 것을 특징으로 하는 노화 관련 질환 예방 또는 치료용 약학조성물.The pharmaceutical composition for preventing or treating aging-related diseases according to claim 3, wherein the premature ejaculation is selected from the group consisting of Werner syndrome and Hutchinson Gilford progria syndrome. 청구항 2에 있어서, 상기 화학식 1로 표시되는 화합물 및 이의 약학적으로 허용가능한 염은 프로게린과 라민 A간의 결합을 억제하는 것을 특징으로 하는 노화 관련 질환 예방 또는 치료용 약학조성물.The method according to claim 2, wherein the compound represented by Formula 1 and a pharmaceutically acceptable salt thereof is a pharmaceutical composition for the prevention or treatment of aging-related diseases, characterized in that to inhibit the binding between progerin and lamin A. 하기 화학식 1로 표시되는 화합물 또는 이의 약학적으로 허용가능한 염을 포함하는 주름 예방 또는 개선용 화장료조성물:
[화학식 1]
Figure pat00013
A cosmetic composition for preventing or improving wrinkles comprising a compound represented by Formula 1 or a pharmaceutically acceptable salt thereof:
[Formula 1]
Figure pat00013
청구항 6에 있어서, 상기 화학식 1로 표시되는 화합물 및 이의 약학적으로 허용가능한 염은 케라틴세포 및 섬유아세포에서 콜라겐 생성을 향상시키는 것을 특징으로 하는 주름 예방 또는 개선용 화장료조성물.


The method of claim 6, wherein the compound represented by Formula 1 and a pharmaceutically acceptable salt thereof is a cosmetic composition for preventing or improving wrinkles, characterized in that to enhance collagen production in keratinocytes and fibroblasts.


KR1020180119264A 2018-10-05 2018-10-05 Pharmaceutical composition for preventing or treating aging-related diseases comprising decursin derivatives KR102230488B1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
KR1020180119264A KR102230488B1 (en) 2018-10-05 2018-10-05 Pharmaceutical composition for preventing or treating aging-related diseases comprising decursin derivatives

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
KR1020180119264A KR102230488B1 (en) 2018-10-05 2018-10-05 Pharmaceutical composition for preventing or treating aging-related diseases comprising decursin derivatives

Publications (2)

Publication Number Publication Date
KR20200039898A true KR20200039898A (en) 2020-04-17
KR102230488B1 KR102230488B1 (en) 2021-03-23

Family

ID=70461009

Family Applications (1)

Application Number Title Priority Date Filing Date
KR1020180119264A KR102230488B1 (en) 2018-10-05 2018-10-05 Pharmaceutical composition for preventing or treating aging-related diseases comprising decursin derivatives

Country Status (1)

Country Link
KR (1) KR102230488B1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20220075253A (en) * 2020-11-29 2022-06-08 (주)피알지에스앤텍 Hair restorer composition with decursin derivatives
KR20220075254A (en) * 2020-11-29 2022-06-08 (주)피알지에스앤텍 Cosmetic composition comprising of decursin derivatives for improving anti-aging and whitening

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20070100329A (en) * 2005-02-01 2007-10-10 주식회사 이매진 Method for stimulating collagen synthesis and/or kgf expression
KR20100008808A (en) * 2008-07-17 2010-01-27 박용진 A composition comprising novel (+)-decursin-ether derivative for treating and preventing atopic dermatitis disease
KR20120106286A (en) 2011-03-18 2012-09-26 부산대학교 산학협력단 Pharmaceutical composition for treating aging-related diseases comprising inhibitor of progerin and screening method thereof
KR101407044B1 (en) * 2012-03-16 2014-07-04 충남대학교산학협력단 Pharmaceutical Composition for Preventing or Treating Aging-related Diseases Comprising Blocker of Progerin and Lamin A Binding and Screening Method Thereof
KR20180119490A (en) * 2017-04-25 2018-11-02 (주)피알지에스앤텍 Pharmaceutical composition for preventing or treating aging-related diseases comprising decursin derivatives

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20070100329A (en) * 2005-02-01 2007-10-10 주식회사 이매진 Method for stimulating collagen synthesis and/or kgf expression
KR20100008808A (en) * 2008-07-17 2010-01-27 박용진 A composition comprising novel (+)-decursin-ether derivative for treating and preventing atopic dermatitis disease
KR20120106286A (en) 2011-03-18 2012-09-26 부산대학교 산학협력단 Pharmaceutical composition for treating aging-related diseases comprising inhibitor of progerin and screening method thereof
KR101407044B1 (en) * 2012-03-16 2014-07-04 충남대학교산학협력단 Pharmaceutical Composition for Preventing or Treating Aging-related Diseases Comprising Blocker of Progerin and Lamin A Binding and Screening Method Thereof
KR20180119490A (en) * 2017-04-25 2018-11-02 (주)피알지에스앤텍 Pharmaceutical composition for preventing or treating aging-related diseases comprising decursin derivatives

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20220075253A (en) * 2020-11-29 2022-06-08 (주)피알지에스앤텍 Hair restorer composition with decursin derivatives
KR20220075254A (en) * 2020-11-29 2022-06-08 (주)피알지에스앤텍 Cosmetic composition comprising of decursin derivatives for improving anti-aging and whitening

Also Published As

Publication number Publication date
KR102230488B1 (en) 2021-03-23

Similar Documents

Publication Publication Date Title
US9493440B2 (en) Compounds inhibiting leucine-rich repeat kinase enzyme activity
US10017463B2 (en) Inhibitors of deubiquitinating proteases
CN113490495A (en) Small molecule degradation agent of HELIOS and use method thereof
JP2021512059A (en) Degradation and use of BTK by conjugation of Bruton&#39;s tyrosine kinase (BTK) inhibitor with E3 ligase ligand
EP3786167A1 (en) Diaryl macrocyclic compound and pharmaceutical composition, and use thereof
KR102070328B1 (en) Pharmaceutical composition for preventing or treating aging-related diseases comprising decursin derivatives
TW201625620A (en) Heterocyclic hydroxamic acids as protein deacetylase inhibitors and dual protein deacetylase-protein kinase inhibitors and methods of use thereof
US11078222B2 (en) Hydroxybenzoic acid derivatives, methods and uses thereof
KR102230488B1 (en) Pharmaceutical composition for preventing or treating aging-related diseases comprising decursin derivatives
WO2018199633A1 (en) Pharmaceutical composition for preventing or treating aging-related diseases containing decursin derivative as active ingredient
CN114409680A (en) PPAR agonist and application thereof
CN113387932B (en) Bifunctional compound for inducing BRD4 protein degradation
JP2010502644A (en) Treatment methods using WRN binding molecules
KR20240055788A (en) Novel RAS inhibitors
US7939542B2 (en) Cinnamaldehyde derivatives having improved solubility in water, a method for preparing the same and a pharmaceutical composition comprising the same
EP3127900B1 (en) Alkynyl indazole derivative and use thereof
US20200308144A1 (en) Multimeric piperidine derivatives
US20200038371A1 (en) Compound having anticancer activity and preparation method and application
KR101281955B1 (en) Novel compound, method for producing thereof and pharmaceutical composition for preventing or treatment comprising the same
KR102107061B1 (en) Composition for inhibiting progerin-lamin A binding comprising WRN recombinant proteins
JP2020509044A (en) Pyridyl derivatives as bromodomain inhibitors
WO2022102962A1 (en) Anticancer composition comprising caudatin compound as active ingredient
JP5548916B2 (en) Pharmaceutical preparations containing Kawalactone derivatives
CN111247148B (en) Wnt pathway modulators
WO2017152570A1 (en) Novel gvs compound and use thereof

Legal Events

Date Code Title Description
E902 Notification of reason for refusal
E701 Decision to grant or registration of patent right
GRNT Written decision to grant