KR20190115262A - Nano particle comprising self-assembled ferritin structure conjugated with antigen peptide and adjuvant and use thereof - Google Patents
Nano particle comprising self-assembled ferritin structure conjugated with antigen peptide and adjuvant and use thereof Download PDFInfo
- Publication number
- KR20190115262A KR20190115262A KR1020180038078A KR20180038078A KR20190115262A KR 20190115262 A KR20190115262 A KR 20190115262A KR 1020180038078 A KR1020180038078 A KR 1020180038078A KR 20180038078 A KR20180038078 A KR 20180038078A KR 20190115262 A KR20190115262 A KR 20190115262A
- Authority
- KR
- South Korea
- Prior art keywords
- thr
- ala
- gly
- ser
- leu
- Prior art date
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 140
- 238000008416 Ferritin Methods 0.000 title claims abstract description 95
- 102000008857 Ferritin Human genes 0.000 title claims abstract description 86
- 108050000784 Ferritin Proteins 0.000 title claims abstract description 86
- 239000002105 nanoparticle Substances 0.000 title claims abstract description 86
- 239000000427 antigen Substances 0.000 title claims abstract description 51
- 102000036639 antigens Human genes 0.000 title claims abstract description 51
- 108091007433 antigens Proteins 0.000 title claims abstract description 51
- 239000002671 adjuvant Substances 0.000 title description 13
- 238000001338 self-assembly Methods 0.000 claims abstract description 56
- 102000037865 fusion proteins Human genes 0.000 claims abstract description 42
- 108020001507 fusion proteins Proteins 0.000 claims abstract description 42
- 229960005486 vaccine Drugs 0.000 claims abstract description 32
- 239000003623 enhancer Substances 0.000 claims abstract description 25
- 239000000203 mixture Substances 0.000 claims abstract description 17
- 230000004927 fusion Effects 0.000 claims abstract description 12
- 239000000178 monomer Substances 0.000 claims description 37
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 29
- 238000000034 method Methods 0.000 claims description 15
- 230000002708 enhancing effect Effects 0.000 claims description 13
- 230000000890 antigenic effect Effects 0.000 claims description 5
- 230000007969 cellular immunity Effects 0.000 claims description 3
- 230000004727 humoral immunity Effects 0.000 claims description 3
- 230000001571 immunoadjuvant effect Effects 0.000 claims description 3
- 239000000568 immunological adjuvant Substances 0.000 claims description 3
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 2
- 101710154606 Hemagglutinin Proteins 0.000 description 97
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 97
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 97
- 101710176177 Protein A56 Proteins 0.000 description 97
- 239000000185 hemagglutinin Substances 0.000 description 97
- 108010040721 Flagellin Proteins 0.000 description 69
- 150000001413 amino acids Chemical group 0.000 description 29
- 108020004414 DNA Proteins 0.000 description 27
- 210000002966 serum Anatomy 0.000 description 21
- 235000018102 proteins Nutrition 0.000 description 19
- 102000004169 proteins and genes Human genes 0.000 description 19
- 108090000623 proteins and genes Proteins 0.000 description 19
- 108010050848 glycylleucine Proteins 0.000 description 18
- 230000002441 reversible effect Effects 0.000 description 18
- 101000669460 Homo sapiens Toll-like receptor 5 Proteins 0.000 description 17
- 102100039357 Toll-like receptor 5 Human genes 0.000 description 17
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 17
- 241000880493 Leptailurus serval Species 0.000 description 16
- 230000000694 effects Effects 0.000 description 14
- MJOZZTKJZQFKDK-GUBZILKMSA-N Leu-Ala-Gln Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCC(N)=O MJOZZTKJZQFKDK-GUBZILKMSA-N 0.000 description 13
- 101710194807 Protective antigen Proteins 0.000 description 13
- 108010047857 aspartylglycine Proteins 0.000 description 13
- 210000004027 cell Anatomy 0.000 description 13
- 230000028993 immune response Effects 0.000 description 13
- 230000004044 response Effects 0.000 description 13
- 241000699666 Mus <mouse, genus> Species 0.000 description 12
- 230000004913 activation Effects 0.000 description 11
- 239000013598 vector Substances 0.000 description 11
- RLMISHABBKUNFO-WHFBIAKZSA-N Ala-Ala-Gly Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)NCC(O)=O RLMISHABBKUNFO-WHFBIAKZSA-N 0.000 description 10
- LJBVRCDPWOJOEK-PPCPHDFISA-N Leu-Thr-Ile Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O LJBVRCDPWOJOEK-PPCPHDFISA-N 0.000 description 10
- XKUKSGPZAADMRA-UHFFFAOYSA-N glycyl-glycyl-glycine Natural products NCC(=O)NCC(=O)NCC(O)=O XKUKSGPZAADMRA-UHFFFAOYSA-N 0.000 description 10
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 10
- JBVSSSZFNTXJDX-YTLHQDLWSA-N Ala-Ala-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](C)N JBVSSSZFNTXJDX-YTLHQDLWSA-N 0.000 description 9
- 241000588724 Escherichia coli Species 0.000 description 9
- LCNASHSOFMRYFO-WDCWCFNPSA-N Leu-Thr-Gln Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CCC(N)=O LCNASHSOFMRYFO-WDCWCFNPSA-N 0.000 description 9
- 241000699670 Mus sp. Species 0.000 description 9
- YQYFYUSYEDNLSD-YEPSODPASA-N Val-Thr-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O YQYFYUSYEDNLSD-YEPSODPASA-N 0.000 description 9
- 101150063416 add gene Proteins 0.000 description 9
- 108010040443 aspartyl-aspartic acid Proteins 0.000 description 9
- 108091033319 polynucleotide Proteins 0.000 description 9
- 102000040430 polynucleotide Human genes 0.000 description 9
- 239000002157 polynucleotide Substances 0.000 description 9
- 108010061238 threonyl-glycine Proteins 0.000 description 9
- FXGRXIATVXUAHO-WEDXCCLWSA-N Gly-Lys-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)CN)CCCCN FXGRXIATVXUAHO-WEDXCCLWSA-N 0.000 description 8
- RIPJMCFGQHGHNP-RHYQMDGZSA-N Lys-Val-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CCCCN)N)O RIPJMCFGQHGHNP-RHYQMDGZSA-N 0.000 description 8
- SITLTJHOQZFJGG-UHFFFAOYSA-N N-L-alpha-glutamyl-L-valine Natural products CC(C)C(C(O)=O)NC(=O)C(N)CCC(O)=O SITLTJHOQZFJGG-UHFFFAOYSA-N 0.000 description 8
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 8
- 108010005233 alanylglutamic acid Proteins 0.000 description 8
- 238000006243 chemical reaction Methods 0.000 description 8
- 108010044311 leucyl-glycyl-glycine Proteins 0.000 description 8
- 239000002953 phosphate buffered saline Substances 0.000 description 8
- YLZOPXRUQYQQID-UHFFFAOYSA-N 3-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)-1-[4-[2-[[3-(trifluoromethoxy)phenyl]methylamino]pyrimidin-5-yl]piperazin-1-yl]propan-1-one Chemical compound N1N=NC=2CN(CCC=21)CCC(=O)N1CCN(CC1)C=1C=NC(=NC=1)NCC1=CC(=CC=C1)OC(F)(F)F YLZOPXRUQYQQID-UHFFFAOYSA-N 0.000 description 7
- ZCUFMRIQCPNOHZ-NRPADANISA-N Ala-Val-Gln Chemical compound C[C@@H](C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N ZCUFMRIQCPNOHZ-NRPADANISA-N 0.000 description 7
- 241000894006 Bacteria Species 0.000 description 7
- 102000004127 Cytokines Human genes 0.000 description 7
- 108090000695 Cytokines Proteins 0.000 description 7
- UQJNXZSSGQIPIQ-FBCQKBJTSA-N Gly-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)CN UQJNXZSSGQIPIQ-FBCQKBJTSA-N 0.000 description 7
- NKRJALPCDNXULF-BYULHYEWSA-N Ile-Asp-Gly Chemical compound [H]N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(O)=O NKRJALPCDNXULF-BYULHYEWSA-N 0.000 description 7
- 108010074328 Interferon-gamma Proteins 0.000 description 7
- 102000004388 Interleukin-4 Human genes 0.000 description 7
- 108090000978 Interleukin-4 Proteins 0.000 description 7
- WSGXUIQTEZDVHJ-GARJFASQSA-N Leu-Ala-Pro Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N1CCC[C@@H]1C(O)=O WSGXUIQTEZDVHJ-GARJFASQSA-N 0.000 description 7
- XPNSAQMEAVSQRD-FBCQKBJTSA-N Thr-Gly-Gly Chemical compound C[C@@H](O)[C@H](N)C(=O)NCC(=O)NCC(O)=O XPNSAQMEAVSQRD-FBCQKBJTSA-N 0.000 description 7
- VBMOVTMNHWPZJR-SUSMZKCASA-N Thr-Thr-Glu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(O)=O VBMOVTMNHWPZJR-SUSMZKCASA-N 0.000 description 7
- MWUYSCVVPVITMW-IGNZVWTISA-N Tyr-Tyr-Ala Chemical compound C([C@@H](C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 MWUYSCVVPVITMW-IGNZVWTISA-N 0.000 description 7
- 201000010099 disease Diseases 0.000 description 7
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 7
- 108010089804 glycyl-threonine Proteins 0.000 description 7
- 229940028885 interleukin-4 Drugs 0.000 description 7
- 108010070409 phenylalanyl-glycyl-glycine Proteins 0.000 description 7
- GFBLJMHGHAXGNY-ZLUOBGJFSA-N Ala-Asn-Asp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O GFBLJMHGHAXGNY-ZLUOBGJFSA-N 0.000 description 6
- MEFILNJXAVSUTO-JXUBOQSCSA-N Ala-Leu-Thr Chemical compound C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O MEFILNJXAVSUTO-JXUBOQSCSA-N 0.000 description 6
- MDNAVFBZPROEHO-UHFFFAOYSA-N Ala-Lys-Val Natural products CC(C)C(C(O)=O)NC(=O)C(NC(=O)C(C)N)CCCCN MDNAVFBZPROEHO-UHFFFAOYSA-N 0.000 description 6
- DAPLJWATMAXPPZ-CIUDSAMLSA-N Asn-Asn-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CC(N)=O DAPLJWATMAXPPZ-CIUDSAMLSA-N 0.000 description 6
- XACXDSRQIXRMNS-OLHMAJIHSA-N Asp-Asn-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(=O)O)N)O XACXDSRQIXRMNS-OLHMAJIHSA-N 0.000 description 6
- LURQDGKYBFWWJA-MNXVOIDGSA-N Gln-Lys-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)N)N LURQDGKYBFWWJA-MNXVOIDGSA-N 0.000 description 6
- SBVMXEZQJVUARN-XPUUQOCRSA-N Gly-Val-Ser Chemical compound NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O SBVMXEZQJVUARN-XPUUQOCRSA-N 0.000 description 6
- 108060003951 Immunoglobulin Proteins 0.000 description 6
- POJPZSMTTMLSTG-SRVKXCTJSA-N Leu-Asn-Lys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCCCN)C(=O)O)N POJPZSMTTMLSTG-SRVKXCTJSA-N 0.000 description 6
- YBAFDPFAUTYYRW-UHFFFAOYSA-N N-L-alpha-glutamyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCC(O)=O YBAFDPFAUTYYRW-UHFFFAOYSA-N 0.000 description 6
- UIGMAMGZOJVTDN-WHFBIAKZSA-N Ser-Gly-Ser Chemical compound OC[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O UIGMAMGZOJVTDN-WHFBIAKZSA-N 0.000 description 6
- VPGCVZRRBYOGCD-AVGNSLFASA-N Val-Lys-Val Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O VPGCVZRRBYOGCD-AVGNSLFASA-N 0.000 description 6
- 108010076324 alanyl-glycyl-glycine Proteins 0.000 description 6
- 108010069020 alanyl-prolyl-glycine Proteins 0.000 description 6
- 108010044940 alanylglutamine Proteins 0.000 description 6
- 108010047495 alanylglycine Proteins 0.000 description 6
- 235000001014 amino acid Nutrition 0.000 description 6
- 230000001580 bacterial effect Effects 0.000 description 6
- 238000005119 centrifugation Methods 0.000 description 6
- XBGGUPMXALFZOT-UHFFFAOYSA-N glycyl-L-tyrosine hemihydrate Natural products NCC(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 XBGGUPMXALFZOT-UHFFFAOYSA-N 0.000 description 6
- 102000018358 immunoglobulin Human genes 0.000 description 6
- 238000004519 manufacturing process Methods 0.000 description 6
- 230000028327 secretion Effects 0.000 description 6
- 108010026333 seryl-proline Proteins 0.000 description 6
- 238000001542 size-exclusion chromatography Methods 0.000 description 6
- 239000006228 supernatant Substances 0.000 description 6
- LTTLSZVJTDSACD-OWLDWWDNSA-N Ala-Thr-Trp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O LTTLSZVJTDSACD-OWLDWWDNSA-N 0.000 description 5
- REQUGIWGOGSOEZ-ZLUOBGJFSA-N Asn-Ser-Asn Chemical compound C([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)N)C(=O)O)N)C(=O)N REQUGIWGOGSOEZ-ZLUOBGJFSA-N 0.000 description 5
- UXHYOWXTJLBEPG-GSSVUCPTSA-N Asn-Thr-Thr Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O UXHYOWXTJLBEPG-GSSVUCPTSA-N 0.000 description 5
- BCADFFUQHIMQAA-KKHAAJSZSA-N Asn-Thr-Val Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O BCADFFUQHIMQAA-KKHAAJSZSA-N 0.000 description 5
- ALMIMUZAWTUNIO-BZSNNMDCSA-N Asp-Tyr-Tyr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O ALMIMUZAWTUNIO-BZSNNMDCSA-N 0.000 description 5
- JXYMPBCYRKWJEE-BQBZGAKWSA-N Gly-Arg-Ala Chemical compound [H]NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(O)=O JXYMPBCYRKWJEE-BQBZGAKWSA-N 0.000 description 5
- XPJBQTCXPJNIFE-ZETCQYMHSA-N Gly-Gly-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)CNC(=O)CN XPJBQTCXPJNIFE-ZETCQYMHSA-N 0.000 description 5
- IALQAMYQJBZNSK-WHFBIAKZSA-N Gly-Ser-Asn Chemical compound [H]NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O IALQAMYQJBZNSK-WHFBIAKZSA-N 0.000 description 5
- FFALDIDGPLUDKV-ZDLURKLDSA-N Gly-Thr-Ser Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O FFALDIDGPLUDKV-ZDLURKLDSA-N 0.000 description 5
- NCSIQAFSIPHVAN-IUKAMOBKSA-N Ile-Asn-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H]([C@@H](C)O)C(=O)O)N NCSIQAFSIPHVAN-IUKAMOBKSA-N 0.000 description 5
- FADYJNXDPBKVCA-UHFFFAOYSA-N L-Phenylalanyl-L-lysin Natural products NCCCCC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FADYJNXDPBKVCA-UHFFFAOYSA-N 0.000 description 5
- LRALLISKBZNSKN-BQBZGAKWSA-N Met-Gly-Ser Chemical compound CSCC[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O LRALLISKBZNSKN-BQBZGAKWSA-N 0.000 description 5
- 108010079364 N-glycylalanine Proteins 0.000 description 5
- 239000012614 Q-Sepharose Substances 0.000 description 5
- XXWBHOWRARMUOC-NHCYSSNCSA-N Val-Lys-Asn Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N)C(=O)O)N XXWBHOWRARMUOC-NHCYSSNCSA-N 0.000 description 5
- DEGUERSKQBRZMZ-FXQIFTODSA-N Val-Ser-Ala Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O DEGUERSKQBRZMZ-FXQIFTODSA-N 0.000 description 5
- 108010087924 alanylproline Proteins 0.000 description 5
- 238000005349 anion exchange Methods 0.000 description 5
- 108010092854 aspartyllysine Proteins 0.000 description 5
- 108010068265 aspartyltyrosine Proteins 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 239000002299 complementary DNA Substances 0.000 description 5
- 108010049041 glutamylalanine Proteins 0.000 description 5
- 108010000434 glycyl-alanyl-leucine Proteins 0.000 description 5
- 108010025306 histidylleucine Proteins 0.000 description 5
- 239000012139 lysis buffer Substances 0.000 description 5
- 108010054155 lysyllysine Proteins 0.000 description 5
- 238000005259 measurement Methods 0.000 description 5
- 238000002156 mixing Methods 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 238000011282 treatment Methods 0.000 description 5
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 5
- BYXHQQCXAJARLQ-ZLUOBGJFSA-N Ala-Ala-Ala Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(O)=O BYXHQQCXAJARLQ-ZLUOBGJFSA-N 0.000 description 4
- BTYTYHBSJKQBQA-GCJQMDKQSA-N Ala-Asp-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)N)O BTYTYHBSJKQBQA-GCJQMDKQSA-N 0.000 description 4
- VGPWRRFOPXVGOH-BYPYZUCNSA-N Ala-Gly-Gly Chemical compound C[C@H](N)C(=O)NCC(=O)NCC(O)=O VGPWRRFOPXVGOH-BYPYZUCNSA-N 0.000 description 4
- DCVYRWFAMZFSDA-ZLUOBGJFSA-N Ala-Ser-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O DCVYRWFAMZFSDA-ZLUOBGJFSA-N 0.000 description 4
- WNHNMKOFKCHKKD-BFHQHQDPSA-N Ala-Thr-Gly Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O WNHNMKOFKCHKKD-BFHQHQDPSA-N 0.000 description 4
- NKBQZKVMKJJDLX-SRVKXCTJSA-N Arg-Glu-Leu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O NKBQZKVMKJJDLX-SRVKXCTJSA-N 0.000 description 4
- AOHKLEBWKMKITA-IHRRRGAJSA-N Arg-Phe-Ser Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N AOHKLEBWKMKITA-IHRRRGAJSA-N 0.000 description 4
- CPTXATAOUQJQRO-GUBZILKMSA-N Arg-Val-Ser Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O CPTXATAOUQJQRO-GUBZILKMSA-N 0.000 description 4
- QLSRIZIDQXDQHK-RCWTZXSCSA-N Arg-Val-Thr Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O QLSRIZIDQXDQHK-RCWTZXSCSA-N 0.000 description 4
- MSBDSTRUMZFSEU-PEFMBERDSA-N Asn-Glu-Ile Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O MSBDSTRUMZFSEU-PEFMBERDSA-N 0.000 description 4
- RAQMSGVCGSJKCL-FOHZUACHSA-N Asn-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CC(N)=O RAQMSGVCGSJKCL-FOHZUACHSA-N 0.000 description 4
- GURLOFOJBHRPJN-AAEUAGOBSA-N Asn-Gly-Trp Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CC(=O)N)N GURLOFOJBHRPJN-AAEUAGOBSA-N 0.000 description 4
- KRXIWXCXOARFNT-ZLUOBGJFSA-N Asp-Ala-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O KRXIWXCXOARFNT-ZLUOBGJFSA-N 0.000 description 4
- VPSHHQXIWLGVDD-ZLUOBGJFSA-N Asp-Asp-Asp Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O VPSHHQXIWLGVDD-ZLUOBGJFSA-N 0.000 description 4
- SBHUBSDEZQFJHJ-CIUDSAMLSA-N Asp-Asp-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC(O)=O SBHUBSDEZQFJHJ-CIUDSAMLSA-N 0.000 description 4
- TZOZNVLBTAFJRW-UGYAYLCHSA-N Asp-Ile-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](CC(=O)O)N TZOZNVLBTAFJRW-UGYAYLCHSA-N 0.000 description 4
- AYFVRYXNDHBECD-YUMQZZPRSA-N Asp-Leu-Gly Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O AYFVRYXNDHBECD-YUMQZZPRSA-N 0.000 description 4
- CJUKAWUWBZCTDQ-SRVKXCTJSA-N Asp-Leu-Lys Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(O)=O CJUKAWUWBZCTDQ-SRVKXCTJSA-N 0.000 description 4
- QSFHZPQUAAQHAQ-CIUDSAMLSA-N Asp-Ser-Leu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O QSFHZPQUAAQHAQ-CIUDSAMLSA-N 0.000 description 4
- JSNWZMFSLIWAHS-HJGDQZAQSA-N Asp-Thr-Leu Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)O)NC(=O)[C@H](CC(=O)O)N)O JSNWZMFSLIWAHS-HJGDQZAQSA-N 0.000 description 4
- 241001198387 Escherichia coli BL21(DE3) Species 0.000 description 4
- PRBLYKYHAJEABA-SRVKXCTJSA-N Gln-Arg-Leu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(O)=O PRBLYKYHAJEABA-SRVKXCTJSA-N 0.000 description 4
- LJEPDHWNQXPXMM-NHCYSSNCSA-N Gln-Arg-Val Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(O)=O LJEPDHWNQXPXMM-NHCYSSNCSA-N 0.000 description 4
- INFBPLSHYFALDE-ACZMJKKPSA-N Gln-Asn-Ala Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(O)=O INFBPLSHYFALDE-ACZMJKKPSA-N 0.000 description 4
- ZBKUIQNCRIYVGH-SDDRHHMPSA-N Gln-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCC(=O)N)N ZBKUIQNCRIYVGH-SDDRHHMPSA-N 0.000 description 4
- YPFFHGRJCUBXPX-NHCYSSNCSA-N Gln-Pro-Val Chemical compound CC(C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CCC(N)=O)C(O)=O YPFFHGRJCUBXPX-NHCYSSNCSA-N 0.000 description 4
- WZZSKAJIHTUUSG-ACZMJKKPSA-N Glu-Ala-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCC(O)=O WZZSKAJIHTUUSG-ACZMJKKPSA-N 0.000 description 4
- MWMJCGBSIORNCD-AVGNSLFASA-N Glu-Leu-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O MWMJCGBSIORNCD-AVGNSLFASA-N 0.000 description 4
- SOYWRINXUSUWEQ-DLOVCJGASA-N Glu-Val-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CCC(O)=O SOYWRINXUSUWEQ-DLOVCJGASA-N 0.000 description 4
- TWTPDFFBLQEBOE-IUCAKERBSA-N Gly-Leu-Gln Chemical compound [H]NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O TWTPDFFBLQEBOE-IUCAKERBSA-N 0.000 description 4
- GMTXWRIDLGTVFC-IUCAKERBSA-N Gly-Lys-Glu Chemical compound [H]NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O GMTXWRIDLGTVFC-IUCAKERBSA-N 0.000 description 4
- YOBGUCWZPXJHTN-BQBZGAKWSA-N Gly-Ser-Arg Chemical compound NCC(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCN=C(N)N YOBGUCWZPXJHTN-BQBZGAKWSA-N 0.000 description 4
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 4
- HXIDVIFHRYRXLZ-NAKRPEOUSA-N Ile-Ser-Val Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)O)N HXIDVIFHRYRXLZ-NAKRPEOUSA-N 0.000 description 4
- NAFIFZNBSPWYOO-RWRJDSDZSA-N Ile-Thr-Gln Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N NAFIFZNBSPWYOO-RWRJDSDZSA-N 0.000 description 4
- 102100037850 Interferon gamma Human genes 0.000 description 4
- UCOCBWDBHCUPQP-DCAQKATOSA-N Leu-Arg-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(O)=O UCOCBWDBHCUPQP-DCAQKATOSA-N 0.000 description 4
- TWQIYNGNYNJUFM-NHCYSSNCSA-N Leu-Asn-Val Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(O)=O TWQIYNGNYNJUFM-NHCYSSNCSA-N 0.000 description 4
- PVMPDMIKUVNOBD-CIUDSAMLSA-N Leu-Asp-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(O)=O PVMPDMIKUVNOBD-CIUDSAMLSA-N 0.000 description 4
- CLVUXCBGKUECIT-HJGDQZAQSA-N Leu-Asp-Thr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O CLVUXCBGKUECIT-HJGDQZAQSA-N 0.000 description 4
- VCHVSKNMTXWIIP-SRVKXCTJSA-N Leu-Lys-Ser Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O VCHVSKNMTXWIIP-SRVKXCTJSA-N 0.000 description 4
- NHRINZSPIUXYQZ-DCAQKATOSA-N Leu-Met-Cys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CS)C(=O)O)N NHRINZSPIUXYQZ-DCAQKATOSA-N 0.000 description 4
- IRMLZWSRWSGTOP-CIUDSAMLSA-N Leu-Ser-Ala Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O IRMLZWSRWSGTOP-CIUDSAMLSA-N 0.000 description 4
- HPXVFFIIGOAQRV-DCAQKATOSA-N Pro-Arg-Gln Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(O)=O HPXVFFIIGOAQRV-DCAQKATOSA-N 0.000 description 4
- YQHZVYJAGWMHES-ZLUOBGJFSA-N Ser-Ala-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O YQHZVYJAGWMHES-ZLUOBGJFSA-N 0.000 description 4
- HJEBZBMOTCQYDN-ACZMJKKPSA-N Ser-Glu-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O HJEBZBMOTCQYDN-ACZMJKKPSA-N 0.000 description 4
- SFTZWNJFZYOLBD-ZDLURKLDSA-N Ser-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CO SFTZWNJFZYOLBD-ZDLURKLDSA-N 0.000 description 4
- AZWNCEBQZXELEZ-FXQIFTODSA-N Ser-Pro-Ser Chemical compound OC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O AZWNCEBQZXELEZ-FXQIFTODSA-N 0.000 description 4
- JGUWRQWULDWNCM-FXQIFTODSA-N Ser-Val-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O JGUWRQWULDWNCM-FXQIFTODSA-N 0.000 description 4
- DWYAUVCQDTZIJI-VZFHVOOUSA-N Thr-Ala-Ser Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O DWYAUVCQDTZIJI-VZFHVOOUSA-N 0.000 description 4
- TZKPNGDGUVREEB-FOHZUACHSA-N Thr-Asn-Gly Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O TZKPNGDGUVREEB-FOHZUACHSA-N 0.000 description 4
- OJRNZRROAIAHDL-LKXGYXEUSA-N Thr-Asn-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O OJRNZRROAIAHDL-LKXGYXEUSA-N 0.000 description 4
- XXNLGZRRSKPSGF-HTUGSXCWSA-N Thr-Gln-Phe Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)N)O XXNLGZRRSKPSGF-HTUGSXCWSA-N 0.000 description 4
- JQAWYCUUFIMTHE-WLTAIBSBSA-N Thr-Gly-Tyr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O JQAWYCUUFIMTHE-WLTAIBSBSA-N 0.000 description 4
- FWTFAZKJORVTIR-VZFHVOOUSA-N Thr-Ser-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O FWTFAZKJORVTIR-VZFHVOOUSA-N 0.000 description 4
- BKIOKSLLAAZYTC-KKHAAJSZSA-N Thr-Val-Asn Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O BKIOKSLLAAZYTC-KKHAAJSZSA-N 0.000 description 4
- 239000007983 Tris buffer Substances 0.000 description 4
- OCCYDHCUKXRPSJ-SXNHZJKMSA-N Trp-Ile-Gln Chemical compound [H]N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(O)=O OCCYDHCUKXRPSJ-SXNHZJKMSA-N 0.000 description 4
- VCXWRWYFJLXITF-AUTRQRHGSA-N Tyr-Ala-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 VCXWRWYFJLXITF-AUTRQRHGSA-N 0.000 description 4
- OVLIFGQSBSNGHY-KKHAAJSZSA-N Val-Asp-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C(C)C)N)O OVLIFGQSBSNGHY-KKHAAJSZSA-N 0.000 description 4
- CKTMJBPRVQWPHU-JSGCOSHPSA-N Val-Phe-Gly Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)NCC(=O)O)N CKTMJBPRVQWPHU-JSGCOSHPSA-N 0.000 description 4
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- 108010037850 glycylvaline Proteins 0.000 description 4
- 108010028295 histidylhistidine Proteins 0.000 description 4
- 238000011534 incubation Methods 0.000 description 4
- 206010022000 influenza Diseases 0.000 description 4
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 4
- 108010025153 lysyl-alanyl-alanine Proteins 0.000 description 4
- 108010045397 lysyl-tyrosyl-lysine Proteins 0.000 description 4
- 108010009298 lysylglutamic acid Proteins 0.000 description 4
- 108010017391 lysylvaline Proteins 0.000 description 4
- 239000008188 pellet Substances 0.000 description 4
- 239000013612 plasmid Substances 0.000 description 4
- 239000004033 plastic Substances 0.000 description 4
- 239000000047 product Substances 0.000 description 4
- 108010029020 prolylglycine Proteins 0.000 description 4
- 230000017854 proteolysis Effects 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- 210000004988 splenocyte Anatomy 0.000 description 4
- 230000014616 translation Effects 0.000 description 4
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 4
- 108010003137 tyrosyltyrosine Proteins 0.000 description 4
- 108010073969 valyllysine Proteins 0.000 description 4
- CXRCVCURMBFFOL-FXQIFTODSA-N Ala-Ala-Pro Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O CXRCVCURMBFFOL-FXQIFTODSA-N 0.000 description 3
- YAXNATKKPOWVCP-ZLUOBGJFSA-N Ala-Asn-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(O)=O YAXNATKKPOWVCP-ZLUOBGJFSA-N 0.000 description 3
- FXKNPWNXPQZLES-ZLUOBGJFSA-N Ala-Asn-Ser Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O FXKNPWNXPQZLES-ZLUOBGJFSA-N 0.000 description 3
- CZPAHAKGPDUIPJ-CIUDSAMLSA-N Ala-Gln-Pro Chemical compound C[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(O)=O CZPAHAKGPDUIPJ-CIUDSAMLSA-N 0.000 description 3
- LXAARTARZJJCMB-CIQUZCHMSA-N Ala-Ile-Thr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(O)=O LXAARTARZJJCMB-CIQUZCHMSA-N 0.000 description 3
- QUIGLPSHIFPEOV-CIUDSAMLSA-N Ala-Lys-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O QUIGLPSHIFPEOV-CIUDSAMLSA-N 0.000 description 3
- IORKCNUBHNIMKY-CIUDSAMLSA-N Ala-Pro-Glu Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O IORKCNUBHNIMKY-CIUDSAMLSA-N 0.000 description 3
- VJVQKGYHIZPSNS-FXQIFTODSA-N Ala-Ser-Arg Chemical compound C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCN=C(N)N VJVQKGYHIZPSNS-FXQIFTODSA-N 0.000 description 3
- LSMDIAAALJJLRO-XQXXSGGOSA-N Ala-Thr-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(O)=O LSMDIAAALJJLRO-XQXXSGGOSA-N 0.000 description 3
- KTXKIYXZQFWJKB-VZFHVOOUSA-N Ala-Thr-Ser Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O KTXKIYXZQFWJKB-VZFHVOOUSA-N 0.000 description 3
- IETUUAHKCHOQHP-KZVJFYERSA-N Ala-Thr-Val Chemical compound CC(C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)N)[C@@H](C)O)C(O)=O IETUUAHKCHOQHP-KZVJFYERSA-N 0.000 description 3
- XCIGOVDXZULBBV-DCAQKATOSA-N Ala-Val-Lys Chemical compound CC(C)[C@H](NC(=O)[C@H](C)N)C(=O)N[C@@H](CCCCN)C(O)=O XCIGOVDXZULBBV-DCAQKATOSA-N 0.000 description 3
- GIVWETPOBCRTND-DCAQKATOSA-N Arg-Gln-Arg Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O GIVWETPOBCRTND-DCAQKATOSA-N 0.000 description 3
- UHFUZWSZQKMDSX-DCAQKATOSA-N Arg-Leu-Asn Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N UHFUZWSZQKMDSX-DCAQKATOSA-N 0.000 description 3
- HUZGPXBILPMCHM-IHRRRGAJSA-N Asn-Arg-Phe Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O HUZGPXBILPMCHM-IHRRRGAJSA-N 0.000 description 3
- ACRYGQFHAQHDSF-ZLUOBGJFSA-N Asn-Asn-Asn Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O ACRYGQFHAQHDSF-ZLUOBGJFSA-N 0.000 description 3
- XSGBIBGAMKTHMY-WHFBIAKZSA-N Asn-Asp-Gly Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(O)=O XSGBIBGAMKTHMY-WHFBIAKZSA-N 0.000 description 3
- NVWJMQNYLYWVNQ-BYULHYEWSA-N Asn-Ile-Gly Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(O)=O NVWJMQNYLYWVNQ-BYULHYEWSA-N 0.000 description 3
- ACKNRKFVYUVWAC-ZPFDUUQYSA-N Asn-Ile-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC(=O)N)N ACKNRKFVYUVWAC-ZPFDUUQYSA-N 0.000 description 3
- WIDVAWAQBRAKTI-YUMQZZPRSA-N Asn-Leu-Gly Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O WIDVAWAQBRAKTI-YUMQZZPRSA-N 0.000 description 3
- ORJQQZIXTOYGGH-SRVKXCTJSA-N Asn-Lys-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O ORJQQZIXTOYGGH-SRVKXCTJSA-N 0.000 description 3
- RVHGJNGNKGDCPX-KKUMJFAQSA-N Asn-Phe-Lys Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC(=O)N)N RVHGJNGNKGDCPX-KKUMJFAQSA-N 0.000 description 3
- BYLSYQASFJJBCL-DCAQKATOSA-N Asn-Pro-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(O)=O BYLSYQASFJJBCL-DCAQKATOSA-N 0.000 description 3
- XTMZYFMTYJNABC-ZLUOBGJFSA-N Asn-Ser-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)N)N XTMZYFMTYJNABC-ZLUOBGJFSA-N 0.000 description 3
- JWQWPRCDYWNVNM-ACZMJKKPSA-N Asn-Ser-Gln Chemical compound C(CC(=O)N)[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)N)N JWQWPRCDYWNVNM-ACZMJKKPSA-N 0.000 description 3
- LTDGPJKGJDIBQD-LAEOZQHASA-N Asn-Val-Gln Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O LTDGPJKGJDIBQD-LAEOZQHASA-N 0.000 description 3
- UQBGYPFHWFZMCD-ZLUOBGJFSA-N Asp-Asn-Asn Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O UQBGYPFHWFZMCD-ZLUOBGJFSA-N 0.000 description 3
- KNMRXHIAVXHCLW-ZLUOBGJFSA-N Asp-Asn-Ser Chemical compound C([C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CO)C(=O)O)N)C(=O)O KNMRXHIAVXHCLW-ZLUOBGJFSA-N 0.000 description 3
- BFOYULZBKYOKAN-OLHMAJIHSA-N Asp-Asp-Thr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O BFOYULZBKYOKAN-OLHMAJIHSA-N 0.000 description 3
- SNAWMGHSCHKSDK-GUBZILKMSA-N Asp-Gln-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CC(=O)O)N SNAWMGHSCHKSDK-GUBZILKMSA-N 0.000 description 3
- PSLSTUMPZILTAH-BYULHYEWSA-N Asp-Gly-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CC(O)=O PSLSTUMPZILTAH-BYULHYEWSA-N 0.000 description 3
- SNDBKTFJWVEVPO-WHFBIAKZSA-N Asp-Gly-Ser Chemical compound [H]N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CO)C(O)=O SNDBKTFJWVEVPO-WHFBIAKZSA-N 0.000 description 3
- SVABRQFIHCSNCI-FOHZUACHSA-N Asp-Gly-Thr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(O)=O SVABRQFIHCSNCI-FOHZUACHSA-N 0.000 description 3
- MNQMTYSEKZHIDF-GCJQMDKQSA-N Asp-Thr-Ala Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O MNQMTYSEKZHIDF-GCJQMDKQSA-N 0.000 description 3
- ITGFVUYOLWBPQW-KKHAAJSZSA-N Asp-Thr-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O ITGFVUYOLWBPQW-KKHAAJSZSA-N 0.000 description 3
- GGBQDSHTXKQSLP-NHCYSSNCSA-N Asp-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC(=O)O)N GGBQDSHTXKQSLP-NHCYSSNCSA-N 0.000 description 3
- 239000012591 Dulbecco’s Phosphate Buffered Saline Substances 0.000 description 3
- ODBLJLZVLAWVMS-GUBZILKMSA-N Gln-Asn-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CCC(=O)N)N ODBLJLZVLAWVMS-GUBZILKMSA-N 0.000 description 3
- MADFVRSKEIEZHZ-DCAQKATOSA-N Gln-Gln-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CCC(=O)N)N MADFVRSKEIEZHZ-DCAQKATOSA-N 0.000 description 3
- DOQUICBEISTQHE-CIUDSAMLSA-N Gln-Pro-Asp Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(O)=O)C(O)=O DOQUICBEISTQHE-CIUDSAMLSA-N 0.000 description 3
- UTOQQOMEJDPDMX-ACZMJKKPSA-N Gln-Ser-Asp Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O UTOQQOMEJDPDMX-ACZMJKKPSA-N 0.000 description 3
- NHMRJKKAVMENKJ-WDCWCFNPSA-N Gln-Thr-Leu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O NHMRJKKAVMENKJ-WDCWCFNPSA-N 0.000 description 3
- QGWXAMDECCKGRU-XVKPBYJWSA-N Gln-Val-Gly Chemical compound CC(C)[C@H](NC(=O)[C@@H](N)CCC(N)=O)C(=O)NCC(O)=O QGWXAMDECCKGRU-XVKPBYJWSA-N 0.000 description 3
- LXAUHIRMWXQRKI-XHNCKOQMSA-N Glu-Asn-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC(=O)N)NC(=O)[C@H](CCC(=O)O)N)C(=O)O LXAUHIRMWXQRKI-XHNCKOQMSA-N 0.000 description 3
- XXCDTYBVGMPIOA-FXQIFTODSA-N Glu-Asp-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O XXCDTYBVGMPIOA-FXQIFTODSA-N 0.000 description 3
- CXRWMMRLEMVSEH-PEFMBERDSA-N Glu-Ile-Asn Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(O)=O CXRWMMRLEMVSEH-PEFMBERDSA-N 0.000 description 3
- LGYCLOCORAEQSZ-PEFMBERDSA-N Glu-Ile-Asp Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(O)=O)C(O)=O LGYCLOCORAEQSZ-PEFMBERDSA-N 0.000 description 3
- FBEJIDRSQCGFJI-GUBZILKMSA-N Glu-Leu-Ser Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O FBEJIDRSQCGFJI-GUBZILKMSA-N 0.000 description 3
- ILWHFUZZCFYSKT-AVGNSLFASA-N Glu-Lys-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O ILWHFUZZCFYSKT-AVGNSLFASA-N 0.000 description 3
- IDEODOAVGCMUQV-GUBZILKMSA-N Glu-Ser-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O IDEODOAVGCMUQV-GUBZILKMSA-N 0.000 description 3
- RGJKYNUINKGPJN-RWRJDSDZSA-N Glu-Thr-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(=O)O)N RGJKYNUINKGPJN-RWRJDSDZSA-N 0.000 description 3
- QXUPRMQJDWJDFR-NRPADANISA-N Glu-Val-Ser Chemical compound CC(C)[C@H](NC(=O)[C@@H](N)CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O QXUPRMQJDWJDFR-NRPADANISA-N 0.000 description 3
- VSVZIEVNUYDAFR-YUMQZZPRSA-N Gly-Ala-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)CN VSVZIEVNUYDAFR-YUMQZZPRSA-N 0.000 description 3
- QSDKBRMVXSWAQE-BFHQHQDPSA-N Gly-Ala-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)CN QSDKBRMVXSWAQE-BFHQHQDPSA-N 0.000 description 3
- FMNHBTKMRFVGRO-FOHZUACHSA-N Gly-Asn-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)CN FMNHBTKMRFVGRO-FOHZUACHSA-N 0.000 description 3
- FUTAPPOITCCWTH-WHFBIAKZSA-N Gly-Asp-Asp Chemical compound [H]NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O FUTAPPOITCCWTH-WHFBIAKZSA-N 0.000 description 3
- NPSWCZIRBAYNSB-JHEQGTHGSA-N Gly-Gln-Thr Chemical compound [H]NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O NPSWCZIRBAYNSB-JHEQGTHGSA-N 0.000 description 3
- MBOAPAXLTUSMQI-JHEQGTHGSA-N Gly-Glu-Thr Chemical compound [H]NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O MBOAPAXLTUSMQI-JHEQGTHGSA-N 0.000 description 3
- CCQOOWAONKGYKQ-BYPYZUCNSA-N Gly-Gly-Ala Chemical compound OC(=O)[C@H](C)NC(=O)CNC(=O)CN CCQOOWAONKGYKQ-BYPYZUCNSA-N 0.000 description 3
- QITBQGJOXQYMOA-ZETCQYMHSA-N Gly-Gly-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)CNC(=O)CN QITBQGJOXQYMOA-ZETCQYMHSA-N 0.000 description 3
- YWAQATDNEKZFFK-BYPYZUCNSA-N Gly-Gly-Ser Chemical compound NCC(=O)NCC(=O)N[C@@H](CO)C(O)=O YWAQATDNEKZFFK-BYPYZUCNSA-N 0.000 description 3
- AYBKPDHHVADEDA-YUMQZZPRSA-N Gly-His-Asn Chemical compound [H]NCC(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(O)=O AYBKPDHHVADEDA-YUMQZZPRSA-N 0.000 description 3
- HAXARWKYFIIHKD-ZKWXMUAHSA-N Gly-Ile-Ser Chemical compound NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O HAXARWKYFIIHKD-ZKWXMUAHSA-N 0.000 description 3
- YTSVAIMKVLZUDU-YUMQZZPRSA-N Gly-Leu-Asp Chemical compound [H]NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O YTSVAIMKVLZUDU-YUMQZZPRSA-N 0.000 description 3
- CVFOYJJOZYYEPE-KBPBESRZSA-N Gly-Lys-Tyr Chemical compound [H]NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O CVFOYJJOZYYEPE-KBPBESRZSA-N 0.000 description 3
- CSMYMGFCEJWALV-WDSKDSINSA-N Gly-Ser-Gln Chemical compound NCC(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(N)=O CSMYMGFCEJWALV-WDSKDSINSA-N 0.000 description 3
- MREVELMMFOLESM-HOCLYGCPSA-N Gly-Trp-Val Chemical compound [H]NCC(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](C(C)C)C(O)=O MREVELMMFOLESM-HOCLYGCPSA-N 0.000 description 3
- NGBGZCUWFVVJKC-IRXDYDNUSA-N Gly-Tyr-Tyr Chemical compound C([C@H](NC(=O)CN)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=C(O)C=C1 NGBGZCUWFVVJKC-IRXDYDNUSA-N 0.000 description 3
- FNXSYBOHALPRHV-ONGXEEELSA-N Gly-Val-Lys Chemical compound NCC(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CCCCN FNXSYBOHALPRHV-ONGXEEELSA-N 0.000 description 3
- YKRYHWJRQUSTKG-KBIXCLLPSA-N Ile-Ala-Gln Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N YKRYHWJRQUSTKG-KBIXCLLPSA-N 0.000 description 3
- VAXBXNPRXPHGHG-BJDJZHNGSA-N Ile-Ala-Leu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)O)N VAXBXNPRXPHGHG-BJDJZHNGSA-N 0.000 description 3
- ZDNORQNHCJUVOV-KBIXCLLPSA-N Ile-Gln-Ala Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(O)=O ZDNORQNHCJUVOV-KBIXCLLPSA-N 0.000 description 3
- LBRCLQMZAHRTLV-ZKWXMUAHSA-N Ile-Gly-Ser Chemical compound CC[C@H](C)[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O LBRCLQMZAHRTLV-ZKWXMUAHSA-N 0.000 description 3
- PARSHQDZROHERM-NHCYSSNCSA-N Ile-Lys-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)O)N PARSHQDZROHERM-NHCYSSNCSA-N 0.000 description 3
- ZLFNNVATRMCAKN-ZKWXMUAHSA-N Ile-Ser-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)NCC(=O)O)N ZLFNNVATRMCAKN-ZKWXMUAHSA-N 0.000 description 3
- AGGIYSLVUKVOPT-HTFCKZLJSA-N Ile-Ser-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)O)N AGGIYSLVUKVOPT-HTFCKZLJSA-N 0.000 description 3
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 3
- 241000712431 Influenza A virus Species 0.000 description 3
- CQQGCWPXDHTTNF-GUBZILKMSA-N Leu-Ala-Glu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCC(O)=O CQQGCWPXDHTTNF-GUBZILKMSA-N 0.000 description 3
- KKXDHFKZWKLYGB-GUBZILKMSA-N Leu-Asn-Glu Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N KKXDHFKZWKLYGB-GUBZILKMSA-N 0.000 description 3
- ZURHXHNAEJJRNU-CIUDSAMLSA-N Leu-Asp-Asn Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O ZURHXHNAEJJRNU-CIUDSAMLSA-N 0.000 description 3
- VPKIQULSKFVCSM-SRVKXCTJSA-N Leu-Gln-Arg Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O VPKIQULSKFVCSM-SRVKXCTJSA-N 0.000 description 3
- KAFOIVJDVSZUMD-UHFFFAOYSA-N Leu-Gln-Gln Natural products CC(C)CC(N)C(=O)NC(CCC(N)=O)C(=O)NC(CCC(N)=O)C(O)=O KAFOIVJDVSZUMD-UHFFFAOYSA-N 0.000 description 3
- FQZPTCNSNPWHLJ-AVGNSLFASA-N Leu-Gln-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(O)=O FQZPTCNSNPWHLJ-AVGNSLFASA-N 0.000 description 3
- GPICTNQYKHHHTH-GUBZILKMSA-N Leu-Gln-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O GPICTNQYKHHHTH-GUBZILKMSA-N 0.000 description 3
- ZGUMORRUBUCXEH-AVGNSLFASA-N Leu-Lys-Gln Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(O)=O ZGUMORRUBUCXEH-AVGNSLFASA-N 0.000 description 3
- QNTJIDXQHWUBKC-BZSNNMDCSA-N Leu-Lys-Phe Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O QNTJIDXQHWUBKC-BZSNNMDCSA-N 0.000 description 3
- XOWMDXHFSBCAKQ-SRVKXCTJSA-N Leu-Ser-Leu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CC(C)C XOWMDXHFSBCAKQ-SRVKXCTJSA-N 0.000 description 3
- AAORVPFVUIHEAB-YUMQZZPRSA-N Lys-Asp-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(O)=O AAORVPFVUIHEAB-YUMQZZPRSA-N 0.000 description 3
- MIFFFXHMAHFACR-KATARQTJSA-N Lys-Ser-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CCCCN MIFFFXHMAHFACR-KATARQTJSA-N 0.000 description 3
- PLOUVAYOMTYJRG-JXUBOQSCSA-N Lys-Thr-Ala Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O PLOUVAYOMTYJRG-JXUBOQSCSA-N 0.000 description 3
- PPNCMJARTHYNEC-MEYUZBJRSA-N Lys-Tyr-Thr Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H]([C@H](O)C)C(O)=O)CC1=CC=C(O)C=C1 PPNCMJARTHYNEC-MEYUZBJRSA-N 0.000 description 3
- GILLQRYAWOMHED-DCAQKATOSA-N Lys-Val-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CCCCN GILLQRYAWOMHED-DCAQKATOSA-N 0.000 description 3
- HGKJFNCLOHKEHS-FXQIFTODSA-N Met-Cys-Asp Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@H](C(O)=O)CC(O)=O HGKJFNCLOHKEHS-FXQIFTODSA-N 0.000 description 3
- LQMHZERGCQJKAH-STQMWFEESA-N Met-Gly-Phe Chemical compound CSCC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 LQMHZERGCQJKAH-STQMWFEESA-N 0.000 description 3
- SOAYQFDWEIWPPR-IHRRRGAJSA-N Met-Ser-Tyr Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O SOAYQFDWEIWPPR-IHRRRGAJSA-N 0.000 description 3
- XZFYRXDAULDNFX-UHFFFAOYSA-N N-L-cysteinyl-L-phenylalanine Natural products SCC(N)C(=O)NC(C(O)=O)CC1=CC=CC=C1 XZFYRXDAULDNFX-UHFFFAOYSA-N 0.000 description 3
- XMBSYZWANAQXEV-UHFFFAOYSA-N N-alpha-L-glutamyl-L-phenylalanine Natural products OC(=O)CCC(N)C(=O)NC(C(O)=O)CC1=CC=CC=C1 XMBSYZWANAQXEV-UHFFFAOYSA-N 0.000 description 3
- 108010002311 N-glycylglutamic acid Proteins 0.000 description 3
- 101100068676 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) gln-1 gene Proteins 0.000 description 3
- HHOOEUSPFGPZFP-QWRGUYRKSA-N Phe-Asn-Gly Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O HHOOEUSPFGPZFP-QWRGUYRKSA-N 0.000 description 3
- JWQWPTLEOFNCGX-AVGNSLFASA-N Phe-Glu-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 JWQWPTLEOFNCGX-AVGNSLFASA-N 0.000 description 3
- DNAXXTQSTKOHFO-QEJZJMRPSA-N Phe-Lys-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CC1=CC=CC=C1 DNAXXTQSTKOHFO-QEJZJMRPSA-N 0.000 description 3
- GMWNQSGWWGKTSF-LFSVMHDDSA-N Phe-Thr-Ala Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O GMWNQSGWWGKTSF-LFSVMHDDSA-N 0.000 description 3
- VTFXTWDFPTWNJY-RHYQMDGZSA-N Pro-Leu-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O VTFXTWDFPTWNJY-RHYQMDGZSA-N 0.000 description 3
- KHRLUIPIMIQFGT-AVGNSLFASA-N Pro-Val-Leu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O KHRLUIPIMIQFGT-AVGNSLFASA-N 0.000 description 3
- MWMKFWJYRRGXOR-ZLUOBGJFSA-N Ser-Ala-Asn Chemical compound N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)O)CC(N)=O)C)CO MWMKFWJYRRGXOR-ZLUOBGJFSA-N 0.000 description 3
- JPIDMRXXNMIVKY-VZFHVOOUSA-N Ser-Ala-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O JPIDMRXXNMIVKY-VZFHVOOUSA-N 0.000 description 3
- UGJRQLURDVGULT-LKXGYXEUSA-N Ser-Asn-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O UGJRQLURDVGULT-LKXGYXEUSA-N 0.000 description 3
- BTPAWKABYQMKKN-LKXGYXEUSA-N Ser-Asp-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O BTPAWKABYQMKKN-LKXGYXEUSA-N 0.000 description 3
- FMDHKPRACUXATF-ACZMJKKPSA-N Ser-Gln-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O FMDHKPRACUXATF-ACZMJKKPSA-N 0.000 description 3
- SFTZTYBXIXLRGQ-JBDRJPRFSA-N Ser-Ile-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O SFTZTYBXIXLRGQ-JBDRJPRFSA-N 0.000 description 3
- IFPBAGJBHSNYPR-ZKWXMUAHSA-N Ser-Ile-Gly Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(O)=O IFPBAGJBHSNYPR-ZKWXMUAHSA-N 0.000 description 3
- UIPXCLNLUUAMJU-JBDRJPRFSA-N Ser-Ile-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O UIPXCLNLUUAMJU-JBDRJPRFSA-N 0.000 description 3
- KCNSGAMPBPYUAI-CIUDSAMLSA-N Ser-Leu-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O KCNSGAMPBPYUAI-CIUDSAMLSA-N 0.000 description 3
- FKYWFUYPVKLJLP-DCAQKATOSA-N Ser-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CO FKYWFUYPVKLJLP-DCAQKATOSA-N 0.000 description 3
- SQHKXWODKJDZRC-LKXGYXEUSA-N Ser-Thr-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(O)=O SQHKXWODKJDZRC-LKXGYXEUSA-N 0.000 description 3
- DYEGLQRVMBWQLD-IXOXFDKPSA-N Ser-Thr-Phe Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)NC(=O)[C@H](CO)N)O DYEGLQRVMBWQLD-IXOXFDKPSA-N 0.000 description 3
- UBTNVMGPMYDYIU-HJPIBITLSA-N Ser-Tyr-Ile Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O UBTNVMGPMYDYIU-HJPIBITLSA-N 0.000 description 3
- OQSQCUWQOIHECT-YJRXYDGGSA-N Ser-Tyr-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O OQSQCUWQOIHECT-YJRXYDGGSA-N 0.000 description 3
- UKKROEYWYIHWBD-ZKWXMUAHSA-N Ser-Val-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O UKKROEYWYIHWBD-ZKWXMUAHSA-N 0.000 description 3
- DFTCYYILCSQGIZ-GCJQMDKQSA-N Thr-Ala-Asn Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(O)=O DFTCYYILCSQGIZ-GCJQMDKQSA-N 0.000 description 3
- BSNZTJXVDOINSR-JXUBOQSCSA-N Thr-Ala-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(O)=O BSNZTJXVDOINSR-JXUBOQSCSA-N 0.000 description 3
- SKHPKKYKDYULDH-HJGDQZAQSA-N Thr-Asn-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(O)=O SKHPKKYKDYULDH-HJGDQZAQSA-N 0.000 description 3
- MFEBUIFJVPNZLO-OLHMAJIHSA-N Thr-Asp-Asn Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O MFEBUIFJVPNZLO-OLHMAJIHSA-N 0.000 description 3
- LGNBRHZANHMZHK-NUMRIWBASA-N Thr-Glu-Asp Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)O)N)O LGNBRHZANHMZHK-NUMRIWBASA-N 0.000 description 3
- QQWNRERCGGZOKG-WEDXCCLWSA-N Thr-Gly-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(O)=O QQWNRERCGGZOKG-WEDXCCLWSA-N 0.000 description 3
- MPUMPERGHHJGRP-WEDXCCLWSA-N Thr-Gly-Lys Chemical compound C[C@H]([C@@H](C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)O)N)O MPUMPERGHHJGRP-WEDXCCLWSA-N 0.000 description 3
- RFKVQLIXNVEOMB-WEDXCCLWSA-N Thr-Leu-Gly Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)O)N)O RFKVQLIXNVEOMB-WEDXCCLWSA-N 0.000 description 3
- NZRUWPIYECBYRK-HTUGSXCWSA-N Thr-Phe-Glu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(O)=O NZRUWPIYECBYRK-HTUGSXCWSA-N 0.000 description 3
- VGYVVSQFSSKZRJ-OEAJRASXSA-N Thr-Phe-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)[C@H](O)C)CC1=CC=CC=C1 VGYVVSQFSSKZRJ-OEAJRASXSA-N 0.000 description 3
- IQPWNQRRAJHOKV-KATARQTJSA-N Thr-Ser-Lys Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCCN IQPWNQRRAJHOKV-KATARQTJSA-N 0.000 description 3
- COYHRQWNJDJCNA-NUJDXYNKSA-N Thr-Thr-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O COYHRQWNJDJCNA-NUJDXYNKSA-N 0.000 description 3
- BKVICMPZWRNWOC-RHYQMDGZSA-N Thr-Val-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)[C@@H](C)O BKVICMPZWRNWOC-RHYQMDGZSA-N 0.000 description 3
- VEYXZZGMIBKXCN-UBHSHLNASA-N Trp-Asp-Asp Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)O)N VEYXZZGMIBKXCN-UBHSHLNASA-N 0.000 description 3
- ZWZOCUWOXSDYFZ-CQDKDKBSSA-N Tyr-Ala-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 ZWZOCUWOXSDYFZ-CQDKDKBSSA-N 0.000 description 3
- UNUZEBFXGWVAOP-DZKIICNBSA-N Tyr-Glu-Val Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O UNUZEBFXGWVAOP-DZKIICNBSA-N 0.000 description 3
- NMPXRFYMZDIBRF-ZOBUZTSGSA-N Val-Asn-Trp Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)N NMPXRFYMZDIBRF-ZOBUZTSGSA-N 0.000 description 3
- BMGOFDMKDVVGJG-NHCYSSNCSA-N Val-Asp-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)O)N BMGOFDMKDVVGJG-NHCYSSNCSA-N 0.000 description 3
- OUUBKKIJQIAPRI-LAEOZQHASA-N Val-Gln-Asn Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O OUUBKKIJQIAPRI-LAEOZQHASA-N 0.000 description 3
- UZDHNIJRRTUKKC-DLOVCJGASA-N Val-Gln-Val Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](C(C)C)C(=O)O)N UZDHNIJRRTUKKC-DLOVCJGASA-N 0.000 description 3
- CELJCNRXKZPTCX-XPUUQOCRSA-N Val-Gly-Ala Chemical compound CC(C)[C@H](N)C(=O)NCC(=O)N[C@@H](C)C(O)=O CELJCNRXKZPTCX-XPUUQOCRSA-N 0.000 description 3
- DJEVQCWNMQOABE-RCOVLWMOSA-N Val-Gly-Asp Chemical compound CC(C)[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)O)N DJEVQCWNMQOABE-RCOVLWMOSA-N 0.000 description 3
- IEBGHUMBJXIXHM-AVGNSLFASA-N Val-Lys-Met Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(=O)O)N IEBGHUMBJXIXHM-AVGNSLFASA-N 0.000 description 3
- PGQUDQYHWICSAB-NAKRPEOUSA-N Val-Ser-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](C(C)C)N PGQUDQYHWICSAB-NAKRPEOUSA-N 0.000 description 3
- WUFHZIRMAZZWRS-OSUNSFLBSA-N Val-Thr-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](C(C)C)N WUFHZIRMAZZWRS-OSUNSFLBSA-N 0.000 description 3
- HTONZBWRYUKUKC-RCWTZXSCSA-N Val-Thr-Val Chemical compound CC(C)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O HTONZBWRYUKUKC-RCWTZXSCSA-N 0.000 description 3
- AOILQMZPNLUXCM-AVGNSLFASA-N Val-Val-Lys Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CCCCN AOILQMZPNLUXCM-AVGNSLFASA-N 0.000 description 3
- 108010024078 alanyl-glycyl-serine Proteins 0.000 description 3
- 108010041407 alanylaspartic acid Proteins 0.000 description 3
- 229940031567 attenuated vaccine Drugs 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 239000012634 fragment Substances 0.000 description 3
- 108010006664 gamma-glutamyl-glycyl-glycine Proteins 0.000 description 3
- 108010063718 gamma-glutamylaspartic acid Proteins 0.000 description 3
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 3
- 230000028996 humoral immune response Effects 0.000 description 3
- 230000003053 immunization Effects 0.000 description 3
- 238000002649 immunization Methods 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 230000001965 increasing effect Effects 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 230000003993 interaction Effects 0.000 description 3
- 108010057821 leucylproline Proteins 0.000 description 3
- 108010064235 lysylglycine Proteins 0.000 description 3
- 108010051242 phenylalanylserine Proteins 0.000 description 3
- 108010031719 prolyl-serine Proteins 0.000 description 3
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 210000004989 spleen cell Anatomy 0.000 description 3
- 108010072986 threonyl-seryl-lysine Proteins 0.000 description 3
- IBIDRSSEHFLGSD-UHFFFAOYSA-N valinyl-arginine Natural products CC(C)C(N)C(=O)NC(C(O)=O)CCCN=C(N)N IBIDRSSEHFLGSD-UHFFFAOYSA-N 0.000 description 3
- 239000011534 wash buffer Substances 0.000 description 3
- GJLXVWOMRRWCIB-MERZOTPQSA-N (2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-acetamido-5-(diaminomethylideneamino)pentanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanamide Chemical compound C([C@H](NC(=O)[C@H](CCCN=C(N)N)NC(=O)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(N)=O)C1=CC=C(O)C=C1 GJLXVWOMRRWCIB-MERZOTPQSA-N 0.000 description 2
- HMUNWXXNJPVALC-UHFFFAOYSA-N 1-[4-[2-(2,3-dihydro-1H-inden-2-ylamino)pyrimidin-5-yl]piperazin-1-yl]-2-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)ethanone Chemical compound C1C(CC2=CC=CC=C12)NC1=NC=C(C=N1)N1CCN(CC1)C(CN1CC2=C(CC1)NN=N2)=O HMUNWXXNJPVALC-UHFFFAOYSA-N 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- 108010036211 5-HT-moduline Proteins 0.000 description 2
- CONKBQPVFMXDOV-QHCPKHFHSA-N 6-[(5S)-5-[[4-[2-(2,3-dihydro-1H-inden-2-ylamino)pyrimidin-5-yl]piperazin-1-yl]methyl]-2-oxo-1,3-oxazolidin-3-yl]-3H-1,3-benzoxazol-2-one Chemical compound C1C(CC2=CC=CC=C12)NC1=NC=C(C=N1)N1CCN(CC1)C[C@H]1CN(C(O1)=O)C1=CC2=C(NC(O2)=O)C=C1 CONKBQPVFMXDOV-QHCPKHFHSA-N 0.000 description 2
- 229920000936 Agarose Polymers 0.000 description 2
- DKJPOZOEBONHFS-ZLUOBGJFSA-N Ala-Ala-Asp Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC(O)=O DKJPOZOEBONHFS-ZLUOBGJFSA-N 0.000 description 2
- TTXMOJWKNRJWQJ-FXQIFTODSA-N Ala-Arg-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)C)CCCN=C(N)N TTXMOJWKNRJWQJ-FXQIFTODSA-N 0.000 description 2
- ZEXDYVGDZJBRMO-ACZMJKKPSA-N Ala-Asn-Gln Chemical compound C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N ZEXDYVGDZJBRMO-ACZMJKKPSA-N 0.000 description 2
- WXERCAHAIKMTKX-ZLUOBGJFSA-N Ala-Asp-Asp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O WXERCAHAIKMTKX-ZLUOBGJFSA-N 0.000 description 2
- KIUYPHAMDKDICO-WHFBIAKZSA-N Ala-Asp-Gly Chemical compound C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(O)=O KIUYPHAMDKDICO-WHFBIAKZSA-N 0.000 description 2
- ZIWWTZWAKYBUOB-CIUDSAMLSA-N Ala-Asp-Leu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O ZIWWTZWAKYBUOB-CIUDSAMLSA-N 0.000 description 2
- KUDREHRZRIVKHS-UWJYBYFXSA-N Ala-Asp-Tyr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O KUDREHRZRIVKHS-UWJYBYFXSA-N 0.000 description 2
- VIGKUFXFTPWYER-BIIVOSGPSA-N Ala-Cys-Pro Chemical compound C[C@@H](C(=O)N[C@@H](CS)C(=O)N1CCC[C@@H]1C(=O)O)N VIGKUFXFTPWYER-BIIVOSGPSA-N 0.000 description 2
- YIGLXQRFQVWFEY-NRPADANISA-N Ala-Gln-Val Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(O)=O YIGLXQRFQVWFEY-NRPADANISA-N 0.000 description 2
- PAIHPOGPJVUFJY-WDSKDSINSA-N Ala-Glu-Gly Chemical compound C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O PAIHPOGPJVUFJY-WDSKDSINSA-N 0.000 description 2
- GGNHBHYDMUDXQB-KBIXCLLPSA-N Ala-Glu-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)N GGNHBHYDMUDXQB-KBIXCLLPSA-N 0.000 description 2
- HXNNRBHASOSVPG-GUBZILKMSA-N Ala-Glu-Leu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O HXNNRBHASOSVPG-GUBZILKMSA-N 0.000 description 2
- SIGTYDNEPYEXGK-ZANVPECISA-N Ala-Gly-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)CNC(=O)[C@@H](N)C)C(O)=O)=CNC2=C1 SIGTYDNEPYEXGK-ZANVPECISA-N 0.000 description 2
- NYDBKUNVSALYPX-NAKRPEOUSA-N Ala-Ile-Arg Chemical compound C[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CCCN=C(N)N NYDBKUNVSALYPX-NAKRPEOUSA-N 0.000 description 2
- 108010011667 Ala-Phe-Ala Proteins 0.000 description 2
- MMLHRUJLOUSRJX-CIUDSAMLSA-N Ala-Ser-Lys Chemical compound C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCCN MMLHRUJLOUSRJX-CIUDSAMLSA-N 0.000 description 2
- ARHJJAAWNWOACN-FXQIFTODSA-N Ala-Ser-Val Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O ARHJJAAWNWOACN-FXQIFTODSA-N 0.000 description 2
- OEVCHROQUIVQFZ-YTLHQDLWSA-N Ala-Thr-Ala Chemical compound C[C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@@H](C)C(O)=O OEVCHROQUIVQFZ-YTLHQDLWSA-N 0.000 description 2
- HCBKAOZYACJUEF-XQXXSGGOSA-N Ala-Thr-Gln Chemical compound N[C@@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@@H](CCC(N)=O)C(=O)O HCBKAOZYACJUEF-XQXXSGGOSA-N 0.000 description 2
- KUFVXLQLDHJVOG-SHGPDSBTSA-N Ala-Thr-Thr Chemical compound C[C@H]([C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)O)NC(=O)[C@H](C)N)O KUFVXLQLDHJVOG-SHGPDSBTSA-N 0.000 description 2
- 102100031325 Anthrax toxin receptor 2 Human genes 0.000 description 2
- DCGLNNVKIZXQOJ-FXQIFTODSA-N Arg-Asn-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CCCN=C(N)N)N DCGLNNVKIZXQOJ-FXQIFTODSA-N 0.000 description 2
- PNQWAUXQDBIJDY-GUBZILKMSA-N Arg-Glu-Glu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O PNQWAUXQDBIJDY-GUBZILKMSA-N 0.000 description 2
- OQCWXQJLCDPRHV-UWVGGRQHSA-N Arg-Gly-Leu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC(C)C)C(O)=O OQCWXQJLCDPRHV-UWVGGRQHSA-N 0.000 description 2
- WVNFNPGXYADPPO-BQBZGAKWSA-N Arg-Gly-Ser Chemical compound NC(N)=NCCC[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O WVNFNPGXYADPPO-BQBZGAKWSA-N 0.000 description 2
- YTMKMRSYXHBGER-IHRRRGAJSA-N Arg-Phe-Asn Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N YTMKMRSYXHBGER-IHRRRGAJSA-N 0.000 description 2
- DPLFNLDACGGBAK-KKUMJFAQSA-N Arg-Phe-Glu Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N DPLFNLDACGGBAK-KKUMJFAQSA-N 0.000 description 2
- ADPACBMPYWJJCE-FXQIFTODSA-N Arg-Ser-Asp Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O ADPACBMPYWJJCE-FXQIFTODSA-N 0.000 description 2
- DNLQVHBBMPZUGJ-BQBZGAKWSA-N Arg-Ser-Gly Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O DNLQVHBBMPZUGJ-BQBZGAKWSA-N 0.000 description 2
- RYQSYXFGFOTJDJ-RHYQMDGZSA-N Arg-Thr-Leu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O RYQSYXFGFOTJDJ-RHYQMDGZSA-N 0.000 description 2
- HZPSDHRYYIORKR-WHFBIAKZSA-N Asn-Ala-Gly Chemical compound OC(=O)CNC(=O)[C@H](C)NC(=O)[C@@H](N)CC(N)=O HZPSDHRYYIORKR-WHFBIAKZSA-N 0.000 description 2
- KXFCBAHYSLJCCY-ZLUOBGJFSA-N Asn-Asn-Ser Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O KXFCBAHYSLJCCY-ZLUOBGJFSA-N 0.000 description 2
- QISZHYWZHJRDAO-CIUDSAMLSA-N Asn-Asp-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(=O)N)N QISZHYWZHJRDAO-CIUDSAMLSA-N 0.000 description 2
- OLVIPTLKNSAYRJ-YUMQZZPRSA-N Asn-Gly-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CC(=O)N)N OLVIPTLKNSAYRJ-YUMQZZPRSA-N 0.000 description 2
- NCFJQJRLQJEECD-NHCYSSNCSA-N Asn-Leu-Val Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(O)=O NCFJQJRLQJEECD-NHCYSSNCSA-N 0.000 description 2
- FTSAJSADJCMDHH-CIUDSAMLSA-N Asn-Lys-Asp Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](CC(=O)N)N FTSAJSADJCMDHH-CIUDSAMLSA-N 0.000 description 2
- NYGILGUOUOXGMJ-YUMQZZPRSA-N Asn-Lys-Gly Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(O)=O NYGILGUOUOXGMJ-YUMQZZPRSA-N 0.000 description 2
- LRCIOEVFVGXZKB-BZSNNMDCSA-N Asn-Tyr-Tyr Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O LRCIOEVFVGXZKB-BZSNNMDCSA-N 0.000 description 2
- CBHVAFXKOYAHOY-NHCYSSNCSA-N Asn-Val-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O CBHVAFXKOYAHOY-NHCYSSNCSA-N 0.000 description 2
- XOQYDFCQPWAMSA-KKHAAJSZSA-N Asn-Val-Thr Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O XOQYDFCQPWAMSA-KKHAAJSZSA-N 0.000 description 2
- MRQQMVZUHXUPEV-IHRRRGAJSA-N Asp-Arg-Phe Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O MRQQMVZUHXUPEV-IHRRRGAJSA-N 0.000 description 2
- XYBJLTKSGFBLCS-QXEWZRGKSA-N Asp-Arg-Val Chemical compound NC(N)=NCCC[C@@H](C(=O)N[C@@H](C(C)C)C(O)=O)NC(=O)[C@@H](N)CC(O)=O XYBJLTKSGFBLCS-QXEWZRGKSA-N 0.000 description 2
- FANQWNCPNFEPGZ-WHFBIAKZSA-N Asp-Asp-Gly Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(O)=O FANQWNCPNFEPGZ-WHFBIAKZSA-N 0.000 description 2
- WBDWQKRLTVCDSY-WHFBIAKZSA-N Asp-Gly-Asp Chemical compound OC(=O)C[C@H](N)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(O)=O WBDWQKRLTVCDSY-WHFBIAKZSA-N 0.000 description 2
- OMMIEVATLAGRCK-BYPYZUCNSA-N Asp-Gly-Gly Chemical compound OC(=O)C[C@H](N)C(=O)NCC(=O)NCC(O)=O OMMIEVATLAGRCK-BYPYZUCNSA-N 0.000 description 2
- PZXPWHFYZXTFBI-YUMQZZPRSA-N Asp-Gly-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CC(O)=O PZXPWHFYZXTFBI-YUMQZZPRSA-N 0.000 description 2
- NRIFEOUAFLTMFJ-AAEUAGOBSA-N Asp-Gly-Trp Chemical compound [H]N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O NRIFEOUAFLTMFJ-AAEUAGOBSA-N 0.000 description 2
- UZNSWMFLKVKJLI-VHWLVUOQSA-N Asp-Ile-Trp Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O UZNSWMFLKVKJLI-VHWLVUOQSA-N 0.000 description 2
- JNNVNVRBYUJYGS-CIUDSAMLSA-N Asp-Leu-Ala Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(O)=O JNNVNVRBYUJYGS-CIUDSAMLSA-N 0.000 description 2
- PAYPSKIBMDHZPI-CIUDSAMLSA-N Asp-Leu-Asp Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O PAYPSKIBMDHZPI-CIUDSAMLSA-N 0.000 description 2
- ORRJQLIATJDMQM-HJGDQZAQSA-N Asp-Leu-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC(O)=O ORRJQLIATJDMQM-HJGDQZAQSA-N 0.000 description 2
- XXAMCEGRCZQGEM-ZLUOBGJFSA-N Asp-Ser-Asn Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O XXAMCEGRCZQGEM-ZLUOBGJFSA-N 0.000 description 2
- RSMZEHCMIOKNMW-GSSVUCPTSA-N Asp-Thr-Thr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O RSMZEHCMIOKNMW-GSSVUCPTSA-N 0.000 description 2
- JDDYEZGPYBBPBN-JRQIVUDYSA-N Asp-Thr-Tyr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O JDDYEZGPYBBPBN-JRQIVUDYSA-N 0.000 description 2
- KNDCWFXCFKSEBM-AVGNSLFASA-N Asp-Tyr-Glu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(O)=O KNDCWFXCFKSEBM-AVGNSLFASA-N 0.000 description 2
- ZQFZEBRNAMXXJV-KKUMJFAQSA-N Asp-Tyr-His Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)NC(=O)[C@H](CC(=O)O)N)O ZQFZEBRNAMXXJV-KKUMJFAQSA-N 0.000 description 2
- 241000193738 Bacillus anthracis Species 0.000 description 2
- 208000035473 Communicable disease Diseases 0.000 description 2
- DCXGXDGGXVZVMY-GHCJXIJMSA-N Cys-Asn-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CS DCXGXDGGXVZVMY-GHCJXIJMSA-N 0.000 description 2
- UWXFFVQPAMBETM-ZLUOBGJFSA-N Cys-Asp-Asn Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O UWXFFVQPAMBETM-ZLUOBGJFSA-N 0.000 description 2
- UCMIKRLLIOVDRJ-XKBZYTNZSA-N Cys-Gln-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CS)N)O UCMIKRLLIOVDRJ-XKBZYTNZSA-N 0.000 description 2
- ZMWOJVAXTOUHAP-ZKWXMUAHSA-N Cys-Ile-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)NCC(=O)O)NC(=O)[C@H](CS)N ZMWOJVAXTOUHAP-ZKWXMUAHSA-N 0.000 description 2
- IDFVDSBJNMPBSX-SRVKXCTJSA-N Cys-Lys-Leu Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O IDFVDSBJNMPBSX-SRVKXCTJSA-N 0.000 description 2
- CLEFUAZULXANBU-MELADBBJSA-N Cys-Tyr-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC2=CC=C(C=C2)O)NC(=O)[C@H](CS)N)C(=O)O CLEFUAZULXANBU-MELADBBJSA-N 0.000 description 2
- 229920002307 Dextran Polymers 0.000 description 2
- SHERTACNJPYHAR-ACZMJKKPSA-N Gln-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCC(N)=O SHERTACNJPYHAR-ACZMJKKPSA-N 0.000 description 2
- LPYPANUXJGFMGV-FXQIFTODSA-N Gln-Gln-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CCC(=O)N)N LPYPANUXJGFMGV-FXQIFTODSA-N 0.000 description 2
- KVXVVDFOZNYYKZ-DCAQKATOSA-N Gln-Gln-Leu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(O)=O KVXVVDFOZNYYKZ-DCAQKATOSA-N 0.000 description 2
- KHGGWBRVRPHFMH-PEFMBERDSA-N Gln-Ile-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCC(=O)N)N KHGGWBRVRPHFMH-PEFMBERDSA-N 0.000 description 2
- FTIJVMLAGRAYMJ-MNXVOIDGSA-N Gln-Ile-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CCC(N)=O FTIJVMLAGRAYMJ-MNXVOIDGSA-N 0.000 description 2
- MSHXWFKYXJTLEZ-CIUDSAMLSA-N Gln-Met-Asn Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCC(=O)N)N MSHXWFKYXJTLEZ-CIUDSAMLSA-N 0.000 description 2
- LHMWTCWZARHLPV-CIUDSAMLSA-N Gln-Met-Ser Chemical compound CSCC[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CCC(=O)N)N LHMWTCWZARHLPV-CIUDSAMLSA-N 0.000 description 2
- SYZZMPFLOLSMHL-XHNCKOQMSA-N Gln-Ser-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)N)N)C(=O)O SYZZMPFLOLSMHL-XHNCKOQMSA-N 0.000 description 2
- STHSGOZLFLFGSS-SUSMZKCASA-N Gln-Thr-Thr Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O STHSGOZLFLFGSS-SUSMZKCASA-N 0.000 description 2
- RUFHOVYUYSNDNY-ACZMJKKPSA-N Glu-Ala-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCC(O)=O RUFHOVYUYSNDNY-ACZMJKKPSA-N 0.000 description 2
- JJKKWYQVHRUSDG-GUBZILKMSA-N Glu-Ala-Lys Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(O)=O JJKKWYQVHRUSDG-GUBZILKMSA-N 0.000 description 2
- PXHABOCPJVTGEK-BQBZGAKWSA-N Glu-Gln-Gly Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(O)=O PXHABOCPJVTGEK-BQBZGAKWSA-N 0.000 description 2
- PVBBEKPHARMPHX-DCAQKATOSA-N Glu-Gln-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CCC(O)=O PVBBEKPHARMPHX-DCAQKATOSA-N 0.000 description 2
- AIGROOHQXCACHL-WDSKDSINSA-N Glu-Gly-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](C)C(O)=O AIGROOHQXCACHL-WDSKDSINSA-N 0.000 description 2
- XOFYVODYSNKPDK-AVGNSLFASA-N Glu-His-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)NC(=O)[C@H](CCC(=O)O)N XOFYVODYSNKPDK-AVGNSLFASA-N 0.000 description 2
- VSRCAOIHMGCIJK-SRVKXCTJSA-N Glu-Leu-Arg Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O VSRCAOIHMGCIJK-SRVKXCTJSA-N 0.000 description 2
- SJJHXJDSNQJMMW-SRVKXCTJSA-N Glu-Lys-Arg Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O SJJHXJDSNQJMMW-SRVKXCTJSA-N 0.000 description 2
- JWNZHMSRZXXGTM-XKBZYTNZSA-N Glu-Ser-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O JWNZHMSRZXXGTM-XKBZYTNZSA-N 0.000 description 2
- UMZHHILWZBFPGL-LOKLDPHHSA-N Glu-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCC(=O)O)N)O UMZHHILWZBFPGL-LOKLDPHHSA-N 0.000 description 2
- WGYHAAXZWPEBDQ-IFFSRLJSSA-N Glu-Val-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O WGYHAAXZWPEBDQ-IFFSRLJSSA-N 0.000 description 2
- RLFSBAPJTYKSLG-WHFBIAKZSA-N Gly-Ala-Asp Chemical compound NCC(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(O)=O RLFSBAPJTYKSLG-WHFBIAKZSA-N 0.000 description 2
- MXXXVOYFNVJHMA-IUCAKERBSA-N Gly-Arg-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)CN MXXXVOYFNVJHMA-IUCAKERBSA-N 0.000 description 2
- JSNNHGHYGYMVCK-XVKPBYJWSA-N Gly-Glu-Val Chemical compound [H]NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O JSNNHGHYGYMVCK-XVKPBYJWSA-N 0.000 description 2
- LHYJCVCQPWRMKZ-WEDXCCLWSA-N Gly-Leu-Thr Chemical compound [H]NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O LHYJCVCQPWRMKZ-WEDXCCLWSA-N 0.000 description 2
- LOEANKRDMMVOGZ-YUMQZZPRSA-N Gly-Lys-Asp Chemical compound NCCCC[C@H](NC(=O)CN)C(=O)N[C@@H](CC(O)=O)C(O)=O LOEANKRDMMVOGZ-YUMQZZPRSA-N 0.000 description 2
- MHXKHKWHPNETGG-QWRGUYRKSA-N Gly-Lys-Leu Chemical compound [H]NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O MHXKHKWHPNETGG-QWRGUYRKSA-N 0.000 description 2
- FJWSJWACLMTDMI-WPRPVWTQSA-N Gly-Met-Val Chemical compound [H]NCC(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(O)=O FJWSJWACLMTDMI-WPRPVWTQSA-N 0.000 description 2
- SOEGEPHNZOISMT-BYPYZUCNSA-N Gly-Ser-Gly Chemical compound NCC(=O)N[C@@H](CO)C(=O)NCC(O)=O SOEGEPHNZOISMT-BYPYZUCNSA-N 0.000 description 2
- YABRDIBSPZONIY-BQBZGAKWSA-N Gly-Ser-Met Chemical compound [H]NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(O)=O YABRDIBSPZONIY-BQBZGAKWSA-N 0.000 description 2
- WCORRBXVISTKQL-WHFBIAKZSA-N Gly-Ser-Ser Chemical compound NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O WCORRBXVISTKQL-WHFBIAKZSA-N 0.000 description 2
- NVTPVQLIZCOJFK-FOHZUACHSA-N Gly-Thr-Asp Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O NVTPVQLIZCOJFK-FOHZUACHSA-N 0.000 description 2
- JQFILXICXLDTRR-FBCQKBJTSA-N Gly-Thr-Gly Chemical compound NCC(=O)N[C@@H]([C@H](O)C)C(=O)NCC(O)=O JQFILXICXLDTRR-FBCQKBJTSA-N 0.000 description 2
- UMBDRSMLCUYIRI-DVJZZOLTSA-N Gly-Trp-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)NC(=O)CN)O UMBDRSMLCUYIRI-DVJZZOLTSA-N 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- DCRODRAURLJOFY-XPUUQOCRSA-N His-Ala-Gly Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)NCC(O)=O DCRODRAURLJOFY-XPUUQOCRSA-N 0.000 description 2
- QQQHYJFKDLDUNK-CIUDSAMLSA-N His-Asp-Cys Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CS)C(=O)O)N QQQHYJFKDLDUNK-CIUDSAMLSA-N 0.000 description 2
- VYMGAXSNYUFVCK-GUBZILKMSA-N His-Gln-Asn Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(=O)N)C(=O)O)N VYMGAXSNYUFVCK-GUBZILKMSA-N 0.000 description 2
- BQFGKVYHKCNEMF-DCAQKATOSA-N His-Glu-Gln Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CC1=CN=CN1 BQFGKVYHKCNEMF-DCAQKATOSA-N 0.000 description 2
- 241000282414 Homo sapiens Species 0.000 description 2
- 101000796085 Homo sapiens Anthrax toxin receptor 2 Proteins 0.000 description 2
- DMHGKBGOUAJRHU-UHFFFAOYSA-N Ile-Arg-Pro Natural products CCC(C)C(N)C(=O)NC(CCCN=C(N)N)C(=O)N1CCCC1C(O)=O DMHGKBGOUAJRHU-UHFFFAOYSA-N 0.000 description 2
- HDODQNPMSHDXJT-GHCJXIJMSA-N Ile-Asn-Ser Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O HDODQNPMSHDXJT-GHCJXIJMSA-N 0.000 description 2
- RPZFUIQVAPZLRH-GHCJXIJMSA-N Ile-Asp-Ala Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C)C(=O)O)N RPZFUIQVAPZLRH-GHCJXIJMSA-N 0.000 description 2
- IDAHFEPYTJJZFD-PEFMBERDSA-N Ile-Asp-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N IDAHFEPYTJJZFD-PEFMBERDSA-N 0.000 description 2
- BGZIJZJBXRVBGJ-SXTJYALSSA-N Ile-Asp-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)O)N BGZIJZJBXRVBGJ-SXTJYALSSA-N 0.000 description 2
- QSPLUJGYOPZINY-ZPFDUUQYSA-N Ile-Asp-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)O)N QSPLUJGYOPZINY-ZPFDUUQYSA-N 0.000 description 2
- LJKDGRWXYUTRSH-YVNDNENWSA-N Ile-Gln-Gln Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N LJKDGRWXYUTRSH-YVNDNENWSA-N 0.000 description 2
- YBJWJQQBWRARLT-KBIXCLLPSA-N Ile-Gln-Ser Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O YBJWJQQBWRARLT-KBIXCLLPSA-N 0.000 description 2
- BEWFWZRGBDVXRP-PEFMBERDSA-N Ile-Glu-Asn Chemical compound [H]N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O BEWFWZRGBDVXRP-PEFMBERDSA-N 0.000 description 2
- QRTVJGKXFSYJGW-KBIXCLLPSA-N Ile-Glu-Cys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CS)C(=O)O)N QRTVJGKXFSYJGW-KBIXCLLPSA-N 0.000 description 2
- MTFVYKQRLXYAQN-LAEOZQHASA-N Ile-Glu-Gly Chemical compound [H]N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O MTFVYKQRLXYAQN-LAEOZQHASA-N 0.000 description 2
- LNJLOZYNZFGJMM-DEQVHRJGSA-N Ile-His-Pro Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N2CCC[C@@H]2C(=O)O)N LNJLOZYNZFGJMM-DEQVHRJGSA-N 0.000 description 2
- PFPUFNLHBXKPHY-HTFCKZLJSA-N Ile-Ile-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)O)N PFPUFNLHBXKPHY-HTFCKZLJSA-N 0.000 description 2
- FHPZJWJWTWZKNA-LLLHUVSDSA-N Ile-Phe-Pro Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N2CCC[C@@H]2C(=O)O)N FHPZJWJWTWZKNA-LLLHUVSDSA-N 0.000 description 2
- CAHCWMVNBZJVAW-NAKRPEOUSA-N Ile-Pro-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)O)N CAHCWMVNBZJVAW-NAKRPEOUSA-N 0.000 description 2
- SAEWJTCJQVZQNZ-IUKAMOBKSA-N Ile-Thr-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(=O)N)C(=O)O)N SAEWJTCJQVZQNZ-IUKAMOBKSA-N 0.000 description 2
- HJDZMPFEXINXLO-QPHKQPEJSA-N Ile-Thr-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)O)N HJDZMPFEXINXLO-QPHKQPEJSA-N 0.000 description 2
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 2
- 102000008070 Interferon-gamma Human genes 0.000 description 2
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 2
- PMGDADKJMCOXHX-UHFFFAOYSA-N L-Arginyl-L-glutamin-acetat Natural products NC(=N)NCCCC(N)C(=O)NC(CCC(N)=O)C(O)=O PMGDADKJMCOXHX-UHFFFAOYSA-N 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- RCFDOSNHHZGBOY-UHFFFAOYSA-N L-isoleucyl-L-alanine Natural products CCC(C)C(N)C(=O)NC(C)C(O)=O RCFDOSNHHZGBOY-UHFFFAOYSA-N 0.000 description 2
- SENJXOPIZNYLHU-UHFFFAOYSA-N L-leucyl-L-arginine Natural products CC(C)CC(N)C(=O)NC(C(O)=O)CCCN=C(N)N SENJXOPIZNYLHU-UHFFFAOYSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- 241000254158 Lampyridae Species 0.000 description 2
- XBBKIIGCUMBKCO-JXUBOQSCSA-N Leu-Ala-Thr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O XBBKIIGCUMBKCO-JXUBOQSCSA-N 0.000 description 2
- ILJREDZFPHTUIE-GUBZILKMSA-N Leu-Asp-Glu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O ILJREDZFPHTUIE-GUBZILKMSA-N 0.000 description 2
- HFBCHNRFRYLZNV-GUBZILKMSA-N Leu-Glu-Asp Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O HFBCHNRFRYLZNV-GUBZILKMSA-N 0.000 description 2
- HQUXQAMSWFIRET-AVGNSLFASA-N Leu-Glu-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H](C(O)=O)CCCCN HQUXQAMSWFIRET-AVGNSLFASA-N 0.000 description 2
- OXRLYTYUXAQTHP-YUMQZZPRSA-N Leu-Gly-Ala Chemical compound [H]N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](C)C(O)=O OXRLYTYUXAQTHP-YUMQZZPRSA-N 0.000 description 2
- VWHGTYCRDRBSFI-ZETCQYMHSA-N Leu-Gly-Gly Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)NCC(O)=O VWHGTYCRDRBSFI-ZETCQYMHSA-N 0.000 description 2
- APFJUBGRZGMQFF-QWRGUYRKSA-N Leu-Gly-Lys Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCCCN APFJUBGRZGMQFF-QWRGUYRKSA-N 0.000 description 2
- TVEOVCYCYGKVPP-HSCHXYMDSA-N Leu-Ile-Trp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)NC(=O)[C@H](CC(C)C)N TVEOVCYCYGKVPP-HSCHXYMDSA-N 0.000 description 2
- WMIOEVKKYIMVKI-DCAQKATOSA-N Leu-Pro-Ala Chemical compound [H]N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O WMIOEVKKYIMVKI-DCAQKATOSA-N 0.000 description 2
- AMSSKPUHBUQBOQ-SRVKXCTJSA-N Leu-Ser-Lys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)O)N AMSSKPUHBUQBOQ-SRVKXCTJSA-N 0.000 description 2
- ICYRCNICGBJLGM-HJGDQZAQSA-N Leu-Thr-Asp Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CC(O)=O ICYRCNICGBJLGM-HJGDQZAQSA-N 0.000 description 2
- LFSQWRSVPNKJGP-WDCWCFNPSA-N Leu-Thr-Glu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CCC(O)=O LFSQWRSVPNKJGP-WDCWCFNPSA-N 0.000 description 2
- ILDSIMPXNFWKLH-KATARQTJSA-N Leu-Thr-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O ILDSIMPXNFWKLH-KATARQTJSA-N 0.000 description 2
- VHTIZYYHIUHMCA-JYJNAYRXSA-N Leu-Tyr-Gln Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(N)=O)C(O)=O VHTIZYYHIUHMCA-JYJNAYRXSA-N 0.000 description 2
- YQFZRHYZLARWDY-IHRRRGAJSA-N Leu-Val-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CCCCN YQFZRHYZLARWDY-IHRRRGAJSA-N 0.000 description 2
- PNPYKQFJGRFYJE-GUBZILKMSA-N Lys-Ala-Glu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O PNPYKQFJGRFYJE-GUBZILKMSA-N 0.000 description 2
- UWKNTTJNVSYXPC-CIUDSAMLSA-N Lys-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN UWKNTTJNVSYXPC-CIUDSAMLSA-N 0.000 description 2
- QZONCCHVHCOBSK-YUMQZZPRSA-N Lys-Gly-Asn Chemical compound [H]N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(O)=O QZONCCHVHCOBSK-YUMQZZPRSA-N 0.000 description 2
- SQJSXOQXJYAVRV-SRVKXCTJSA-N Lys-His-Asn Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCCCN)N SQJSXOQXJYAVRV-SRVKXCTJSA-N 0.000 description 2
- OVAOHZIOUBEQCJ-IHRRRGAJSA-N Lys-Leu-Arg Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O OVAOHZIOUBEQCJ-IHRRRGAJSA-N 0.000 description 2
- NJNRBRKHOWSGMN-SRVKXCTJSA-N Lys-Leu-Asn Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O NJNRBRKHOWSGMN-SRVKXCTJSA-N 0.000 description 2
- GOVDTWNJCBRRBJ-DCAQKATOSA-N Lys-Met-Asn Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCCCN)N GOVDTWNJCBRRBJ-DCAQKATOSA-N 0.000 description 2
- AZOFEHCPMBRNFD-BZSNNMDCSA-N Lys-Phe-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(O)=O)CC1=CC=CC=C1 AZOFEHCPMBRNFD-BZSNNMDCSA-N 0.000 description 2
- SQXZLVXQXWILKW-KKUMJFAQSA-N Lys-Ser-Phe Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O SQXZLVXQXWILKW-KKUMJFAQSA-N 0.000 description 2
- CUHGAUZONORRIC-HJGDQZAQSA-N Lys-Thr-Asn Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCCCN)N)O CUHGAUZONORRIC-HJGDQZAQSA-N 0.000 description 2
- QVTDVTONTRSQMF-WDCWCFNPSA-N Lys-Thr-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H]([C@H](O)C)NC(=O)[C@@H](N)CCCCN QVTDVTONTRSQMF-WDCWCFNPSA-N 0.000 description 2
- RMOKGALPSPOYKE-KATARQTJSA-N Lys-Thr-Ser Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O RMOKGALPSPOYKE-KATARQTJSA-N 0.000 description 2
- WINFHLHJTRGLCV-BZSNNMDCSA-N Lys-Tyr-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(O)=O)CC1=CC=C(O)C=C1 WINFHLHJTRGLCV-BZSNNMDCSA-N 0.000 description 2
- VVURYEVJJTXWNE-ULQDDVLXSA-N Lys-Tyr-Val Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C(C)C)C(O)=O VVURYEVJJTXWNE-ULQDDVLXSA-N 0.000 description 2
- MDDUIRLQCYVRDO-NHCYSSNCSA-N Lys-Val-Asn Chemical compound NC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CCCCN MDDUIRLQCYVRDO-NHCYSSNCSA-N 0.000 description 2
- QLFAPXUXEBAWEK-NHCYSSNCSA-N Lys-Val-Asp Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O QLFAPXUXEBAWEK-NHCYSSNCSA-N 0.000 description 2
- KQBJYJXPZBNEIK-DCAQKATOSA-N Met-Glu-Arg Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H](C(O)=O)CCCNC(N)=N KQBJYJXPZBNEIK-DCAQKATOSA-N 0.000 description 2
- RATXDYWHIYNZLE-DCAQKATOSA-N Met-Lys-Cys Chemical compound CSCC[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)O)N RATXDYWHIYNZLE-DCAQKATOSA-N 0.000 description 2
- XPVCDCMPKCERFT-GUBZILKMSA-N Met-Ser-Arg Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O XPVCDCMPKCERFT-GUBZILKMSA-N 0.000 description 2
- RIIFMEBFDDXGCV-VEVYYDQMSA-N Met-Thr-Asn Chemical compound CSCC[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CC(N)=O RIIFMEBFDDXGCV-VEVYYDQMSA-N 0.000 description 2
- 101100342977 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) leu-1 gene Proteins 0.000 description 2
- CYZBFPYMSJGBRL-DRZSPHRISA-N Phe-Ala-Glu Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O CYZBFPYMSJGBRL-DRZSPHRISA-N 0.000 description 2
- CDNPIRSCAFMMBE-SRVKXCTJSA-N Phe-Asn-Ser Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O CDNPIRSCAFMMBE-SRVKXCTJSA-N 0.000 description 2
- ZENDEDYRYVHBEG-SRVKXCTJSA-N Phe-Asp-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 ZENDEDYRYVHBEG-SRVKXCTJSA-N 0.000 description 2
- UMKYAYXCMYYNHI-AVGNSLFASA-N Phe-Gln-Asn Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(=O)N)C(=O)O)N UMKYAYXCMYYNHI-AVGNSLFASA-N 0.000 description 2
- OYQBFWWQSVIHBN-FHWLQOOXSA-N Phe-Glu-Phe Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O OYQBFWWQSVIHBN-FHWLQOOXSA-N 0.000 description 2
- JJHVFCUWLSKADD-ONGXEEELSA-N Phe-Gly-Ala Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)NCC(=O)N[C@@H](C)C(O)=O JJHVFCUWLSKADD-ONGXEEELSA-N 0.000 description 2
- NAXPHWZXEXNDIW-JTQLQIEISA-N Phe-Gly-Gly Chemical compound OC(=O)CNC(=O)CNC(=O)[C@@H](N)CC1=CC=CC=C1 NAXPHWZXEXNDIW-JTQLQIEISA-N 0.000 description 2
- BPCLGWHVPVTTFM-QWRGUYRKSA-N Phe-Ser-Gly Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)NCC(O)=O BPCLGWHVPVTTFM-QWRGUYRKSA-N 0.000 description 2
- HFZNNDWPHBRNPV-KZVJFYERSA-N Pro-Ala-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O HFZNNDWPHBRNPV-KZVJFYERSA-N 0.000 description 2
- QCARZLHECSFOGG-CIUDSAMLSA-N Pro-Glu-Cys Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CS)C(=O)O QCARZLHECSFOGG-CIUDSAMLSA-N 0.000 description 2
- WVOXLKUUVCCCSU-ZPFDUUQYSA-N Pro-Glu-Ile Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O WVOXLKUUVCCCSU-ZPFDUUQYSA-N 0.000 description 2
- DMKWYMWNEKIPFC-IUCAKERBSA-N Pro-Gly-Arg Chemical compound [H]N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(O)=O DMKWYMWNEKIPFC-IUCAKERBSA-N 0.000 description 2
- FYPGHGXAOZTOBO-IHRRRGAJSA-N Pro-Leu-His Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@@H]2CCCN2 FYPGHGXAOZTOBO-IHRRRGAJSA-N 0.000 description 2
- ABSSTGUCBCDKMU-UWVGGRQHSA-N Pro-Lys-Gly Chemical compound NCCCC[C@@H](C(=O)NCC(O)=O)NC(=O)[C@@H]1CCCN1 ABSSTGUCBCDKMU-UWVGGRQHSA-N 0.000 description 2
- WCNVGGZRTNHOOS-ULQDDVLXSA-N Pro-Lys-Tyr Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)O WCNVGGZRTNHOOS-ULQDDVLXSA-N 0.000 description 2
- WOIFYRZPIORBRY-AVGNSLFASA-N Pro-Lys-Val Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O WOIFYRZPIORBRY-AVGNSLFASA-N 0.000 description 2
- 102000007066 Prostate-Specific Antigen Human genes 0.000 description 2
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 2
- 241000242739 Renilla Species 0.000 description 2
- FIXILCYTSAUERA-FXQIFTODSA-N Ser-Ala-Arg Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O FIXILCYTSAUERA-FXQIFTODSA-N 0.000 description 2
- HRNQLKCLPVKZNE-CIUDSAMLSA-N Ser-Ala-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(O)=O HRNQLKCLPVKZNE-CIUDSAMLSA-N 0.000 description 2
- QVOGDCQNGLBNCR-FXQIFTODSA-N Ser-Arg-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(O)=O QVOGDCQNGLBNCR-FXQIFTODSA-N 0.000 description 2
- RDFQNDHEHVSONI-ZLUOBGJFSA-N Ser-Asn-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O RDFQNDHEHVSONI-ZLUOBGJFSA-N 0.000 description 2
- CNIIKZQXBBQHCX-FXQIFTODSA-N Ser-Asp-Arg Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O CNIIKZQXBBQHCX-FXQIFTODSA-N 0.000 description 2
- HEQPKICPPDOSIN-SRVKXCTJSA-N Ser-Asp-Tyr Chemical compound OC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 HEQPKICPPDOSIN-SRVKXCTJSA-N 0.000 description 2
- YQQKYAZABFEYAF-FXQIFTODSA-N Ser-Glu-Gln Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O YQQKYAZABFEYAF-FXQIFTODSA-N 0.000 description 2
- UOLGINIHBRIECN-FXQIFTODSA-N Ser-Glu-Glu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O UOLGINIHBRIECN-FXQIFTODSA-N 0.000 description 2
- SNVIOQXAHVORQM-WDSKDSINSA-N Ser-Gly-Gln Chemical compound [H]N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(O)=O SNVIOQXAHVORQM-WDSKDSINSA-N 0.000 description 2
- IOVHBRCQOGWAQH-ZKWXMUAHSA-N Ser-Gly-Ile Chemical compound [H]N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(O)=O IOVHBRCQOGWAQH-ZKWXMUAHSA-N 0.000 description 2
- GZFAWAQTEYDKII-YUMQZZPRSA-N Ser-Gly-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CO GZFAWAQTEYDKII-YUMQZZPRSA-N 0.000 description 2
- OQPNSDWGAMFJNU-QWRGUYRKSA-N Ser-Gly-Tyr Chemical compound OC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 OQPNSDWGAMFJNU-QWRGUYRKSA-N 0.000 description 2
- CJINPXGSKSZQNE-KBIXCLLPSA-N Ser-Ile-Gln Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(O)=O CJINPXGSKSZQNE-KBIXCLLPSA-N 0.000 description 2
- VMLONWHIORGALA-SRVKXCTJSA-N Ser-Leu-Leu Chemical compound CC(C)C[C@@H](C([O-])=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]([NH3+])CO VMLONWHIORGALA-SRVKXCTJSA-N 0.000 description 2
- KCGIREHVWRXNDH-GARJFASQSA-N Ser-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CO)N KCGIREHVWRXNDH-GARJFASQSA-N 0.000 description 2
- MUJQWSAWLLRJCE-KATARQTJSA-N Ser-Leu-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O MUJQWSAWLLRJCE-KATARQTJSA-N 0.000 description 2
- GZSZPKSBVAOGIE-CIUDSAMLSA-N Ser-Lys-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O GZSZPKSBVAOGIE-CIUDSAMLSA-N 0.000 description 2
- PPCZVWHJWJFTFN-ZLUOBGJFSA-N Ser-Ser-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O PPCZVWHJWJFTFN-ZLUOBGJFSA-N 0.000 description 2
- BMKNXTJLHFIAAH-CIUDSAMLSA-N Ser-Ser-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O BMKNXTJLHFIAAH-CIUDSAMLSA-N 0.000 description 2
- DKGRNFUXVTYRAS-UBHSHLNASA-N Ser-Ser-Trp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O DKGRNFUXVTYRAS-UBHSHLNASA-N 0.000 description 2
- VGQVAVQWKJLIRM-FXQIFTODSA-N Ser-Ser-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O VGQVAVQWKJLIRM-FXQIFTODSA-N 0.000 description 2
- XJDMUQCLVSCRSJ-VZFHVOOUSA-N Ser-Thr-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O XJDMUQCLVSCRSJ-VZFHVOOUSA-N 0.000 description 2
- YXEYTHXDRDAIOJ-CWRNSKLLSA-N Ser-Trp-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC2=CNC3=CC=CC=C32)NC(=O)[C@H](CO)N)C(=O)O YXEYTHXDRDAIOJ-CWRNSKLLSA-N 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 230000005867 T cell response Effects 0.000 description 2
- NJEMRSFGDNECGF-GCJQMDKQSA-N Thr-Ala-Asp Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC(O)=O NJEMRSFGDNECGF-GCJQMDKQSA-N 0.000 description 2
- CAJFZCICSVBOJK-SHGPDSBTSA-N Thr-Ala-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O CAJFZCICSVBOJK-SHGPDSBTSA-N 0.000 description 2
- XSLXHSYIVPGEER-KZVJFYERSA-N Thr-Ala-Val Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(O)=O XSLXHSYIVPGEER-KZVJFYERSA-N 0.000 description 2
- NRBUKAHTWRCUEQ-XGEHTFHBSA-N Thr-Cys-Met Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCSC)C(O)=O NRBUKAHTWRCUEQ-XGEHTFHBSA-N 0.000 description 2
- GCXFWAZRHBRYEM-NUMRIWBASA-N Thr-Gln-Asn Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(=O)N)C(=O)O)N)O GCXFWAZRHBRYEM-NUMRIWBASA-N 0.000 description 2
- LIXBDERDAGNVAV-XKBZYTNZSA-N Thr-Gln-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O LIXBDERDAGNVAV-XKBZYTNZSA-N 0.000 description 2
- VGYBYGQXZJDZJU-XQXXSGGOSA-N Thr-Glu-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O VGYBYGQXZJDZJU-XQXXSGGOSA-N 0.000 description 2
- BNGDYRRHRGOPHX-IFFSRLJSSA-N Thr-Glu-Val Chemical compound CC(C)[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)[C@@H](C)O)C(O)=O BNGDYRRHRGOPHX-IFFSRLJSSA-N 0.000 description 2
- CRZNCABIJLRFKZ-IUKAMOBKSA-N Thr-Ile-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H]([C@@H](C)O)N CRZNCABIJLRFKZ-IUKAMOBKSA-N 0.000 description 2
- BVOVIGCHYNFJBZ-JXUBOQSCSA-N Thr-Leu-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(O)=O BVOVIGCHYNFJBZ-JXUBOQSCSA-N 0.000 description 2
- IMDMLDSVUSMAEJ-HJGDQZAQSA-N Thr-Leu-Asn Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O IMDMLDSVUSMAEJ-HJGDQZAQSA-N 0.000 description 2
- KKPOGALELPLJTL-MEYUZBJRSA-N Thr-Lys-Tyr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 KKPOGALELPLJTL-MEYUZBJRSA-N 0.000 description 2
- DXPURPNJDFCKKO-RHYQMDGZSA-N Thr-Lys-Val Chemical compound CC(C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)[C@@H](C)O)C(O)=O DXPURPNJDFCKKO-RHYQMDGZSA-N 0.000 description 2
- YGCDFAJJCRVQKU-RCWTZXSCSA-N Thr-Pro-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)[C@@H](C)O YGCDFAJJCRVQKU-RCWTZXSCSA-N 0.000 description 2
- UQCNIMDPYICBTR-KYNKHSRBSA-N Thr-Thr-Gly Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O UQCNIMDPYICBTR-KYNKHSRBSA-N 0.000 description 2
- NHQVWACSJZJCGJ-FLBSBUHZSA-N Thr-Thr-Ile Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O NHQVWACSJZJCGJ-FLBSBUHZSA-N 0.000 description 2
- LXXCHJKHJYRMIY-FQPOAREZSA-N Thr-Tyr-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(O)=O LXXCHJKHJYRMIY-FQPOAREZSA-N 0.000 description 2
- NJGMALCNYAMYCB-JRQIVUDYSA-N Thr-Tyr-Asn Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(O)=O NJGMALCNYAMYCB-JRQIVUDYSA-N 0.000 description 2
- HTGJDTPQYFMKNC-VFAJRCTISA-N Trp-Thr-Leu Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(O)=O)[C@@H](C)O)=CNC2=C1 HTGJDTPQYFMKNC-VFAJRCTISA-N 0.000 description 2
- BURPTJBFWIOHEY-UWJYBYFXSA-N Tyr-Ala-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 BURPTJBFWIOHEY-UWJYBYFXSA-N 0.000 description 2
- TZXFLDNBYYGLKA-BZSNNMDCSA-N Tyr-Asp-Tyr Chemical compound C([C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=C(O)C=C1 TZXFLDNBYYGLKA-BZSNNMDCSA-N 0.000 description 2
- KEANSLVUGJADPN-LKTVYLICSA-N Tyr-His-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CC1=CN=CN1)NC(=O)[C@H](CC2=CC=C(C=C2)O)N KEANSLVUGJADPN-LKTVYLICSA-N 0.000 description 2
- WVGKPKDWYQXWLU-BZSNNMDCSA-N Tyr-His-Lys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC2=CN=CN2)C(=O)N[C@@H](CCCCN)C(=O)O)N)O WVGKPKDWYQXWLU-BZSNNMDCSA-N 0.000 description 2
- FJBCEFPCVPHPPM-STECZYCISA-N Tyr-Ile-Val Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(O)=O FJBCEFPCVPHPPM-STECZYCISA-N 0.000 description 2
- GITNQBVCEQBDQC-KKUMJFAQSA-N Tyr-Lys-Asn Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(O)=O GITNQBVCEQBDQC-KKUMJFAQSA-N 0.000 description 2
- UMSZZGTXGKHTFJ-SRVKXCTJSA-N Tyr-Ser-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 UMSZZGTXGKHTFJ-SRVKXCTJSA-N 0.000 description 2
- AGDDLOQMXUQPDY-BZSNNMDCSA-N Tyr-Tyr-Ser Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(O)=O AGDDLOQMXUQPDY-BZSNNMDCSA-N 0.000 description 2
- UEOOXDLMQZBPFR-ZKWXMUAHSA-N Val-Ala-Asn Chemical compound C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](C(C)C)N UEOOXDLMQZBPFR-ZKWXMUAHSA-N 0.000 description 2
- KKHRWGYHBZORMQ-NHCYSSNCSA-N Val-Arg-Glu Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N KKHRWGYHBZORMQ-NHCYSSNCSA-N 0.000 description 2
- BYOHPUZJVXWHAE-BYULHYEWSA-N Val-Asn-Asn Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(=O)N)C(=O)O)N BYOHPUZJVXWHAE-BYULHYEWSA-N 0.000 description 2
- HURRXSNHCCSJHA-AUTRQRHGSA-N Val-Gln-Gln Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N HURRXSNHCCSJHA-AUTRQRHGSA-N 0.000 description 2
- WDIGUPHXPBMODF-UMNHJUIQSA-N Val-Glu-Pro Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N1CCC[C@@H]1C(=O)O)N WDIGUPHXPBMODF-UMNHJUIQSA-N 0.000 description 2
- OQWNEUXPKHIEJO-NRPADANISA-N Val-Glu-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CO)C(=O)O)N OQWNEUXPKHIEJO-NRPADANISA-N 0.000 description 2
- BZMIYHIJVVJPCK-QSFUFRPTSA-N Val-Ile-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](C(C)C)N BZMIYHIJVVJPCK-QSFUFRPTSA-N 0.000 description 2
- BTWMICVCQLKKNR-DCAQKATOSA-N Val-Leu-Ser Chemical compound CC(C)[C@H]([NH3+])C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C([O-])=O BTWMICVCQLKKNR-DCAQKATOSA-N 0.000 description 2
- ZRSZTKTVPNSUNA-IHRRRGAJSA-N Val-Lys-Leu Chemical compound CC(C)C[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)C(C)C)C(O)=O ZRSZTKTVPNSUNA-IHRRRGAJSA-N 0.000 description 2
- MJOUSKQHAIARKI-JYJNAYRXSA-N Val-Phe-Val Chemical compound CC(C)[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](C(C)C)C(O)=O)CC1=CC=CC=C1 MJOUSKQHAIARKI-JYJNAYRXSA-N 0.000 description 2
- YTNGABPUXFEOGU-SRVKXCTJSA-N Val-Pro-Arg Chemical compound CC(C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCN=C(N)N)C(O)=O YTNGABPUXFEOGU-SRVKXCTJSA-N 0.000 description 2
- GQMNEJMFMCJJTD-NHCYSSNCSA-N Val-Pro-Gln Chemical compound CC(C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(O)=O GQMNEJMFMCJJTD-NHCYSSNCSA-N 0.000 description 2
- KSFXWENSJABBFI-ZKWXMUAHSA-N Val-Ser-Asn Chemical compound [H]N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O KSFXWENSJABBFI-ZKWXMUAHSA-N 0.000 description 2
- UGFMVXRXULGLNO-XPUUQOCRSA-N Val-Ser-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O UGFMVXRXULGLNO-XPUUQOCRSA-N 0.000 description 2
- CEKSLIVSNNGOKH-KZVJFYERSA-N Val-Thr-Ala Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](C)C(=O)O)NC(=O)[C@H](C(C)C)N)O CEKSLIVSNNGOKH-KZVJFYERSA-N 0.000 description 2
- TVGWMCTYUFBXAP-QTKMDUPCSA-N Val-Thr-His Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](C(C)C)N)O TVGWMCTYUFBXAP-QTKMDUPCSA-N 0.000 description 2
- LCHZBEUVGAVMKS-RHYQMDGZSA-N Val-Thr-Leu Chemical compound CC(C)C[C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)[C@@H](C)O)C(O)=O LCHZBEUVGAVMKS-RHYQMDGZSA-N 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 108010013835 arginine glutamate Proteins 0.000 description 2
- 108010008355 arginyl-glutamine Proteins 0.000 description 2
- 108010052670 arginyl-glutamyl-glutamic acid Proteins 0.000 description 2
- 108010027371 asparaginyl-leucyl-prolyl-arginine Proteins 0.000 description 2
- 230000002238 attenuated effect Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 238000000326 densiometry Methods 0.000 description 2
- 239000012470 diluted sample Substances 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 210000003743 erythrocyte Anatomy 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 108010090037 glycyl-alanyl-isoleucine Proteins 0.000 description 2
- 108010066198 glycyl-leucyl-phenylalanine Proteins 0.000 description 2
- 108010050475 glycyl-leucyl-tyrosine Proteins 0.000 description 2
- 108010048994 glycyl-tyrosyl-alanine Proteins 0.000 description 2
- 108010020688 glycylhistidine Proteins 0.000 description 2
- 108010015792 glycyllysine Proteins 0.000 description 2
- 108010087823 glycyltyrosine Proteins 0.000 description 2
- 108010050343 histidyl-alanyl-glutamine Proteins 0.000 description 2
- 108010018006 histidylserine Proteins 0.000 description 2
- 229960003130 interferon gamma Drugs 0.000 description 2
- 108010034529 leucyl-lysine Proteins 0.000 description 2
- 108010090333 leucyl-lysyl-proline Proteins 0.000 description 2
- 108010000761 leucylarginine Proteins 0.000 description 2
- 108010003700 lysyl aspartic acid Proteins 0.000 description 2
- 108010056582 methionylglutamic acid Proteins 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 230000003472 neutralizing effect Effects 0.000 description 2
- 108010012581 phenylalanylglutamate Proteins 0.000 description 2
- 238000006116 polymerization reaction Methods 0.000 description 2
- 108010053725 prolylvaline Proteins 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 230000019491 signal transduction Effects 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 230000004936 stimulating effect Effects 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 108700004896 tripeptide FEG Proteins 0.000 description 2
- 108010080629 tryptophan-leucine Proteins 0.000 description 2
- 108010014563 tryptophyl-cysteinyl-serine Proteins 0.000 description 2
- 108010044292 tryptophyltyrosine Proteins 0.000 description 2
- IGXNPQWXIRIGBF-KEOOTSPTSA-N (2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-amino-3-(1h-imidazol-5-yl)propanoyl]amino]-3-(1h-imidazol-5-yl)propanoyl]amino]-3-(1h-imidazol-5-yl)propanoyl]amino]-3-(1h-imidazol-5-yl)propanoyl]amino]-3-(1h-imidazol-5-yl)propanoic acid Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1NC=NC=1)C(O)=O)C1=CN=CN1 IGXNPQWXIRIGBF-KEOOTSPTSA-N 0.000 description 1
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 1
- LDXJRKWFNNFDSA-UHFFFAOYSA-N 2-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)-1-[4-[2-[[3-(trifluoromethoxy)phenyl]methylamino]pyrimidin-5-yl]piperazin-1-yl]ethanone Chemical compound C1CN(CC2=NNN=C21)CC(=O)N3CCN(CC3)C4=CN=C(N=C4)NCC5=CC(=CC=C5)OC(F)(F)F LDXJRKWFNNFDSA-UHFFFAOYSA-N 0.000 description 1
- JQMFQLVAJGZSQS-UHFFFAOYSA-N 2-[4-[2-(2,3-dihydro-1H-inden-2-ylamino)pyrimidin-5-yl]piperazin-1-yl]-N-(2-oxo-3H-1,3-benzoxazol-6-yl)acetamide Chemical compound C1C(CC2=CC=CC=C12)NC1=NC=C(C=N1)N1CCN(CC1)CC(=O)NC1=CC2=C(NC(O2)=O)C=C1 JQMFQLVAJGZSQS-UHFFFAOYSA-N 0.000 description 1
- FATXTKJILXPNJL-UHFFFAOYSA-N 2-[[2-[2-[(2-amino-3-methylpentanoyl)amino]propanoylamino]acetyl]amino]-3-phenylpropanoic acid Chemical compound CCC(C)C(N)C(=O)NC(C)C(=O)NCC(=O)NC(C(O)=O)CC1=CC=CC=C1 FATXTKJILXPNJL-UHFFFAOYSA-N 0.000 description 1
- OTEWWRBKGONZBW-UHFFFAOYSA-N 2-[[2-[[2-[(2-azaniumylacetyl)amino]-4-methylpentanoyl]amino]acetyl]amino]acetate Chemical compound NCC(=O)NC(CC(C)C)C(=O)NCC(=O)NCC(O)=O OTEWWRBKGONZBW-UHFFFAOYSA-N 0.000 description 1
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 1
- BFSVOASYOCHEOV-UHFFFAOYSA-N 2-diethylaminoethanol Chemical compound CCN(CC)CCO BFSVOASYOCHEOV-UHFFFAOYSA-N 0.000 description 1
- DFGKGUXTPFWHIX-UHFFFAOYSA-N 6-[2-[4-[2-(2,3-dihydro-1H-inden-2-ylamino)pyrimidin-5-yl]piperazin-1-yl]acetyl]-3H-1,3-benzoxazol-2-one Chemical compound C1C(CC2=CC=CC=C12)NC1=NC=C(C=N1)N1CCN(CC1)CC(=O)C1=CC2=C(NC(O2)=O)C=C1 DFGKGUXTPFWHIX-UHFFFAOYSA-N 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- PIPTUBPKYFRLCP-NHCYSSNCSA-N Ala-Ala-Phe Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 PIPTUBPKYFRLCP-NHCYSSNCSA-N 0.000 description 1
- YYSWCHMLFJLLBJ-ZLUOBGJFSA-N Ala-Ala-Ser Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O YYSWCHMLFJLLBJ-ZLUOBGJFSA-N 0.000 description 1
- MCKSLROAGSDNFC-ACZMJKKPSA-N Ala-Asp-Gln Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O MCKSLROAGSDNFC-ACZMJKKPSA-N 0.000 description 1
- YSMPVONNIWLJML-FXQIFTODSA-N Ala-Asp-Pro Chemical compound C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(O)=O YSMPVONNIWLJML-FXQIFTODSA-N 0.000 description 1
- LGFCAXJBAZESCF-ACZMJKKPSA-N Ala-Gln-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(O)=O LGFCAXJBAZESCF-ACZMJKKPSA-N 0.000 description 1
- FUSPCLTUKXQREV-ACZMJKKPSA-N Ala-Glu-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O FUSPCLTUKXQREV-ACZMJKKPSA-N 0.000 description 1
- BLIMFWGRQKRCGT-YUMQZZPRSA-N Ala-Gly-Lys Chemical compound C[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCCCN BLIMFWGRQKRCGT-YUMQZZPRSA-N 0.000 description 1
- QHASENCZLDHBGX-ONGXEEELSA-N Ala-Gly-Phe Chemical compound C[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 QHASENCZLDHBGX-ONGXEEELSA-N 0.000 description 1
- OBVSBEYOMDWLRJ-BFHQHQDPSA-N Ala-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@H](C)N OBVSBEYOMDWLRJ-BFHQHQDPSA-N 0.000 description 1
- JDIQCVUDDFENPU-ZKWXMUAHSA-N Ala-His-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](N)C)CC1=CNC=N1 JDIQCVUDDFENPU-ZKWXMUAHSA-N 0.000 description 1
- PNALXAODQKTNLV-JBDRJPRFSA-N Ala-Ile-Ala Chemical compound C[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O PNALXAODQKTNLV-JBDRJPRFSA-N 0.000 description 1
- IFKQPMZRDQZSHI-GHCJXIJMSA-N Ala-Ile-Asn Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(O)=O IFKQPMZRDQZSHI-GHCJXIJMSA-N 0.000 description 1
- CKLDHDOIYBVUNP-KBIXCLLPSA-N Ala-Ile-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(O)=O CKLDHDOIYBVUNP-KBIXCLLPSA-N 0.000 description 1
- HHRAXZAYZFFRAM-CIUDSAMLSA-N Ala-Leu-Asn Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O HHRAXZAYZFFRAM-CIUDSAMLSA-N 0.000 description 1
- SDZRIBWEVVRDQI-CIUDSAMLSA-N Ala-Lys-Asp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(O)=O SDZRIBWEVVRDQI-CIUDSAMLSA-N 0.000 description 1
- PMQXMXAASGFUDX-SRVKXCTJSA-N Ala-Lys-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@H](C)N)CCCCN PMQXMXAASGFUDX-SRVKXCTJSA-N 0.000 description 1
- VCSABYLVNWQYQE-UHFFFAOYSA-N Ala-Lys-Lys Natural products NCCCCC(NC(=O)C(N)C)C(=O)NC(CCCCN)C(O)=O VCSABYLVNWQYQE-UHFFFAOYSA-N 0.000 description 1
- NINQYGGNRIBFSC-CIUDSAMLSA-N Ala-Lys-Ser Chemical compound NCCCC[C@H](NC(=O)[C@@H](N)C)C(=O)N[C@@H](CO)C(O)=O NINQYGGNRIBFSC-CIUDSAMLSA-N 0.000 description 1
- OMDNCNKNEGFOMM-BQBZGAKWSA-N Ala-Met-Gly Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)NCC(O)=O OMDNCNKNEGFOMM-BQBZGAKWSA-N 0.000 description 1
- XRUJOVRWNMBAAA-NHCYSSNCSA-N Ala-Phe-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](N)C)CC1=CC=CC=C1 XRUJOVRWNMBAAA-NHCYSSNCSA-N 0.000 description 1
- ZBLQIYPCUWZSRZ-QEJZJMRPSA-N Ala-Phe-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@H](C)N)CC1=CC=CC=C1 ZBLQIYPCUWZSRZ-QEJZJMRPSA-N 0.000 description 1
- MAZZQZWCCYJQGZ-GUBZILKMSA-N Ala-Pro-Arg Chemical compound [H]N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(O)=O MAZZQZWCCYJQGZ-GUBZILKMSA-N 0.000 description 1
- HOVPGJUNRLMIOZ-CIUDSAMLSA-N Ala-Ser-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](C)N HOVPGJUNRLMIOZ-CIUDSAMLSA-N 0.000 description 1
- IDLBLNBDLCTPGC-HERUPUMHSA-N Ala-Trp-Cys Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)N[C@@H](CS)C(=O)O)N IDLBLNBDLCTPGC-HERUPUMHSA-N 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- DFCIPNHFKOQAME-FXQIFTODSA-N Arg-Ala-Asn Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(O)=O DFCIPNHFKOQAME-FXQIFTODSA-N 0.000 description 1
- GXCSUJQOECMKPV-CIUDSAMLSA-N Arg-Ala-Gln Chemical compound C[C@H](NC(=O)[C@@H](N)CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(O)=O GXCSUJQOECMKPV-CIUDSAMLSA-N 0.000 description 1
- JGDGLDNAQJJGJI-AVGNSLFASA-N Arg-Arg-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCCN=C(N)N)N JGDGLDNAQJJGJI-AVGNSLFASA-N 0.000 description 1
- USNSOPDIZILSJP-FXQIFTODSA-N Arg-Asn-Asn Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O USNSOPDIZILSJP-FXQIFTODSA-N 0.000 description 1
- DXQIQUIQYAGRCC-CIUDSAMLSA-N Arg-Asp-Gln Chemical compound C(C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N)CN=C(N)N DXQIQUIQYAGRCC-CIUDSAMLSA-N 0.000 description 1
- NKNILFJYKKHBKE-WPRPVWTQSA-N Arg-Gly-Val Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O NKNILFJYKKHBKE-WPRPVWTQSA-N 0.000 description 1
- SLNCSSWAIDUUGF-LSJOCFKGSA-N Arg-His-Ala Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(O)=O SLNCSSWAIDUUGF-LSJOCFKGSA-N 0.000 description 1
- FNXCAFKDGBROCU-STECZYCISA-N Arg-Ile-Tyr Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 FNXCAFKDGBROCU-STECZYCISA-N 0.000 description 1
- OTZMRMHZCMZOJZ-SRVKXCTJSA-N Arg-Leu-Glu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O OTZMRMHZCMZOJZ-SRVKXCTJSA-N 0.000 description 1
- COXMUHNBYCVVRG-DCAQKATOSA-N Arg-Leu-Ser Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O COXMUHNBYCVVRG-DCAQKATOSA-N 0.000 description 1
- OISWSORSLQOGFV-AVGNSLFASA-N Arg-Met-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@@H](N)CCCN=C(N)N OISWSORSLQOGFV-AVGNSLFASA-N 0.000 description 1
- VRTWYUYCJGNFES-CIUDSAMLSA-N Arg-Ser-Gln Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(O)=O VRTWYUYCJGNFES-CIUDSAMLSA-N 0.000 description 1
- JQHASVQBAKRJKD-GUBZILKMSA-N Arg-Ser-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CCCN=C(N)N)N JQHASVQBAKRJKD-GUBZILKMSA-N 0.000 description 1
- UVTGNSWSRSCPLP-UHFFFAOYSA-N Arg-Tyr Natural products NC(CCNC(=N)N)C(=O)NC(Cc1ccc(O)cc1)C(=O)O UVTGNSWSRSCPLP-UHFFFAOYSA-N 0.000 description 1
- QHUOOCKNNURZSL-IHRRRGAJSA-N Arg-Tyr-Ser Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(O)=O QHUOOCKNNURZSL-IHRRRGAJSA-N 0.000 description 1
- SWLOHUMCUDRTCL-ZLUOBGJFSA-N Asn-Ala-Asn Chemical compound C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CC(=O)N)N SWLOHUMCUDRTCL-ZLUOBGJFSA-N 0.000 description 1
- RZVVKNIACROXRM-ZLUOBGJFSA-N Asn-Ala-Asp Chemical compound C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](CC(=O)N)N RZVVKNIACROXRM-ZLUOBGJFSA-N 0.000 description 1
- SLKLLQWZQHXYSV-CIUDSAMLSA-N Asn-Ala-Lys Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(O)=O SLKLLQWZQHXYSV-CIUDSAMLSA-N 0.000 description 1
- ZZXMOQIUIJJOKZ-ZLUOBGJFSA-N Asn-Asn-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CC(N)=O ZZXMOQIUIJJOKZ-ZLUOBGJFSA-N 0.000 description 1
- SRUUBQBAVNQZGJ-LAEOZQHASA-N Asn-Gln-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CC(=O)N)N SRUUBQBAVNQZGJ-LAEOZQHASA-N 0.000 description 1
- JREOBWLIZLXRIS-GUBZILKMSA-N Asn-Glu-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O JREOBWLIZLXRIS-GUBZILKMSA-N 0.000 description 1
- PLVAAIPKSGUXDV-WHFBIAKZSA-N Asn-Gly-Cys Chemical compound C([C@@H](C(=O)NCC(=O)N[C@@H](CS)C(=O)O)N)C(=O)N PLVAAIPKSGUXDV-WHFBIAKZSA-N 0.000 description 1
- OPEPUCYIGFEGSW-WDSKDSINSA-N Asn-Gly-Glu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(O)=O OPEPUCYIGFEGSW-WDSKDSINSA-N 0.000 description 1
- XLHLPYFMXGOASD-CIUDSAMLSA-N Asn-His-Asp Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](CC(=O)N)N XLHLPYFMXGOASD-CIUDSAMLSA-N 0.000 description 1
- IKLAUGBIDCDFOY-SRVKXCTJSA-N Asn-His-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(O)=O IKLAUGBIDCDFOY-SRVKXCTJSA-N 0.000 description 1
- SEKBHZJLARBNPB-GHCJXIJMSA-N Asn-Ile-Ser Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O SEKBHZJLARBNPB-GHCJXIJMSA-N 0.000 description 1
- ZMUQQMGITUJQTI-CIUDSAMLSA-N Asn-Leu-Asn Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O ZMUQQMGITUJQTI-CIUDSAMLSA-N 0.000 description 1
- BXUHCIXDSWRSBS-CIUDSAMLSA-N Asn-Leu-Asp Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O BXUHCIXDSWRSBS-CIUDSAMLSA-N 0.000 description 1
- FHETWELNCBMRMG-HJGDQZAQSA-N Asn-Leu-Thr Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O FHETWELNCBMRMG-HJGDQZAQSA-N 0.000 description 1
- KEUNWIXNKVWCFL-FXQIFTODSA-N Asn-Met-Ser Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CO)C(O)=O KEUNWIXNKVWCFL-FXQIFTODSA-N 0.000 description 1
- HZZIFFOVHLWGCS-KKUMJFAQSA-N Asn-Phe-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(O)=O HZZIFFOVHLWGCS-KKUMJFAQSA-N 0.000 description 1
- GMUOCGCDOYYWPD-FXQIFTODSA-N Asn-Pro-Ser Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O GMUOCGCDOYYWPD-FXQIFTODSA-N 0.000 description 1
- QYRMBFWDSFGSFC-OLHMAJIHSA-N Asn-Thr-Asn Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CC(=O)N)N)O QYRMBFWDSFGSFC-OLHMAJIHSA-N 0.000 description 1
- UPAGTDJAORYMEC-VHWLVUOQSA-N Asn-Trp-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)NC(=O)[C@H](CC(=O)N)N UPAGTDJAORYMEC-VHWLVUOQSA-N 0.000 description 1
- QNNBHTFDFFFHGC-KKUMJFAQSA-N Asn-Tyr-Lys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC(=O)N)N)O QNNBHTFDFFFHGC-KKUMJFAQSA-N 0.000 description 1
- AECPDLSSUMDUAA-ZKWXMUAHSA-N Asn-Val-Cys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC(=O)N)N AECPDLSSUMDUAA-ZKWXMUAHSA-N 0.000 description 1
- LMIWYCWRJVMAIQ-NHCYSSNCSA-N Asn-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC(=O)N)N LMIWYCWRJVMAIQ-NHCYSSNCSA-N 0.000 description 1
- ILJQISGMGXRZQQ-IHRRRGAJSA-N Asp-Arg-Tyr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O ILJQISGMGXRZQQ-IHRRRGAJSA-N 0.000 description 1
- QXHVOUSPVAWEMX-ZLUOBGJFSA-N Asp-Asp-Ser Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(O)=O QXHVOUSPVAWEMX-ZLUOBGJFSA-N 0.000 description 1
- RYKWOUUZJFSJOH-FXQIFTODSA-N Asp-Gln-Glu Chemical compound C(CC(=O)N)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC(=O)[C@H](CC(=O)O)N RYKWOUUZJFSJOH-FXQIFTODSA-N 0.000 description 1
- VAWNQIGQPUOPQW-ACZMJKKPSA-N Asp-Glu-Ala Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O VAWNQIGQPUOPQW-ACZMJKKPSA-N 0.000 description 1
- PDECQIHABNQRHN-GUBZILKMSA-N Asp-Glu-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CC(O)=O PDECQIHABNQRHN-GUBZILKMSA-N 0.000 description 1
- KHGPWGKPYHPOIK-QWRGUYRKSA-N Asp-Gly-Phe Chemical compound [H]N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O KHGPWGKPYHPOIK-QWRGUYRKSA-N 0.000 description 1
- PGUYEUCYVNZGGV-QWRGUYRKSA-N Asp-Gly-Tyr Chemical compound OC(=O)C[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 PGUYEUCYVNZGGV-QWRGUYRKSA-N 0.000 description 1
- CTWCFPWFIGRAEP-CIUDSAMLSA-N Asp-Lys-Asp Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(O)=O CTWCFPWFIGRAEP-CIUDSAMLSA-N 0.000 description 1
- HJCGDIGVVWETRO-ZPFDUUQYSA-N Asp-Lys-Ile Chemical compound CC[C@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CC(O)=O)C(O)=O HJCGDIGVVWETRO-ZPFDUUQYSA-N 0.000 description 1
- GKWFMNNNYZHJHV-SRVKXCTJSA-N Asp-Lys-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CC(O)=O GKWFMNNNYZHJHV-SRVKXCTJSA-N 0.000 description 1
- HXVILZUZXFLVEN-DCAQKATOSA-N Asp-Met-Leu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(O)=O HXVILZUZXFLVEN-DCAQKATOSA-N 0.000 description 1
- PCJOFZYFFMBZKC-PCBIJLKTSA-N Asp-Phe-Ile Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O PCJOFZYFFMBZKC-PCBIJLKTSA-N 0.000 description 1
- JUWISGAGWSDGDH-KKUMJFAQSA-N Asp-Phe-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(O)=O)CC1=CC=CC=C1 JUWISGAGWSDGDH-KKUMJFAQSA-N 0.000 description 1
- GWWSUMLEWKQHLR-NUMRIWBASA-N Asp-Thr-Glu Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC(=O)[C@H](CC(=O)O)N)O GWWSUMLEWKQHLR-NUMRIWBASA-N 0.000 description 1
- PDIYGFYAMZZFCW-JIOCBJNQSA-N Asp-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC(=O)O)N)O PDIYGFYAMZZFCW-JIOCBJNQSA-N 0.000 description 1
- GCACQYDBDHRVGE-LKXGYXEUSA-N Asp-Thr-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H]([C@H](O)C)NC(=O)[C@@H](N)CC(O)=O GCACQYDBDHRVGE-LKXGYXEUSA-N 0.000 description 1
- PLNJUJGNLDSFOP-UWJYBYFXSA-N Asp-Tyr-Ala Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(O)=O PLNJUJGNLDSFOP-UWJYBYFXSA-N 0.000 description 1
- VHUKCUHLFMRHOD-MELADBBJSA-N Asp-Tyr-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC2=CC=C(C=C2)O)NC(=O)[C@H](CC(=O)O)N)C(=O)O VHUKCUHLFMRHOD-MELADBBJSA-N 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 108090000565 Capsid Proteins Proteins 0.000 description 1
- 102100023321 Ceruloplasmin Human genes 0.000 description 1
- LHLSSZYQFUNWRZ-NAKRPEOUSA-N Cys-Arg-Ile Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O LHLSSZYQFUNWRZ-NAKRPEOUSA-N 0.000 description 1
- NLCZGISONIGRQP-DCAQKATOSA-N Cys-Arg-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CS)N NLCZGISONIGRQP-DCAQKATOSA-N 0.000 description 1
- JLZCAZJGWNRXCI-XKBZYTNZSA-N Cys-Thr-Glu Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(O)=O JLZCAZJGWNRXCI-XKBZYTNZSA-N 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 238000008157 ELISA kit Methods 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- RZSLYUUFFVHFRQ-FXQIFTODSA-N Gln-Ala-Glu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O RZSLYUUFFVHFRQ-FXQIFTODSA-N 0.000 description 1
- HHWQMFIGMMOVFK-WDSKDSINSA-N Gln-Ala-Gly Chemical compound OC(=O)CNC(=O)[C@H](C)NC(=O)[C@@H](N)CCC(N)=O HHWQMFIGMMOVFK-WDSKDSINSA-N 0.000 description 1
- OETQLUYCMBARHJ-CIUDSAMLSA-N Gln-Asn-Arg Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O OETQLUYCMBARHJ-CIUDSAMLSA-N 0.000 description 1
- SOBBAYVQSNXYPQ-ACZMJKKPSA-N Gln-Asn-Asn Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O SOBBAYVQSNXYPQ-ACZMJKKPSA-N 0.000 description 1
- WQWMZOIPXWSZNE-WDSKDSINSA-N Gln-Asp-Gly Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(O)=O WQWMZOIPXWSZNE-WDSKDSINSA-N 0.000 description 1
- OFPWCBGRYAOLMU-AVGNSLFASA-N Gln-Asp-Tyr Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)N)N)O OFPWCBGRYAOLMU-AVGNSLFASA-N 0.000 description 1
- RBWKVOSARCFSQQ-FXQIFTODSA-N Gln-Gln-Ser Chemical compound NC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O RBWKVOSARCFSQQ-FXQIFTODSA-N 0.000 description 1
- SNLOOPZHAQDMJG-CIUDSAMLSA-N Gln-Glu-Glu Chemical compound NC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O SNLOOPZHAQDMJG-CIUDSAMLSA-N 0.000 description 1
- IULKWYSYZSURJK-AVGNSLFASA-N Gln-Leu-Lys Chemical compound NC(=O)CC[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(O)=O IULKWYSYZSURJK-AVGNSLFASA-N 0.000 description 1
- DQLVHRFFBQOWFL-JYJNAYRXSA-N Gln-Lys-Tyr Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)N)N)O DQLVHRFFBQOWFL-JYJNAYRXSA-N 0.000 description 1
- AQPZYBSRDRZBAG-AVGNSLFASA-N Gln-Phe-Asn Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCC(=O)N)N AQPZYBSRDRZBAG-AVGNSLFASA-N 0.000 description 1
- KUBFPYIMAGXGBT-ACZMJKKPSA-N Gln-Ser-Ala Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O KUBFPYIMAGXGBT-ACZMJKKPSA-N 0.000 description 1
- RWQCWSGOOOEGPB-FXQIFTODSA-N Gln-Ser-Glu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(O)=O RWQCWSGOOOEGPB-FXQIFTODSA-N 0.000 description 1
- YRHZWVKUFWCEPW-GLLZPBPUSA-N Gln-Thr-Gln Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)O)NC(=O)[C@H](CCC(=O)N)N)O YRHZWVKUFWCEPW-GLLZPBPUSA-N 0.000 description 1
- VXAIXLOYBPMZPT-JBACZVJFSA-N Gln-Trp-Tyr Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CC3=CC=C(C=C3)O)C(=O)O)NC(=O)[C@H](CCC(=O)N)N VXAIXLOYBPMZPT-JBACZVJFSA-N 0.000 description 1
- YYOBUPFZLKQUAX-FXQIFTODSA-N Glu-Asn-Glu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O YYOBUPFZLKQUAX-FXQIFTODSA-N 0.000 description 1
- CKRUHITYRFNUKW-WDSKDSINSA-N Glu-Asn-Gly Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O CKRUHITYRFNUKW-WDSKDSINSA-N 0.000 description 1
- KVBPDJIFRQUQFY-ACZMJKKPSA-N Glu-Cys-Ser Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(O)=O KVBPDJIFRQUQFY-ACZMJKKPSA-N 0.000 description 1
- BUZMZDDKFCSKOT-CIUDSAMLSA-N Glu-Glu-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O BUZMZDDKFCSKOT-CIUDSAMLSA-N 0.000 description 1
- KASDBWKLWJKTLJ-GUBZILKMSA-N Glu-Glu-Met Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(O)=O KASDBWKLWJKTLJ-GUBZILKMSA-N 0.000 description 1
- CAVMESABQIKFKT-IUCAKERBSA-N Glu-Gly-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CCC(=O)O)N CAVMESABQIKFKT-IUCAKERBSA-N 0.000 description 1
- VGUYMZGLJUJRBV-YVNDNENWSA-N Glu-Ile-Glu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(O)=O VGUYMZGLJUJRBV-YVNDNENWSA-N 0.000 description 1
- ITBHUUMCJJQUSC-LAEOZQHASA-N Glu-Ile-Gly Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(O)=O ITBHUUMCJJQUSC-LAEOZQHASA-N 0.000 description 1
- ZSWGJYOZWBHROQ-RWRJDSDZSA-N Glu-Ile-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(O)=O ZSWGJYOZWBHROQ-RWRJDSDZSA-N 0.000 description 1
- HVYWQYLBVXMXSV-GUBZILKMSA-N Glu-Leu-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(O)=O HVYWQYLBVXMXSV-GUBZILKMSA-N 0.000 description 1
- IOUQWHIEQYQVFD-JYJNAYRXSA-N Glu-Leu-Tyr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O IOUQWHIEQYQVFD-JYJNAYRXSA-N 0.000 description 1
- OCJRHJZKGGSPRW-IUCAKERBSA-N Glu-Lys-Gly Chemical compound NCCCC[C@@H](C(=O)NCC(O)=O)NC(=O)[C@@H](N)CCC(O)=O OCJRHJZKGGSPRW-IUCAKERBSA-N 0.000 description 1
- SUIAHERNFYRBDZ-GVXVVHGQSA-N Glu-Lys-Val Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O SUIAHERNFYRBDZ-GVXVVHGQSA-N 0.000 description 1
- QMOSCLNJVKSHHU-YUMQZZPRSA-N Glu-Met-Gly Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(=O)NCC(O)=O QMOSCLNJVKSHHU-YUMQZZPRSA-N 0.000 description 1
- HMJULNMJWOZNFI-XHNCKOQMSA-N Glu-Ser-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)O)N)C(=O)O HMJULNMJWOZNFI-XHNCKOQMSA-N 0.000 description 1
- DMYACXMQUABZIQ-NRPADANISA-N Glu-Ser-Val Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O DMYACXMQUABZIQ-NRPADANISA-N 0.000 description 1
- VHPVBPCCWVDGJL-IRIUXVKKSA-N Glu-Thr-Tyr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O VHPVBPCCWVDGJL-IRIUXVKKSA-N 0.000 description 1
- JLCYOCDGIUZMKQ-JBACZVJFSA-N Glu-Trp-Phe Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)O)NC(=O)[C@H](CC2=CNC3=CC=CC=C32)NC(=O)[C@H](CCC(=O)O)N JLCYOCDGIUZMKQ-JBACZVJFSA-N 0.000 description 1
- KIEICAOUSNYOLM-NRPADANISA-N Glu-Val-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O KIEICAOUSNYOLM-NRPADANISA-N 0.000 description 1
- FGGKGJHCVMYGCD-UKJIMTQDSA-N Glu-Val-Ile Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O FGGKGJHCVMYGCD-UKJIMTQDSA-N 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- PYTZFYUXZZHOAD-WHFBIAKZSA-N Gly-Ala-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)CN PYTZFYUXZZHOAD-WHFBIAKZSA-N 0.000 description 1
- MFVQGXGQRIXBPK-WDSKDSINSA-N Gly-Ala-Glu Chemical compound NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O MFVQGXGQRIXBPK-WDSKDSINSA-N 0.000 description 1
- GGEJHJIXRBTJPD-BYPYZUCNSA-N Gly-Asn-Gly Chemical compound NCC(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O GGEJHJIXRBTJPD-BYPYZUCNSA-N 0.000 description 1
- JVWPPCWUDRJGAE-YUMQZZPRSA-N Gly-Asn-Leu Chemical compound [H]NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(O)=O JVWPPCWUDRJGAE-YUMQZZPRSA-N 0.000 description 1
- FZQLXNIMCPJVJE-YUMQZZPRSA-N Gly-Asp-Leu Chemical compound [H]NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O FZQLXNIMCPJVJE-YUMQZZPRSA-N 0.000 description 1
- MHHUEAIBJZWDBH-YUMQZZPRSA-N Gly-Asp-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)CN MHHUEAIBJZWDBH-YUMQZZPRSA-N 0.000 description 1
- RPLLQZBOVIVGMX-QWRGUYRKSA-N Gly-Asp-Phe Chemical compound [H]NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O RPLLQZBOVIVGMX-QWRGUYRKSA-N 0.000 description 1
- CQZDZKRHFWJXDF-WDSKDSINSA-N Gly-Gln-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CN CQZDZKRHFWJXDF-WDSKDSINSA-N 0.000 description 1
- XTQFHTHIAKKCTM-YFKPBYRVSA-N Gly-Glu-Gly Chemical compound NCC(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O XTQFHTHIAKKCTM-YFKPBYRVSA-N 0.000 description 1
- UUWOBINZFGTFMS-UWVGGRQHSA-N Gly-His-Met Chemical compound [H]NCC(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCSC)C(O)=O UUWOBINZFGTFMS-UWVGGRQHSA-N 0.000 description 1
- QSVMIMFAAZPCAQ-PMVVWTBXSA-N Gly-His-Thr Chemical compound [H]NCC(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O QSVMIMFAAZPCAQ-PMVVWTBXSA-N 0.000 description 1
- PAWIVEIWWYGBAM-YUMQZZPRSA-N Gly-Leu-Ala Chemical compound NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(O)=O PAWIVEIWWYGBAM-YUMQZZPRSA-N 0.000 description 1
- NSTUFLGQJCOCDL-UWVGGRQHSA-N Gly-Leu-Arg Chemical compound NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CCCN=C(N)N NSTUFLGQJCOCDL-UWVGGRQHSA-N 0.000 description 1
- UHPAZODVFFYEEL-QWRGUYRKSA-N Gly-Leu-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)CN UHPAZODVFFYEEL-QWRGUYRKSA-N 0.000 description 1
- LLZXNUUIBOALNY-QWRGUYRKSA-N Gly-Leu-Lys Chemical compound NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CCCCN LLZXNUUIBOALNY-QWRGUYRKSA-N 0.000 description 1
- UUYBFNKHOCJCHT-VHSXEESVSA-N Gly-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)CN UUYBFNKHOCJCHT-VHSXEESVSA-N 0.000 description 1
- AFWYPMDMDYCKMD-KBPBESRZSA-N Gly-Leu-Tyr Chemical compound NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 AFWYPMDMDYCKMD-KBPBESRZSA-N 0.000 description 1
- VLIJYPMATZSOLL-YUMQZZPRSA-N Gly-Lys-Cys Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)CN VLIJYPMATZSOLL-YUMQZZPRSA-N 0.000 description 1
- NTBOEZICHOSJEE-YUMQZZPRSA-N Gly-Lys-Ser Chemical compound [H]NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O NTBOEZICHOSJEE-YUMQZZPRSA-N 0.000 description 1
- JPVGHHQGKPQYIL-KBPBESRZSA-N Gly-Phe-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)CN)CC1=CC=CC=C1 JPVGHHQGKPQYIL-KBPBESRZSA-N 0.000 description 1
- HJARVELKOSZUEW-YUMQZZPRSA-N Gly-Pro-Gln Chemical compound [H]NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(O)=O HJARVELKOSZUEW-YUMQZZPRSA-N 0.000 description 1
- FGPLUIQCSKGLTI-WDSKDSINSA-N Gly-Ser-Glu Chemical compound NCC(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(O)=O FGPLUIQCSKGLTI-WDSKDSINSA-N 0.000 description 1
- FFJQHWKSGAWSTJ-BFHQHQDPSA-N Gly-Thr-Ala Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O FFJQHWKSGAWSTJ-BFHQHQDPSA-N 0.000 description 1
- XHVONGZZVUUORG-WEDXCCLWSA-N Gly-Thr-Lys Chemical compound NCC(=O)N[C@@H]([C@H](O)C)C(=O)N[C@H](C(O)=O)CCCCN XHVONGZZVUUORG-WEDXCCLWSA-N 0.000 description 1
- UVTSZKIATYSKIR-RYUDHWBXSA-N Gly-Tyr-Glu Chemical compound [H]NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(O)=O UVTSZKIATYSKIR-RYUDHWBXSA-N 0.000 description 1
- KBBFOULZCHWGJX-KBPBESRZSA-N Gly-Tyr-His Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)NC(=O)CN)O KBBFOULZCHWGJX-KBPBESRZSA-N 0.000 description 1
- GWCJMBNBFYBQCV-XPUUQOCRSA-N Gly-Val-Ala Chemical compound NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O GWCJMBNBFYBQCV-XPUUQOCRSA-N 0.000 description 1
- RYAOJUMWLWUGNW-QMMMGPOBSA-N Gly-Val-Gly Chemical compound NCC(=O)N[C@@H](C(C)C)C(=O)NCC(O)=O RYAOJUMWLWUGNW-QMMMGPOBSA-N 0.000 description 1
- FULZDMOZUZKGQU-ONGXEEELSA-N Gly-Val-His Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)CN FULZDMOZUZKGQU-ONGXEEELSA-N 0.000 description 1
- JBCLFWXMTIKCCB-UHFFFAOYSA-N H-Gly-Phe-OH Natural products NCC(=O)NC(C(O)=O)CC1=CC=CC=C1 JBCLFWXMTIKCCB-UHFFFAOYSA-N 0.000 description 1
- 102000002812 Heat-Shock Proteins Human genes 0.000 description 1
- 108010004889 Heat-Shock Proteins Proteins 0.000 description 1
- 241000589989 Helicobacter Species 0.000 description 1
- BIAKMWKJMQLZOJ-ZKWXMUAHSA-N His-Ala-Ala Chemical compound C[C@H](NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc1cnc[nH]1)C(O)=O BIAKMWKJMQLZOJ-ZKWXMUAHSA-N 0.000 description 1
- YPLYIXGKCRQZGW-SRVKXCTJSA-N His-Arg-Glu Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(O)=O YPLYIXGKCRQZGW-SRVKXCTJSA-N 0.000 description 1
- ZZLWLWSUIBSMNP-CIUDSAMLSA-N His-Asp-Ser Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(O)=O ZZLWLWSUIBSMNP-CIUDSAMLSA-N 0.000 description 1
- TXLQHACKRLWYCM-DCAQKATOSA-N His-Glu-Glu Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O TXLQHACKRLWYCM-DCAQKATOSA-N 0.000 description 1
- JIUYRPFQJJRSJB-QWRGUYRKSA-N His-His-Gly Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)NCC(O)=O)C1=CN=CN1 JIUYRPFQJJRSJB-QWRGUYRKSA-N 0.000 description 1
- STOOMQFEJUVAKR-KKUMJFAQSA-N His-His-His Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CC=1N=CNC=1)C(O)=O)C1=CNC=N1 STOOMQFEJUVAKR-KKUMJFAQSA-N 0.000 description 1
- JBSLJUPMTYLLFH-MELADBBJSA-N His-His-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC2=CN=CN2)NC(=O)[C@H](CC3=CN=CN3)N)C(=O)O JBSLJUPMTYLLFH-MELADBBJSA-N 0.000 description 1
- BZKDJRSZWLPJNI-SRVKXCTJSA-N His-His-Ser Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(O)=O BZKDJRSZWLPJNI-SRVKXCTJSA-N 0.000 description 1
- YXASFUBDSDAXQD-UWVGGRQHSA-N His-Met-Gly Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCSC)C(=O)NCC(O)=O YXASFUBDSDAXQD-UWVGGRQHSA-N 0.000 description 1
- LPBWRHRHEIYAIP-KKUMJFAQSA-N His-Tyr-Asp Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(O)=O)C(O)=O LPBWRHRHEIYAIP-KKUMJFAQSA-N 0.000 description 1
- 101001030705 Homo sapiens Huntingtin Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 102000016252 Huntingtin Human genes 0.000 description 1
- 108050004784 Huntingtin Proteins 0.000 description 1
- LQSBBHNVAVNZSX-GHCJXIJMSA-N Ile-Ala-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)N)C(=O)O)N LQSBBHNVAVNZSX-GHCJXIJMSA-N 0.000 description 1
- MKWSZEHGHSLNPF-NAKRPEOUSA-N Ile-Ala-Val Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)O)N MKWSZEHGHSLNPF-NAKRPEOUSA-N 0.000 description 1
- QLRMMMQNCWBNPQ-QXEWZRGKSA-N Ile-Arg-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)NCC(=O)O)N QLRMMMQNCWBNPQ-QXEWZRGKSA-N 0.000 description 1
- YOTNPRLPIPHQSB-XUXIUFHCSA-N Ile-Arg-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCCN)C(=O)O)N YOTNPRLPIPHQSB-XUXIUFHCSA-N 0.000 description 1
- JDAWAWXGAUZPNJ-ZPFDUUQYSA-N Ile-Glu-Arg Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N JDAWAWXGAUZPNJ-ZPFDUUQYSA-N 0.000 description 1
- DFJJAVZIHDFOGQ-MNXVOIDGSA-N Ile-Glu-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)O)N DFJJAVZIHDFOGQ-MNXVOIDGSA-N 0.000 description 1
- PWDSHAAAFXISLE-SXTJYALSSA-N Ile-Ile-Asp Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(O)=O)C(O)=O PWDSHAAAFXISLE-SXTJYALSSA-N 0.000 description 1
- YNMQUIVKEFRCPH-QSFUFRPTSA-N Ile-Ile-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)O)N YNMQUIVKEFRCPH-QSFUFRPTSA-N 0.000 description 1
- YGDWPQCLFJNMOL-MNXVOIDGSA-N Ile-Leu-Gln Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N YGDWPQCLFJNMOL-MNXVOIDGSA-N 0.000 description 1
- FZWVCYCYWCLQDH-NHCYSSNCSA-N Ile-Leu-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)O)N FZWVCYCYWCLQDH-NHCYSSNCSA-N 0.000 description 1
- GVKKVHNRTUFCCE-BJDJZHNGSA-N Ile-Leu-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)O)N GVKKVHNRTUFCCE-BJDJZHNGSA-N 0.000 description 1
- XMYURPUVJSKTMC-KBIXCLLPSA-N Ile-Ser-Gln Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N XMYURPUVJSKTMC-KBIXCLLPSA-N 0.000 description 1
- WXLYNEHOGRYNFU-URLPEUOOSA-N Ile-Thr-Phe Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)N WXLYNEHOGRYNFU-URLPEUOOSA-N 0.000 description 1
- GNXGAVNTVNOCLL-SIUGBPQLSA-N Ile-Tyr-Gln Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N GNXGAVNTVNOCLL-SIUGBPQLSA-N 0.000 description 1
- YJRSIJZUIUANHO-NAKRPEOUSA-N Ile-Val-Ala Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(=O)O)N YJRSIJZUIUANHO-NAKRPEOUSA-N 0.000 description 1
- 108010065920 Insulin Lispro Proteins 0.000 description 1
- PWWVAXIEGOYWEE-UHFFFAOYSA-N Isophenergan Chemical compound C1=CC=C2N(CC(C)N(C)C)C3=CC=CC=C3SC2=C1 PWWVAXIEGOYWEE-UHFFFAOYSA-N 0.000 description 1
- QOOWRKBDDXQRHC-BQBZGAKWSA-N L-lysyl-L-alanine Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN QOOWRKBDDXQRHC-BQBZGAKWSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- WNGVUZWBXZKQES-YUMQZZPRSA-N Leu-Ala-Gly Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)NCC(O)=O WNGVUZWBXZKQES-YUMQZZPRSA-N 0.000 description 1
- HBJZFCIVFIBNSV-DCAQKATOSA-N Leu-Arg-Asn Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CC(N)=O)C(O)=O HBJZFCIVFIBNSV-DCAQKATOSA-N 0.000 description 1
- OIARJGNVARWKFP-YUMQZZPRSA-N Leu-Asn-Gly Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O OIARJGNVARWKFP-YUMQZZPRSA-N 0.000 description 1
- OXKYZSRZKBTVEY-ZPFDUUQYSA-N Leu-Asn-Ile Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O OXKYZSRZKBTVEY-ZPFDUUQYSA-N 0.000 description 1
- NEEOBPIXKWSBRF-IUCAKERBSA-N Leu-Glu-Gly Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O NEEOBPIXKWSBRF-IUCAKERBSA-N 0.000 description 1
- IWTBYNQNAPECCS-AVGNSLFASA-N Leu-Glu-His Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H](C(O)=O)CC1=CN=CN1 IWTBYNQNAPECCS-AVGNSLFASA-N 0.000 description 1
- QVFGXCVIXXBFHO-AVGNSLFASA-N Leu-Glu-Leu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O QVFGXCVIXXBFHO-AVGNSLFASA-N 0.000 description 1
- FMEICTQWUKNAGC-YUMQZZPRSA-N Leu-Gly-Asn Chemical compound [H]N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(O)=O FMEICTQWUKNAGC-YUMQZZPRSA-N 0.000 description 1
- HYMLKESRWLZDBR-WEDXCCLWSA-N Leu-Gly-Thr Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(O)=O HYMLKESRWLZDBR-WEDXCCLWSA-N 0.000 description 1
- HGFGEMSVBMCFKK-MNXVOIDGSA-N Leu-Ile-Glu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(O)=O HGFGEMSVBMCFKK-MNXVOIDGSA-N 0.000 description 1
- QLDHBYRUNQZIJQ-DKIMLUQUSA-N Leu-Ile-Phe Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O QLDHBYRUNQZIJQ-DKIMLUQUSA-N 0.000 description 1
- LIINDKYIGYTDLG-PPCPHDFISA-N Leu-Ile-Thr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(O)=O LIINDKYIGYTDLG-PPCPHDFISA-N 0.000 description 1
- DSFYPIUSAMSERP-IHRRRGAJSA-N Leu-Leu-Arg Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CCCN=C(N)N DSFYPIUSAMSERP-IHRRRGAJSA-N 0.000 description 1
- QNBVTHNJGCOVFA-AVGNSLFASA-N Leu-Leu-Glu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CCC(O)=O QNBVTHNJGCOVFA-AVGNSLFASA-N 0.000 description 1
- IEWBEPKLKUXQBU-VOAKCMCISA-N Leu-Leu-Thr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O IEWBEPKLKUXQBU-VOAKCMCISA-N 0.000 description 1
- WXUOJXIGOPMDJM-SRVKXCTJSA-N Leu-Lys-Asn Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(O)=O WXUOJXIGOPMDJM-SRVKXCTJSA-N 0.000 description 1
- BGZCJDGBBUUBHA-KKUMJFAQSA-N Leu-Lys-Leu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O BGZCJDGBBUUBHA-KKUMJFAQSA-N 0.000 description 1
- ZAVCJRJOQKIOJW-KKUMJFAQSA-N Leu-Phe-Asp Chemical compound CC(C)C[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CC(O)=O)C(O)=O)CC1=CC=CC=C1 ZAVCJRJOQKIOJW-KKUMJFAQSA-N 0.000 description 1
- KQFZKDITNUEVFJ-JYJNAYRXSA-N Leu-Phe-Gln Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(C)C)CC1=CC=CC=C1 KQFZKDITNUEVFJ-JYJNAYRXSA-N 0.000 description 1
- PJWOOBTYQNNRBF-BZSNNMDCSA-N Leu-Phe-Lys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCCN)C(=O)O)N PJWOOBTYQNNRBF-BZSNNMDCSA-N 0.000 description 1
- UCBPDSYUVAAHCD-UWVGGRQHSA-N Leu-Pro-Gly Chemical compound CC(C)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O UCBPDSYUVAAHCD-UWVGGRQHSA-N 0.000 description 1
- VJGQRELPQWNURN-JYJNAYRXSA-N Leu-Tyr-Glu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(O)=O VJGQRELPQWNURN-JYJNAYRXSA-N 0.000 description 1
- RDFIVFHPOSOXMW-ACRUOGEOSA-N Leu-Tyr-Phe Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O RDFIVFHPOSOXMW-ACRUOGEOSA-N 0.000 description 1
- FDBTVENULFNTAL-XQQFMLRXSA-N Leu-Val-Pro Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@@H]1C(=O)O)N FDBTVENULFNTAL-XQQFMLRXSA-N 0.000 description 1
- HLFSDGLLUJUHTE-SNVBAGLBSA-N Levamisole Chemical compound C1([C@H]2CN3CCSC3=N2)=CC=CC=C1 HLFSDGLLUJUHTE-SNVBAGLBSA-N 0.000 description 1
- 102000004895 Lipoproteins Human genes 0.000 description 1
- 108090001030 Lipoproteins Proteins 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- XFIHDSBIPWEYJJ-YUMQZZPRSA-N Lys-Ala-Gly Chemical compound OC(=O)CNC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN XFIHDSBIPWEYJJ-YUMQZZPRSA-N 0.000 description 1
- YIBOAHAOAWACDK-QEJZJMRPSA-N Lys-Ala-Phe Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 YIBOAHAOAWACDK-QEJZJMRPSA-N 0.000 description 1
- QUYCUALODHJQLK-CIUDSAMLSA-N Lys-Asp-Asp Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O QUYCUALODHJQLK-CIUDSAMLSA-N 0.000 description 1
- AIPHUKOBUXJNKM-KKUMJFAQSA-N Lys-Cys-Phe Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O AIPHUKOBUXJNKM-KKUMJFAQSA-N 0.000 description 1
- KSFQPRLZAUXXPT-GARJFASQSA-N Lys-Cys-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CS)NC(=O)[C@H](CCCCN)N)C(=O)O KSFQPRLZAUXXPT-GARJFASQSA-N 0.000 description 1
- YVMQJGWLHRWMDF-MNXVOIDGSA-N Lys-Gln-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CCCCN)N YVMQJGWLHRWMDF-MNXVOIDGSA-N 0.000 description 1
- GJJQCBVRWDGLMQ-GUBZILKMSA-N Lys-Glu-Ala Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O GJJQCBVRWDGLMQ-GUBZILKMSA-N 0.000 description 1
- LPAJOCKCPRZEAG-MNXVOIDGSA-N Lys-Glu-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CCCCN LPAJOCKCPRZEAG-MNXVOIDGSA-N 0.000 description 1
- FGMHXLULNHTPID-KKUMJFAQSA-N Lys-His-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(O)=O)CC1=CN=CN1 FGMHXLULNHTPID-KKUMJFAQSA-N 0.000 description 1
- KYNNSEJZFVCDIV-ZPFDUUQYSA-N Lys-Ile-Asn Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(O)=O KYNNSEJZFVCDIV-ZPFDUUQYSA-N 0.000 description 1
- IUWMQCZOTYRXPL-ZPFDUUQYSA-N Lys-Ile-Asp Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(O)=O)C(O)=O IUWMQCZOTYRXPL-ZPFDUUQYSA-N 0.000 description 1
- ORVFEGYUJITPGI-IHRRRGAJSA-N Lys-Leu-Met Chemical compound CSCC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCCCN ORVFEGYUJITPGI-IHRRRGAJSA-N 0.000 description 1
- XIZQPFCRXLUNMK-BZSNNMDCSA-N Lys-Leu-Phe Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)NC(=O)[C@H](CCCCN)N XIZQPFCRXLUNMK-BZSNNMDCSA-N 0.000 description 1
- XOQMURBBIXRRCR-SRVKXCTJSA-N Lys-Lys-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCCCN XOQMURBBIXRRCR-SRVKXCTJSA-N 0.000 description 1
- GAHJXEMYXKLZRQ-AJNGGQMLSA-N Lys-Lys-Ile Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O GAHJXEMYXKLZRQ-AJNGGQMLSA-N 0.000 description 1
- TWPCWKVOZDUYAA-KKUMJFAQSA-N Lys-Phe-Asp Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(O)=O)C(O)=O TWPCWKVOZDUYAA-KKUMJFAQSA-N 0.000 description 1
- CNGOEHJCLVCJHN-SRVKXCTJSA-N Lys-Pro-Glu Chemical compound NCCCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O CNGOEHJCLVCJHN-SRVKXCTJSA-N 0.000 description 1
- DNWBUCHHMRQWCZ-GUBZILKMSA-N Lys-Ser-Gln Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(N)=O DNWBUCHHMRQWCZ-GUBZILKMSA-N 0.000 description 1
- JOSAKOKSPXROGQ-BJDJZHNGSA-N Lys-Ser-Ile Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O JOSAKOKSPXROGQ-BJDJZHNGSA-N 0.000 description 1
- DLCAXBGXGOVUCD-PPCPHDFISA-N Lys-Thr-Ile Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O DLCAXBGXGOVUCD-PPCPHDFISA-N 0.000 description 1
- PELXPRPDQRFBGQ-KKUMJFAQSA-N Lys-Tyr-Asn Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCCCN)N)O PELXPRPDQRFBGQ-KKUMJFAQSA-N 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- KUQWVNFMZLHAPA-CIUDSAMLSA-N Met-Ala-Gln Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(O)=O KUQWVNFMZLHAPA-CIUDSAMLSA-N 0.000 description 1
- OXHSZBRPUGNMKW-DCAQKATOSA-N Met-Gln-Arg Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O OXHSZBRPUGNMKW-DCAQKATOSA-N 0.000 description 1
- GPAHWYRSHCKICP-GUBZILKMSA-N Met-Glu-Glu Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O GPAHWYRSHCKICP-GUBZILKMSA-N 0.000 description 1
- YCUSPBPZVJDMII-YUMQZZPRSA-N Met-Gly-Glu Chemical compound CSCC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCC(O)=O YCUSPBPZVJDMII-YUMQZZPRSA-N 0.000 description 1
- RXWPLVRJQNWXRQ-IHRRRGAJSA-N Met-His-His Chemical compound C([C@H](NC(=O)[C@@H](N)CCSC)C(=O)N[C@@H](CC=1N=CNC=1)C(O)=O)C1=CNC=N1 RXWPLVRJQNWXRQ-IHRRRGAJSA-N 0.000 description 1
- QGRJTULYDZUBAY-ZPFDUUQYSA-N Met-Ile-Glu Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(O)=O QGRJTULYDZUBAY-ZPFDUUQYSA-N 0.000 description 1
- KMSMNUFBNCHMII-IHRRRGAJSA-N Met-Leu-Lys Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CCCCN KMSMNUFBNCHMII-IHRRRGAJSA-N 0.000 description 1
- UNPGTBHYKJOCCZ-DCAQKATOSA-N Met-Lys-Ala Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O UNPGTBHYKJOCCZ-DCAQKATOSA-N 0.000 description 1
- AXHNAGAYRGCDLG-UWVGGRQHSA-N Met-Lys-Gly Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)NCC(O)=O AXHNAGAYRGCDLG-UWVGGRQHSA-N 0.000 description 1
- HSJIGJRZYUADSS-IHRRRGAJSA-N Met-Lys-Leu Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O HSJIGJRZYUADSS-IHRRRGAJSA-N 0.000 description 1
- VSJAPSMRFYUOKS-IUCAKERBSA-N Met-Pro-Gly Chemical compound CSCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O VSJAPSMRFYUOKS-IUCAKERBSA-N 0.000 description 1
- KZKVVWBOGDKHKE-QTKMDUPCSA-N Met-Thr-His Chemical compound CSCC[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CC1=CNC=N1 KZKVVWBOGDKHKE-QTKMDUPCSA-N 0.000 description 1
- NDJSSFWDYDUQID-YTWAJWBKSA-N Met-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCSC)N)O NDJSSFWDYDUQID-YTWAJWBKSA-N 0.000 description 1
- OOLVTRHJJBCJKB-IHRRRGAJSA-N Met-Tyr-Asp Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CC(=O)O)C(=O)O)N OOLVTRHJJBCJKB-IHRRRGAJSA-N 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- WUGMRIBZSVSJNP-UHFFFAOYSA-N N-L-alanyl-L-tryptophan Natural products C1=CC=C2C(CC(NC(=O)C(N)C)C(O)=O)=CNC2=C1 WUGMRIBZSVSJNP-UHFFFAOYSA-N 0.000 description 1
- WYBVBIHNJWOLCJ-UHFFFAOYSA-N N-L-arginyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCCN=C(N)N WYBVBIHNJWOLCJ-UHFFFAOYSA-N 0.000 description 1
- KZNQNBZMBZJQJO-UHFFFAOYSA-N N-glycyl-L-proline Natural products NCC(=O)N1CCCC1C(O)=O KZNQNBZMBZJQJO-UHFFFAOYSA-N 0.000 description 1
- AJHCSUXXECOXOY-UHFFFAOYSA-N N-glycyl-L-tryptophan Natural products C1=CC=C2C(CC(NC(=O)CN)C(O)=O)=CNC2=C1 AJHCSUXXECOXOY-UHFFFAOYSA-N 0.000 description 1
- 108010057466 NF-kappa B Proteins 0.000 description 1
- 102000003945 NF-kappa B Human genes 0.000 description 1
- 241000150452 Orthohantavirus Species 0.000 description 1
- OXUMFAOVGFODPN-KKUMJFAQSA-N Phe-Asn-His Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)N OXUMFAOVGFODPN-KKUMJFAQSA-N 0.000 description 1
- CUMXHKAOHNWRFQ-BZSNNMDCSA-N Phe-Asp-Tyr Chemical compound C([C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=CC=C1 CUMXHKAOHNWRFQ-BZSNNMDCSA-N 0.000 description 1
- FGXIJNMDRCZVDE-KKUMJFAQSA-N Phe-Cys-Lys Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)O)N FGXIJNMDRCZVDE-KKUMJFAQSA-N 0.000 description 1
- UNLYPPYNDXHGDG-IHRRRGAJSA-N Phe-Gln-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 UNLYPPYNDXHGDG-IHRRRGAJSA-N 0.000 description 1
- LLGTYVHITPVGKR-RYUDHWBXSA-N Phe-Gln-Gly Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(O)=O LLGTYVHITPVGKR-RYUDHWBXSA-N 0.000 description 1
- FIRWJEJVFFGXSH-RYUDHWBXSA-N Phe-Glu-Gly Chemical compound OC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 FIRWJEJVFFGXSH-RYUDHWBXSA-N 0.000 description 1
- GYEPCBNTTRORKW-PCBIJLKTSA-N Phe-Ile-Asp Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(O)=O)C(O)=O GYEPCBNTTRORKW-PCBIJLKTSA-N 0.000 description 1
- RORUIHAWOLADSH-HJWJTTGWSA-N Phe-Ile-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CC1=CC=CC=C1 RORUIHAWOLADSH-HJWJTTGWSA-N 0.000 description 1
- RSPUIENXSJYZQO-JYJNAYRXSA-N Phe-Leu-Gln Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC1=CC=CC=C1 RSPUIENXSJYZQO-JYJNAYRXSA-N 0.000 description 1
- SMFGCTXUBWEPKM-KBPBESRZSA-N Phe-Leu-Gly Chemical compound OC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC1=CC=CC=C1 SMFGCTXUBWEPKM-KBPBESRZSA-N 0.000 description 1
- LRBSWBVUCLLRLU-BZSNNMDCSA-N Phe-Leu-Lys Chemical compound CC(C)C[C@H](NC(=O)[C@@H](N)Cc1ccccc1)C(=O)N[C@@H](CCCCN)C(O)=O LRBSWBVUCLLRLU-BZSNNMDCSA-N 0.000 description 1
- SCKXGHWQPPURGT-KKUMJFAQSA-N Phe-Lys-Ser Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O SCKXGHWQPPURGT-KKUMJFAQSA-N 0.000 description 1
- MMJJFXWMCMJMQA-STQMWFEESA-N Phe-Pro-Gly Chemical compound C([C@H](N)C(=O)N1[C@@H](CCC1)C(=O)NCC(O)=O)C1=CC=CC=C1 MMJJFXWMCMJMQA-STQMWFEESA-N 0.000 description 1
- RGMLUHANLDVMPB-ULQDDVLXSA-N Phe-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)N RGMLUHANLDVMPB-ULQDDVLXSA-N 0.000 description 1
- VIIRRNQMMIHYHQ-XHSDSOJGSA-N Phe-Val-Pro Chemical compound CC(C)[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC2=CC=CC=C2)N VIIRRNQMMIHYHQ-XHSDSOJGSA-N 0.000 description 1
- 108091036414 Polyinosinic:polycytidylic acid Proteins 0.000 description 1
- GRIRJQGZZJVANI-CYDGBPFRSA-N Pro-Arg-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@@H]1CCCN1 GRIRJQGZZJVANI-CYDGBPFRSA-N 0.000 description 1
- ODPIUQVTULPQEP-CIUDSAMLSA-N Pro-Gln-Asn Chemical compound NC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@@H]1CCCN1 ODPIUQVTULPQEP-CIUDSAMLSA-N 0.000 description 1
- NXEYSLRNNPWCRN-SRVKXCTJSA-N Pro-Glu-Leu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O NXEYSLRNNPWCRN-SRVKXCTJSA-N 0.000 description 1
- PTLOFJZJADCNCD-DCAQKATOSA-N Pro-Glu-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H]1CCCN1 PTLOFJZJADCNCD-DCAQKATOSA-N 0.000 description 1
- HAEGAELAYWSUNC-WPRPVWTQSA-N Pro-Gly-Val Chemical compound [H]N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O HAEGAELAYWSUNC-WPRPVWTQSA-N 0.000 description 1
- CPRLKHJUFAXVTD-ULQDDVLXSA-N Pro-Leu-Tyr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O CPRLKHJUFAXVTD-ULQDDVLXSA-N 0.000 description 1
- ZVEQWRWMRFIVSD-HRCADAONSA-N Pro-Phe-Pro Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CC2=CC=CC=C2)C(=O)N3CCC[C@@H]3C(=O)O ZVEQWRWMRFIVSD-HRCADAONSA-N 0.000 description 1
- KWMZPPWYBVZIER-XGEHTFHBSA-N Pro-Ser-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O KWMZPPWYBVZIER-XGEHTFHBSA-N 0.000 description 1
- PRKWBYCXBBSLSK-GUBZILKMSA-N Pro-Ser-Val Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O PRKWBYCXBBSLSK-GUBZILKMSA-N 0.000 description 1
- JDJMFMVVJHLWDP-UNQGMJICSA-N Pro-Thr-Phe Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O JDJMFMVVJHLWDP-UNQGMJICSA-N 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 1
- LVVBAKCGXXUHFO-ZLUOBGJFSA-N Ser-Ala-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(O)=O LVVBAKCGXXUHFO-ZLUOBGJFSA-N 0.000 description 1
- BTKUIVBNGBFTTP-WHFBIAKZSA-N Ser-Ala-Gly Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)NCC(O)=O BTKUIVBNGBFTTP-WHFBIAKZSA-N 0.000 description 1
- WTWGOQRNRFHFQD-JBDRJPRFSA-N Ser-Ala-Ile Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O WTWGOQRNRFHFQD-JBDRJPRFSA-N 0.000 description 1
- IYCBDVBJWDXQRR-FXQIFTODSA-N Ser-Ala-Met Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(O)=O IYCBDVBJWDXQRR-FXQIFTODSA-N 0.000 description 1
- FCRMLGJMPXCAHD-FXQIFTODSA-N Ser-Arg-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(O)=O FCRMLGJMPXCAHD-FXQIFTODSA-N 0.000 description 1
- KYKKKSWGEPFUMR-NAKRPEOUSA-N Ser-Arg-Ile Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O KYKKKSWGEPFUMR-NAKRPEOUSA-N 0.000 description 1
- DKKGAAJTDKHWOD-BIIVOSGPSA-N Ser-Asn-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC(=O)N)NC(=O)[C@H](CO)N)C(=O)O DKKGAAJTDKHWOD-BIIVOSGPSA-N 0.000 description 1
- BQWCDDAISCPDQV-XHNCKOQMSA-N Ser-Gln-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CO)N)C(=O)O BQWCDDAISCPDQV-XHNCKOQMSA-N 0.000 description 1
- SVWQEIRZHHNBIO-WHFBIAKZSA-N Ser-Gly-Cys Chemical compound [H]N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CS)C(O)=O SVWQEIRZHHNBIO-WHFBIAKZSA-N 0.000 description 1
- MIJWOJAXARLEHA-WDSKDSINSA-N Ser-Gly-Glu Chemical compound OC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCC(O)=O MIJWOJAXARLEHA-WDSKDSINSA-N 0.000 description 1
- YMTLKLXDFCSCNX-BYPYZUCNSA-N Ser-Gly-Gly Chemical compound OC[C@H](N)C(=O)NCC(=O)NCC(O)=O YMTLKLXDFCSCNX-BYPYZUCNSA-N 0.000 description 1
- IOVBCLGAJJXOHK-SRVKXCTJSA-N Ser-His-His Chemical compound C([C@H](NC(=O)[C@H](CO)N)C(=O)N[C@@H](CC=1NC=NC=1)C(O)=O)C1=CN=CN1 IOVBCLGAJJXOHK-SRVKXCTJSA-N 0.000 description 1
- QYSFWUIXDFJUDW-DCAQKATOSA-N Ser-Leu-Arg Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O QYSFWUIXDFJUDW-DCAQKATOSA-N 0.000 description 1
- YUJLIIRMIAGMCQ-CIUDSAMLSA-N Ser-Leu-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O YUJLIIRMIAGMCQ-CIUDSAMLSA-N 0.000 description 1
- JWOBLHJRDADHLN-KKUMJFAQSA-N Ser-Leu-Tyr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O JWOBLHJRDADHLN-KKUMJFAQSA-N 0.000 description 1
- CRJZZXMAADSBBQ-SRVKXCTJSA-N Ser-Lys-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CO CRJZZXMAADSBBQ-SRVKXCTJSA-N 0.000 description 1
- IFLVBVIYADZIQO-DCAQKATOSA-N Ser-Met-Lys Chemical compound CSCC[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CO)N IFLVBVIYADZIQO-DCAQKATOSA-N 0.000 description 1
- BUYHXYIUQUBEQP-AVGNSLFASA-N Ser-Phe-Glu Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC(=O)[C@H](CO)N BUYHXYIUQUBEQP-AVGNSLFASA-N 0.000 description 1
- QPPYAWVLAVXISR-DCAQKATOSA-N Ser-Pro-His Chemical compound C1C[C@H](N(C1)C(=O)[C@H](CO)N)C(=O)N[C@@H](CC2=CN=CN2)C(=O)O QPPYAWVLAVXISR-DCAQKATOSA-N 0.000 description 1
- SRSPTFBENMJHMR-WHFBIAKZSA-N Ser-Ser-Gly Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O SRSPTFBENMJHMR-WHFBIAKZSA-N 0.000 description 1
- NVNPWELENFJOHH-CIUDSAMLSA-N Ser-Ser-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)N NVNPWELENFJOHH-CIUDSAMLSA-N 0.000 description 1
- ILZAUMFXKSIUEF-SRVKXCTJSA-N Ser-Ser-Phe Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 ILZAUMFXKSIUEF-SRVKXCTJSA-N 0.000 description 1
- PYTKULIABVRXSC-BWBBJGPYSA-N Ser-Ser-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O PYTKULIABVRXSC-BWBBJGPYSA-N 0.000 description 1
- SNXUIBACCONSOH-BWBBJGPYSA-N Ser-Thr-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@@H](CO)C(O)=O SNXUIBACCONSOH-BWBBJGPYSA-N 0.000 description 1
- HXPNJVLVHKABMJ-KKUMJFAQSA-N Ser-Tyr-His Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)NC(=O)[C@H](CO)N)O HXPNJVLVHKABMJ-KKUMJFAQSA-N 0.000 description 1
- KIEIJCFVGZCUAS-MELADBBJSA-N Ser-Tyr-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC2=CC=C(C=C2)O)NC(=O)[C@H](CO)N)C(=O)O KIEIJCFVGZCUAS-MELADBBJSA-N 0.000 description 1
- PCMZJFMUYWIERL-ZKWXMUAHSA-N Ser-Val-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O PCMZJFMUYWIERL-ZKWXMUAHSA-N 0.000 description 1
- BEBVVQPDSHHWQL-NRPADANISA-N Ser-Val-Glu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O BEBVVQPDSHHWQL-NRPADANISA-N 0.000 description 1
- MFQMZDPAZRZAPV-NAKRPEOUSA-N Ser-Val-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CO)N MFQMZDPAZRZAPV-NAKRPEOUSA-N 0.000 description 1
- LGIMRDKGABDMBN-DCAQKATOSA-N Ser-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CO)N LGIMRDKGABDMBN-DCAQKATOSA-N 0.000 description 1
- HSWXBJCBYSWBPT-GUBZILKMSA-N Ser-Val-Val Chemical compound CC(C)[C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CO)C(C)C)C(O)=O HSWXBJCBYSWBPT-GUBZILKMSA-N 0.000 description 1
- 241001535172 Severe fever with thrombocytopenia virus Species 0.000 description 1
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 239000012505 Superdex™ Substances 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- DCCGCVLVVSAJFK-NUMRIWBASA-N Thr-Asp-Gln Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N)O DCCGCVLVVSAJFK-NUMRIWBASA-N 0.000 description 1
- XDARBNMYXKUFOJ-GSSVUCPTSA-N Thr-Asp-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O XDARBNMYXKUFOJ-GSSVUCPTSA-N 0.000 description 1
- LHEZGZQRLDBSRR-WDCWCFNPSA-N Thr-Glu-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O LHEZGZQRLDBSRR-WDCWCFNPSA-N 0.000 description 1
- XFTYVCHLARBHBQ-FOHZUACHSA-N Thr-Gly-Asn Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(O)=O XFTYVCHLARBHBQ-FOHZUACHSA-N 0.000 description 1
- KBBRNEDOYWMIJP-KYNKHSRBSA-N Thr-Gly-Thr Chemical compound C[C@H]([C@@H](C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)O)N)O KBBRNEDOYWMIJP-KYNKHSRBSA-N 0.000 description 1
- KLCCPYZXGXHAGS-QTKMDUPCSA-N Thr-His-Met Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N[C@@H](CCSC)C(=O)O)N)O KLCCPYZXGXHAGS-QTKMDUPCSA-N 0.000 description 1
- XOWKUMFHEZLKLT-CIQUZCHMSA-N Thr-Ile-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O XOWKUMFHEZLKLT-CIQUZCHMSA-N 0.000 description 1
- ZBKDBZUTTXINIX-RWRJDSDZSA-N Thr-Ile-Gln Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(O)=O ZBKDBZUTTXINIX-RWRJDSDZSA-N 0.000 description 1
- GMXIJHCBTZDAPD-QPHKQPEJSA-N Thr-Ile-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)O)NC(=O)[C@H]([C@@H](C)O)N GMXIJHCBTZDAPD-QPHKQPEJSA-N 0.000 description 1
- FQPDRTDDEZXCEC-SVSWQMSJSA-N Thr-Ile-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O FQPDRTDDEZXCEC-SVSWQMSJSA-N 0.000 description 1
- RRRRCRYTLZVCEN-HJGDQZAQSA-N Thr-Leu-Asp Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O RRRRCRYTLZVCEN-HJGDQZAQSA-N 0.000 description 1
- SCSVNSNWUTYSFO-WDCWCFNPSA-N Thr-Lys-Glu Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O SCSVNSNWUTYSFO-WDCWCFNPSA-N 0.000 description 1
- KZURUCDWKDEAFZ-XVSYOHENSA-N Thr-Phe-Asn Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(=O)N)C(=O)O)N)O KZURUCDWKDEAFZ-XVSYOHENSA-N 0.000 description 1
- HSQXHRIRJSFDOH-URLPEUOOSA-N Thr-Phe-Ile Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O HSQXHRIRJSFDOH-URLPEUOOSA-N 0.000 description 1
- IEZVHOULSUULHD-XGEHTFHBSA-N Thr-Ser-Val Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O IEZVHOULSUULHD-XGEHTFHBSA-N 0.000 description 1
- CJEHCEOXPLASCK-MEYUZBJRSA-N Thr-Tyr-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)[C@H](O)C)CC1=CC=C(O)C=C1 CJEHCEOXPLASCK-MEYUZBJRSA-N 0.000 description 1
- QNXZCKMXHPULME-ZNSHCXBVSA-N Thr-Val-Pro Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@@H]1C(=O)O)N)O QNXZCKMXHPULME-ZNSHCXBVSA-N 0.000 description 1
- JZHJLBPBQKPTNX-UBHSHLNASA-N Trp-Cys-Ser Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(O)=O)=CNC2=C1 JZHJLBPBQKPTNX-UBHSHLNASA-N 0.000 description 1
- YNJBFSFTYAPMTA-FNINZLGVSA-N Trp-Gly-Ile-His-His Chemical compound CCC(C)[C@H](NC(=O)CNC(=O)[C@@H](N)Cc1c[nH]c2ccccc12)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](Cc1cnc[nH]1)C(O)=O YNJBFSFTYAPMTA-FNINZLGVSA-N 0.000 description 1
- SSSDKJMQMZTMJP-BVSLBCMMSA-N Trp-Tyr-Val Chemical compound C([C@@H](C(=O)N[C@@H](C(C)C)C(O)=O)NC(=O)[C@@H](N)CC=1C2=CC=CC=C2NC=1)C1=CC=C(O)C=C1 SSSDKJMQMZTMJP-BVSLBCMMSA-N 0.000 description 1
- IEESWNWYUOETOT-BVSLBCMMSA-N Trp-Val-Phe Chemical compound CC(C)[C@H](NC(=O)[C@@H](N)Cc1c[nH]c2ccccc12)C(=O)N[C@@H](Cc1ccccc1)C(O)=O IEESWNWYUOETOT-BVSLBCMMSA-N 0.000 description 1
- XGEUYEOEZYFHRL-KKXDTOCCSA-N Tyr-Ala-Phe Chemical compound C([C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=C(O)C=C1 XGEUYEOEZYFHRL-KKXDTOCCSA-N 0.000 description 1
- DXYWRYQRKPIGGU-BPNCWPANSA-N Tyr-Ala-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 DXYWRYQRKPIGGU-BPNCWPANSA-N 0.000 description 1
- NMKJPMCEKQHRPD-IRXDYDNUSA-N Tyr-Gly-Tyr Chemical compound C([C@H](N)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=C(O)C=C1 NMKJPMCEKQHRPD-IRXDYDNUSA-N 0.000 description 1
- CVXURBLRELTJKO-BWAGICSOSA-N Tyr-His-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CN=CN1)NC(=O)[C@H](CC2=CC=C(C=C2)O)N)O CVXURBLRELTJKO-BWAGICSOSA-N 0.000 description 1
- PMHLLBKTDHQMCY-ULQDDVLXSA-N Tyr-Lys-Val Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O PMHLLBKTDHQMCY-ULQDDVLXSA-N 0.000 description 1
- MNWINJDPGBNOED-ULQDDVLXSA-N Tyr-Pro-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CC1=CC=C(O)C=C1 MNWINJDPGBNOED-ULQDDVLXSA-N 0.000 description 1
- VYQQQIRHIFALGE-UWJYBYFXSA-N Tyr-Ser-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 VYQQQIRHIFALGE-UWJYBYFXSA-N 0.000 description 1
- NHOVZGFNTGMYMI-KKUMJFAQSA-N Tyr-Ser-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 NHOVZGFNTGMYMI-KKUMJFAQSA-N 0.000 description 1
- XUIOBCQESNDTDE-FQPOAREZSA-N Tyr-Thr-Ala Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](C)C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)N)O XUIOBCQESNDTDE-FQPOAREZSA-N 0.000 description 1
- ZLFHAAGHGQBQQN-GUBZILKMSA-N Val-Ala-Pro Natural products CC(C)[C@H](N)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O ZLFHAAGHGQBQQN-GUBZILKMSA-N 0.000 description 1
- VMRFIKXKOFNMHW-GUBZILKMSA-N Val-Arg-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CO)C(=O)O)N VMRFIKXKOFNMHW-GUBZILKMSA-N 0.000 description 1
- LNYOXPDEIZJDEI-NHCYSSNCSA-N Val-Asn-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](C(C)C)N LNYOXPDEIZJDEI-NHCYSSNCSA-N 0.000 description 1
- DBOXBUDEAJVKRE-LSJOCFKGSA-N Val-Asn-Val Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](C(C)C)C(=O)O)N DBOXBUDEAJVKRE-LSJOCFKGSA-N 0.000 description 1
- PWRITNSESKQTPW-NRPADANISA-N Val-Gln-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CO)C(=O)O)N PWRITNSESKQTPW-NRPADANISA-N 0.000 description 1
- VLDMQVZZWDOKQF-AUTRQRHGSA-N Val-Glu-Gln Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N VLDMQVZZWDOKQF-AUTRQRHGSA-N 0.000 description 1
- ZXAGTABZUOMUDO-GVXVVHGQSA-N Val-Glu-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)O)N ZXAGTABZUOMUDO-GVXVVHGQSA-N 0.000 description 1
- VXDSPJJQUQDCKH-UKJIMTQDSA-N Val-Ile-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC(=O)[C@H](C(C)C)N VXDSPJJQUQDCKH-UKJIMTQDSA-N 0.000 description 1
- SDUBQHUJJWQTEU-XUXIUFHCSA-N Val-Ile-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](C(C)C)N SDUBQHUJJWQTEU-XUXIUFHCSA-N 0.000 description 1
- SYSWVVCYSXBVJG-RHYQMDGZSA-N Val-Leu-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C(C)C)N)O SYSWVVCYSXBVJG-RHYQMDGZSA-N 0.000 description 1
- RFKJNTRMXGCKFE-FHWLQOOXSA-N Val-Leu-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)CC(C)C)C(O)=O)=CNC2=C1 RFKJNTRMXGCKFE-FHWLQOOXSA-N 0.000 description 1
- RWOGENDAOGMHLX-DCAQKATOSA-N Val-Lys-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C(C)C)N RWOGENDAOGMHLX-DCAQKATOSA-N 0.000 description 1
- DIOSYUIWOQCXNR-ONGXEEELSA-N Val-Lys-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)NCC(O)=O DIOSYUIWOQCXNR-ONGXEEELSA-N 0.000 description 1
- AIWLHFZYOUUJGB-UFYCRDLUSA-N Val-Phe-Tyr Chemical compound C([C@H](NC(=O)[C@@H](N)C(C)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=CC=C1 AIWLHFZYOUUJGB-UFYCRDLUSA-N 0.000 description 1
- GBIUHAYJGWVNLN-UHFFFAOYSA-N Val-Ser-Pro Natural products CC(C)C(N)C(=O)NC(CO)C(=O)N1CCCC1C(O)=O GBIUHAYJGWVNLN-UHFFFAOYSA-N 0.000 description 1
- OFTXTCGQJXTNQS-XGEHTFHBSA-N Val-Thr-Ser Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](C(C)C)N)O OFTXTCGQJXTNQS-XGEHTFHBSA-N 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 108010070944 alanylhistidine Proteins 0.000 description 1
- 229910000288 alkali metal carbonate Inorganic materials 0.000 description 1
- 150000008041 alkali metal carbonates Chemical class 0.000 description 1
- 229910000318 alkali metal phosphate Inorganic materials 0.000 description 1
- 229910052784 alkaline earth metal Inorganic materials 0.000 description 1
- -1 alkaline earth metal carbonates Chemical class 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 108010069926 arginyl-glycyl-serine Proteins 0.000 description 1
- 108010038850 arginyl-isoleucyl-tyrosine Proteins 0.000 description 1
- 108010084758 arginyl-tyrosyl-aspartic acid Proteins 0.000 description 1
- 108010077245 asparaginyl-proline Proteins 0.000 description 1
- 108010038633 aspartylglutamate Proteins 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 229940065181 bacillus anthracis Drugs 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 239000003124 biologic agent Substances 0.000 description 1
- 238000010241 blood sampling Methods 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 239000005018 casein Substances 0.000 description 1
- BECPQYXYKAMYBN-UHFFFAOYSA-N casein, tech. Chemical compound NCCCCC(C(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(CC(C)C)N=C(O)C(CCC(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(C(C)O)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(COP(O)(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(N)CC1=CC=CC=C1 BECPQYXYKAMYBN-UHFFFAOYSA-N 0.000 description 1
- 235000021240 caseins Nutrition 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 108010060199 cysteinylproline Proteins 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- FSXRLASFHBWESK-UHFFFAOYSA-N dipeptide phenylalanyl-tyrosine Natural products C=1C=C(O)C=CC=1CC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FSXRLASFHBWESK-UHFFFAOYSA-N 0.000 description 1
- 231100000676 disease causative agent Toxicity 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 238000010864 dual luciferase reporter gene assay Methods 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 239000002158 endotoxin Substances 0.000 description 1
- 238000011013 endotoxin removal Methods 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 108010079547 glutamylmethionine Proteins 0.000 description 1
- 108010019832 glycyl-asparaginyl-glycine Proteins 0.000 description 1
- 108010067216 glycyl-glycyl-glycine Proteins 0.000 description 1
- 108010026364 glycyl-glycyl-leucine Proteins 0.000 description 1
- 108010054666 glycyl-leucyl-glycyl-glycine Proteins 0.000 description 1
- 108010082286 glycyl-seryl-alanine Proteins 0.000 description 1
- 108010084389 glycyltryptophan Proteins 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 108010092114 histidylphenylalanine Proteins 0.000 description 1
- 238000000265 homogenisation Methods 0.000 description 1
- 102000054185 human HTT Human genes 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 229940031551 inactivated vaccine Drugs 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- FZWBNHMXJMCXLU-BLAUPYHCSA-N isomaltotriose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C=O)O1 FZWBNHMXJMCXLU-BLAUPYHCSA-N 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 108010044056 leucyl-phenylalanine Proteins 0.000 description 1
- 108010091871 leucylmethionine Proteins 0.000 description 1
- 229960001614 levamisole Drugs 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 108010057952 lysyl-phenylalanyl-lysine Proteins 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 108010004914 prolylarginine Proteins 0.000 description 1
- 239000012460 protein solution Substances 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 238000012772 sequence design Methods 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 201000010740 swine influenza Diseases 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 108010031491 threonyl-lysyl-glutamic acid Proteins 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 239000012096 transfection reagent Substances 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 108010038745 tryptophylglycine Proteins 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 108010051110 tyrosyl-lysine Proteins 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 108010009962 valyltyrosine Proteins 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 108010000998 wheylin-2 peptide Proteins 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/145—Orthomyxoviridae, e.g. influenza virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/69—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/69—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit
- A61K47/6921—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere
- A61K47/6927—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere the form being a solid microparticle having no hollow or gas-filled cores
- A61K47/6929—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere the form being a solid microparticle having no hollow or gas-filled cores the form being a nanoparticle, e.g. an immuno-nanoparticle
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55555—Liposomes; Vesicles, e.g. nanoparticles; Spheres, e.g. nanospheres; Polymers
Abstract
Description
본 발명은 페리틴 자가조립체에 항원 펩타이드 및 면역 증강제가 결합된 나노 입자에 관한 것이다.The present invention relates to nanoparticles in which an antigen peptide and an immune enhancer are bound to a ferritin self-assembly.
백신이란 감염증의 예방을 위하여 동물을 능동적으로 면역하기 위하여 쓰이는 항원(antigen), 또는 항원을 유효성분으로 함유한 생물학적 제제로서 프랑스의 미생물학자 L.파스퇴르에 의하여 제창되었다. 통상 백신을 투여하면 생체에서는 해당 항체가 만들어져 면역이 획득되며, 일단 생성된 항체는 비교적 오랫동안 생체 안에 남아있게 되어, 해당 질병의 원인균에 의한 감염이 발생하더라도 이에 대한 방어가 가능하여 결과적으로 질병을 예방할 수 있다.Vaccines are antigens used to actively immunize animals for the prevention of infectious diseases, or biological agents containing the antigen as an active ingredient, which was proposed by the French microbiologist L. Pasteur. In general, when a vaccine is administered, the antibody is produced in the living body, and immunization is obtained. Once the generated antibody remains in the living body for a relatively long time, even if an infection caused by the causative agent of the disease occurs, it is possible to defend against the disease. Can be.
통상적으로 백신제제에는 세균을 사멸시켜 사용하는 사균백신(killed vaccine), 불활성 백신(inactivated vaccine), 살아있는 세균을 그대로 사용하는 생균백신(live vaccine), 생균을 약화시킨 약독균주(attenuated strain)를 사용하는 약독화 백신 (attenuated vaccine), 세균의 톡소이드(toxoid) 또는 이것의 유도체 등 다양한 종류가 존재하며, 효과적인 백신 개발을 위해서는 질병을 일으키는 원인체에 대해 항체의 형성을 원활하게 하여 생체 내 면역반응이 적절히 유도되도록 해야 하기 때문에, 가능한 질병 원인체에 유사한 형태로 개발되는 것이 바람직하다. 이 때문에 아무 처리도 하지 않고 생균을 그대로 사용하는 생균백신이 백신으로서는 가장 좋은 효과를 나타낼 수 있다. 하지만, 생균백신의 경우 질병을 야기하는 질병 원인체를 살아 있는 채로 이용하는 것이기 때문에, 향후 독성이 있는 균주로 전환되어 오히려 질병을 유발할 수 있는 위험성을 가지고 있어 극히 일부 감염성 질환에 있어서만 사용되고 있는 실정이다. 이런 단점을 극복하기 위한 대안으로 생균을 약독화시킨 약독화백신이 개발되어 사용되어지고 있지만, 이 경우 일반적으로 항원성이 생균백신에 비해 약화되어 백신으로서의 효과가 떨어지고, 또한 여전히 안전하다고도 할 수 없는 문제점을 가지고 있다. 사용상 안전성 때문에 개발된 사균백신은 비록 상기의 안전성 관점에서의 문제점을 해결할 수는 있지만 항원성이 생균백신이나 약독백신에 비해 크게 떨어지는 것이 일반적이다. 이에 따라, 사균백신처럼 사용상 안전하면서도 생균백신처럼 항원성이 뛰어난 이상적인 새로운 백신제제의 개발이 요구되고 있는 실정이다. In general, vaccine vaccines include killed vaccines used for killing bacteria, inactivated vaccines, live vaccines using live bacteria, and attenuated strains that weaken live bacteria. Attenuated vaccines, bacterial toxoids, or derivatives thereof are present.In order to develop effective vaccines, the immune response in vivo can be appropriately developed by smoothing the formation of antibodies against disease causing agents. Since it should be induced, it is desirable to develop it in a form similar to a possible disease agent. For this reason, live vaccines that use live bacteria without any treatment can have the best effect as vaccines. However, in the case of live vaccines because the disease causing agent causing disease is used alive, it is converted to a toxic strain in the future and has a risk of causing the disease, which is used only in very few infectious diseases. As an alternative to overcome these drawbacks, attenuated vaccines that have attenuated live bacteria have been developed and used.However, in this case, antigenicity is weakened compared to live vaccines, which makes them less effective as vaccines and is still safe. There is no problem. Although the bacteriophage vaccine developed due to safety in use can solve the above problems in terms of safety, the antigenicity is much lower than that of live vaccine or attenuated vaccine. Accordingly, there is a demand for the development of an ideal new vaccine formulation that is safe to use, such as live vaccine, and excellent antigenicity, such as live vaccine.
케이지(cage) 단백질은 저분자량 단일체들의 정밀한 자가조립 성질에 의하여 단일체 분자량의 수십에서 수백 배의 거대분자를 형성할 수 있는 단백질이다. 자연계에서 바이러스 capsid 단백질, 페리틴, 열충격 단백질 (heat shock protein), Dps 단백질 등이 이에 해당되며 케이지(cage)를 구성하는 각각의 단량체들은 인접 단량체들과 매우 규칙적이고 정밀한 상호작용을 이루어, 내부가 비어있는 구조를 형성한다.Cage proteins are proteins that can form macromolecules of tens to hundreds of times the molecular weight of a monolith by the precise self-assembly of low molecular weight monoliths. In nature, these include viral capsid proteins, ferritins, heat shock proteins, and Dps proteins, and each of the monomers that make up the cage has very regular and precise interactions with neighboring monomers. To form a structure.
페리틴은 철을 저장하는 단백질로써 원핵생물과 진핵생물에 널리 존재한다. 페리틴 케이지(cage)의 분자량은 약 500,000Da으로, 20 kDa의 동일한 단량체(중쇄 혹은 경쇄 중 하나로 구성된 단일 단량체 혹은 이종 단량체)가 자가 조립되어 거대한 구 형태의 삼차구조를 형성한 것으로, 인간 페리틴 케이지의 경우 외경은 약 12 nm 이고 내경은 약 8 nm이다. 페리틴은 pH 조건에 따라 단량체로 흩어지기도 하고 24개의 단량체가 결합한 나노 입자를 형성하기도 하는데 이러한 특성을 이용하면 페리틴 내에 다양한 물질을 포집할 수 있다. Ferritin is a protein that stores iron and is widely present in prokaryotes and eukaryotes. The molecular weight of the ferritin cage is about 500,000 Da, and the same monomer of 20 kDa (a single monomer or a heterologous monomer composed of either heavy or light chain) is self-assembled to form a giant spherical tertiary structure. The outer diameter is about 12 nm and the inner diameter is about 8 nm. Ferritin disperses into monomers depending on pH conditions and forms nanoparticles with 24 monomers bound together.
그 외에도 페리틴 단량체의 N-말단에 인플루엔자 헤마글루티닌(hemagglutinin)을 유전적으로 융합하여 페리틴 케이지의 외부 표면에 나타낼 수 있고 (Kanekiyo, M et al., Self-assembling influenza nanoparticle vaccines elicit broadly neutralizing H1N1 antibodies, Nature 2013; 499: 102~6), 특히 헤마글루티닌의 불변 영역(invariable region)의 서열을 페리틴 표면에 발현시키는 경우, 광범위한 인플루엔자 균주에 대한 후보 백신을 생산하는 데에도 사용될 수 있다 (Yassine, HM et al., Hemagglutinin-stem nanoparticles generate heterosubtypic influenza protection, Nat Med 2015; 21: 1065~70).In addition, influenza hemagglutinin may be genetically fused to the N-terminus of the ferritin monomer to be expressed on the outer surface of the ferritin cage (Kanekiyo, M et al., Self-assembling influenza nanoparticle vaccines elicit broadly neutralizing H1N1 antibodies , Nature 2013; 499: 102-6), especially when the sequences of the invariable regions of hemagglutinin are expressed on the surface of ferritin, can also be used to produce candidate vaccines against a wide range of influenza strains (Yassine). , HM et al., Hemagglutinin-stem nanoparticles generate heterosubtypic influenza protection, Nat Med 2015; 21: 1065-70).
이에 본 발명자들은 항원-항체 결합 및 이황화 결합을 형성하는 HTTcys 펩타이드와 VL12.3cys 펩타이드를 이용하여 페리틴 자가조립체에 항원 펩타이드 및 면역 증강제를 결합시킨 나노 입자를 제조하여, 항원 및 면역 증강 펩타이드를 직접 융합시키는 경우보다 용이하게 융합 단백질을 생산할 수 있고, 페리틴 자가조립체에 결합하는 항원 펩타이드 및 면역 증강제의 몰비(molar ratio)를 용이하게 조절할 수 있음을 확인하였다. 또한, 본 발명자들은 상기 나노 입자를 포함하는 조성물은 총 면역글로불린 수치를 증가시키고, 세포성 면역 및 체액성 면역을 증진시킬 수 있음을 확인함으로써 본 발명을 완성하였다.The inventors have therefore found that HTT cys forms antigen-antibody bonds and disulfide bonds. By using a peptide and V L 12.3 cys peptide to prepare nanoparticles that combine antigen peptides and immune enhancers to ferritin self-assembly, fusion proteins can be produced more easily than direct fusion of antigen and immune enhancer peptides. It was confirmed that the molar ratio of the antigen peptide to the assembly and the immune enhancer can be easily controlled. In addition, the inventors have completed the present invention by confirming that the composition comprising the nanoparticles can increase total immunoglobulin levels and enhance cellular and humoral immunity.
본 발명의 목적은 페리틴 자가조립체에 항원 펩타이드 및 면역 증강제가 결합된 페리틴 나노 입자를 제공하는 것이다. It is an object of the present invention to provide ferritin nanoparticles in which an antigen peptide and an immune enhancer are bound to a ferritin self-assembly.
상기 목적을 달성하기 위하여, 본 발명은 HTTcys 펩타이드 및 페리틴 단량체의 융합 단백질 24개의 자가조립체; VL12.3cys 펩타이드 및 항원 펩타이드가 융합된 융합 단백질; 및 VL12.3cys 펩타이드 및 면역 증강제(adjuvant)의 융합 분자를 포함하는 나노 입자로서, 상기 항원 펩타이드 및 면역 증강제는 상기 HTTcys 펩타이드와 VL12.3cys 펩타이드 간의 결합에 의해 페리틴 자가조립체와 연결된 것인, 나노 입자를 제공한다. In order to achieve the above object, the present invention provides a self-assembly of 24 fusion proteins of HTT cys peptide and ferritin monomer; Fusion proteins fused to a VL 12.3 cys peptide and an antigen peptide; And a nanoparticle comprising a fusion molecule of a V L 12.3 cys peptide and an immunoadjuvant, wherein the antigenic peptide and the immune enhancer are linked to a ferritin self-assembly by binding between the HTT cys peptide and the V L 12.3 cys peptide. To provide nanoparticles.
또한, 본 발명은 상기 나노 입자를 포함하는, 백신 조성물을 제공한다. The present invention also provides a vaccine composition comprising the nanoparticles.
본 발명의 나노 입자는 HTTcys 펩타이드와 VL12.3cys 펩타이드를 매개로 페리틴 자가조립체에 항원 펩타이드 또는 면역 증강제가 결합된 것으로, 항원 및 면역 증강제를 직접 융합시키는 경우보다 용이하게 융합 단백질을 생산할 수 있으며 항원 펩타이드 및 면역 증강제의 몰비를 용이하게 조절할 수 있으므로 백신 생산을 위한 조성물로 유용하게 이용될 수 있다. The nanoparticles of the present invention are antigen peptides or immune enhancers coupled to ferritin self-assembly via HTT cys peptides and V L 12.3 cys peptides, which can produce fusion proteins more easily than direct fusion of antigens and immune enhancers. Since the molar ratio of the antigen peptide and the immune enhancer can be easily controlled, it can be usefully used as a composition for vaccine production.
도 1은 HTT 펩타이드 및 VL12.3 펩타이드 간의 항원-항체 결합에 이황화 결합을 추가적으로 도입시킬 수 있는 HTTcys 펩타이드 및 VL12.3cys 펩타이드의 서열을 나타낸 것이다.
도 2는 살모넬라 플라젤린(FliC), 대장균 페리틴(Ftn) 및 헤마글루티닌(인플루엔자 A 바이러스 (A/California/04/2009(H1N1), HA)의 융합 단백질 도메인을 도시적으로 나타낸 것이다.
도 3은 면역 증강 펩타이드인 플라젤린이 결합된 나노 입자를 나타낸 것으로, (A-1)은 Ftn-HA-ΔFliC 나노 입자, (B-1)은 Ftn-PA-ΔFliC 나노 입자 및 (C-1)은 I3-01-HA-ΔFliC 나노 입자를 나타낸 것이고, (A-2)는 (A-1)의 나노 입자의 크기 배제 크로마토그래피 프로파일, (B-2)는 (B-1)의 나노 입자의 크기 배제 크로마토그래피 프로파일 및 (C-2)는 (C-1)의 나노 입자의 크기 배제 크로마토그래피 프로파일을 나타낸 것이며, (A-3)은 (A-2)의 크로마토그래피로 정제된 나노 입자의 SDS-PAGE 분석 결과를 나타낸 것이다.
도 4는 Ftn, Ftn-ΔFliC(N) 및 Ftn-FliC 와 각각 배양된 HEK293 세포의 TLR5 활성화 정도를 나타낸 것이다.
도 5는 Ftn-HA-ΔFliC(N) 및 Ftn-HA-FliC(N)로 각각 면역화된 마우스 혈청의 총 IgG 및 IgG 서브클래스 수치를 나타낸 것이다
(Ftn : HA = 24:10;
HA : FliC(또는 ΔFliC) = 4:1).
도 6은 Ftn + ΔFliC, Ftn-ΔFliC(C), Ftn-ΔFliC(I) 및 Ftn-ΔFliC(N) 와 각각 배양된 HEK293 세포의 TLR5 활성화 정도를 나타낸 것이다.
도 7의 (A)는 HA, Ftn + ΔFliC + HA 및 Ftn-ΔFliC(I) + HA로 각각 면역화된 마우스 혈청의 총 IgG 및 IgG 서브클래스 수치를 나타낸 것이고, (B)는 Ftn-HA + ΔFliC 및 Ftn-HA-ΔFliC(I)로 각각 면역화된 마우스 혈청의 IgG 수치를 나타낸 것이다
(Ftn-ΔFliC에서 Ftn : ΔFliC = 24:10;
Ftn-HA에서 Ftn : HA = 24:10;
Ftn-HA-ΔFliC(I)에서 Ftn : HA : ΔFliC = 24:10:3.3).
도 8은 Ftn-HA 및 HA와 ΔFliC의 몰비를 다르게 조절하여 제조한 Ftn-HA-ΔFliC로 각각 면역화된 마우스 혈청의 IgG의 수치를 나타낸 것으로, (A)는 총 IgG, (B)는 IgG1, (C)는 IgG2a, (D)는 IgG2b 및 (E)는IgG1/IgG2a의 수치를 나타낸 것이다
(1:1의 Ftn-HA-ΔFliC에서 Ftn : HA : ΔFliC = 24:10:10;
2:1의 Ftn-HA-ΔFliC에서 Ftn : HA : ΔFliC = 24:10:5;
3:1의 Ftn-HA-ΔFliC에서 Ftn : HA : ΔFliC = 24:10:3.3;
4:1의 Ftn-HA-ΔFliC에서 Ftn : HA : ΔFliC = 24:10:2.5).
도 9는 Ftn-HA; 및 HA와 ΔFliC의 몰비를 다르게 조절하여 제조한 Ftn-HA-ΔFliC로 각각 면역화된 마우스의 비장 세포로부터 분비되는 사이토카인 IFN-γ 및 IL-4의 양을 나타낸 것이다
(1:1의 Ftn-HA-ΔFliC에서 Ftn : HA : ΔFliC = 24:10:10;
2:1의 Ftn-HA-ΔFliC에서 Ftn : HA : ΔFliC = 24:10:5;
4:1의 Ftn-HA-ΔFliC에서 Ftn : HA : ΔFliC = 24:10:2.5).
도 10은 Ftn와 HA의 몰비를 다르게 조절하여 제조한 Ftn-HA; 및 HA와 ΔFliC의 몰비를 3:1로 조절한 Ftn-HA-ΔFliC로 각각 면역화된 마우스 혈청의 총 IgG의 수치를 나타낸 것으로, (A)는 총 IgG, (B)는 IgG1, (C)는 IgG2a, (D)는 IgG2b 및 (E)는 IgG1/IgG2a의 수치를 나타낸 것이다
(Low의 Ftn-HA에서 Ftn : HA = 24:4;
High의 Ftn-HA에서 Ftn : HA = 24:24;
3:1의 Ftn-HA-ΔFliC에서 Ftn : HA : ΔFliC = 24:10:3.3).1 is HTT HTT cys can additionally introduce disulfide bonds to antigen-antibody bonds between the peptide and the V L 12.3 peptide The sequence of the peptide and V L 12.3 cys peptide is shown.
Figure 2 shows the fusion protein domains of Salmonella flagellin (FliC), Escherichia coli ferritin (Ftn) and hemagglutinin (influenza A virus (A / California / 04/2009 (H1N1), HA).
Figure 3 shows the nanoparticles bound to flagellin, an immune enhancing peptide, (A-1) is Ftn-HA-ΔFliC nanoparticles, (B-1) is Ftn-PA-ΔFliC nanoparticles and (C-1 ) Represents I3-01-HA-ΔFliC nanoparticles, (A-2) is the size exclusion chromatography profile of the nanoparticles of (A-1), (B-2) is the nanoparticles of (B-1) The size exclusion chromatography profile of (C-2) shows the size exclusion chromatography profile of the nanoparticles of (C-1), and (A-3) shows the nanoparticles purified by chromatography of (A-2). The results of SDS-PAGE analysis are shown.
Figure 4 shows the degree of TLR5 activation of HEK293 cells incubated with Ftn, Ftn-ΔFliC (N) and Ftn-FliC, respectively.
5 shows the total IgG and IgG subclass values of mouse serum immunized with Ftn-HA-ΔFliC (N) and Ftn-HA-FliC (N), respectively.
(Ftn: HA = 24:10;
HA: FliC (or ΔFliC) = 4: 1).
6 shows the degree of TLR5 activation of HEK293 cells incubated with Ftn + ΔFliC, Ftn-ΔFliC (C), Ftn-ΔFliC (I) and Ftn-ΔFliC (N), respectively.
Figure 7 (A) shows the total IgG and IgG subclass values of mouse serum immunized with HA, Ftn + ΔFliC + HA and Ftn-ΔFliC (I) + HA, respectively, (B) is Ftn-HA + ΔFliC And IgG levels of mouse serum immunized with Ftn-HA-ΔFliC (I), respectively.
(Ftn-ΔFliC = 24: 10 in Ftn-ΔFliC;
Ftn-HA to Ftn: HA = 24:10;
Ftn-HA-ΔFliC = 24: 10: 3.3) in Ftn-HA-ΔFliC (I).
FIG. 8 shows IgG levels of mouse serum immunized with Ftn-HA-ΔFliC prepared by differently controlling the molar ratios of Ftn-HA and HA and ΔFliC, wherein (A) is total IgG, (B) is IgG1, (C) shows IgG2a, (D) shows IgG2b and (E) shows IgG1 / IgG2a.
(Ftn: HA: ΔFliC = 24: 10: 10 in Ftn-HA-ΔFliC of 1: 1;
Ftn: HA: ΔFliC = 24: 10: 5 in Ftn-HA-ΔFliC at 2: 1;
Ftn: HA: ΔFliC = 24: 10: 3.3 in Ftn-HA-ΔFliC at 3: 1;
Ftn: HA: ΔFliC = 24: 10: 2.5) at 4: 1 Ftn-HA-ΔFliC.
9 is Ftn-HA; And the amounts of cytokines IFN-γ and IL-4 secreted from splenocytes of mice immunized with Ftn-HA-ΔFliC, which were prepared by differently controlling the molar ratio of HA and ΔFliC.
(Ftn: HA: ΔFliC = 24: 10: 10 in Ftn-HA-ΔFliC of 1: 1;
Ftn: HA: ΔFliC = 24: 10: 5 in Ftn-HA-ΔFliC at 2: 1;
Ftn: HA: ΔFliC = 24: 10: 2.5) at 4: 1 Ftn-HA-ΔFliC.
10 is Ftn-HA prepared by differently adjusting the molar ratio of Ftn and HA; And the total IgG levels of mouse serum immunized with Ftn-HA-ΔFliC, each of which adjusted the molar ratio of HA to ΔFliC by 3: 1, (A) for total IgG, (B) for IgG1, and (C) for IgG2a, (D) shows IgG2b and (E) shows IgG1 / IgG2a levels
(From Low's Ftn-HA, Ftn: HA = 24: 4;
Ftn-HA at High Ftn: HA = 24:24;
Ftn: HA: ΔFliC = 24: 10: 3.3) at 3: 1 Ftn-HA-ΔFliC.
이하, 본 발명을 상세히 설명한다. Hereinafter, the present invention will be described in detail.
본 발명은 HTTcys 펩타이드 및 페리틴 단량체의 융합 단백질 24개의 자가조립체; VL12.3cys 펩타이드 및 항원 펩타이드가 융합된 융합 단백질; 및 VL12.3cys 펩타이드 및 면역 증강제(adjuvant)의 융합 분자를 포함하는 나노 입자로서, 상기 항원 펩타이드 및 면역 증강제는 상기 HTTcys 펩타이드와 VL12.3cys 펩타이드 간의 결합에 의해 페리틴 자가조립체와 연결된 것인, 나노 입자를 제공한다. The present invention is HTT cys Autoassembles of 24 fusion proteins of peptide and ferritin monomers; Fusion proteins fused to a VL 12.3 cys peptide and an antigen peptide; And a fusion molecule of a V L 12.3 cys peptide and an immune adjuvant, wherein the antigenic peptide and the immune enhancer are the HTT cys Peptides with V L 12.3 cys Nanoparticles are provided that are linked to the ferritin self-assembly by binding between peptides.
본 발명에서 "융합 단백질"은 2개 이상의 단백질 또는 펩타이드가 서로 연결된 인위적으로 합성된 단백질을 의미한다. 본 발명의 융합 단백질은 당해 분야에 공지된 화학적 합성방법으로 제조하거나 본 발명의 융합 단백질을 코딩하는 폴리뉴클레오티드를 발현벡터에 클로닝하여 발현시켜서 제조할 수 있다. 상기 융합 단백질은 표적화 서열, 태그(tag), 표지된 잔기, 반감기 또는 펩타이드의 안정성을 증가시키기 위한 특정 목적으로 고안된 아미노산 서열을 추가로 포함할 수 있고, 공지된 아미노산 서열의 일부 아미노산이 부가, 치환, 결실 등의 방법으로 변이된 변이첸 단백질도 본 발명에서 제공하는 융합 단백질의 범주에 포함될 수 있다. As used herein, the term "fusion protein" refers to an artificially synthesized protein in which two or more proteins or peptides are linked to each other. The fusion protein of the present invention may be prepared by chemical synthesis methods known in the art or by expressing a polynucleotide encoding the fusion protein of the present invention by cloning into an expression vector. The fusion protein may further comprise an amino acid sequence designed for the purpose of increasing the stability of the targeting sequence, tag, labeled residue, half-life or peptide, wherein some amino acids of the known amino acid sequence are added, substituted Mutantchen protein mutated by a method such as deletion or deletion may also be included in the category of fusion proteins provided by the present invention.
본 발명에서 페리틴(ferritin) 자가조립체는 생물 유래의 페리틴 단량체 24개가 자가조립(self-assembly)을 통하여 속이 빈 케이지(cage) 형태의 나노 입자를 형성한 것을 말한다. In the present invention, the ferritin self-assembly means that 24 ferritin monomers derived from living organisms form nanoparticles in the form of hollow cages through self-assembly.
상기 페리틴 단량체는 서로 동종 또는 이종일 수 있으며, 인간, 헬리코박터 균, 또는 대장균(E. coli) 유래의 것일 수 있으나, 이에 한정되는 것은 아니다. 바람직하게 상기 페리틴 단량체는 대장균 유래의 것일 수 있고 더 바람직하게는 서열번호 1의 아미노산 서열로 구성된 것일 수 있다. The ferritin monomers may be homologous or heterologous to each other, but may be derived from human, Helicobacter bacteria, or E. coli , but is not limited thereto. Preferably the ferritin monomer may be derived from E. coli and more preferably may be composed of the amino acid sequence of SEQ ID NO: 1.
서열번호 1: SEQ ID NO 1:
MLKPEMIEKLNEQMNLELYSSLLYQQMSAWCSYHTFEGAAAFLRRHAQEEMTHMQRLFDYLTDTGNLPRINTVESPFAEYSSLDELFQETYKHEQLITQKINELAHAAMTNQDYPTFNFLQWYVSEQHEEEKLFKSIIDKLSLAGKSGEGLYFIDKELSTLDTQNMLKPEMIEKLNEQMNLELYSSLLYQQMSAWCSYHTFEGAAAFLRRHAQEEMTHMQRLFDYLTDTGNLPRINTVESPFAEYSSLDELFQETYKHEQLITQKINELAHAAMTNQDYPTFNFLQWYVSEQHEEEKLFKSIIDKLSLAGKSGEGDTIFNKELSTLDT
본 발명에서 HTTcys 펩타이드는 헌팅틴(huntingtin) 단백질에 존재하는 짧은 알파 나선의 헌팅틴 펩타이드(이하, HTT로 표기)의 변이체를 의미한다. 구체적으로, 상기 HTTcys 펩타이드는 서열번호 2의 아미노산 서열로 구성된 HTT 펩타이드의 6번째 아미노산인 알라닌(Alanine, A)을 시스테인(cysteine, C)으로 돌연변이시킨 것으로, 서열번호 3의 아미노산 서열로 구성된 것일 수 있다. HTT cys in the present invention Peptide refers to a variant of the short alpha helical huntingtin peptide (hereinafter referred to as HTT) present in the huntingtin protein. Specifically, the HTT cys The peptide is a mutated alanine (Alanine, A), the sixth amino acid of the HTT peptide consisting of the amino acid sequence of SEQ ID NO: 2 with cysteine (C), may be composed of the amino acid sequence of SEQ ID NO: 3.
상기 HTTcys 펩타이드는 페리틴 단량체의 N-말단 또는 C-말단에 융합되거나 내부에 삽입된 것일 수 있고, 바람직하게는 N-말단에 융합된 것일 수 있다. 상기 HTTcys 펩타이드가 페리틴 단량체의 N-말단에 융합된 융합 단백질로 페리틴 자가조립체 형성 시, HTTcys 펩타이드는 페리틴 자가조립체의 외부 표면에 위치할 수 있다. 본 발명의 구체적인 실시예에 의하면, 상기 HTTcys 펩타이드는 페리틴 단량체의 N-말단에 융합된 것이고, 상기 HTTcys 펩타이드가 페리틴 단량체의 N-말단에 융합된 융합 단백질은 서열번호 6의 아미노산 서열로 구성된 것일 수 있다. The HTT cys The peptide may be fused to or inserted into the N-terminus or C-terminus of the ferritin monomer, preferably fused to the N-terminus. When the HTT cys peptide is a fusion protein fused to the N-terminus of the ferritin monomer, when the ferritin self-assembly is formed, HTT cys The peptide may be located on the outer surface of the ferritin autoassembly. According to a specific embodiment of the present invention, the HTT cys The peptide is fused to the N-terminus of the ferritin monomer and the HTT cys The fusion protein in which the peptide is fused to the N-terminus of the ferritin monomer may be composed of the amino acid sequence of SEQ ID NO.
상기 HTTcys 펩타이드 및 페리틴 단량체의 융합 단백질 24개로 이루어진 페리틴 자가조립체에서, 상기 HTTcys 펩타이드는 페리틴 자가조립체의 내부 또는 외부 표면에 위치할 수 있으며, 바람직하게는 페리틴 자가조립체의 외부 표면에 위치한 것일 수 있다. The HTT cys In the ferritin self-assembly consisting of 24 fusion proteins of peptides and ferritin monomers, the HTT cys The peptide may be located on the inner or outer surface of the ferritin self-assembly, preferably may be located on the outer surface of the ferritin self-assembly.
본 발명에서 VL12.3cys 펩타이드는 상기 헌팅틴 펩타이드에 결합하는 면역글로불린 단편인 VL12.3 펩타이드의 변이체를 의미한다. 구체적으로, 상기 VL12.3cys 펩타이드는 서열번호 4의 아미노산 서열로 구성된 VL12.3 펩타이드의 53번째 아미노산인 타이로신(Tyrosine, Y)을 시스테인(C)으로 돌연변이시킨 것으로, 서열번호 5의 아미노산 서열로 구성된 것일 수 있다. In the present invention, the V L 12.3 cys peptide refers to a variant of the V L 12.3 peptide, which is an immunoglobulin fragment that binds to the huntingtin peptide. Specifically, the V L 12.3 cys peptide is a mutated tyrosine (Y), which is the 53rd amino acid of the V L 12.3 peptide consisting of the amino acid sequence of SEQ ID NO: 4, to cysteine (C), and the amino acid sequence of SEQ ID NO: 5 It may be configured.
상기 VL12.3cys 펩타이드는 항원 펩타이드의 N-말단 또는 C-말단에 융합되거나 내부에 삽입된 것일 수 있다. The V L 12.3 cys peptide may be fused to the N- terminus or the C- terminus of the peptide antigen or inserted therein.
상기 항원 펩타이드는 헤마글루티닌(Hemagglutinin, HA), PA(Protective antigen), PSA (prostate-specific antigen), 한타바이러스 당단백질 항원(Hantavirus glycoprotein antigen), SFTS 바이러스 당단백질 항원(virus glycoprotein antigen) 등일 수 있으나, 면역 반응을 유도할 수 있는 항원을 구성하는 펩타이드인 한, 제한없이 사용될 수 있다. The antigen peptide is hemagglutinin (HA), protective antigen (PA), prostate-specific antigen (PSA), hantavirus glycoprotein antigen, SFTS virus glycoprotein antigen, etc. However, as long as it is a peptide constituting an antigen capable of inducing an immune response, it can be used without limitation.
상기 면역 증강제(adjuvant)는 플라젤린(flagellin), MPL-A (monophosphoryl lipid A), 박테리아 리포단백질(bacterial lipoprotein) 등일 수 있으나, 면역 반응을 유도하는 항원 펩타이드의 기능을 직접적 또는 간접적인 방식으로 강화시킬 수 있는 한, 제한없이 사용될 수 있다. 바람직하게 상기 면역 증강제는 면역 증강 펩타이드일 수 있고, 더 바람직하게는 플라젤린(flagellin) 펩타이드일 수 있다. The adjuvant may be flagellin, monophosphoryl lipid A, MPL-A, bacterial lipoprotein, or the like, but enhances the function of an antigen peptide that induces an immune response in a direct or indirect manner. As long as it can, it can be used without limitation. Preferably the immune enhancer may be an immune enhancing peptide, more preferably a flagellin peptide.
(hemagglutinin,HA)Hemagglutinin
(hemagglutinin, HA)
(full-length flagellin, Flic)Battlefield Flaglin
(full-length flagellin, Flic)
(truncated flagellin, ΔFlic)Digested flagellin
(truncated flagellin, ΔFlic)
상기 VL12.3cys 펩타이드는 항원 펩타이드 또는 면역 증강 펩타이드의 N-말단 또는 C-말단에 융합되거나 내부에 삽입된 것일 수 있다. 본 발명의 구체적인 실시예에서, 상기 VL12.3cys 펩타이드는 항원 펩타이드인 헤마글루티닌의 C-말단 또는 면역 증강 펩타이드인 전장(full length) 플라젤린의 N-말단, C-말단 또는 내부에 융합된 것을 이용하였다. V L 12.3 cys The peptide may be fused to or inserted into the N-terminus or C-terminus of the antigenic peptide or immune enhancing peptide. In a specific embodiment of the present invention, the V L 12.3 cys Peptides were fused to the C-terminus of the antigen peptide hemagglutinin or to the N-terminus, C-terminus, or inside of full-length flagellin, an immune enhancing peptide.
상기 HTTcys 펩타이드는 헌팅틴(hungtingtin) 단백질에 존재하는 짧은 알파 나선의 헌팅틴(HTT) 펩타이드의 변이체이고, 상기 VL12.3cys 펩타이드는 상기 헌팅틴 펩타이드에 결합하는 면역글로불린 단편인 VL12.3 펩타이드의 변이체로서, 상기 HTTcys 펩타이드와 VL12.3cys 펩타이드는 항원-항체 반응에 의해 결합될 수 있다. 또한, 상기 HTTcys 펩타이드 및 VL12.3cys 펩타이드는 각각 HTT 펩타이드와 VL12.3 펩타이드 내에 시스테인이 도입된 변이체로서, 상기 HTTcys 펩타이드와 VL12.3cys 펩타이드는 이황화 결합에 의해 결합될 수 있다. 따라서 상기 VL12.3cys 펩타이드와 융합된 항원 펩타이드 및 면역 증강제는 상기 HTTcys 펩타이드와 VL12.3cys 펩타이드 간의 결합에 의해 페리틴 자가조립체에 연결될 수 있다. 따라서 상기 HTTcys 펩타이드와 VL12.3cys 펩타이드 간의 결합은 항원-항체 결합 및 이황화 결합을 포함할 수 있으며, 이에 상기 HTTcys 펩타이드와 VL12.3cys 펩타이드 간의 결합은 항원-항체 결합만 형성한 경우보다 견고한 결합을 형성할 수 있다. The HTT cys Peptides huntingtin (hungtingtin) a variant of a short alpha helix of huntingtin (HTT) peptides present in the protein, wherein the V L 12.3 cys peptide is a variant of an immunoglobulin fragment of V L 12.3 peptide coupled to the huntingtin peptide The HTT cys peptide and the V L 12.3 cys peptide may be bound by an antigen-antibody reaction. In addition, the HTT cys Peptide and V L 12.3 cys peptide were each HTT As a variant in which cysteine is introduced into a peptide and a V L 12.3 peptide, the HTT cys Peptides and V L 12.3 cys peptides may be bound by disulfide bonds. Thus, the antigen peptide and the immune enhancer fused with the VL 12.3 cys peptide are the HTT cys It can be linked to the ferritin autoassembly by binding between the peptide and the V L 12.3 cys peptide. Thus the HTT cys Binding between the peptide and the V L 12.3 cys peptide may include antigen-antibody binding and disulfide bonds, thereby providing the HTT cys The bond between the peptide and the V L 12.3 cys peptide may form a stronger bond than if only the antigen-antibody bond was formed.
상기 나노 입자 내의 항원 펩타이드와 면역 증강 펩타이드의 몰비(molar ratio)는 적절하게 조절될 수 있다. 바람직하게는 0.1~10 : 1 일 수 있으며, 보다 바람직하게는 1~4 : 1 일 수 있으며, 가장 바람직하게는 1~3 : 1 일 수 있다. The molar ratio of the antigen peptide and the immune enhancing peptide in the nanoparticles can be appropriately controlled. Preferably it may be 0.1-10: 1, More preferably, it may be 1-4: 1, Most preferably, it may be 1-3: 1.
상기 나노 입자는 하기의 단계들을 포함하는 제조방법에 의해 제조될 수 있다: The nanoparticles can be prepared by a manufacturing method comprising the following steps:
1) HTTcys 펩타이드 및 페리틴 단량체의 융합 단백질 24개의 단량체로부터 페리틴 자가조립체를 얻는 단계; 및1) HTT cys Fusion Proteins of Peptides and Ferritin Monomers Obtaining ferritin autoassembly from 24 monomers; And
2) 상기 1)의 페리틴 자가조립체에 VL12.3cys 펩타이드 및 항원 펩타이드가 융합된 융합 단백질; 및 VL12.3cys 펩타이드 및 면역 증강제(adjuvant)가 융합된 융합 분자를 혼합하는 단계. 2) a fusion protein in which the V L 12.3 cys peptide and the antigen peptide are fused to the ferritin self-assembly of 1); And mixing the fusion molecule to which the V L 12.3 cys peptide and the immunoadjuvant are fused.
또한, 본 발명은 본 발명의 나노 입자를 포함하는, 백신 조성물을 제공한다. 본 발명의 나노 입자는 항원 및 면역 증강제를 페리틴 단량체 단백질에 직접 융합시키는 경우 보다 제작이 용이하고 항원 펩타이드 및 면역 증강제의 몰비를 용이하게 조절할 수 있다. The present invention also provides a vaccine composition comprising the nanoparticles of the present invention. Nanoparticles of the present invention is easier to manufacture when fusion of the antigen and immune enhancer directly to the ferritin monomer protein and can easily control the molar ratio of the antigen peptide and immune enhancer.
상기 백신은 총 IgG 수치를 증가시킬 수 있다. The vaccine can increase total IgG levels.
또한, 상기 백신은 세포성 면역 및 체액성 면역을 증진시킬 수 있다.In addition, the vaccine can enhance cellular immunity and humoral immunity.
본 발명의 백신 조성물은 약학적 허용가능한 담체, 적절한 보조제, 기타 통상적인 물질들을 더욱 포함할 수 있고, 면역학적 효과량으로 투여될 수 있다. 본 발명에서 용어, "면역학적 효과량"이란 면역 증강 효과를 나타낼 수 있을 정도의 충분한 양과 부작용이나 심각한 또는 과도한 면역반응을 일으키지 않을 정도의 양을 의미하며, 정확한 투여 농도는 투여될 특정 면역원에 따라 달라지며 면역반응의 발생을 검사하기 위하여 당업자가 공지의 방법을 이용하여 이를 결정할 수 있다. 또한, 투여형태 및 경로, 수용자의 연령, 건강 및 체중, 증상의 특성 및 정도, 현재 치료법의 종류, 및 치료 횟수에 따라 변화될 수 있다.The vaccine composition of the present invention may further comprise a pharmaceutically acceptable carrier, appropriate adjuvant, other conventional substances, and may be administered in an immunologically effective amount. As used herein, the term "immunologically effective amount" means an amount sufficient to exhibit an immune enhancing effect and an amount sufficient to not cause side effects or serious or excessive immune responses, and the exact dosage concentration depends on the specific immunogen to be administered. To determine the occurrence of an immune response, one skilled in the art can determine this using known methods. It may also vary depending on the dosage form and route, the age, health and weight of the recipient, the nature and extent of the symptoms, the type of current treatment, and the number of treatments.
담체는 당 분야에 공지의 것으로 안정화제, 희석제, 완충액을 포함할 수 있다. 적절한 안정화제는 솔비톨, 락토즈, 만니톨, 전분, 당, 덱스트란 및 포도당 같은 탄수화물; 알부민 또는 카제인 같은 단백질 등을 포함할 수 있다. 적절한 희석제에는 염, Hanks 균형 염, 링거액 등을 포함할 수 있다. 적절한 완충액에는 알칼리 금속 인산염, 알칼리 금속 탄산염, 알칼리 토금속 탄산염 등을 포함한다. 또한 백신에는 면역반응을 개선 또는 강화시키기 위하여 하나 이상의 면역 증강제(아쥬반트, adjuvant)를 포함할 수 있다. 적절한 면역 증강제의 예는 알루미늄 히드록시드, 프로이드 완전 또는 불완전 아쥬반트, DEAE 덱스트란, 레바미솔, PCG 및 poly I:C 또는 poly A:U를 포함할 수 있다. 본 발명의 백신 조성물은 공지의 투여 경로를 통하여 투여될 수 있다. 이와 같은 방법에는 경구, 경피, 근육, 복막, 정맥, 피하, 비강 경로를 이용할 수 있지만 이에 국한되지는 않으며, 활성 물질이 표적 세포로 이동할 수 있는 임의의 장치에 의해 투여될 수 있다. Carriers are known in the art and may include stabilizers, diluents, buffers. Suitable stabilizers include carbohydrates such as sorbitol, lactose, mannitol, starch, sugars, dextran and glucose; Proteins such as albumin or casein and the like. Suitable diluents may include salts, Hanks balance salts, Ringer's solution and the like. Suitable buffers include alkali metal phosphates, alkali metal carbonates, alkaline earth metal carbonates, and the like. The vaccine may also include one or more immune enhancers (adjuvant) to improve or enhance the immune response. Examples of suitable immune enhancers may include aluminum hydroxide, Freud's complete or incomplete adjuvant, DEAE dextran, levamisol, PCG and poly I: C or poly A: U. Vaccine compositions of the invention can be administered via known routes of administration. Such methods may include, but are not limited to, oral, transdermal, muscle, peritoneal, intravenous, subcutaneous, nasal routes, and may be administered by any device that allows the active substance to migrate to the target cell.
본 발명의 구체적인 실시예에 의하면, 본 발명자들은 HTTcys 펩타이드와 VL12.3cys 펩타이드를 매개로 페리틴 자가조립체에 헤마글루티닌 항원 펩타이드 및 플라젤린 면역 증강 펩타이드가 안정적으로 결합된 나노 입자를 제조하였다 (도 3 참조). According to a specific embodiment of the present invention, the present inventors are HTT cys The nanoparticles were stably bound to the hemagglutinin antigen peptide and the flagellin immune enhancing peptide to the ferritin self-assembly via the peptide and the V L 12.3 cys peptide (see FIG. 3).
또한, 본 발명자들은 단백질 분해(proteolytic degradation) 및 중합화하는 경향을 가진 플라젤린 D0 도메인의 면역 반응 유도에 대한 영향을 시험하고자, 플라젤린의 D0 내지 D3 도메인을 포함하는 전장 플라젤린(이하, FliC로 표기)이 페리틴 자가조립체에 결합된 나노 입자(Ftn-FliC); 및 D0 도메인이 절단된 플라젤린(이하, ΔFliC로 표기)이 페리틴 자가조립체에 결합된 나노 입자(Ftn-ΔFliC)의 TLR5 활성화능과 상기 나노 입자로 유도된 마우스 혈청 내 면역글로불린 수치를 확인한 결과, 단백질 다량 생산에 제한이 될 수 있는 플라젤린의 D0 도메인은 IgG 반응에 미미한 영향을 끼치는 것을 확인하였다 (도 4 및 도 5 참조).In addition, the present inventors wish to test the effect on the induction of an immune response of flagellin D0 domains that have a tendency to proteolytic degradation and polymerization, and thus, full-length flagellin comprising the D0 to D3 domains of flagellin (hereinafter, FliC). Nanoparticles bound to the ferritin self-assembly (Ftn-FliC); And the TLR5 activation ability of the nanoparticles (Ftn-ΔFliC) bound to the ferritin self-assembled flagellin (hereinafter referred to as ΔFliC) in which the D0 domain was cleaved, and the immunoglobulin levels in the mouse serum induced by the nanoparticles, It was confirmed that the D0 domain of flagellin, which may limit the production of large amounts of protein, has a slight effect on the IgG response (see FIGS. 4 and 5).
또한, 본 발명자들은 페리틴 자가조립체에 적합한 플라젤린(ΔFliC)의 부착 부위를 확인하고자, 플라젤린(ΔFliC)의 N-말단, C-말단 또는 내부(D3 도메인)에 VL12.3cys 펩타이드를 융합하여 페리틴 자가조립체에 결합시킨 나노 입자(각각 Ftn-ΔFliC(N), Ftn-ΔFliC(C) 및 Ftn-ΔFliC(I)로 표기)의 TLR5 활성화능을 확인한 결과, Ftn-ΔFliC(N) 및 Ftn-ΔFliC(I)는 Ftn-ΔFliC(C) 보다 TLR5 신호전달경로를 자극하는 데 효과적임을 확인하였다 (도 6 참조). In addition, the present inventors have fused to ferritin self N- terminal, C- terminal, or internal (D3 domain) in V L 12.3 cys peptide of Plastic jelrin (ΔFliC), Plastic jelrin (ΔFliC) to confirm the attachment sites suitable for assembly The TLR5 activation ability of nanoparticles (represented as Ftn-ΔFliC (N), Ftn-ΔFliC (C) and Ftn-ΔFliC (I), respectively) bound to the ferritin self-assembly was confirmed. As a result, Ftn-ΔFliC (N) and Ftn- ΔFliC (I) was found to be more effective in stimulating the TLR5 signaling pathway than Ftn-ΔFliC (C) (see FIG. 6).
또한, 본 발명자들은 페리틴 자가조립체에 대해 헤마글루티닌과 플라젤린을 동시에 결합하는 경우, 결합하지 않고 헤마글루티닌과 플라젤린을 단순히 혼합하는 경우보다 강력한 면역 반응을 유도함을 확인하였다 (도 7 참조). In addition, the inventors confirmed that when hemagglutinin and flagellin are simultaneously bound to the ferritin self-assembly, they induce a stronger immune response than simply mixing hemagglutinin and flagellin without binding (FIG. 7). Reference).
또한, 본 발명자들은 면역 증강 활성에 필요한 플라젤린의 최소량을 확인하고자, 페리틴 자가조립체에 결합한 헤마글루티닌 대 플라젤린의 몰비가 조절된 나노 입자로 유도된 마우스 혈청 내 면역글로불린 수치 및 비장세포의 사이토카인의 양을 측정한 결과, 페리틴 자가조립체에 결합한 헤마글루티닌 대 플라젤린의 몰비는 3:1까지 IgG2a 클래스 전환과 Th1 반응에 영향없이 플라젤린의 양을 줄일 수 있음을 확인하였다. 또한, 페리틴 자가조립체에 헤마글루티닌과 플라젤린을 동시 결합하는 것은 체액성 면역 반응을 증진시키고, 항원-특이적 T세포 반응을 자극하는 것임을 확인하였다 (도 8 및 도 9 참조). In addition, to determine the minimum amount of flagellin required for immune enhancing activity, the present inventors have found that the immunoglobulin levels and splenocytes in mouse serum derived from nanoparticles with controlled molar ratios of hemagglutinin to flagellin bound to ferritin autoassembly. As a result of measuring the amount of cytokines, it was confirmed that the molar ratio of hemagglutinin to flagellin bound to the ferritin self-assembly can reduce the amount of flagellin up to 3: 1 without affecting IgG2a class conversion and Th1 response. In addition, the co-binding of hemagglutinin and flagellin to the ferritin self-assembly was confirmed to enhance humoral immune responses and stimulate antigen-specific T cell responses (see FIGS. 8 and 9).
또한, 본 발명자들은 4 분자 또는 24 분자 헤마글루티닌이 페리틴 자가조립체에 결합된 나노 입자(각각 Ftn-HA(Low), Ftn-HA(High))와, 헤마글루티닌과 플라젤린이 3:1의 몰비로 페리틴 자가조립체에 결합된 나노 입자(Ftn-HA-ΔFliC)로 유도된 마우스 혈청 내 면역글로불린 수치를 확인한 결과, 페리틴 자가조립체에 최대로 결합된 헤마글루티닌은 체액성 면역 반응을 유도하는 데 유용하지만, 자가 면역 증강 활성을 가진 나노 입자를 생산하기 위해서는 플라젤린이 결합되어야 함을 확인하였다 (도 10 참조).The present inventors also found that nanoparticles (Ftn-HA (Low), Ftn-HA (High), respectively) in which 4- or 24-molecule hemagglutinin is bound to the ferritin self-assembly, and hemagglutinin and
따라서, 본 발명의 나노 입자는 HTTcys 펩타이드와 VL12.3cys 펩타이드를 매개로 페리틴 자가조립체에 항원 펩타이드 및 면역 증강제가 결합된 것으로, 나노 입자 내의 항원 펩타이드 및 면역 증강제의 몰비를 용이하게 조절할 수 있어, 독성을 나타낼 위험성이 있는 면역 증강제의 함량을 최적화할 수 있다. 또한, 항원 펩타이드와 면역 증강제를 함께 결합시킨 나노 입자를 투여한 경우, 전체(Total) IgG 뿐만 아니라 Th1 사이토카인 분비 및 IgG2a 클래스 전환을 크게 향상시킬 수 있으므로, 상기 나노 입자를 백신 조성물로 유용하게 이용할 수 있다. Therefore, the nanoparticles of the present invention is HTT cys An antigen peptide and an immune enhancer are coupled to a ferritin self-assembly via a peptide and a V L 12.3 cys peptide, and the mole ratio of the antigen peptide and the immune enhancer in the nanoparticles can be easily controlled, resulting in a risk of toxicity. The content can be optimized. In addition, the administration of nanoparticles that combine antigen peptides and immune enhancers together can greatly enhance Th1 cytokine secretion and IgG2a class conversion, as well as total IgG, thus making the nanoparticles useful for vaccine compositions. Can be.
이하, 본 발명을 하기 실시예에 의해 상세히 설명한다.Hereinafter, the present invention will be described in detail by the following examples.
단, 하기 실시예는 본 발명을 예시하는 것일 뿐, 본 발명의 내용이 하기 실시예에 의해 한정되는 것은 아니다.However, the following examples are merely to illustrate the invention, but the content of the present invention is not limited by the following examples.
<< 실시예Example 1> 1> 이황화Disulfide 결합 형성을 위한 아미노산 서열 설계 Amino Acid Sequence Design for Bond Formation
VL12.3은 115개의 아미노산(서열번호 4)으로 이루어진 단일 도메인 항체 단편으로, 인간 헌팅틴 단백질(human huntingtin protein) 내 HTT 펩타이드 서열(서열번호 2)과 항원-항체 결합에 의해 결합한다. Disulfide-by-Design 웹 서버를 사용하여 HTT 펩타이드와 VL12.3 에 각각 시스테인 서열을 도입한 VL12.3cys와 HTTcys 펩타이드를 제조하였다 (도 1, http://cptweb.cpt.wayne.edu/DbD2/). VL12.3cys와 HTTcys 펩타이드는 항원-항체 결합 이외에 추가적인 이황화 다리 형성을 통해 견고한 공유결합을 형성할 수 있다 (도 1, 표 1 및 표 2). V L 12.3 is a single domain antibody fragment consisting of 115 amino acids (SEQ ID NO: 4), which binds to an HTT peptide sequence (SEQ ID NO: 2) by antigen-antibody binding in a human huntingtin protein. V L 12.3 cys and HTT cys introduced cysteine sequences into HTT peptide and V L 12.3 respectively using disulfide-by-design web server Peptides were prepared (FIG. 1, http://cptweb.cpt.wayne.edu/DbD2/). V L 12.3 cys and HTT cys peptides can form robust covalent bonds through additional disulfide bridge formation in addition to antigen-antibody binding (FIG. 1, Table 1 and Table 2).
<< 실시예Example 2> 2> 자가조립체의Self-assembly 단량체 제조 Monomer manufacturers
<< 실시예Example 2-1> 2-1> HTTHTT cyscys 펩타이드가Peptide 융합된 페리틴( Fused ferritin ( ferritinferritin ) 단량체의 제조) Preparation of Monomer
대장균(E. coli) 페리틴 단량체(이하 Ftn로 표기)의 N-말단에 HTTcys를 융합시키고자(도 2), HTTcys가 융합된 페리틴 단량체를 암호화하는 폴리뉴클레오티드(표 4)를 PCR로 증폭하였다. 구체적으로, PCR 주형으로는 HTTcys 는 Addgene plasmid #23966 (Addgene, Cambridge, MA), 페리틴 단량체(Ftn)는 Addgene bacterial strain #61440를 사용하였으며, 하기 프라이머를 이용하여 95℃에서 30초, 58℃에서 30초, 72℃에서 30초 조건으로 PCR을 수행하였다. In order to fuse HTT cys to the N-terminus of E. coli ferritin monomer (hereinafter referred to as Ftn) (FIG. 2), polynucleotides encoding the ferritin monomer fused with HTT cys (Table 4) were amplified by PCR. It was. Specifically, as a PCR template, HTT cys was used as Addgene plasmid # 23966 (Addgene, Cambridge, Mass.), And ferritin monomer (Ftn) was used as Addgene bacterial strain # 61440. PCR was performed at 30 seconds at 72 ° C. and at 30 seconds.
(HTTcys 정방향 프라이머: ATC ATC CAT GGG CGA AAA GCT GAT GAA GTG TTT C(서열번호 25); (HTT cys forward primer: ATC ATC CAT GGG CGA AAA GCT GAT GAA GTG TTT C (SEQ ID NO: 25);
HTTcys 역방향 프라이머: ATC ACT CTA GAA CCA CCC TGG AAG GAC TTG AG(서열번호 26); HTT cys reverse primer: ATC ACT CTA GAA CCA CCC TGG AAG GAC TTG AG (SEQ ID NO: 26);
Ftn 정방향 프라이머: TGC GGT CTA GAA TGC TGA AAC CAG AAA TGA TTG AA(서열번호 27); Ftn forward primer: TGC GGT CTA GAA TGC TGA AAC CAG AAA TGA TTG AA (SEQ ID NO: 27);
Ftn 역방향 프라이머: AGG CCA GCC ACT CGA GAC TAG TTC ATT AGT TTT GTG TGT C(서열번호 28))Ftn reverse primer: AGG CCA GCC ACT CGA GAC TAG TTC ATT AGT TTT GTG TGT C (SEQ ID NO: 28))
증폭된 HTTcys-페리틴(HTTcys-Ftn)을 암호화하는 폴리뉴클레오티드를 pET28a 벡터(Addgene, Cambridge, MA)에 클로닝하였다.Polynucleotides encoding amplified HTT cys -ferritin (HTT cys- Ftn) were cloned into pET28a vector (Addgene, Cambridge, Mass.).
(HTTcys-Ftn)HTT cys -ferritin monomer
(HTT cys -Ftn)
클로닝된 벡터를 E. coli BL21(DE3) 균주에 형질전환하고, 박테리아 배양액의 O.D.600 값이 0.7에 도달할 때, 1 mM IPTG를 첨가하여 HTTcys-페리틴 단량체 융합 단백질 생산을 유도하였다. 37℃에서 4시간 배양한 후, 4℃에서 4000 rpm, 30분 동안 원심분리를 통해 E. coli(DE3)를 수확하였다. The cloned vector was transformed into E. coli BL21 (DE3) strain and when the OD 600 value of the bacterial culture reached 0.7, 1 mM IPTG was added to induce HTT cys -ferritin monomer fusion protein production. After 4 hours of incubation at 37 ° C, E. coli (DE3) was harvested by centrifugation at 4000 rpm for 30 minutes at 4 ° C.
수확한 세포의 펠릿(pellet)을 20 mM Tris(pH 8.0), 200 mM NaCl, 10 mM β-메르캅토에탄올(β-mercaptoethanol) 및 0.1 mM PMSF를 포함한 용해 완충액(lysis buffer)에 재현탁하고, 마이크로플루다이저(microfludizer, Microfluidics, Westwood, MA)를 사용하여 균질화시킨 후 15,000 rpm으로 4℃에서 40분 동안 원심분리하였다. 상층액을 80℃에서 10분간 가열한 후 15,000 rpm으로 4℃에서 30분 동안 원심분리하고, Q-Sepharose 음이온 교환 컬럼으로 단백질을 정제하여 HTTcys-페리틴 단량체 융합 단백질을 함유하는 분획을 수득한 후 농축시켰다. Pellets of harvested cells are resuspended in lysis buffer containing 20 mM Tris (pH 8.0), 200 mM NaCl, 10 mM β-mercaptoethanol and 0.1 mM PMSF, It was homogenized using a microfludizer (microfludizer, Microfluidics, Westwood, Mass.) And then centrifuged at 15,000 rpm for 40 minutes at 4 ° C. The supernatant was heated at 80 ° C. for 10 minutes, then centrifuged at 15,000 rpm for 30 minutes at 4 ° C., and purified by a Q-Sepharose anion exchange column to obtain a fraction containing HTT cys -ferritin monomer fusion protein. Concentrated.
<< 실시예Example 2-2> 2-2> HTTHTT cyscys 펩타이드가Peptide 융합된 I3-01 단량체의 제조 Preparation of Fused I3-01 Monomers
페리틴 자가조립체에 항원 또는 면역 증강 펩타이드를 부착하기 위한 HTTcys 펩타이드 및 VL12.3cys 펩타이드 간의 결합이 다른 단백질의 자가조립체에서도 유용한지 확인하기 위해, 인공 케이지 단백질 I3-01 단량체의 N-말단에도 HTTcys 서열을 융합시켰다. I3-01 자가조립체는 60개의 단량체 서브유닛으로 구성된 250 옹스트롬 케이지를 형성하는 컴퓨터로 설계된 단백질이다. HTT cys for attaching antigen or immune enhancing peptides to ferritin self-assembly Peptides and V L 12.3 cys To confirm that the binding between peptides is also useful in self-assembly of other proteins, the HTT cys sequence was fused to the N-terminus of the artificial cage protein I3-01 monomer. I3-01 self-assembly is a computer designed protein that forms a 250 angstrom cage consisting of 60 monomer subunits.
구체적으로, PCR 주형으로는 HTTcys 는 Addgene plasmid #23966 (Addgene, Cambridge, MA), I3-01 자가조립체는 워싱턴 대학교 Dr. Baker 실험실의 I3-01 cDNA를 사용하였으며, 하기 프라이머를 이용하여 95℃에서 30초, 62℃에서 60초, 72℃에서 30초 조건으로 PCR을 수행하였다. Specifically, PCR templates include HTT cys , Addgene plasmid # 23966 (Addgene, Cambridge, MA), and I3-01 self-assembly. Baker's I3-01 cDNA was used, and PCR was performed using the following primers under conditions of 30 seconds at 95 ° C, 60 seconds at 62 ° C, and 30 seconds at 72 ° C.
(HTTcys-I3-01 정방향 프라이머: ATT ATC ATA TGC ATC ATC ATC ATC ATC ACG GTG GAA GCG GTG GAA GC(서열번호 29); (HTT cys- I3-01 forward primer: ATT ATC ATA TGC ATC ATC ATC ATC ATC ACG GTG GAA GCG GTG GAA GC (SEQ ID NO: 29);
HTTcys-I3-01 역방향 프라이머: TGC GCC TCG AGC TAT TAT TCG GTG CAG CCA CGA ATC(서열번호 30))HTT cys -I3-01 reverse primer: TGC GCC TCG AGC TAT TAT TCG GTG CAG CCA CGA ATC (SEQ ID NO: 30))
클로닝된 벡터를 E. coli BL21(DE3) 균주에 형질전환하고, 박테리아 배양액의 O.D.600 값이 0.5에 도달할 때, 0.5 mM IPTG를 첨가하여 HTTcys-I3-01 융합 단백질 생산을 유도하였다. 37℃에서 4시간 배양한 후, 4℃에서 4000 rpm, 30분 동안 원심분리를 통해 E. coli(DE3)를 수확하였다. The cloned vector was transformed into E. coli BL21 (DE3) strain and when the OD 600 value of the bacterial culture reached 0.5, 0.5 mM IPTG was added to induce HTT cys- I3-01 fusion protein production. After 4 hours of incubation at 37 ° C, E. coli (DE3) was harvested by centrifugation at 4000 rpm for 30 minutes at 4 ° C.
수확한 세포의 펠릿(pellet)을 20 mM Tris(pH 8.0), 200 mM NaCl, 10 mM β-메르캅토에탄올(β-mercaptoethanol) 및 0.1 mM PMSF를 포함한 용해 완충액(lysis buffer)에 재현탁하고, 마이크로플루다이저(microfludizer, Microfluidics, Westwood, MA)를 사용하여 균질화시킨 후, 15,000 rpm으로 4℃에서 40분 동안 원심분리하였다. 상층액을 80℃에서 5분간 가열한 후 15,000 rpm으로 4℃에서 30분 동안 원심분리하고, Q-Sepharose 음이온 교환 컬럼으로 단백질을 정제하여 HTT-I3-01 융합 단백질을 함유하는 분획을 수득한 후 농축시켰다. Pellets of harvested cells are resuspended in lysis buffer containing 20 mM Tris (pH 8.0), 200 mM NaCl, 10 mM β-mercaptoethanol and 0.1 mM PMSF, After homogenization using a microfludizer (Microfludizer, Microfluidics, Westwood, Mass.), It was centrifuged for 40 minutes at 4 ℃ at 15,000 rpm. The supernatant was heated at 80 ° C. for 5 minutes, centrifuged at 15,000 rpm for 30 minutes at 4 ° C., and purified by a Q-Sepharose anion exchange column to obtain a fraction containing HTT-I3-01 fusion protein. Concentrated.
<< 실시예Example 3> 항원 3> antigen 펩타이드의Peptide 제조 Produce
<< 실시예Example 3-1> V 3-1> V LL 12.12. 33 cyscys 펩타이드Peptide 및 And 헤마글루티닌Hemagglutinin (( hemagglutininhemagglutinin , HA) 항원이 융합된 융합 단백질의 제조, HA) Preparation of fusion protein fused antigen
인플루엔자 A 바이러스의 헤마글루티닌(hemagglutinin, 이하 HA로 표기) (A/California/ 04/2009 (H1N1))의 단편(18D~530I)을 항원 펩타이드로 사용하였다 (도 2). Fragments (18D-530I) of hemagglutinin (hereinafter referred to as HA) (A / California / 04/2009 (H1N1)) of influenza A virus were used as antigen peptides (FIG. 2).
상기 HA 항원 단편의 C-말단에 VL12.3cys 도메인이 융합된 단백질을 얻기 위해, 이를 암호화하는 폴리뉴클레오티드(표 6)를 PCR로 증폭하였다. 구체적으로, PCR 주형으로는 HA 는 Swine Flu H1N1 hemagglutinin (a.a. 1-530)( A/California/04/2009)의 cDNA 클론, VL12.3cys 는 MIT(Massachusetts Institute of Technology) Dr Wittrup 실험실로부터 얻은 VL12.3 single domain intrabody의 cDNA를 사용하였으며, 하기 프라이머를 이용하여 95℃에서 30초, 58℃에서 30초, 72℃에서 1분 30초 조건으로 PCR을 수행하였다. V L 12.3 cys at the C-terminus of the HA antigen fragment To obtain the protein with the domain fused, polynucleotides encoding it (Table 6) were amplified by PCR. Specifically, as a PCR template, HA is a cDNA clone of Swine Flu H1N1 hemagglutinin (aa 1-530) (A / California / 04/2009), V L 12.3 cys The cDNA of V L 12.3 single domain intrabody obtained from the Massachusetts Institute of Technology (MIT) Dr Wittrup Laboratories, was used for 30 seconds at 95 ℃, 30 seconds at 58 ℃, 1
(HA-VL12.3cys 정방향 프라이머: AGG CCT CTA GAA GCA TGG GTA GTC AAC CAG TAC TT (서열번호 31);(HA-V L 12.3 cys forward primer: AGG CCT CTA GAA GCA TGG GTA GTC AAC CAG TAC TT (SEQ ID NO: 31);
HA-VL12.3cys 역방향 프라이머: GTG ATG ATG ATG ATG ATG GCT ACT GCC TGC GGA CAG CAC CGT (서열번호 32))HA-V L 12.3 cys reverse primer: GTG ATG ATG ATG ATG ATG GCT ACT GCC TGC GGA CAG CAC CGT (SEQ ID NO: 32))
증폭된 HA-VL12.3cys 암호화 폴리뉴클레오티드를 pAcGP67A 바큘로바이러스 전달 벡터(baculovirus transfer vector, BD Biosciences, San Jose, CA)로 클로닝하였다. Amplified HA-V L 12.3 cys encoding polynucleotides were cloned into pAcGP67A baculovirus transfer vector (BD Biosciences, San Jose, Calif.).
클로닝된 벡터를 High Five 곤충 세포(High Five insect cells, Invitrogen, Waltham, MA)에 감염시키고, 28℃에서 2일 동안 배양 후 세포를 수득하였다. 세포 배양액을 4℃에서 4,000 rpm으로 30분 동안 원심분리하여 상등액을 얻은 후, 상등액에 0.1 mM PMSF, 10 mM β-메르캅토에탄올(β-mercaptoethanol)을 처리한 다음 상등액을 Ni-NTA 킬레이팅 아가로스 CL-6B 및 Q-Sepharose 음이온 교환 컬럼에 로딩하여 HA-VL12.3cys 융합 단백질을 정제하였다. The cloned vector was infected with High Five insect cells (High Five insect cells, Invitrogen, Waltham, Mass.) And cells were obtained after incubation at 28 ° C. for 2 days. The supernatant was obtained by centrifuging the cell culture at 4 ° C. at 4,000 rpm for 30 minutes. The supernatant was treated with 0.1 mM PMSF, 10 mM β-mercaptoethanol, and the supernatant was treated with Ni-NTA chelating agar. HA-V L 12.3 cys fusion proteins were purified by loading onto Ross CL-6B and Q-Sepharose anion exchange columns.
<< 실시예Example 3-2> V 3-2> V LL 12.12. 33 cyscys 펩타이드Peptide 및 PA(protective antigen) 항원이 융합된 융합 단백질의 제조 And preparation of a fusion protein to which a protective antigen (PA) antigen is fused.
바실러스 안트라시스(Bacillus anthracis)의 방어항원(protective antigen, 이하 PA)의 도메인 4(596F-735G)를 항원 펩타이드로 사용하였다. PA의 도메인4는 모세혈관 형성 단백질2(capillary morphogenesis protein 2, CMG2) 수용체에 대한 PA의 결합을 중재하고, 탄저병 중화 항체(anthrax neutralizing antibody)의 인식 부위이다. Domain 4 (596F-735G) of the protective antigen (PA) of Bacillus anthracis was used as the antigen peptide.
상기 PA 항원 단편의 C-말단에 VL12.3cys 도메인이 융합된 단백질을 얻기 위해, 이를 암호화하는 폴리뉴클레오티드(표 7)를 PCR로 증폭하였다. 구체적으로, PCR 주형으로는 PA 는 Addgene plasmid #11079, VL12.3cys 는 MIT(Massachusetts Institute of Technology) Dr Wittrup 실험실로부터 얻은 VL12.3 single domain intrabody의 cDNA를 사용하였으며, 하기 프라이머를 이용하여 95℃에서 30초, 58℃에서 30초, 72℃에서 30초 조건으로 PCR을 수행하였다. To obtain a protein in which the V L 12.3 cys domain was fused to the C-terminus of the PA antigen fragment, polynucleotides encoding it (Table 7) were amplified by PCR. Specifically, as the PCR template, PA was used as Addgene plasmid # 11079, and V L 12.3 cys was used as the cDNA of V L 12.3 single domain intrabody obtained from MIT Dr. M. Wittrup, Massachusetts Institute of Technology (MIT). PCR was performed at 30 seconds, 58 seconds at 30 seconds, and 72 seconds at 30 seconds.
(PA-VL12.3cys 정방향 프라이머: AAG AGC CAT GGG CTT TCA TTA TGA TAG AAA TAA C (서열번호 33); (PA-V L 12.3 cys forward primer: AAG AGC CAT GGG CTT TCA TTA TGA TAG AAA TAA C (SEQ ID NO: 33);
PA-VL12.3cys 역방향 프라이머: AGC ATC TCG AGT GCG GAC AGC ACC GTA ACT TTA (서열번호 34))PA-V L 12.3 cys reverse primer: AGC ATC TCG AGT GCG GAC AGC ACC GTA ACT TTA (SEQ ID NO: 34))
증폭된 PA-VL12.3cys 암호화하는 폴리뉴클레오티드를 pET28a 벡터에 클로닝하였다. The polynucleotide encoding the amplified PA-V L 12.3 cys was cloned into the pET28a vector.
클로닝된 벡터를 E. coli BL21(DE3) 균주에 형질전환하고, 박테리아 배양액의 O.D.600 값이 0.5에 도달할 때, 0.4 mM IPTG를 첨가하여 PA-VL12.3cys 융합 단백질 생산을 유도하였다. PA-VL12.3cys 융합 단백질은 30℃에서 3.5시간 배양한 후, 4℃에서 4000 rpm, 30분 동안 원심분리를 통해 E. coli(DE3)를 수확하였다. The cloned vector was transformed into E. coli BL21 (DE3) strain, and when the OD 600 value of the bacterial culture reached 0.5, 0.4 mM IPTG was added to PA-V L 12.3 cys Induced fusion protein production. PA-V L 12.3 cys fusion protein was incubated at 30 ° C. for 3.5 hours and then harvested E. coli (DE3) by centrifugation at 4000 rpm for 30 minutes at 4 ° C.
PA-VL12.3cys 융합 단백질을 발현하는 세포 펠릿을 20 mM Tris(pH 8.0), 200 mM NaCl, 10 mM β-메르캅토에탄올(β-mercaptoethanol) 및 0.1 mM PMSF를 포함한 용해 완충액(lysis buffer)에 재현탁하고, 마이크로플루다이저(microfludizer, Microfluidics, Westwood, MA)를 사용하여 균질화시켰다. 15,000 rpm으로 4℃에서 40분 동안 원심분리한 후, 단백질을 Ni-NTA 킬레이팅 아가로스 CL-6B(Incospharm, Daejeon, Korea) 및 Q-Sepharose(GE Healthcare, Pittsburgh, PA) 음이온 교환 컬럼으로 정제하였다. PA-VL12.3cys 융합 단백질을 포함하는 분획을 수득한 후 농축시켰다. Cell pellets expressing PA-V L 12.3 cys fusion protein were lysis buffer containing 20 mM Tris (pH 8.0), 200 mM NaCl, 10 mM β-mercaptoethanol and 0.1 mM PMSF. Resuspended and homogenized using a microfludizer (Microfludizer, Microfluidics, Westwood, Mass.). After centrifugation at 4 ° C. at 15,000 rpm for 40 minutes, the proteins were purified by Ni-NTA chelating agarose CL-6B (Incospharm, Daejeon, Korea) and Q-Sepharose (GE Healthcare, Pittsburgh, PA) anion exchange columns. It was. Fractions containing PA-V L 12.3 cys fusion protein were obtained and concentrated.
<< 실시예Example 4> V 4> V LL 12.12. 33 cyscys 가end 융합된 Fused 플라젤린(flagellin)의Flagellin 제조 Produce
D0 도메인을 포함하는 전장(full-length) 플라젤린은 D0 도메인이 절단된(truncated) 플라젤린보다 면역 반응을 자극하는 활성이 더 높다고 알려져있으나, 플라젤린 D0 도메인은 단백질 분해 및 중합(polymerization)을 증가시키는 경향이 있어, D0 도메인을 포함한 재조합 단백질의 생산은 종종 어려움이 따른다.Full-length flagellin containing the D0 domain is known to have higher activity to stimulate an immune response than flagellin, in which the D0 domain is truncated, while the flagellin D0 domain is responsible for proteolysis and polymerization. There is a tendency to increase, and production of recombinant proteins, including the D0 domain, is often difficult.
본 발명의 나노 입자 시스템에서 D0 도메인의 영향을 테스트하기 위해, D0 내지 D3를 모두 포함하는 전장(full-length) 플라젤린(이하 FliC로 표기)과 D1 내지 D3를 포함하는 절단된 플라젤린(이하 ΔFliC로 표기)를 모두 사용하였다. 전장 플라젤린(FliC)의 경우, 단백질 분해를 감소시키기 위해 이황화 결합을 도입시킨 SS5 돌연변이를 포함한다. SS5 돌연변이는 플라젤린(FliC)의 L36C와 D456C 잔기의 이황화 결합이며, 플라젤린의 단백질 분해를 감소시킨다. 또한 플라젤린과의 가장 적합한 융합 부위를 확인하기 위해, VL12.3cys을 플라젤린의 N-말단, C-말단 또는 D3 도메인(238G와 239G 사이, I) 내부에 융합시켰다 (도 2). To test the effect of the D0 domain in the nanoparticle system of the present invention, a full-length flagellin (hereinafter referred to as FliC) containing all of D0 to D3 and a cleaved flagellin containing D1 to D3 (hereinafter And denoted ΔFliC. For full-length flagellin (FliC), it includes SS5 mutations that introduce disulfide bonds to reduce proteolysis. The SS5 mutation is a disulfide bond of the L36C and D456C residues of flagellin (FliC) and reduces proteolysis of flagellin. Also, to identify the most suitable fusion site with flagellin, V L 12.3 cys was fused inside the N-terminal, C-terminal, or D3 domain (between 238G and 239G, I) of flagellin (FIG. 2).
표 8과 같이, 플라젤린과 VL12.3cys의 다양한 융합 단백질을 암호화하는 폴리뉴클레오티드를 PCR로 증폭하였다. 구체적으로, PCR 주형으로는 FliC 는 Addgene plasmid #85438, VL12.3cys 는 MIT(Massachusetts Institute of Technology) Dr Wittrup 실험실로부터 얻은 VL12.3 single domain intrabody의 cDNA를 사용하였으며, 하기 프라이머를 이용하여 95℃에서 30초, 58℃에서 30초, 72℃에서 30초 내지 1분 조건으로 PCR을 수행하였다. As shown in Table 8, polynucleotides encoding various fusion proteins of flagellin and V L 12.3 cys were amplified by PCR. Specifically, as a PCR template, FliC is Addgene plasmid # 85438, V L 12.3 cys The cDNA of V L 12.3 single domain intrabody obtained from the Massachusetts Institute of Technology (MIT) Dr Wittrup laboratory was used, 30 seconds at 95 ° C, 30 seconds at 58 ° C, 30 seconds to 1 minute at 72 ° C using the following primers: PCR was performed under the conditions.
(FliC(N)-VL12.3cys 정방향 프라이머: AGC GGC ATA TGG GTA GTC AAC CAG TAC TTA CAC AAA GCC CG (서열번호 35); (FliC (N) -V L 12.3 cys forward primer: AGC GGC ATA TGG GTA GTC AAC CAG TAC TTA CAC AAA GCC CG (SEQ ID NO: 35);
FliC(N)-VL12.3cys 역방향 프라이머: ATT ATG CGG CCG CTC AAC GCA GTA AAG AGA GGA CG (서열번호 36);FliC (N) -V L 12.3 cys reverse primers: ATT ATG CGG CCG CTC AAC GCA GTA AAG AGA GGA CG (SEQ ID NO: 36);
ΔFliC(N)-VL12.3cys 정방향 프라이머: ACT GGT GGT ACC ATG GGT AGT CAA CCA GTA CTT (서열번호 37); ΔFliC (N) -V L 12.3 cys forward primers: ACT GGT GGT ACC ATG GGT AGT CAA CCA GTA CTT (SEQ ID NO: 37);
ΔFliC(N)-VL12.3cys 역방향 프라이머: AGT TAC TCG AGA CGG GCA GAA GTC AGG TTG TT (서열번호 38);ΔFliC (N) -V L 12.3 cys reverse primers: AGT TAC TCG AGA CGG GCA GAA GTC AGG TTG TT (SEQ ID NO: 38);
ΔFliC(C)-VL12.3cys 정방향 프라이머: ATA ATC CAT GGG CTT TAC CGC GAA CAT CAA AGG T (서열번호 39); ΔFliC (C) -V L 12.3 cys forward primers: ATA ATC CAT GGG CTT TAC CGC GAA CAT CAA AGG T (SEQ ID NO: 39);
ΔFliC(C)-VL12.3cys 역방향 프라이머: AGC ATC TCG AGT GCG GAC AGC ACC GTA AC (서열번호 40);ΔFliC (C) -V L 12.3 cys reverse primer: AGC ATC TCG AGT GCG GAC AGC ACC GTA AC (SEQ ID NO: 40);
ΔFliC(I)-VL12.3cys 정방향 프라이머: ATA ATC CAT GGG CTT TAC CGC GAA CAT CAA AGG T (서열번호 41); ΔFliC (I) -V L 12.3 cys forward primers: ATA ATC CAT GGG CTT TAC CGC GAA CAT CAA AGG T (SEQ ID NO: 41);
ΔFliC(I)-VL12.3cys 역방향 프라이머: AGT TAC TCG AGA CGG GCA GAA GTC AGG TTG TT (서열번호 42))ΔFliC (I) -V L 12.3 cys reverse primer: AGT TAC TCG AGA CGG GCA GAA GTC AGG TTG TT (SEQ ID NO: 42))
증폭된 폴리뉴클레오티드를 pET28a 벡터(Addgene, Cambridge, MA)에 클로닝하였다.The amplified polynucleotides were cloned into pET28a vector (Addgene, Cambridge, MA).
서열amino acid
order
FliC (N) -V L 12.3 cys
ΔFliC (N) -V L 12.3 cys
클로닝된 벡터를 E. coli BL21(DE3) 균주에 형질전환하고, 박테리아의 O.D.600 값이 0.7에 도달할 때, 1 mM IPTG를 첨가하여 융합 단백질 생산을 유도하였다. 37℃에서 3시간 배양한 후, 4℃에서 4000 rpm, 30분 동안 원심분리를 통해 E. coli(DE3)를 수확하였다. The cloned vector was transformed into E. coli BL21 (DE3) strain and when the OD 600 value of the bacteria reached 0.7, 1 mM IPTG was added to induce fusion protein production. After 3 hours of incubation at 37 ° C, E. coli (DE3) was harvested by centrifugation at 4000 rpm for 30 minutes at 4 ° C.
수확한 세포 펠릿을 20 mM Tris(pH 8.0), 200 mM NaCl, 10 mM β-메르캅토에탄올(β-mercaptoethanol) 및 0.1 mM PMSF를 포함한 용해 완충액(lysis buffer)에 재현탁하고, 마이크로플루다이저(microfludizer, Microfluidics, Westwood, MA)를 사용하여 균질화시켰다. 15,000 rpm으로 4℃에서 40분 동안 원심분리한 후, 단백질을 Ni-NTA 킬레이팅 아가로스 CL-6B(Incospharm, Daejeon, Korea) 및 Q-Sepharose(GE Healthcare, Pittsburgh, PA) 음이온 교환 컬럼으로 정제하였다. 플라젤린-VL12.3cys 융합 단백질을 포함하는 분획을 수득한 후 농축시켰다. Harvested cell pellets are resuspended in lysis buffer containing 20 mM Tris (pH 8.0), 200 mM NaCl, 10 mM β-mercaptoethanol and 0.1 mM PMSF, followed by a microfluidizer. (microfludizer, Microfluidics, Westwood, Mass.) was used to homogenize. After centrifugation at 4 ° C. at 15,000 rpm for 40 minutes, the proteins were purified by Ni-NTA chelating agarose CL-6B (Incospharm, Daejeon, Korea) and Q-Sepharose (GE Healthcare, Pittsburgh, PA) anion exchange columns. It was. Fractions containing flagellin-V L 12.3 cys fusion protein were obtained and concentrated.
<< 실험예Experimental Example 1> 나노 입자의 제조 1> Preparation of Nanoparticles
실시예 2 내지 4에서 제조한 각 단백질의 정확한 농도는 SDS-PAGE와 농도계(densitometry)에 의해 계산되었고, 먼저 실시예 2에서 제조한 단량체 융합 단백질을 케이지 형태의 페리틴 자가조립체와 I3-01 자가조립체를 제조하였다. 제조한 자가조립체에 하기 표 9에 기재된 조합으로 실시예 3 및 4에서 제조한 항원 또는 플라젤린을 혼합하여 자가조립체에 결합시켜 나노 입자를 제조하였다. The exact concentration of each protein prepared in Examples 2 to 4 was calculated by SDS-PAGE and densitometry. First, the monomer fusion protein prepared in Example 2 was converted into cage-type ferritin self-assembly and I3-01 self-assembled. Was prepared. Nanoparticles were prepared by incorporating the antigen or flagellin prepared in Examples 3 and 4 into the self-assembly by combining the prepared self-assembly with the combinations shown in Table 9 below.
ΔFliC(I)-VL12.3cys , HA-VL12.3cys HTT cys -Ftn self-assembly,
ΔFliC (I) -V L 12.3 cys , HA-V L 12.3 cys
ΔFliC(I)-VL12.3cys , PA-VL12.3cys HTT cys -Ftn self-assembly,
ΔFliC (I) -V L 12.3 cys , PA-V L 12.3 cys
ΔFliC(I)-VL12.3cys , HA-VL12.3cys HTT cys -I3-01 self-assembly,
ΔFliC (I) -V L 12.3 cys , HA-V L 12.3 cys
제조한 나노 입자를 DPBS(Dulbecco 's phosphate-buffered saline, Welgene)를 완충제로 사용하여 Superdex 200(GE Healthcare) 크기 배제 크로마토그래피로 추가 정제하였다. 원하는 나노 입자를 포함하는 분획을 모아 농축시키고, High-Capacity Endotoxin Removal Resin(Pierce, Thermo Scientific, San Jose, CA)를 사용하여 엔도톡신을 제거하고, 농축된 단백질 용액을 여과멸균하였다. 자가조립된 나노 입자는 크기 배제 크로마토그래피를 통해 확인하였다. The prepared nanoparticles were further purified by Superdex 200 (GE Healthcare) size exclusion chromatography using DPBS (Dulbecco's phosphate-buffered saline, Welgene) as a buffer. Fractions containing the desired nanoparticles were collected and concentrated, endotoxin was removed using High-Capacity Endotoxin Removal Resin (Pierce, Thermo Scientific, San Jose, Calif.), And the concentrated protein solution was filtered sterilized. Self-assembled nanoparticles were identified through size exclusion chromatography.
크기 배제 크로마토그래피 용출 프로필에서 볼 수 있듯이, PA, HA 및 플라젤린은 페리틴 자가조립체에 안정적으로 결합하였고, HA 및 플라젤린은 또한 I3-01 자가조립체에 안정적으로 결합하였다 (도 3).As can be seen in the size exclusion chromatography elution profile, PA, HA and flagellin stably bound to ferritin autoassembly, and HA and flagellin also stably bound to I3-01 self-assembly (FIG. 3).
<< 실험예Experimental Example 2> 면역증강제(Adjuvant)로서 2> As an adjuvant 플라젤린Flagellin 선택 Select
<< 실험예Experimental Example 2-1> 2-1> FliC와With FliC ΔFliC에On ΔFliC 따른 According TLR5TLR5 활성화 측정 Activation measurement
면역증강제(adjuvant)로서 플라젤린 내의 D0 도메인의 효과를 조사하기 위해, D0 내지 D3를 모두 포함하는 전장(full-length) 플라젤린(FliC)과 D1 내지 D3를 포함하는 D0 도메인이 절단된 플라젤린(ΔFliC)의 TLR5 활성화능을 측정하였다. 이를 위해 실시예 2-1에서 제조한 HTTcys-Ftn 융합 단백질의 단량체로부터 제조한 페리틴 자가조립체에 실시예 4에서 제조한 VL12.3cys-FliC(N) 및 VL12.3cys-ΔFliC(N))을 각각 혼합하여, Ftn-FliC(N)과 Ftn-ΔFliC(N)을 제조하였다. To investigate the effect of the D0 domain in flagellin as an adjuvant, full-length flagellin (FliC) containing all of D0 to D3 and flagellin cleaved from the D0 domain including D1 to D3 TLR5 activation ability of (ΔFliC) was measured. To this end, in the ferritin self-assembly prepared from the monomer of the HTT cys- Ftn fusion protein prepared in Example 2-1, V L 12.3 cys -FliC (N) and V L 12.3 cys -ΔFliC (N) prepared in Example 4 ) Were mixed to prepare Ftn-FliC (N) and Ftn-ΔFliC (N).
TLR5 활성화 측정 과정은 다음과 같다. 24-웰 플레이트의 2×105의 HEK293 세포를 X-tremeGENE HP DNA 형질 전환 시약(Roche, Basel, Switzerland)을 이용하여 500 ng의 hTLR5 발현벡터(pcDNA3.1/hTLR5), 200 ng pBII firefly NF-κB 리포터 벡터 및 10 ng pRL-TK Renilla 인터널 컨트롤 벡터(internal control vector)로 형질전환하였다. 24시간 후, Ftn-ΔFliC(N) 및 Ftn-FliC(N)를 처리하고 18시간 동안 추가 배양하였다. 각 세포의 상대적인 루시퍼라제 활성(RLU, firefly/renilla)은 듀얼 루시퍼라제 리포터 어세이(Promega, Madison, WI) 키트 및 VICTOR 3 멀티라벨 플레이트 리더(Wallac 1420, Perkin Elmer)로 제조사의 프로토콜에 따라 분석하였으며, 결과 수치는 DPBS 완충액으로 처리된 샘플의 RLU로 표준화하였다.The procedure for measuring TLR5 activation is as follows. 2 × 10 5 HEK293 cells in 24-well plates were prepared using X-tremeGENE HP DNA transfection reagent (Roche, Basel, Switzerland) at 500 ng of hTLR5 expression vector (pcDNA3.1 / hTLR5), 200 ng pBII firefly NF κB reporter vector and 10 ng pRL-TK Renilla internal control vector were transformed. After 24 hours, Ftn-ΔFliC (N) and Ftn-FliC (N) were treated and further incubated for 18 hours. Relative luciferase activity (RLU, firefly / renilla) of each cell was analyzed according to manufacturer's protocol with dual luciferase reporter assay (Promega, Madison, WI) kit and
그 결과, 전장 플라젤린(FliC)은 절단된 플라젤린(ΔFliC)보다 단지 1.4 내지 2.3 배의 활성을 나타내었다 (도 4). As a result, full-length flagellin (FliC) showed only 1.4-2.3 times more activity than truncated flagellin (ΔFliC) (FIG. 4).
<< 실험예Experimental Example 2-2> 2-2> FliC와With FliC ΔFliC에To ΔFliC 따른 According IgGIgG 수치 측정 Numerical measurement
시험관 내에서(in vitro) 전장(full-length) 플라젤린(FliC)과 절단된 플라젤린(ΔFliC)에 따른 면역 반응을 비교하고자 하였다. 이를 위해 상기 <실험예 2-1>에 기재된 바와 유사하게 HTTcys-Ftn 융합 단백질로 구성된 페리틴 자가조립체에 표 10에 기재된 바와 같이 HA-VL12.3cys와 ΔFliC(N)-VL12.3cys 또는 HA-VL12.3cys와 FliC(N)-VL12.3cys 를 혼합하여 Ftn-HA-ΔFliC(N) 및 Ftn-HA-FliC(N)를 제조하였다. To compare the immune response according to the in vitro (in vitro) full-length (full-length) Plastic jelrin (FliC) and cutting the Plastic jelrin (ΔFliC). To this end, ferritin self-assembly composed of HTT cys- Ftn fusion protein similarly as described in <Experimental Example 2-1>, as described in Table 10, HA-V L 12.3 cys and ΔFliC (N) -V L 12.3 cys or HA-V L 12.3 cys and FliC (N) -V L 12.3 cys were mixed to prepare Ftn-HA-ΔFliC (N) and Ftn-HA-FliC (N).
ΔFliC(N)-VL12.3cys , HA-VL12.3cys HTT cys -Ftn self-assembly,
ΔFliC (N) -V L 12.3 cys , HA-V L 12.3 cys
(Ftn : HA : ΔFliC = 24:10:2.5)Ftn-HA-ΔFliC (N)
(Ftn: HA: ΔFliC = 24: 10: 2.5)
FliC(N)-VL12.3cys , HA-VL12.3cys HTT cys -Ftn self-assembly,
FliC (N) -V L 12.3 cys , HA-V L 12.3 cys
(Ftn : HA : FliC = 24:10:2.5)Ftn-HA-FliC (N)
(Ftn: HA: FliC = 24: 10: 2.5)
마우스에 주사하기 전에 페리틴에 결합된 HA 항원 또는 플라젤린의 몰비(표 10)은 SDS-PAGE 및 농도계를 이용하여 확인하였으며, 조립된 나노 입자에서 페리틴과 HA의 몰비는 24:10이었다. The molar ratio of HA antigen or flagellin bound to ferritin (Table 10) prior to injection into the mice was confirmed using SDS-PAGE and densitometry. The molar ratio of ferritin and HA in the assembled nanoparticles was 24:10.
충남대학교 실험 동물 관리위원회의 승인을 얻은 후 대한 바이오 링크(Eumseong, Korea)로부터 구입한 후, 6주령의 암컷 BALB/c 마우스를 각 5마리의 두 그룹으로 나눈 후 3주 간격으로 Ftn-HA-ΔFliC(N) 및 Ftn-HA-FliC(N)을 포함한 PBS 용액(HA의 농도, 5.2 μg/100 μl PBS)으로 우측 측면에 2회 피하 주사하였다. After obtaining approval from the Chungnam National University Experimental Animal Management Committee, purchased from Daehan Biolink (Eumseong, Korea), 6-week-old female BALB / c mice were divided into two groups of 5 dogs each and then Ftn-HA- Two subcutaneous injections were made on the right side with PBS solution (concentration of HA, 5.2 μg / 100 μl PBS) containing ΔFliC (N) and Ftn-HA-FliC (N).
1차 면역 접종 1주일 전 그리고 1차 면역 접종 및 반복 접종(priming and boosting) 2주 후에 안구에서 혈액을 채혈한 후 혈청 내 IgG(Total IgG, IgG1 및 IgG2a) 수치를 하기에 기재된 바와 같이 ELISA로 측정하였다. 96웰 플레이트(microtiter plate; Komabiotech., Seoul, Korea)의 웰을 10 ㎍/ml의 HA 코팅 완충액(pH 9.6, Komabiotech) 100 ㎕로 4℃에서 밤새 코팅한 후, 세척 완충액(0.05 % Tween을 포함하는 1×PBS)으로 3회 세척하고 실온에서 2시간 동안 1% BSA를 함유한 PBS로 블로킹시켰다. 채취한 혈청을 0.1% BSA를 함유한 PBS에 1:100으로 희석하고, 추가로 연속 10배 희석한 샘플을 BSA-블로킹된 웰에 첨가하였다. 실온에서 2시간 동안 반응시킨 후, 플레이트를 세척 완충액으로 3회 세척하였다. 호스래디쉬페록시다제(Horseradish peroxidase; Abcam, Cambridge, UK)가 결합된 항체(conjugated with goat anti-mouse IgG, IgG1, IgG2a 또는 IgG2b)를 0.1% BSA를 함유한 PBS 에 1:10,000 으로 희석하여 첨가하였다. 실온에서 2시간 동안 반응시킨 후, 플레이트를 세척 완충액으로 3회 다시 세척하고, 100 ㎕ TMB 현상액(Komabiotech)을 첨가하였다. 10분 후에 0.5M 황산 100 ㎕로 반응을 정지시키고, 색상을 마이크로 플레이트 판독기(Tecan GENios Pro, Mannedorf, Switzerland)로 450 nm에서 측정하였다. 1:100으로 희석한 미리 면역화된 마우스 혈청보다 2배 높은 OD450을 나타낸 가장 많이 희석한 샘플을 항체의 최종 항체 역가로 정하였다.Serum IgG (Total IgG, IgG 1 and IgG 2a ) levels after blood sampling from the eye one week before the first immunization and two weeks after the first immunization and priming and boosting as described below. Measured by ELISA. Wells of a 96 well plate (microtiter plate; Komabiotech., Seoul, Korea) were coated overnight at 4 ° C. with 100 μl of 10 μg / ml HA coating buffer (pH 9.6, Komabiotech), followed by wash buffer (0.05% Tween). 1 × PBS) and blocked with PBS containing 1% BSA for 2 hours at room temperature. The collected serum was diluted 1: 100 in PBS containing 0.1% BSA and an additional 10-fold serial diluted sample was added to the BSA-blocked wells. After reacting for 2 hours at room temperature, the plates were washed three times with wash buffer. Conjugated with goat anti-mouse IgG, IgG 1 , IgG 2a or IgG 2b bound to Horseradish peroxidase (Abcam, Cambridge, UK) was 1: 10,000 in PBS containing 0.1% BSA. Diluted with and added. After reacting for 2 hours at room temperature, the plates were washed again three times with wash buffer and 100 μl TMB developer (Komabiotech) was added. After 10 minutes the reaction was stopped with 100 μl of 0.5 M sulfuric acid and the color was measured at 450 nm with a micro plate reader (Tecan GENios Pro, Mannedorf, Switzerland). The most diluted sample showing OD 450 twice as high as pre-immunized mouse serum diluted 1: 100 was defined as the final antibody titer of the antibody.
그 결과, 혈청 IgG1 수치는 Ftn-HA-ΔFliC(N) 및 Ftn-HA-FliC(N) 모두 비슷했다(도 5). Ftn-HA-ΔFliC(N) 처리 시, 혈청 내 총 IgG 및 IgG2a의 양은 각각 2.1 및 2.7배 더 높은 수준을 나타내었다. 플라젤린의 D0 도메인은 본 발명의 플라젤린-페리틴 시스템에서 IgG 반응에 별 영향이 없는 것으로 결론을 내렸으며, 후속 실험에서 나노 입자를 만드는데 D0 도메인이 없는 플라젤린을 사용하였다.As a result, serum IgG 1 levels were similar for both Ftn-HA-ΔFliC (N) and Ftn-HA-FliC (N) (FIG. 5). Upon Ftn-HA-ΔFliC (N) treatment, the amounts of total IgG and IgG 2a in serum showed 2.1 and 2.7 times higher levels, respectively. It was concluded that the D0 domain of flagellin had little effect on the IgG response in the flagellin-ferritin system of the present invention, and in subsequent experiments flagellin without D0 domain was used to make nanoparticles.
<< 실험예Experimental Example 3> 3> 플라젤린에의Flagellin 융합 부위( Fusion site ( ΔFliCΔFliC (C), (C), ΔFliCΔFliC (I) 및 (I) and ΔFliCΔFliC (N))에 따른 TLR5 활성화 측정 Measurement of TLR5 activation according to (N))
플라젤린(ΔFliC)에의 최적의 융합 부위를 확인하기 위해, 실시예 2-1에서 제조한 HTTcys-Ftn 융합 단백질의 단량체로부터 케이지 형태의 페리틴 자가조립체를 제조하였다. 제조한 자가조립체에 실시예 4에서 제조한 VL12.3cys-ΔFliC(N), VL12.3cys-ΔFliC(C) 및 VL12.3cys-ΔFliC(I)을 각각 혼합하여, Ftn:FliC(ΔFliC)가 24:10의 몰비인 Ftn-ΔFliC(N), Ftn-ΔFliC(C) 및 Ftn-ΔFliC(I)의 나노 입자를 제조하고, 이의 TLR5 활성화능을 측정하였다. In order to identify the optimal fusion site to flagellin (ΔFliC), cage-type ferritin self-assembly was prepared from the monomer of the HTT cys- Ftn fusion protein prepared in Example 2-1. In the prepared self-assembly, V L 12.3 cys -ΔFliC (N), V L 12.3 cys -ΔFliC (C) and V L 12.3 cys -ΔFliC (I) prepared in Example 4, respectively, were mixed and Ftn: FliC (ΔFliC ) Nanoparticles of Ftn-ΔFliC (N), Ftn-ΔFliC (C) and Ftn-ΔFliC (I) having a molar ratio of 24:10 were prepared and their TLR5 activation capacity was measured.
TLR5 활성화 측정은 실험예 2-1의 나노 입자 대신 Ftn-ΔFliC(N), Ftn-ΔFliC(C), Ftn-ΔFliC(I) 그리고 페리틴 나노 입자(Ftn)과 플라젤린(ΔFliC)의 비결합된 혼합물(Ftn + ΔFliC)을 사용한 것을 제외하고, 실험예 2-1에 기재된 방법과 동일한 방법으로 수행되었다.TLR5 activation was measured by Ftn-ΔFliC (N), Ftn-ΔFliC (C), Ftn-ΔFliC (I) and unbound ferritin nanoparticles (Ftn) and flagellin (ΔFliC) instead of the nanoparticles of Experimental Example 2-1. Except for using the mixture (Ftn + ΔFliC), it was carried out in the same manner as described in Experimental Example 2-1.
그 결과, 페리틴과 플라젤린(ΔFliC)의 비결합된 혼합물(Ftn + ΔFliC)은 무시할 수 있을 정도의 활성을 나타내었고, 플라젤린이 결합된 모든 페리틴 나노 입자는 농도 의존적으로 TLR5를 활성화시켰다 (도 6). 특히 Ftn-ΔFliC(N) 또는 Ftn-ΔFliC(I) 경우, Ftn-ΔFliC(C) 보다 1.3 내지 1.9배 더 높게 TLR5를 활성화시켰는데, 이는 ΔFliC의 N-말단 또는 D3 도메인과 페리틴과의 결합이 TLR5 신호 전달 경로를 자극하는데 매우 효과적임을 제시한다. D3 도메인은 TLR5와의 상호 작용에 관여하지 않기 때문에, 후속 실험에서 ΔFliC의 238G와 238G 사이에 VL12.3cys 도메인과 융합시킨 페리틴 나노 입자를 선택했다.As a result, the unbound mixture of ferritin and flagellin (ΔFliC) showed negligible activity, and all of the flagellin-bound ferritin nanoparticles activated TLR5 in a concentration dependent manner (FIG. 6). Particularly in the case of Ftn-ΔFliC (N) or Ftn-ΔFliC (I), TLR5 was activated 1.3 to 1.9 times higher than Ftn-ΔFliC (C), indicating that the binding of N-terminal or D3 domains of ΔFliC with ferritin It is very effective in stimulating TLR5 signaling pathway. Since the D3 domain is not involved in the interaction with TLR5, in subsequent experiments, ferritin nanoparticles fused with VL 12.3 cys domain between 238G and 238G of ΔFliC were selected.
<< 실험예Experimental Example 4> 4> 플라젤린이Flagellin 결합된Combined 페리틴 Ferritin 나노 입자의Nanoparticles 면역 반응 Immune response
실험예 3에서 플라젤린-페리틴 나노 입자는 플라젤린이 비결합된 나노 입자 보다 TLR5를 더 효과적으로 활성화시켰으므로, 플라젤린-페리틴 나노 입자가 보다 강력한 면역증강(adjuvant) 반응을 나타낼 수 있는지 조사하였다.Since the flagellin-ferritin nanoparticles in Experimental Example 3 activated TLR5 more effectively than the flagellin-unbound nanoparticles, it was investigated whether the flagellin-ferritin nanoparticles can show a stronger adjuvant response.
이를 위해, 실시예 2-1에서 제조한 HTTcys-Ftn 융합 단백질로부터 페리틴 자가조립체를 제조하였다. 제조한 자가조립체에 하기 표 11에 기재된 바와 같이 실시예 3 및 4에서 제조한 항원 또는 플라젤린을 혼합하여, Ftn-ΔFliC(I), Ftn-HA 및 Ftn-HA-ΔFliC(I)를 제조하였다. To this end, ferritin self-assembly was prepared from the HTT cys- Ftn fusion protein prepared in Example 2-1. Ftn-ΔFliC (I), Ftn-HA and Ftn-HA-ΔFliC (I) were prepared by mixing the antigen or flagellin prepared in Examples 3 and 4 with the prepared self-assembly. .
(Ftn : ΔFliC = 24:10)Ftn-ΔFliC (I)
(Ftn: ΔFliC = 24:10)
(Ftn : HA = 24:10)Ftn-ha
(Ftn: HA = 24:10)
(Ftn : HA : ΔFliC =
24:10:3.3)Ftn-HA-ΔFliC (I)
(Ftn: HA: ΔFliC =
24: 10: 3.3)
마우스 혈청 내 IgG 수치 측정은 실험예 2-2의 나노 입자 대신 HA, Ftn+ΔFliC(I)+HA, Ftn-ΔFliC(I)+HA, Ftn-HA+ΔFliC(I), Ftn-HA-ΔFliC(I)을 사용한 것을 제외하고, 실험예 2-2에 기재된 방법과 동일한 방법으로 수행하였다. 결합(conjugated) 및 비결합(non-conjugated) 형태의 HA의 총 농도는 100 μl PBS 당 5.2 μg이었으며, 최종 조립된 나노 입자에서 페리틴 대 HA의 몰비(molar ratio)는 24:10 이었다.IgG levels in mouse serum were measured by HA, Ftn + ΔFliC (I) + HA, Ftn-ΔFliC (I) + HA, Ftn-HA + ΔFliC (I), Ftn-HA-ΔFliC instead of the nanoparticles of Experimental Example 2-2. Except for using (I), it was carried out in the same manner as described in Experimental Example 2-2. The total concentration of conjugated and non-conjugated HA was 5.2 μg per 100 μl PBS, and the molar ratio of ferritin to HA in the final assembled nanoparticles was 24:10.
시험관 내에서(in vitro) TLR5 활성화 분석에서 관찰된 것과는 달리, Ftn-ΔFliC(I) + HA(HA는 비결합된 형태로 처리)는 Ftn +ΔFliC + HA(ΔFliC 및 HA 모두 비결합된 형태로 처리)와 유사한 수준으로 마우스에서 약한 혈청 IgG 반응을 유도하였다(도 7의 (A)). 그러나 Ftn-HA-ΔFliC(I)는 Ftn-HA + ΔFliC(ΔFliC는 비결합된 형태로 처리) 보다 16.7 배 더 높은 IgG 반응을 유도하였다(도 7의 (B)). 이러한 결과는 항원과 플라젤린을 융합시키는 것이 항원과 플라젤린의 단순한 혼합보다 강력한 면역 반응을 유도함을 보여준다. 또한 HA와 플라젤린이 서로 간에 직접적으로 결합되지 않더라도 페리틴 자가조립체에 HA와 플라젤린의 동시 결합(simultaneous conjugation)은 강력한 혈청 항체 반응을 유도할 수 있으며, HA-페리틴 나노 입자에 부착된 플라젤린이 강력한 면역증강제(adjuvant)임을 제시한다.Unlike observed in in vitro TLR5 activation assays, Ftn-ΔFliC (I) + HA (HA treated in unbound form) was Ftn + ΔFliC + HA (ΔFliC and HA unbounded form) Were induced a weak serum IgG response in mice to levels similar to the treatment (Fig. 7 (A)). However, Ftn-HA-ΔFliC (I) induced an 16.7 fold higher IgG response than Ftn-HA + ΔFliC (ΔFliC treated in unbound form) (FIG. 7B). These results show that fusion of antigen and flagellin elicits a stronger immune response than simple mixing of antigen and flagellin. In addition, even if HA and flagellin are not directly bound to each other, the simultaneous binding of HA and flagellin to ferritin self-assembly can induce a strong serum antibody response, and the flagellin attached to HA-ferritin nanoparticles Suggests a potent adjuvant.
<< 실험예Experimental Example 5> 세포성 면역 반응(cellular immune response)에 필요한 5> necessary for cellular immune response 플라젤린의Flagellin 최소량 확인 Minimum quantity check
<< 실험예Experimental Example 5-1> 5-1> HA:ΔFliC의Of HA: ΔFliC 몰비에 따른 Molar ratio IgGIgG 수치 측정 Numerical measurement
면역증강(adjuvant) 활성에 필요한 HA-페리틴 나노 입자의 플라젤린의 최소량을 확인하기 위해, HA 대 플라젤린의 몰비에 따른 마우스의 면역 반응을 조사하였다. To determine the minimum amount of flagellin in HA-ferritin nanoparticles required for adjuvant activity, the immune response of mice according to the molar ratio of HA to flagellin was examined.
이를 위해 실시예 2-1에서 제조한 HTTcys-Ftn 융합 단백질로부터 케이지 형태의 페리틴 자가조립체를 제조하였다. 제조한 자가조립체에 하기 표 12에 기재된 조합으로 VL12.3cys --ΔFliC(I)과 HA-VL12.3cys 융합 단백질을 혼합하여, HA 대 ΔFliC(I)의 몰비가 1:1 내지 4:1인 Ftn-HA-ΔFliC(I)을 제조하였다. To this end, cage-type ferritin self-assembly was prepared from the HTT cys- Ftn fusion protein prepared in Example 2-1. In the prepared self-assembly, V L 12.3 cys -- ΔFliC (I) and HA-V L 12.3 cys fusion proteins were mixed in the combinations shown in Table 12, and the molar ratio of HA to ΔFliC (I) was 1: 1 to 4: Ftn-HA-ΔFliC (I), which is 1, was prepared.
(Ftn : HA = 24:10)Ftn-ha
(Ftn: HA = 24:10)
(혼합 시 HA-VL12.3cys : ΔFliC(I)-VL12.3cys = 3:1)HTT cys -Ftn autoassembly, ΔFliC (I) -V L 12.3 cys , HA-V L 12.3 cys
(Mixed HA-V L 12.3 cys ΔFliC (I) -V L 12.3 cys = 3: 1)
(Ftn: HA:ΔFliC = 24:10:10)Ftn-HA-ΔFliC (I)
(Ftn: HA: ΔFliC = 24:10:10)
(혼합 시 HA-VL12.3cys : ΔFliC(I)-VL12.3cys = 6:1)HTT cys -Ftn autoassembly, ΔFliC (I) -V L 12.3 cys , HA-V L 12.3 cys
(Mixed HA-V L 12.3 cys ΔFliC (I) -V L 12.3 cys = 6: 1)
(Ftn: HA:ΔFliC = 24:10:5)Ftn-HA-ΔFliC (I)
(Ftn: HA: ΔFliC = 24: 10: 5)
(혼합 시 HA-VL12.3cys : ΔFliC(I)-VL12.3cys = 9:1)HTT cys -Ftn autoassembly, ΔFliC (I) -V L 12.3 cys , HA-V L 12.3 cys
(Mixed HA-V L 12.3 cys ΔFliC (I) -V L 12.3 cys = 9: 1)
(Ftn: HA:ΔFliC = 24:10:3.3)Ftn-HA-ΔFliC (I)
(Ftn: HA: ΔFliC = 24: 10: 3.3)
(혼합 시 HA-VL12.3cys : ΔFliC(I)-VL12.3cys = 12:1)HTT cys -Ftn autoassembly, ΔFliC (I) -V L 12.3 cys , HA-V L 12.3 cys
(Mixed HA-V L 12.3 cys ΔFliC (I) -V L 12.3 cys = 12: 1)
(Ftn: HA:ΔFliC = 24:10:2.5)Ftn-HA-ΔFliC (I)
(Ftn: HA: ΔFliC = 24: 10: 2.5)
마우스 혈청 내 IgG 수치 측정은 실험예 2-2의 나노 입자 대신 Ftn-HA, HA:ΔFliC(I)의 몰비가 1:1 내지 4:1인 Ftn-HA-ΔFliC(I)을 사용한 것을 제외하고, 실험예 2-2에 기재된 방법과 동일한 방법으로 수행하였다. HA의 총 농도는 100 μl PBS 당 5.2 μg이었으며, 최종 조립된 나노 입자에서 페리틴 대 HA의 몰비(molar ratio)는 24:10 이었다.IgG levels in mouse serum were measured using Ftn-HA-ΔFliC (I) having a molar ratio of Ftn-HA, HA: ΔFliC (I) of 1: 1 to 4: 1 instead of the nanoparticles of Experimental Example 2-2. , The same method as described in Experimental Example 2-2 was carried out. The total concentration of HA was 5.2 μg per 100 μl PBS and the molar ratio of ferritin to HA in the final assembled nanoparticles was 24:10.
그 결과 도 8에 나타낸 바와 같이, 총 IgG 및 IgG1 생산은 HA:ΔFliC(I)의 몰비가 4:1 이어도 유의한 영향을 받지 않았다. 그러나 HA 대 ΔFliC의 몰비가 4:1인 경우의 IgG2a의 수치는 그의 몰비가 1:1인 경우 보다 4.8 배 낮았다. 따라서, HA:ΔFliC의 몰비가 4:1일 때, 혈청 내 IgG2a에 대한 IgG1의 비는 4배 증가하였다. 혈청 IgG2b 수준 또한 35.1% 감소했다. As a result, as shown in Figure 8, the total IgG and IgG 1 production was not significantly affected even if the molar ratio of HA: ΔFliC (I) 4: 1. However, when the molar ratio of HA to ΔFliC is 4: 1, the level of IgG 2a was 4.8 times lower than that of 1: 1. Therefore, when the molar ratio of HA: ΔFliC was 4: 1, the ratio of IgG 1 to IgG 2a in serum increased by 4 times. Serum IgG2b levels also decreased by 35.1%.
면역 글로불린 IgG1으로의 클래스 전환은 인터루킨-4(IL-4), IgG2a으로의 클래스 전환은 인터페론-감마(IFN-γ)와 같은 사이토카인이 필요하므로, IgG1의 증가는 Th2 반응의 증가이며, IgG2a의 증가는 Th1 반응의 증가이다. 페리틴 자가조립체에 결합한 헤마글루티닌 대 플라젤린의 몰비는 3:1 까지 IgG2a 클래스 전환과 Th1 반응에 영향이 없이 플라젤린의 양을 줄일 수 있음을 확인하였다. Since class conversion to immunoglobulin IgG1 requires interleukin-4 (IL-4), and class conversion to IgG2a requires cytokines such as interferon-gamma (IFN-γ), an increase in IgG1 is an increase in Th2 response and IgG2a Is an increase in the Th1 response. The molar ratio of hemagglutinin to flagellin bound to the ferritin self-assembly was found to reduce the amount of flagellin up to 3: 1 without affecting IgG2a class conversion and Th1 response.
<< 실험예Experimental Example 5-2> 5-2> HA:ΔFliC의Of HA: ΔFliC 몰비에 따른 사이토카인 분비량 측정 Measurement of cytokine secretion according to molar ratio
면역 글로불린의 클래스 전환은 주로 B 림프구와 특이적인 사이토카인, 구체적으로 IgG1을 만드는데 필요한 인터루킨-4(IL-4) 및 IgG2a를 만드는데 요구되는 인터페론-감마(IFN-γ)와 같은 사이토카인과의 상호작용에 의해 영향을 받는다. 따라서 <실험예 5-1>에서 제조한 Ftn-HA 또는 Ftn-HA-ΔFliC 나노 입자가 주입된 마우스의 비장 세포에서 사이토카인을 측정하였다. Class switching of immunoglobulins is primarily due to interactions with B lymphocytes and cytokines such as interferon-gamma (IFN-γ), which is required to produce specific cytokines, specifically interleukin-4 (IL-4) and IgG2a, which are required to make IgG1. Affected by action Therefore, cytokines were measured in spleen cells of mice injected with Ftn-HA or Ftn-HA-ΔFliC nanoparticles prepared in Experimental Example 5-1.
구체적으로, 마우스에 Ftn-HA 또는 Ftn-HA-ΔFliC 나노 입자를 반복 접종(boosting)하고 3주 후에 비장 세포를 분리하였다. RBC 용해 완충액(lysis buffer, Sigma)로 적혈구를 용해시킨 비장 세포(1 x 106 세포)를 96-웰 플레이트에 분주한 후, HA 캘리포니아(H1N1)의 100 μg/ml 농도의 139 15-mer 펩타이드의 혼합물(PM-INFA-HACal, JPT innovative peptide solutions, Berlin, Germany) 10 μg/ml로 자극하고, 37℃, 5% CO2에서 3일간 배양하였다. 상등액을 수득, INF-γ 및 IL-4의 양을 ELISA 키트(Komabiotech)를 이용하여 제조자의 프로토콜에 따라 측정하였다.Specifically, mice were repeatedly inoculated with Ftn-HA or Ftn-HA-ΔFliC nanoparticles and splenocytes were separated after 3 weeks. Spleen cells (1 × 10 6 cells) lysed with erythrocytes in RBC lysis buffer (Sigma) were dispensed into 96-well plates and then 139 15-mer peptides at 100 μg / ml concentration in HA CA (H1N1). The mixture was stimulated with 10 μg / ml (PM-INFA-HACal, JPT innovative peptide solutions, Berlin, Germany) and incubated at 37 ° C., 5% CO 2 for 3 days. Supernatants were obtained and the amounts of INF-γ and IL-4 were measured using the ELISA kit (Komabiotech) according to the manufacturer's protocol.
도 9에 나타낸 바와 같이, Ftn-HA-ΔFliC 나노 입자가 주입된 마우스의 비장 세포를 HA 펩티드로 자극하였을 때, IFN-γ 분비는 Ftn-HA가 투여된 마우스의 비장 세포보다 HA:ΔFliC의 몰비가 1:1 또는 2:1에서 각각 2.8배 또는 5.4배 더 높았다. 그러나 IFN-γ의 분비량은 HA:ΔFliC의 몰비가 4:1일 때, 유의하게 감소하였다. IL-4의 분비량도 ΔFliC을 페리틴 자가조립체에 결합시킨 경우 증가하였지만, 분비량은 4:1 까지의 HA:ΔFliC 비율에 민감하지 않았다. As shown in FIG. 9, when splenocytes of mice injected with Ftn-HA-ΔFliC nanoparticles were stimulated with HA peptides, IFN-γ secretion was higher in the molar ratio of HA: ΔFliC than spleen cells of Ftn-HA-treated mice. Was 2.8 or 5.4 times higher at 1: 1 or 2: 1, respectively. However, the secretion of IFN-γ was significantly decreased when the molar ratio of HA: ΔFliC was 4: 1. The secretion of IL-4 also increased when ΔFliC was bound to the ferritin self-assembly, but the secretion was not sensitive to the HA: ΔFliC ratio up to 4: 1.
종합적으로, 이러한 결과는 HA 및 플라젤린이 동시에 결합된 페리틴 나노 입자가 체액성 면역 반응 및 항원-특이적 T세포 반응을 자극하며, IgG2a 클래스 전환 및 Th1 반응에 영향 끼치는 것 없이 HA 대 플라젤린의 몰비를 3:1 까지 줄일 수 있음을 제시한다. Overall, these results indicate that ferritin nanoparticles bound to HA and flagellin simultaneously stimulate humoral immune and antigen-specific T-cell responses, and that HA versus flagellin is not affected without affecting IgG2a class conversion and Th1 response. It is suggested that the molar ratio can be reduced to 3: 1.
<< 실험예Experimental Example 5-3> HA의 5-3> of HA 분자수에On the number of molecules 따른 According IgGIgG 수치 확인 Numerical check
페리틴 자가조립체에 결합된 HA 분자의 수에 따라 혈청 IgG 수치에 미치는 영향을 조사하였다. 이를 위해 실시예 2-1에서 제조한 HTTcys-Ftn 단백질로부터 케이지 형태의 페리틴 자가조립체를 제조하고, 상기 제조한 자가조립체에 실시예 3-1에서 제조한 VL12.3cys 융합 단백질을 혼합하여 HA 4분자만 가진 Ftn-HA(low) 나노 입자와 HA 24분자를 가진 Ftn-HA(high) 나노 입자를 생산하고, 이들의 면역 자극 활성(immunostimulatory activities)을 비교했다.The effect of serum IgG levels on the number of HA molecules bound to the ferritin self-assembly was investigated. To this end, a cage-type ferritin self-assembly was prepared from the HTT cys- Ftn protein prepared in Example 2-1, and the HA was prepared by mixing the V L 12.3 cys fusion protein prepared in Example 3-1 with the prepared self-assembly. Ftn-HA (low) nanoparticles having only 4 molecules and Ftn-HA (high) nanoparticles having 24 molecules of HA were produced and their immunostimulatory activities were compared.
마우스 혈청 내 IgG 수치 측정은 실험예 2-2의 나노 입자 대신 Ftn-HA(low), Ftn-HA(high) 및 HA:ΔFliC(I)의 몰비가 3:1인 Ftn-HA-ΔFliC(I)을 사용한 것을 제외하고, 실험예 2-2에 기재된 방법과 동일한 방법으로 수행하였다.IgG levels in mouse serum were measured by Ftn-HA-ΔFliC (I) with a molar ratio of 3: 1 of Ftn-HA (low), Ftn-HA (high) and HA: ΔFliC (I) instead of the nanoparticles of Experiment 2-2. ) Was carried out in the same manner as described in Experimental Example 2-2.
그 결과 도 10에 도시된 바와 같이, Ftn-HA(high) 나노 입자는 Ftn-HA(low) 나노 입자보다 강력한 총 IgG, IgG1, IgG2a 및 IgG2b 반응을 유도하였다. 그러나 IgG1 이외의 IgG 반응은 Ftn-HA-FliC의 3:1 비율(Ftn-HA-FliC 내 HA:플라젤린의 몰비=3:1)의 IgG 반응보다 유의하게 낮았다. 특히, Ftn-HA-ΔFliC 3:1 나노 입자에 의해 유도된 IgG2a 및 IgG2b 수준은 Ftn-HA(high) 나노 입자에 의해 유도된 것보다 각각 1.8 및 7 배 더 높았다. 이러한 결과는 최대로 결합된(conjugated) HA가 체액성 면역 반응을 유도하는데 유용하지만, 자가 면역 증강 활성(self-adjuvant activity)을 가진 매우 효과적인 나노 입자를 생산하기 위해서는 플라젤린이 페리틴 자가조립체에 결합되어야 함을 나타낸다. As a result, as shown in FIG. 10, the Ftn-HA (high) nanoparticles induced stronger total IgG, IgG 1 , IgG 2a and IgG 2b responses than the Ftn-HA (low) nanoparticles. However, IgG response other than IgG 1 was significantly lower than the IgG response of 3: 1 ratio of Ftn-HA-FliC (molar ratio of HA: flagellin in Ftn-HA-FliC = 3: 1). In particular, IgG 2a and IgG 2b levels induced by Ftn-HA-ΔFliC 3: 1 nanoparticles were 1.8 and 7 times higher than those induced by Ftn-HA (high) nanoparticles, respectively. These results suggest that while maximally conjugated HA is useful for inducing a humoral immune response, flagellin binds to ferritin autoassembly in order to produce highly effective nanoparticles with self-adjuvant activity. Indicates that it should be.
<110> THE INDUSTRY & ACADEMIC COOPERATION IN CHUNGNAM NATIONAL UNIVERSITY <120> Nano particle comprising self-assembled ferritin structure conjugated with antigen peptide and adjuvant and use thereof <130> 2018P-01-002 <160> 42 <170> KoPatentIn 3.0 <210> 1 <211> 165 <212> PRT <213> Escherichia coli <400> 1 Met Leu Lys Pro Glu Met Ile Glu Lys Leu Asn Glu Gln Met Asn Leu 1 5 10 15 Glu Leu Tyr Ser Ser Leu Leu Tyr Gln Gln Met Ser Ala Trp Cys Ser 20 25 30 Tyr His Thr Phe Glu Gly Ala Ala Ala Phe Leu Arg Arg His Ala Gln 35 40 45 Glu Glu Met Thr His Met Gln Arg Leu Phe Asp Tyr Leu Thr Asp Thr 50 55 60 Gly Asn Leu Pro Arg Ile Asn Thr Val Glu Ser Pro Phe Ala Glu Tyr 65 70 75 80 Ser Ser Leu Asp Glu Leu Phe Gln Glu Thr Tyr Lys His Glu Gln Leu 85 90 95 Ile Thr Gln Lys Ile Asn Glu Leu Ala His Ala Ala Met Thr Asn Gln 100 105 110 Asp Tyr Pro Thr Phe Asn Phe Leu Gln Trp Tyr Val Ser Glu Gln His 115 120 125 Glu Glu Glu Lys Leu Phe Lys Ser Ile Ile Asp Lys Leu Ser Leu Ala 130 135 140 Gly Lys Ser Gly Glu Gly Leu Tyr Phe Ile Asp Lys Glu Leu Ser Thr 145 150 155 160 Leu Asp Thr Gln Asn 165 <210> 2 <211> 14 <212> PRT <213> Homo sapiens <400> 2 Glu Lys Leu Met Lys Ala Phe Glu Ser Leu Lys Ser Phe Gln 1 5 10 <210> 3 <211> 14 <212> PRT <213> Artificial Sequence <220> <223> HTTcys <400> 3 Glu Lys Leu Met Lys Cys Phe Glu Ser Leu Lys Ser Phe Gln 1 5 10 <210> 4 <211> 115 <212> PRT <213> Artificial Sequence <220> <223> VL12.3 <400> 4 Met Gly Ser Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala 1 5 10 15 Pro Arg Gln Arg Val Thr Ile Ser Val Ser Gly Ser Asn Ser Asn Ile 20 25 30 Gly Ser Asn Thr Val Asn Trp Ile Gln Gln Leu Pro Gly Arg Ala Pro 35 40 45 Glu Leu Leu Met Tyr Asp Asp Asp Leu Leu Ala Pro Gly Val Ser Asp 50 55 60 Arg Phe Ser Gly Ser Arg Ser Gly Thr Ser Ala Ser Leu Thr Ile Ser 65 70 75 80 Gly Leu Gln Ser Glu Asp Glu Ala Asp Tyr Tyr Ala Ala Thr Trp Asp 85 90 95 Asp Ser Leu Asn Gly Trp Val Phe Gly Gly Gly Thr Lys Val Thr Val 100 105 110 Leu Ser Ala 115 <210> 5 <211> 115 <212> PRT <213> Artificial Sequence <220> <223> VL12.3cys <400> 5 Met Gly Ser Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala 1 5 10 15 Pro Arg Gln Arg Val Thr Ile Ser Val Ser Gly Ser Asn Ser Asn Ile 20 25 30 Gly Ser Asn Thr Val Asn Trp Ile Gln Gln Leu Pro Gly Arg Ala Pro 35 40 45 Glu Leu Leu Met Cys Asp Asp Asp Leu Leu Ala Pro Gly Val Ser Asp 50 55 60 Arg Phe Ser Gly Ser Arg Ser Gly Thr Ser Ala Ser Leu Thr Ile Ser 65 70 75 80 Gly Leu Gln Ser Glu Asp Glu Ala Asp Tyr Tyr Ala Ala Thr Trp Asp 85 90 95 Asp Ser Leu Asn Gly Trp Val Phe Gly Gly Gly Thr Lys Val Thr Val 100 105 110 Leu Ser Ala 115 <210> 6 <211> 185 <212> PRT <213> Artificial Sequence <220> <223> HTTcys-Ftn <400> 6 Met Gly Glu Lys Leu Met Lys Cys Phe Glu Ser Leu Lys Ser Phe Gln 1 5 10 15 Gly Gly Ser Arg Met Leu Lys Pro Glu Met Ile Glu Lys Leu Asn Glu 20 25 30 Gln Met Asn Leu Glu Leu Tyr Ser Ser Leu Leu Tyr Gln Gln Met Ser 35 40 45 Ala Trp Cys Ser Tyr His Thr Phe Glu Gly Ala Ala Ala Phe Leu Arg 50 55 60 Arg His Ala Gln Glu Glu Met Thr His Met Gln Arg Leu Phe Asp Tyr 65 70 75 80 Leu Thr Asp Thr Gly Asn Leu Pro Arg Ile Asn Thr Val Glu Ser Pro 85 90 95 Phe Ala Glu Tyr Ser Ser Leu Asp Glu Leu Phe Gln Glu Thr Tyr Lys 100 105 110 His Glu Gln Leu Ile Thr Gln Lys Ile Asn Glu Leu Ala His Ala Ala 115 120 125 Met Thr Asn Gln Asp Tyr Pro Thr Phe Asn Phe Leu Gln Trp Tyr Val 130 135 140 Ser Glu Gln His Glu Glu Glu Lys Leu Phe Lys Ser Ile Ile Asp Lys 145 150 155 160 Leu Ser Leu Ala Gly Lys Ser Gly Glu Gly Leu Tyr Phe Ile Asp Lys 165 170 175 Glu Leu Ser Thr Leu Asp Thr Gln Asn 180 185 <210> 7 <211> 558 <212> DNA <213> Artificial Sequence <220> <223> HTTcys-Ftn <400> 7 atgggcgaaa agctgatgaa gtgtttcgag tccctcaagt ccttccaggg tggttctaga 60 atgctgaaac cagaaatgat tgaaaaactt aatgagcaga tgaacctgga actgtactct 120 tcactgcttt atcagcaaat gagcgcctgg tgcagctatc ataccttcga aggtgctgcc 180 gcgttcctgc gccgtcacgc ccaggaagag atgacgcata tgcagcgtct gtttgattac 240 ctgactgata ccggcaattt accgcgtatt aataccgttg aatctccgtt tgctgaatat 300 tcctcacttg atgaattatt ccaggaaacc tataaacacg aacaattaat cacccagaaa 360 attaacgaac tggctcatgc tgcaatgacc aatcaggact acccaacatt taatttcctg 420 cagtggtatg tttctgagca gcatgaagaa gagaaactgt tcaaatcgat tattgataaa 480 ttaagcctgg caggcaaaag cggcgaaggt ctgtatttta tcgacaaaga actctctacc 540 ctcgacacac aaaactaa 558 <210> 8 <211> 513 <212> PRT <213> Influenza A virus <400> 8 Asp Thr Leu Cys Ile Gly Tyr His Ala Asn Asn Ser Thr Asp Thr Val 1 5 10 15 Asp Thr Val Leu Glu Lys Asn Val Thr Val Thr His Ser Val Asn Leu 20 25 30 Leu Glu Asp Lys His Asn Gly Lys Leu Cys Lys Leu Arg Gly Val Ala 35 40 45 Pro Leu His Leu Gly Lys Cys Asn Ile Ala Gly Trp Ile Leu Gly Asn 50 55 60 Pro Glu Cys Glu Ser Leu Ser Thr Ala Ser Ser Trp Ser Tyr Ile Val 65 70 75 80 Glu Thr Pro Ser Ser Asp Asn Gly Thr Cys Tyr Pro Gly Asp Phe Ile 85 90 95 Asp Tyr Glu Glu Leu Arg Glu Gln Leu Ser Ser Val Ser Ser Phe Glu 100 105 110 Arg Phe Glu Ile Phe Pro Lys Thr Ser Ser Trp Pro Asn His Asp Ser 115 120 125 Asn Lys Gly Val Thr Ala Ala Cys Pro His Ala Gly Ala Lys Ser Phe 130 135 140 Tyr Lys Asn Leu Ile Trp Leu Val Lys Lys Gly Asn Ser Tyr Pro Lys 145 150 155 160 Leu Ser Lys Ser Tyr Ile Asn Asp Lys Gly Lys Glu Val Leu Val Leu 165 170 175 Trp Gly Ile His His Pro Ser Thr Ser Ala Asp Gln Gln Ser Leu Tyr 180 185 190 Gln Asn Ala Asp Thr Tyr Val Phe Val Gly Ser Ser Arg Tyr Ser Lys 195 200 205 Lys Phe Lys Pro Glu Ile Ala Ile Arg Pro Lys Val Arg Asp Gln Glu 210 215 220 Gly Arg Met Asn Tyr Tyr Trp Thr Leu Val Glu Pro Gly Asp Lys Ile 225 230 235 240 Thr Phe Glu Ala Thr Gly Asn Leu Val Val Pro Arg Tyr Ala Phe Ala 245 250 255 Met Glu Arg Asn Ala Gly Ser Gly Ile Ile Ile Ser Asp Thr Pro Val 260 265 270 His Asp Cys Asn Thr Thr Cys Gln Thr Pro Lys Gly Ala Ile Asn Thr 275 280 285 Ser Leu Pro Phe Gln Asn Ile His Pro Ile Thr Ile Gly Lys Cys Pro 290 295 300 Lys Tyr Val Lys Ser Thr Lys Leu Arg Leu Ala Thr Gly Leu Arg Asn 305 310 315 320 Ile Pro Ser Ile Gln Ser Arg Gly Leu Phe Gly Ala Ile Ala Gly Phe 325 330 335 Ile Glu Gly Gly Trp Thr Gly Met Val Asp Gly Trp Tyr Gly Tyr His 340 345 350 His Gln Asn Glu Gln Gly Ser Gly Tyr Ala Ala Asp Leu Lys Ser Thr 355 360 365 Gln Asn Ala Ile Asp Glu Ile Thr Asn Lys Val Asn Ser Val Ile Glu 370 375 380 Lys Met Asn Thr Gln Phe Thr Ala Val Gly Lys Glu Phe Asn His Leu 385 390 395 400 Glu Lys Arg Ile Glu Asn Leu Asn Lys Lys Val Asp Asp Gly Phe Leu 405 410 415 Asp Ile Trp Thr Tyr Asn Ala Glu Leu Leu Val Leu Leu Glu Asn Glu 420 425 430 Arg Thr Leu Asp Tyr His Asp Ser Asn Val Lys Asn Leu Tyr Glu Lys 435 440 445 Val Arg Ser Gln Leu Lys Asn Asn Ala Lys Glu Ile Gly Asn Gly Cys 450 455 460 Phe Glu Phe Tyr His Lys Cys Asp Asn Thr Cys Met Glu Ser Val Lys 465 470 475 480 Asn Gly Thr Tyr Asp Tyr Pro Lys Tyr Ser Glu Glu Ala Lys Leu Asn 485 490 495 Arg Glu Glu Ile Asp Gly Val Lys Leu Glu Ser Thr Arg Ile Tyr Gln 500 505 510 Ile <210> 9 <211> 495 <212> PRT <213> Salmonella typhimurium <400> 9 Met Ala Gln Val Ile Asn Thr Asn Ser Leu Ser Leu Leu Thr Gln Asn 1 5 10 15 Asn Leu Asn Lys Ser Gln Ser Ala Leu Gly Thr Ala Ile Glu Arg Leu 20 25 30 Ser Ser Gly Cys Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln 35 40 45 Ala Ile Ala Asn Arg Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala 50 55 60 Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly 65 70 75 80 Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ala 85 90 95 Val Gln Ser Ala Asn Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile 100 105 110 Gln Ala Glu Ile Thr Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly 115 120 125 Gln Thr Gln Phe Asn Gly Val Lys Val Leu Ala Gln Asp Asn Thr Leu 130 135 140 Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Asp Ile Asp Leu 145 150 155 160 Lys Gln Ile Asn Ser Gln Thr Leu Gly Leu Asp Thr Leu Asn Val Gln 165 170 175 Gln Lys Tyr Lys Val Ser Asp Thr Ala Ala Thr Val Thr Gly Tyr Ala 180 185 190 Asp Thr Thr Ile Ala Leu Asp Asn Ser Thr Phe Lys Ala Ser Ala Thr 195 200 205 Gly Leu Gly Gly Thr Asp Gln Lys Ile Asp Gly Asp Leu Lys Phe Asp 210 215 220 Asp Thr Thr Gly Lys Tyr Tyr Ala Lys Val Thr Val Thr Gly Gly Thr 225 230 235 240 Gly Lys Asp Gly Tyr Tyr Glu Val Ser Val Asp Lys Thr Asn Gly Glu 245 250 255 Val Thr Leu Ala Gly Gly Ala Thr Ser Pro Leu Thr Gly Gly Leu Pro 260 265 270 Ala Thr Ala Thr Glu Asp Val Lys Asn Val Gln Val Ala Asn Ala Asp 275 280 285 Leu Thr Glu Ala Lys Ala Ala Leu Thr Ala Ala Gly Val Thr Gly Thr 290 295 300 Ala Ser Val Val Lys Met Ser Tyr Thr Asp Asn Asn Gly Lys Thr Ile 305 310 315 320 Asp Gly Gly Leu Ala Val Lys Val Gly Asp Asp Tyr Tyr Ser Ala Thr 325 330 335 Gln Asn Lys Asp Gly Ser Ile Ser Ile Asn Thr Thr Lys Tyr Thr Ala 340 345 350 Asp Asp Gly Thr Ser Lys Thr Ala Leu Asn Lys Leu Gly Gly Ala Asp 355 360 365 Gly Lys Thr Glu Val Val Ser Ile Gly Gly Lys Thr Tyr Ala Ala Ser 370 375 380 Lys Ala Glu Gly His Asn Phe Lys Ala Gln Pro Asp Leu Ala Glu Ala 385 390 395 400 Ala Ala Thr Thr Thr Glu Asn Pro Leu Gln Lys Ile Asp Ala Ala Leu 405 410 415 Ala Gln Val Asp Thr Leu Arg Ser Asp Leu Gly Ala Val Gln Asn Arg 420 425 430 Phe Asn Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Asn Asn Leu Thr 435 440 445 Ser Ala Arg Ser Arg Ile Glu Cys Ser Asp Tyr Ala Thr Glu Val Ser 450 455 460 Asn Met Ser Arg Ala Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu 465 470 475 480 Ala Gln Ala Asn Gln Val Pro Gln Asn Val Leu Ser Leu Leu Arg 485 490 495 <210> 10 <211> 442 <212> PRT <213> Artificial Sequence <220> <223> truncated flagellin <400> 10 Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala Ser Arg Asn Ala Asn 1 5 10 15 Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly Ala Leu Asn Glu Ile 20 25 30 Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ala Val Gln Ser Ala Asn 35 40 45 Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile Gln Ala Glu Ile Thr 50 55 60 Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly Gln Thr Gln Phe Asn 65 70 75 80 Gly Val Lys Val Leu Ala Gln Asp Asn Thr Leu Thr Ile Gln Val Gly 85 90 95 Ala Asn Asp Gly Glu Thr Ile Asp Ile Asp Leu Lys Gln Ile Asn Ser 100 105 110 Gln Thr Leu Gly Leu Asp Thr Leu Asn Val Gln Gln Lys Tyr Lys Val 115 120 125 Ser Asp Thr Ala Ala Thr Val Thr Gly Tyr Ala Asp Thr Thr Ile Ala 130 135 140 Leu Asp Asn Ser Thr Phe Lys Ala Ser Ala Thr Gly Leu Gly Gly Thr 145 150 155 160 Asp Gln Lys Ile Asp Gly Asp Leu Lys Phe Asp Asp Thr Thr Gly Lys 165 170 175 Tyr Tyr Ala Lys Val Thr Val Thr Gly Gly Thr Gly Lys Asp Gly Tyr 180 185 190 Tyr Glu Val Ser Val Asp Lys Thr Asn Gly Glu Val Thr Leu Ala Gly 195 200 205 Gly Ala Thr Ser Pro Leu Thr Gly Gly Leu Pro Ala Thr Ala Thr Glu 210 215 220 Asp Val Lys Asn Val Gln Val Ala Asn Ala Asp Leu Thr Glu Ala Lys 225 230 235 240 Ala Ala Leu Thr Ala Ala Gly Val Thr Gly Thr Ala Ser Val Val Lys 245 250 255 Met Ser Tyr Thr Asp Asn Asn Gly Lys Thr Ile Asp Gly Gly Leu Ala 260 265 270 Val Lys Val Gly Asp Asp Tyr Tyr Ser Ala Thr Gln Asn Lys Asp Gly 275 280 285 Ser Ile Ser Ile Asn Thr Thr Lys Tyr Thr Ala Asp Asp Gly Thr Ser 290 295 300 Lys Thr Ala Leu Asn Lys Leu Gly Gly Ala Asp Gly Lys Thr Glu Val 305 310 315 320 Val Ser Ile Gly Gly Lys Thr Tyr Ala Ala Ser Lys Ala Glu Gly His 325 330 335 Asn Phe Lys Ala Gln Pro Asp Leu Ala Glu Ala Ala Ala Thr Thr Thr 340 345 350 Glu Asn Pro Leu Gln Lys Ile Asp Ala Ala Leu Ala Gln Val Asp Thr 355 360 365 Leu Arg Ser Asp Leu Gly Ala Val Gln Asn Arg Phe Asn Ser Ala Ile 370 375 380 Thr Asn Leu Gly Asn Thr Val Asn Asn Leu Thr Ser Ala Arg Ser Arg 385 390 395 400 Ile Glu Cys Ser Asp Tyr Ala Thr Glu Val Ser Asn Met Ser Arg Ala 405 410 415 Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu Ala Gln Ala Asn Gln 420 425 430 Val Pro Gln Asn Val Leu Ser Leu Leu Arg 435 440 <210> 11 <211> 238 <212> PRT <213> Artificial Sequence <220> <223> HTTcys-I3-01 <400> 11 Met His His His His His His Gly Gly Ser Gly Gly Ser Glu Lys Leu 1 5 10 15 Met Lys Cys Phe Glu Ser Leu Lys Ser Phe Gln Gly Gly Ser Gly Gly 20 25 30 Ser Met Lys Met Glu Glu Leu Phe Lys Lys His Lys Ile Val Ala Val 35 40 45 Leu Arg Ala Asn Ser Val Glu Glu Ala Lys Lys Lys Ala Leu Ala Val 50 55 60 Phe Leu Gly Gly Val His Leu Ile Glu Ile Thr Phe Thr Val Pro Asp 65 70 75 80 Ala Asp Thr Val Ile Lys Glu Leu Ser Phe Leu Lys Glu Met Gly Ala 85 90 95 Ile Ile Gly Ala Gly Thr Val Thr Ser Val Glu Gln Cys Arg Lys Ala 100 105 110 Val Glu Ser Gly Ala Glu Phe Ile Val Ser Pro His Leu Asp Glu Glu 115 120 125 Ile Ser Gln Phe Cys Lys Glu Lys Gly Val Phe Tyr Met Pro Gly Val 130 135 140 Met Thr Pro Thr Glu Leu Val Lys Ala Met Lys Leu Gly His Thr Ile 145 150 155 160 Leu Lys Leu Phe Pro Gly Glu Val Val Gly Pro Gln Phe Val Lys Ala 165 170 175 Met Lys Gly Pro Phe Pro Asn Val Lys Phe Val Pro Thr Gly Gly Val 180 185 190 Asn Leu Asp Asn Val Cys Glu Trp Phe Lys Ala Gly Val Leu Ala Val 195 200 205 Gly Val Gly Ser Ala Leu Val Lys Gly Thr Pro Val Glu Val Ala Glu 210 215 220 Lys Ala Lys Ala Phe Val Glu Lys Ile Arg Gly Cys Thr Glu 225 230 235 <210> 12 <211> 717 <212> DNA <213> Artificial Sequence <220> <223> HTTcys-I3-01 <400> 12 atgcatcatc atcatcatca cggtggaagc ggtggaagcg aaaagctgat gaagtgtttc 60 gagtccctca agtccttcca gggtggtagc ggcggttcta tgaagatgga agagctgttc 120 aagaaacaca agatcgttgc cgtgctgcgt gccaatagtg tggaagaagc gaaaaagaaa 180 gcgctggcgg ttttcctggg cggcgttcat ctgattgaaa ttacctttac cgtgccggat 240 gcggataccg tgattaagga actgagcttt ctgaaggaaa tgggcgcgat tattggtgcg 300 ggcaccgtga ccagcgtgga gcagtgccgt aaagcggtgg aaagtggcgc cgaattcatt 360 gtgagtccgc acctggacga ggaaattagc caattttgca aggagaaggg tgtgttctat 420 atgccaggcg ttatgacccc gaccgaactg gtgaaagcca tgaaactggg ccataccatc 480 ttaaaactgt ttccgggtga ggtggtgggt ccgcagtttg ttaaagcgat gaaaggtccg 540 tttccgaatg tgaaatttgt gccaaccggc ggtgttaatc tggacaatgt gtgcgaatgg 600 ttcaaagcgg gcgtgctggc cgtgggcgtg ggcagcgcgt tagtgaaagg caccccggtg 660 gaagtggcgg aaaaggccaa ggcgttcgtt gagaagattc gtggctgcac cgaataa 717 <210> 13 <211> 644 <212> PRT <213> Artificial Sequence <220> <223> HA-VL12.3cys <400> 13 Ala Asp Pro Asp Thr Leu Cys Ile Gly Tyr His Ala Asn Asn Ser Thr 1 5 10 15 Asp Thr Val Asp Thr Val Leu Glu Lys Asn Val Thr Val Thr His Ser 20 25 30 Val Asn Leu Leu Glu Asp Lys His Asn Gly Lys Leu Cys Lys Leu Arg 35 40 45 Gly Val Ala Pro Leu His Leu Gly Lys Cys Asn Ile Ala Gly Trp Ile 50 55 60 Leu Gly Asn Pro Glu Cys Glu Ser Leu Ser Thr Ala Ser Ser Trp Ser 65 70 75 80 Tyr Ile Val Glu Thr Pro Ser Ser Asp Asn Gly Thr Cys Tyr Pro Gly 85 90 95 Asp Phe Ile Asp Tyr Glu Glu Leu Arg Glu Gln Leu Ser Ser Val Ser 100 105 110 Ser Phe Glu Arg Phe Glu Ile Phe Pro Lys Thr Ser Ser Trp Pro Asn 115 120 125 His Asp Ser Asn Lys Gly Val Thr Ala Ala Cys Pro His Ala Gly Ala 130 135 140 Lys Ser Phe Tyr Lys Asn Leu Ile Trp Leu Val Lys Lys Gly Asn Ser 145 150 155 160 Tyr Pro Lys Leu Ser Lys Ser Tyr Ile Asn Asp Lys Gly Lys Glu Val 165 170 175 Leu Val Leu Trp Gly Ile His His Pro Ser Thr Ser Ala Asp Gln Gln 180 185 190 Ser Leu Tyr Gln Asn Ala Asp Thr Tyr Val Phe Val Gly Ser Ser Arg 195 200 205 Tyr Ser Lys Lys Phe Lys Pro Glu Ile Ala Ile Arg Pro Lys Val Arg 210 215 220 Asp Gln Glu Gly Arg Met Asn Tyr Tyr Trp Thr Leu Val Glu Pro Gly 225 230 235 240 Asp Lys Ile Thr Phe Glu Ala Thr Gly Asn Leu Val Val Pro Arg Tyr 245 250 255 Ala Phe Ala Met Glu Arg Asn Ala Gly Ser Gly Ile Ile Ile Ser Asp 260 265 270 Thr Pro Val His Asp Cys Asn Thr Thr Cys Gln Thr Pro Lys Gly Ala 275 280 285 Ile Asn Thr Ser Leu Pro Phe Gln Asn Ile His Pro Ile Thr Ile Gly 290 295 300 Lys Cys Pro Lys Tyr Val Lys Ser Thr Lys Leu Arg Leu Ala Thr Gly 305 310 315 320 Leu Arg Asn Ile Pro Ser Ile Gln Ser Arg Gly Leu Phe Gly Ala Ile 325 330 335 Ala Gly Phe Ile Glu Gly Gly Trp Thr Gly Met Val Asp Gly Trp Tyr 340 345 350 Gly Tyr His His Gln Asn Glu Gln Gly Ser Gly Tyr Ala Ala Asp Leu 355 360 365 Lys Ser Thr Gln Asn Ala Ile Asp Glu Ile Thr Asn Lys Val Asn Ser 370 375 380 Val Ile Glu Lys Met Asn Thr Gln Phe Thr Ala Val Gly Lys Glu Phe 385 390 395 400 Asn His Leu Glu Lys Arg Ile Glu Asn Leu Asn Lys Lys Val Asp Asp 405 410 415 Gly Phe Leu Asp Ile Trp Thr Tyr Asn Ala Glu Leu Leu Val Leu Leu 420 425 430 Glu Asn Glu Arg Thr Leu Asp Tyr His Asp Ser Asn Val Lys Asn Leu 435 440 445 Tyr Glu Lys Val Arg Ser Gln Leu Lys Asn Asn Ala Lys Glu Ile Gly 450 455 460 Asn Gly Cys Phe Glu Phe Tyr His Lys Cys Asp Asn Thr Cys Met Glu 465 470 475 480 Ser Val Lys Asn Gly Thr Tyr Asp Tyr Pro Lys Tyr Ser Glu Glu Ala 485 490 495 Lys Leu Asn Arg Glu Glu Ile Asp Gly Val Lys Leu Glu Ser Thr Arg 500 505 510 Ile Tyr Gln Ile Gly Ser Arg Ser Met Gly Ser Gln Pro Val Leu Thr 515 520 525 Gln Ser Pro Ser Val Ser Ala Ala Pro Arg Gln Arg Val Thr Ile Ser 530 535 540 Val Ser Gly Ser Asn Ser Asn Ile Gly Ser Asn Thr Val Asn Trp Ile 545 550 555 560 Gln Gln Leu Pro Gly Arg Ala Pro Glu Leu Leu Met Cys Asp Asp Asp 565 570 575 Leu Leu Ala Pro Gly Val Ser Asp Arg Phe Ser Gly Ser Arg Ser Gly 580 585 590 Thr Ser Ala Ser Leu Thr Ile Ser Gly Leu Gln Ser Glu Asp Glu Ala 595 600 605 Asp Tyr Tyr Ala Ala Thr Trp Asp Asp Ser Leu Asn Gly Trp Val Phe 610 615 620 Gly Gly Gly Thr Lys Val Thr Val Leu Ser Ala Gly Ser Ser His His 625 630 635 640 His His His His <210> 14 <211> 1934 <212> DNA <213> Artificial Sequence <220> <223> HA-VL12.3cys <400> 14 gcggatcccg acacattgtg cattgggtac catgctaata actcaacaga tacagtagat 60 actgtgttgg aaaaaaacgt aacggtaaca cactcagtga acttactaga agacaaacat 120 aatggaaagt tatgtaaact aagaggggtt gccccattac atctgggtaa atgcaatatt 180 gcagggtgga ttctaggaaa cccagagtgt gagtcactat ccactgcatc aagttggtca 240 tacatcgtgg aaactccaag ctcagataat ggcacatgtt atccgggaga ctttatcgat 300 tatgaggaat taagggaaca gttgagcagt gttagctcgt tcgaaagatt cgagatattc 360 cccaagacat caagttggcc aaatcatgac tccaacaaag gagtaacagc ggcatgccct 420 cacgccggag ctaaatcatt ctacaagaac ctgatttggc tagttaagaa aggcaattct 480 tacccaaaac tgtcaaagtc ttatattaat gacaaaggta aagaagtatt ggttctatgg 540 gggatacatc accccagcac aagcgctgac caacagtcac tataccagaa tgccgatact 600 tacgtatttg tggggagtag cagatattct aaaaagttca agccggaaat tgcaattagg 660 ccgaaggtga gagaccaaga aggtagaatg aattactatt ggacattagt agagccgggt 720 gataaaataa catttgaagc aactggaaat ttggtggttc caagatacgc attcgctatg 780 gagagaaacg ccggtagcgg aatcattata agtgatacac cagtccacga ctgtaacaca 840 acctgccaaa ctcccaaggg agcaataaac acgagcctac cgtttcaaaa tattcaccca 900 attacaatag ggaaatgtcc aaaatatgta aaatcaacaa agttgagact ggcaacaggg 960 ctcagaaaca taccctctat tcagtccaga ggtctatttg gggcaattgc cggattcatc 1020 gaggggggat ggacaggtat ggtcgatggc tggtatgggt accaccatca gaacgagcaa 1080 ggatctggtt acgccgcgat ctaaagtcaa cacaaaatgc aattgatgaa atcacaaata 1140 aggtaaattc agtaatagag aagatgaata cacagttcac agcagtaggc aaagaattta 1200 atcacctgga gaaaagaata gaaaacctca ataaaaaggt agacgatggt ttcttagaca 1260 tttggacata caatgcagaa ctcctagtac tactcgaaaa tgaaaggacg ctggactacc 1320 atgactcaaa cgttaaaaat ctatatgaaa aagtaagatc acagttgaaa aataatgcca 1380 aagagatagg aaatggatgc tttgaatttt accataaatg tgacaataca tgtatggaat 1440 cagttaaaaa tgggacttac gattatccaa agtatagcga agaagctaag ctgaatagag 1500 aagaaataga tggggtaaaa ctagaatcaa ctaggattta tcagattggc tctagaagca 1560 tgggtagtca accagtactt acacaaagcc cgtctgtgtc tgccgctcca cgtcagagag 1620 tcaccatctc agttagtggt tctaattcaa atataggatc gaacacagtg aactggattc 1680 agcagttgcc tggccgtgcc ccggagttat taatgtgtga tgatgattta ttagcacccg 1740 gagtatcaga tcgcttttca ggaagccgta gtggcactag tgcgtcctta accattagcg 1800 ggttacagtc tgaagacgaa gcggactatt acgcagctac gtgggatgat agtttaaatg 1860 gctgggtttt tggtggtggt actaaagtta cggtgctgtc cgcaggcagt agccatcatc 1920 atcatcatca ctaa 1934 <210> 15 <211> 269 <212> PRT <213> Artificial Sequence <220> <223> PA-VL12.3cys <400> 15 Met Gly Phe His Tyr Asp Arg Asn Asn Ile Ala Val Gly Ala Asp Glu 1 5 10 15 Ser Val Val Lys Glu Ala His Arg Glu Val Ile Asn Ser Ser Thr Glu 20 25 30 Gly Leu Leu Leu Asn Ile Asp Lys Asp Ile Arg Lys Ile Leu Ser Gly 35 40 45 Tyr Ile Val Glu Ile Glu Asp Thr Glu Gly Leu Lys Glu Val Ile Asn 50 55 60 Asp Arg Tyr Asp Met Leu Asn Ile Ser Ser Leu Arg Gln Asp Gly Lys 65 70 75 80 Thr Phe Ile Asp Phe Lys Lys Tyr Asn Asp Lys Leu Pro Leu Tyr Ile 85 90 95 Ser Asn Pro Asn Tyr Lys Val Asn Val Tyr Ala Val Thr Lys Glu Asn 100 105 110 Thr Ile Ile Asn Pro Ser Glu Asn Gly Asp Thr Ser Thr Asn Gly Ile 115 120 125 Lys Lys Ile Leu Ile Phe Ser Lys Lys Gly Tyr Glu Ile Gly Ser Gly 130 135 140 Gly Ser Met Gly Ser Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser 145 150 155 160 Ala Ala Pro Arg Gln Arg Val Thr Ile Ser Val Ser Gly Ser Asn Ser 165 170 175 Asn Ile Gly Ser Asn Thr Val Asn Trp Ile Gln Gln Leu Pro Gly Arg 180 185 190 Ala Pro Glu Leu Leu Met Cys Asp Asp Asp Leu Leu Ala Pro Gly Val 195 200 205 Ser Asp Arg Phe Ser Gly Ser Arg Ser Gly Thr Ser Ala Ser Leu Thr 210 215 220 Ile Ser Gly Leu Gln Ser Glu Asp Glu Ala Asp Tyr Tyr Ala Ala Thr 225 230 235 240 Trp Asp Asp Ser Leu Asn Gly Trp Val Phe Gly Gly Gly Thr Lys Val 245 250 255 Thr Val Leu Ser Ala Leu Glu His His His His His His 260 265 <210> 16 <211> 810 <212> DNA <213> Artificial Sequence <220> <223> PA-VL12.3cys <400> 16 atgggctttc attatgatag aaataacata gcagttgggg cggatgagtc agtagttaag 60 gaggctcata gagaagtaat taattcgtca acagagggat tattgttaaa tattgataag 120 gatataagaa aaatattatc aggttatatt gtagaaattg aagatactga agggcttaaa 180 gaagttataa atgacagata tgatatgttg aatatttcta gtttacggca agatggaaaa 240 acatttatag attttaaaaa atataatgat aaattaccgt tatatataag taatcccaat 300 tataaggtaa atgtatatgc tgttactaaa gaaaacacta ttattaatcc tagtgagaat 360 ggggatacta gtaccaacgg gatcaagaaa attttaatct tttctaaaaa aggctatgag 420 ataggatccg gtggtagcat gggtagtcaa ccagtactta cacaaagccc gtctgtgtct 480 gccgctccac gtcagagagt caccatctca gttagtggtt ctaattcaaa tataggatcg 540 aacacagtga actggattca gcagttgcct ggccgtgccc cggagttatt aatgtgtgat 600 gatgatttat tagcacccgg agtatcagat cgcttttcag gaagccgtag tggcactagt 660 gcgtccttaa ccattagcgg gttacagtct gaagacgaag cggactatta cgcagctacg 720 tgggatgata gtttaaatgg ctgggttttt ggtggtggta ctaaagttac ggtgctgtcc 780 gcactcgagc accaccacca ccaccactga 810 <210> 17 <211> 634 <212> PRT <213> Artificial Sequence <220> <223> full-length FliC(N)-VL12.3cys <400> 17 Met Gly Ser Ser His His His His His His Ser Ser Gly Leu Val Pro 1 5 10 15 Arg Gly Ser His Met Gly Ser Gln Pro Val Leu Thr Gln Ser Pro Ser 20 25 30 Val Ser Ala Ala Pro Arg Gln Arg Val Thr Ile Ser Val Ser Gly Ser 35 40 45 Asn Ser Asn Ile Gly Ser Asn Thr Val Asn Trp Ile Gln Gln Leu Pro 50 55 60 Gly Arg Ala Pro Glu Leu Leu Met Cys Asp Asp Asp Leu Leu Ala Pro 65 70 75 80 Gly Val Ser Asp Arg Phe Ser Gly Ser Arg Ser Gly Thr Ser Ala Ser 85 90 95 Leu Thr Ile Ser Gly Leu Gln Ser Glu Asp Glu Ala Asp Tyr Tyr Ala 100 105 110 Ala Thr Trp Asp Asp Ser Leu Asn Gly Trp Val Phe Gly Gly Gly Thr 115 120 125 Lys Val Thr Val Leu Ser Ala Gly Gly Ser Ala Met Ala Gln Val Ile 130 135 140 Asn Thr Asn Ser Leu Ser Leu Leu Thr Gln Asn Asn Leu Asn Lys Ser 145 150 155 160 Gln Ser Ala Leu Gly Thr Ala Ile Glu Arg Leu Ser Ser Gly Cys Arg 165 170 175 Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln Ala Ile Ala Asn Arg 180 185 190 Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala Ser Arg Asn Ala Asn 195 200 205 Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly Ala Leu Asn Glu Ile 210 215 220 Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ala Val Gln Ser Ala Asn 225 230 235 240 Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile Gln Ala Glu Ile Thr 245 250 255 Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly Gln Thr Gln Phe Asn 260 265 270 Gly Val Lys Val Leu Ala Gln Asp Asn Thr Leu Thr Ile Gln Val Gly 275 280 285 Ala Asn Asp Gly Glu Thr Ile Asp Ile Asp Leu Lys Gln Ile Asn Ser 290 295 300 Gln Thr Leu Gly Leu Asp Thr Leu Asn Val Gln Gln Lys Tyr Lys Val 305 310 315 320 Ser Asp Thr Ala Ala Thr Val Thr Gly Tyr Ala Asp Thr Thr Ile Ala 325 330 335 Leu Asp Asn Ser Thr Phe Lys Ala Ser Ala Thr Gly Leu Gly Gly Thr 340 345 350 Asp Gln Lys Ile Asp Gly Asp Leu Lys Phe Asp Asp Thr Thr Gly Lys 355 360 365 Tyr Tyr Ala Lys Val Thr Val Thr Gly Gly Thr Gly Lys Asp Gly Tyr 370 375 380 Tyr Glu Val Ser Val Asp Lys Thr Asn Gly Glu Val Thr Leu Ala Gly 385 390 395 400 Gly Ala Thr Ser Pro Leu Thr Gly Gly Leu Pro Ala Thr Ala Thr Glu 405 410 415 Asp Val Lys Asn Val Gln Val Ala Asn Ala Asp Leu Thr Glu Ala Lys 420 425 430 Ala Ala Leu Thr Ala Ala Gly Val Thr Gly Thr Ala Ser Val Val Lys 435 440 445 Met Ser Tyr Thr Asp Asn Asn Gly Lys Thr Ile Asp Gly Gly Leu Ala 450 455 460 Val Lys Val Gly Asp Asp Tyr Tyr Ser Ala Thr Gln Asn Lys Asp Gly 465 470 475 480 Ser Ile Ser Ile Asn Thr Thr Lys Tyr Thr Ala Asp Asp Gly Thr Ser 485 490 495 Lys Thr Ala Leu Asn Lys Leu Gly Gly Ala Asp Gly Lys Thr Glu Val 500 505 510 Val Ser Ile Gly Gly Lys Thr Tyr Ala Ala Ser Lys Ala Glu Gly His 515 520 525 Asn Phe Lys Ala Gln Pro Asp Leu Ala Glu Ala Ala Ala Thr Thr Thr 530 535 540 Glu Asn Pro Leu Gln Lys Ile Asp Ala Ala Leu Ala Gln Val Asp Thr 545 550 555 560 Leu Arg Ser Asp Leu Gly Ala Val Gln Asn Arg Phe Asn Ser Ala Ile 565 570 575 Thr Asn Leu Gly Asn Thr Val Asn Asn Leu Thr Ser Ala Arg Ser Arg 580 585 590 Ile Glu Cys Ser Asp Tyr Ala Thr Glu Val Ser Asn Met Ser Arg Ala 595 600 605 Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu Ala Gln Ala Asn Gln 610 615 620 Val Pro Gln Asn Val Leu Ser Leu Leu Arg 625 630 <210> 18 <211> 1845 <212> DNA <213> Artificial Sequence <220> <223> full-length FliC(N)-VL12.3cys <400> 18 atgggtagtc aaccagtact tacacaaagc ccgtctgtgt ctgccgctcc acgtcagaga 60 gtcaccatct cagttagtgg ttctaattca aatataggat cgaacacagt gaactggatt 120 cagcagttgc ctggccgtgc cccggagtta ttaatgtgtg atgatgattt attagcaccc 180 ggagtatcag atcgcttttc aggaagccgt agtggcacta gtgcgtcctt aaccattagc 240 gggttacagt ctgaagacga agcggactat tacgcagcta cgtgggatga tagtttaaat 300 ggctgggttt ttggtggtgg tactaaagtt acggtgctgt ccgcaggtgg tagcgccatg 360 gcacaagtca ttaataccaa cagcctgtcg ctgttgaccc agaataacct gaacaaatcc 420 cagtccgctc tgggcaccgc tatcgagcgt ctgtcttcct gcctgcgtat caacagcgcg 480 aaagacgatg cggcaggtca ggcgattgct aaccgtttta ccgcgaacat caaaggtctg 540 actcaggctt cccgtaacgc taacgacggt atctccattg cgcagaccac tgaaggcgcg 600 ctgaacgaaa tcaacaacaa cctgcagcgt gtgcgtgaac tggcggttca gtctgctaac 660 agcaccaact cccagtctga cctcgactcc atccaggctg aaatcaccca gcgcctgaac 720 gaaatcgacc gtgtatccgg ccagactcag ttcaacggcg tgaaagtcct ggcgcaggac 780 aacaccctga ccatccaggt tggtgccaac gacggtgaaa ctatcgatat cgatctgaag 840 cagatcaact ctcagaccct gggtctggat acgctgaatg tgcaacaaaa atataaggtc 900 agcgatacgg ctgcaactgt tacaggatat gccgatacta cgattgcttt agacaatagt 960 acttttaaag cctcggctac tggtcttggt ggtactgacc agaaaattga tggcgattta 1020 aaatttgatg atacgactgg aaaatattac gccaaagtta ccgttacggg gggaactggt 1080 aaagatggct attatgaagt ttccgttgat aagacgaacg gtgaggtgac tcttgctggc 1140 ggtgcgactt ccccgcttac aggtggacta cctgcgacag caactgagga tgtgaaaaat 1200 gtacaagttg caaatgctga tttgacagag gctaaagccg cattgacagc agcaggtgtt 1260 accggcacag catctgttgt taagatgtct tatactgata ataacggtaa aactattgat 1320 ggtggtttag cagttaaggt aggcgatgat tactattctg caactcaaaa taaagatggt 1380 tccataagta ttaatactac gaaatacact gcagatgacg gtacatccaa aactgcacta 1440 aacaaactgg gtggcgcaga cggcaaaacc gaagttgttt ctattggtgg taaaacttac 1500 gctgcaagta aagccgaagg tcacaacttt aaagcacagc ctgatctggc ggaagcggct 1560 gctacaacca ccgaaaaccc gctgcagaaa attgatgctg ctttggcaca ggttgacacg 1620 ttacgttctg acctgggtgc ggtacagaac cgtttcaact ccgctattac caacctgggc 1680 aacaccgtaa acaacctgac ttctgcccgt agccgtatcg aatgctccga ctacgcgacc 1740 gaagtttcca acatgtctcg cgcgcagatt ctgcagcagg ccggtacctc cgttctggcg 1800 caggcgaacc aggttccgca aaacgtcctc tctttactgc gttga 1845 <210> 19 <211> 527 <212> PRT <213> Artificial Sequence <220> <223> truncated FliC(N)-VL12.3cys <400> 19 Met Gly Ser Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala 1 5 10 15 Pro Arg Gln Arg Val Thr Ile Ser Val Ser Gly Ser Asn Ser Asn Ile 20 25 30 Gly Ser Asn Thr Val Asn Trp Ile Gln Gln Leu Pro Gly Arg Ala Pro 35 40 45 Glu Leu Leu Met Cys Asp Asp Asp Leu Leu Ala Pro Gly Val Ser Asp 50 55 60 Arg Phe Ser Gly Ser Arg Ser Gly Thr Ser Ala Ser Leu Thr Ile Ser 65 70 75 80 Gly Leu Gln Ser Glu Asp Glu Ala Asp Tyr Tyr Ala Ala Thr Trp Asp 85 90 95 Asp Ser Leu Asn Gly Trp Val Phe Gly Gly Gly Thr Lys Val Thr Val 100 105 110 Leu Ser Ala Gly Gly Ser Ala Met Gly Phe Thr Ala Asn Ile Lys Gly 115 120 125 Leu Thr Gln Ala Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln 130 135 140 Thr Thr Glu Gly Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val 145 150 155 160 Arg Glu Leu Ala Val Gln Ser Ala Asn Ser Thr Asn Ser Gln Ser Asp 165 170 175 Leu Asp Ser Ile Gln Ala Glu Ile Thr Gln Arg Leu Asn Glu Ile Asp 180 185 190 Arg Val Ser Gly Gln Thr Gln Phe Asn Gly Val Lys Val Leu Ala Gln 195 200 205 Asp Asn Thr Leu Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile 210 215 220 Asp Ile Asp Leu Lys Gln Ile Asn Ser Gln Thr Leu Gly Leu Asp Thr 225 230 235 240 Leu Asn Val Gln Gln Lys Tyr Lys Val Ser Asp Thr Ala Ala Thr Val 245 250 255 Thr Gly Tyr Ala Asp Thr Thr Ile Ala Leu Asp Asn Ser Thr Phe Lys 260 265 270 Ala Ser Ala Thr Gly Leu Gly Gly Thr Asp Gln Lys Ile Asp Gly Asp 275 280 285 Leu Lys Phe Asp Asp Thr Thr Gly Lys Tyr Tyr Ala Lys Val Thr Val 290 295 300 Thr Gly Gly Thr Gly Lys Asp Gly Tyr Tyr Glu Val Ser Val Asp Lys 305 310 315 320 Thr Asn Gly Glu Val Thr Leu Ala Gly Gly Ala Thr Ser Pro Leu Thr 325 330 335 Gly Gly Leu Pro Ala Thr Ala Thr Glu Asp Val Lys Asn Val Gln Val 340 345 350 Ala Asn Ala Asp Leu Thr Glu Ala Lys Ala Ala Leu Thr Ala Ala Gly 355 360 365 Val Thr Gly Thr Ala Ser Val Val Lys Met Ser Tyr Thr Asp Asn Asn 370 375 380 Gly Lys Thr Ile Asp Gly Gly Leu Ala Val Lys Val Gly Asp Asp Tyr 385 390 395 400 Tyr Ser Ala Thr Gln Asn Lys Asp Gly Ser Ile Ser Ile Asn Thr Thr 405 410 415 Lys Tyr Thr Ala Asp Asp Gly Thr Ser Lys Thr Ala Leu Asn Lys Leu 420 425 430 Gly Gly Ala Asp Gly Lys Thr Glu Val Val Ser Ile Gly Gly Lys Thr 435 440 445 Tyr Ala Ala Ser Lys Ala Glu Gly His Asn Phe Lys Ala Gln Pro Asp 450 455 460 Leu Ala Glu Ala Ala Ala Thr Thr Thr Glu Asn Pro Leu Gln Lys Ile 465 470 475 480 Asp Ala Ala Leu Ala Gln Val Asp Thr Leu Arg Ser Asp Leu Gly Ala 485 490 495 Val Gln Asn Arg Phe Asn Ser Ala Ile Thr Asn Leu Gly Asn Thr Val 500 505 510 Asn Asn Leu Thr Ser Ala Arg Leu Glu His His His His His His 515 520 525 <210> 20 <211> 1584 <212> DNA <213> Artificial Sequence <220> <223> truncated FliC(N)-VL12.3cys <400> 20 atgggtagtc aaccagtact tacacaaagc ccgtctgtgt ctgccgctcc acgtcagaga 60 gtcaccatct cagttagtgg ttctaattca aatataggat cgaacacagt gaactggatt 120 cagcagttgc ctggccgtgc cccggagtta ttaatgtgtg atgatgattt attagcaccc 180 ggagtatcag atcgcttttc aggaagccgt agtggcacta gtgcgtcctt aaccattagc 240 gggttacagt ctgaagacga agcggactat tacgcagcta cgtgggatga tagtttaaat 300 ggctgggttt ttggtggtgg tactaaagtt acggtgctgt ccgcaggtgg tagcgccatg 360 ggctttaccg cgaacatcaa aggtctgact caggcttccc gtaacgctaa cgacggtatc 420 tccattgcgc agaccactga aggcgcgctg aacgaaatca acaacaacct gcagcgtgtg 480 cgtgaactgg cggttcagtc tgctaacagc accaactccc agtctgacct cgactccatc 540 caggctgaaa tcacccagcg cctgaacgaa atcgaccgtg tatccggcca gactcagttc 600 aacggcgtga aagtcctggc gcaggacaac accctgacca tccaggttgg tgccaacgac 660 ggtgaaacta tcgatatcga tctgaagcag atcaactctc agaccctggg tctggatacg 720 ctgaatgtgc aacaaaaata taaggtcagc gatacggctg caactgttac aggatatgcc 780 gatactacga ttgctttaga caatagtact tttaaagcct cggctactgg tcttggtggt 840 actgaccaga aaattgatgg cgatttaaaa tttgatgata cgactggaaa atattacgcc 900 aaagttaccg ttacgggggg aactggtaaa gatggctatt atgaagtttc cgttgataag 960 acgaacggtg aggtgactct tgctggcggt gcgacttccc cgcttacagg tggactacct 1020 gcgacagcaa ctgaggatgt gaaaaatgta caagttgcaa atgctgattt gacagaggct 1080 aaagccgcat tgacagcagc aggtgttacc ggcacagcat ctgttgttaa gatgtcttat 1140 actgataata acggtaaaac tattgatggt ggtttagcag ttaaggtagg cgatgattac 1200 tattctgcaa ctcaaaataa agatggttcc ataagtatta atactacgaa atacactgca 1260 gatgacggta catccaaaac tgcactaaac aaactgggtg gcgcagacgg caaaaccgaa 1320 gttgtttcta ttggtggtaa aacttacgct gcaagtaaag ccgaaggtca caactttaaa 1380 gcacagcctg atctggcgga agcggctgct acaaccaccg aaaacccgct gcagaaaatt 1440 gatgctgctt tggcacaggt tgacacgtta cgttctgacc tgggtgcggt acagaaccgt 1500 ttcaactccg ctattaccaa cctgggcaac accgtaaaca acctgacttc tgcccgtctc 1560 gagcaccacc accaccacca ctga 1584 <210> 21 <211> 528 <212> PRT <213> Artificial Sequence <220> <223> truncated FliC(C)-VL12.3cys <400> 21 Met Gly Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala Ser Arg Asn 1 5 10 15 Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly Ala Leu Asn 20 25 30 Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ala Val Gln Ser 35 40 45 Ala Asn Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile Gln Ala Glu 50 55 60 Ile Thr Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly Gln Thr Gln 65 70 75 80 Phe Asn Gly Val Lys Val Leu Ala Gln Asp Asn Thr Leu Thr Ile Gln 85 90 95 Val Gly Ala Asn Asp Gly Glu Thr Ile Asp Ile Asp Leu Lys Gln Ile 100 105 110 Asn Ser Gln Thr Leu Gly Leu Asp Thr Leu Asn Val Gln Gln Lys Tyr 115 120 125 Lys Val Ser Asp Thr Ala Ala Thr Val Thr Gly Tyr Ala Asp Thr Thr 130 135 140 Ile Ala Leu Asp Asn Ser Thr Phe Lys Ala Ser Ala Thr Gly Leu Gly 145 150 155 160 Gly Thr Asp Gln Lys Ile Asp Gly Asp Leu Lys Phe Asp Asp Thr Thr 165 170 175 Gly Lys Tyr Tyr Ala Lys Val Thr Val Thr Gly Gly Thr Gly Lys Asp 180 185 190 Gly Tyr Tyr Glu Val Ser Val Asp Lys Thr Asn Gly Glu Val Thr Leu 195 200 205 Ala Gly Gly Ala Thr Ser Pro Leu Thr Gly Gly Leu Pro Ala Thr Ala 210 215 220 Thr Glu Asp Val Lys Asn Val Gln Val Ala Asn Ala Asp Leu Thr Glu 225 230 235 240 Ala Lys Ala Ala Leu Thr Ala Ala Gly Val Thr Gly Thr Ala Ser Val 245 250 255 Val Lys Met Ser Tyr Thr Asp Asn Asn Gly Lys Thr Ile Asp Gly Gly 260 265 270 Leu Ala Val Lys Val Gly Asp Asp Tyr Tyr Ser Ala Thr Gln Asn Lys 275 280 285 Asp Gly Ser Ile Ser Ile Asn Thr Thr Lys Tyr Thr Ala Asp Asp Gly 290 295 300 Thr Ser Lys Thr Ala Leu Asn Lys Leu Gly Gly Ala Asp Gly Lys Thr 305 310 315 320 Glu Val Val Ser Ile Gly Gly Lys Thr Tyr Ala Ala Ser Lys Ala Glu 325 330 335 Gly His Asn Phe Lys Ala Gln Pro Asp Leu Ala Glu Ala Ala Ala Thr 340 345 350 Thr Thr Glu Asn Pro Leu Gln Lys Ile Asp Ala Ala Leu Ala Gln Val 355 360 365 Asp Thr Leu Arg Ser Asp Leu Gly Ala Val Gln Asn Arg Phe Asn Ser 370 375 380 Ala Ile Thr Asn Leu Gly Asn Thr Val Asn Asn Leu Thr Ser Ala Arg 385 390 395 400 Leu Glu Gly Gly Ser Met Gly Ser Gln Pro Val Leu Thr Gln Ser Pro 405 410 415 Ser Val Ser Ala Ala Pro Arg Gln Arg Val Thr Ile Ser Val Ser Gly 420 425 430 Ser Asn Ser Asn Ile Gly Ser Asn Thr Val Asn Trp Ile Gln Gln Leu 435 440 445 Pro Gly Arg Ala Pro Glu Leu Leu Met Cys Asp Asp Asp Leu Leu Ala 450 455 460 Pro Gly Val Ser Asp Arg Phe Ser Gly Ser Arg Ser Gly Thr Ser Ala 465 470 475 480 Ser Leu Thr Ile Ser Gly Leu Gln Ser Glu Asp Glu Ala Asp Tyr Tyr 485 490 495 Ala Ala Thr Trp Asp Asp Ser Leu Asn Gly Trp Val Phe Gly Gly Gly 500 505 510 Thr Lys Val Thr Val Leu Ser Ala Leu Glu His His His His His His 515 520 525 <210> 22 <211> 1587 <212> DNA <213> Artificial Sequence <220> <223> truncated FliC(C)-VL12.3cys <400> 22 atgggcttta ccgcgaacat caaaggtctg actcaggctt cccgtaacgc taacgacggt 60 atctccattg cgcagaccac tgaaggcgcg ctgaacgaaa tcaacaacaa cctgcagcgt 120 gtgcgtgaac tggcggttca gtctgctaac agcaccaact cccagtctga cctcgactcc 180 atccaggctg aaatcaccca gcgcctgaac gaaatcgacc gtgtatccgg ccagactcag 240 ttcaacggcg tgaaagtcct ggcgcaggac aacaccctga ccatccaggt tggtgccaac 300 gacggtgaaa ctatcgatat cgatctgaag cagatcaact ctcagaccct gggtctggat 360 acgctgaatg tgcaacaaaa atataaggtc agcgatacgg ctgcaactgt tacaggatat 420 gccgatacta cgattgcttt agacaatagt acttttaaag cctcggctac tggtcttggt 480 ggtactgacc agaaaattga tggcgattta aaatttgatg atacgactgg aaaatattac 540 gccaaagtta ccgttacggg gggaactggt aaagatggct attatgaagt ttccgttgat 600 aagacgaacg gtgaggtgac tcttgctggc ggtgcgactt ccccgcttac aggtggacta 660 cctgcgacag caactgagga tgtgaaaaat gtacaagttg caaatgctga tttgacagag 720 gctaaagccg cattgacagc agcaggtgtt accggcacag catctgttgt taagatgtct 780 tatactgata ataacggtaa aactattgat ggtggtttag cagttaaggt aggcgatgat 840 tactattctg caactcaaaa taaagatggt tccataagta ttaatactac gaaatacact 900 gcagatgacg gtacatccaa aactgcacta aacaaactgg gtggcgcaga cggcaaaacc 960 gaagttgttt ctattggtgg taaaacttac gctgcaagta aagccgaagg tcacaacttt 1020 aaagcacagc ctgatctggc ggaagcggct gctacaacca ccgaaaaccc gctgcagaaa 1080 attgatgctg ctttggcaca ggttgacacg ttacgttctg acctgggtgc ggtacagaac 1140 cgtttcaact ccgctattac caacctgggc aacaccgtaa acaacctgac ttctgcccgt 1200 ctcgagggtg gtagcatggg tagtcaacca gtacttacac aaagcccgtc tgtgtctgcc 1260 gctccacgtc agagagtcac catctcagtt agtggttcta attcaaatat aggatcgaac 1320 acagtgaact ggattcagca gttgcctggc cgtgccccgg agttattaat gtgtgatgat 1380 gatttattag cacccggagt atcagatcgc ttttcaggaa gccgtagtgg cactagtgcg 1440 tccttaacca ttagcgggtt acagtctgaa gacgaagcgg actattacgc agctacgtgg 1500 gatgatagtt taaatggctg ggtttttggt ggtggtacta aagttacggt gctgtccgca 1560 ctcgagcacc accaccacca ccactga 1587 <210> 23 <211> 542 <212> PRT <213> Artificial Sequence <220> <223> truncated FliC(I)-VL12.3cys <400> 23 Met Gly Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala Ser Arg Asn 1 5 10 15 Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly Ala Leu Asn 20 25 30 Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ala Val Gln Ser 35 40 45 Ala Asn Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile Gln Ala Glu 50 55 60 Ile Thr Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly Gln Thr Gln 65 70 75 80 Phe Asn Gly Val Lys Val Leu Ala Gln Asp Asn Thr Leu Thr Ile Gln 85 90 95 Val Gly Ala Asn Asp Gly Glu Thr Ile Asp Ile Asp Leu Lys Gln Ile 100 105 110 Asn Ser Gln Thr Leu Gly Leu Asp Thr Leu Asn Val Gln Gln Lys Tyr 115 120 125 Lys Val Ser Asp Thr Ala Ala Thr Val Thr Gly Tyr Ala Asp Thr Thr 130 135 140 Ile Ala Leu Asp Asn Ser Thr Phe Lys Ala Ser Ala Thr Gly Leu Gly 145 150 155 160 Gly Thr Asp Gln Lys Ile Asp Gly Asp Leu Lys Phe Asp Asp Thr Thr 165 170 175 Gly Lys Tyr Tyr Ala Lys Val Thr Val Thr Gly Gly Ser Gly Gly Ser 180 185 190 Met Gly Ser Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala 195 200 205 Pro Arg Gln Arg Val Thr Ile Ser Val Ser Gly Ser Asn Ser Asn Ile 210 215 220 Gly Ser Asn Thr Val Asn Trp Ile Gln Gln Leu Pro Gly Arg Ala Pro 225 230 235 240 Glu Leu Leu Met Cys Asp Asp Asp Leu Leu Ala Pro Gly Val Ser Asp 245 250 255 Arg Phe Ser Gly Ser Arg Ser Gly Thr Ser Ala Ser Leu Thr Ile Ser 260 265 270 Gly Leu Gln Ser Glu Asp Glu Ala Asp Tyr Tyr Ala Ala Thr Trp Asp 275 280 285 Asp Ser Leu Asn Gly Trp Val Phe Gly Gly Gly Thr Lys Val Thr Val 290 295 300 Leu Ser Ala Gly His Met Leu Val Pro Arg Gly Ser Gly Gly Ser Val 305 310 315 320 Asp Gly Thr Gly Lys Asp Gly Tyr Tyr Glu Val Ser Val Asp Lys Thr 325 330 335 Asn Gly Glu Val Thr Leu Ala Gly Gly Ala Thr Ser Pro Leu Thr Gly 340 345 350 Gly Leu Pro Ala Thr Ala Thr Glu Asp Val Lys Asn Val Gln Val Ala 355 360 365 Asn Ala Asp Leu Thr Glu Ala Lys Ala Ala Leu Thr Ala Ala Gly Val 370 375 380 Thr Gly Thr Ala Ser Val Val Lys Met Ser Tyr Thr Asp Asn Asn Gly 385 390 395 400 Lys Thr Ile Asp Gly Gly Leu Ala Val Lys Val Gly Asp Asp Tyr Tyr 405 410 415 Ser Ala Thr Gln Asn Lys Asp Gly Ser Ile Ser Ile Asn Thr Thr Lys 420 425 430 Tyr Thr Ala Asp Asp Gly Thr Ser Lys Thr Ala Leu Asn Lys Leu Gly 435 440 445 Gly Ala Asp Gly Lys Thr Glu Val Val Ser Ile Gly Gly Lys Thr Tyr 450 455 460 Ala Ala Ser Lys Ala Glu Gly His Asn Phe Lys Ala Gln Pro Asp Leu 465 470 475 480 Ala Glu Ala Ala Ala Thr Thr Thr Glu Asn Pro Leu Gln Lys Ile Asp 485 490 495 Ala Ala Leu Ala Gln Val Asp Thr Leu Arg Ser Asp Leu Gly Ala Val 500 505 510 Gln Asn Arg Phe Asn Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Asn 515 520 525 Asn Leu Thr Ser Ala Arg Leu Glu His His His His His His 530 535 540 <210> 24 <211> 1629 <212> DNA <213> Artificial Sequence <220> <223> truncated FliC(I)-VL12.3cys <400> 24 atgggcttta ccgcgaacat caaaggtctg actcaggctt cccgtaacgc taacgacggt 60 atctccattg cgcagaccac tgaaggcgcg ctgaacgaaa tcaacaacaa cctgcagcgt 120 gtgcgtgaac tggcggttca gtctgctaac agcaccaact cccagtctga cctcgactcc 180 atccaggctg aaatcaccca gcgcctgaac gaaatcgacc gtgtatccgg ccagactcag 240 ttcaacggcg tgaaagtcct ggcgcaggac aacaccctga ccatccaggt tggtgccaac 300 gacggtgaaa ctatcgatat cgatctgaag cagatcaact ctcagaccct gggtctggat 360 acgctgaatg tgcaacaaaa atataaggtc agcgatacgg ctgcaactgt tacaggatat 420 gccgatacta cgattgcttt agacaatagt acttttaaag cctcggctac tggtcttggt 480 ggtactgacc agaaaattga tggcgattta aaatttgatg atacgactgg aaaatattac 540 gccaaagtta ccgttacggg gggatccggt ggtagcatgg gtagtcaacc agtacttaca 600 caaagcccgt ctgtgtctgc cgctccacgt cagagagtca ccatctcagt tagtggttct 660 aattcaaata taggatcgaa cacagtgaac tggattcagc agttgcctgg ccgtgccccg 720 gagttattaa tgtgtgatga tgatttatta gcacccggag tatcagatcg cttttcagga 780 agccgtagtg gcactagtgc gtccttaacc attagcgggt tacagtctga agacgaagcg 840 gactattacg cagctacgtg ggatgatagt ttaaatggct gggtttttgg tggtggtact 900 aaagttacgg tgctgtccgc aggtcatatg ctggtgccgc gcggcagcgg tggtagcgtc 960 gacggaactg gtaaagatgg ctattatgaa gtttccgttg ataagacgaa cggtgaggtg 1020 actcttgctg gcggtgcgac ttccccgctt acaggtggac tacctgcgac agcaactgag 1080 gatgtgaaaa atgtacaagt tgcaaatgct gatttgacag aggctaaagc cgcattgaca 1140 gcagcaggtg ttaccggcac agcatctgtt gttaagatgt cttatactga taataacggt 1200 aaaactattg atggtggttt agcagttaag gtaggcgatg attactattc tgcaactcaa 1260 aataaagatg gttccataag tattaatact acgaaataca ctgcagatga cggtacatcc 1320 aaaactgcac taaacaaact gggtggcgca gacggcaaaa ccgaagttgt ttctattggt 1380 ggtaaaactt acgctgcaag taaagccgaa ggtcacaact ttaaagcaca gcctgatctg 1440 gcggaagcgg ctgctacaac caccgaaaac ccgctgcaga aaattgatgc tgctttggca 1500 caggttgaca cgttacgttc tgacctgggt gcggtacaga accgtttcaa ctccgctatt 1560 accaacctgg gcaacaccgt aaacaacctg acttctgccc gtctcgagca ccaccaccac 1620 caccactga 1629 <210> 25 <211> 34 <212> DNA <213> Artificial Sequence <220> <223> HTTcys Forward primer <400> 25 atcatccatg ggcgaaaagc tgatgaagtg tttc 34 <210> 26 <211> 32 <212> DNA <213> Artificial Sequence <220> <223> HTTcys Reverse primer <400> 26 atcactctag aaccaccctg gaaggacttg ag 32 <210> 27 <211> 35 <212> DNA <213> Artificial Sequence <220> <223> Ftn Forward primer <400> 27 tgcggtctag aatgctgaaa ccagaaatga ttgaa 35 <210> 28 <211> 40 <212> DNA <213> Artificial Sequence <220> <223> Ftn Reverse primer <400> 28 aggccagcca ctcgagacta gttcattagt tttgtgtgtc 40 <210> 29 <211> 47 <212> DNA <213> Artificial Sequence <220> <223> HTTcys-I3-01 Forward primer <400> 29 attatcatat gcatcatcat catcatcacg gtggaagcgg tggaagc 47 <210> 30 <211> 36 <212> DNA <213> Artificial Sequence <220> <223> HTTcys-I3-01 Reverse primer <400> 30 tgcgcctcga gctattattc ggtgcagcca cgaatc 36 <210> 31 <211> 35 <212> DNA <213> Artificial Sequence <220> <223> HA-VL12.3cys Forward primer <400> 31 aggcctctag aagcatgggt agtcaaccag tactt 35 <210> 32 <211> 42 <212> DNA <213> Artificial Sequence <220> <223> HA-VL12.3cys Reverse primer <400> 32 gtgatgatga tgatgatggc tactgcctgc ggacagcacc gt 42 <210> 33 <211> 34 <212> DNA <213> Artificial Sequence <220> <223> PA-VL12.3cys Forward primer <400> 33 aagagccatg ggctttcatt atgatagaaa taac 34 <210> 34 <211> 33 <212> DNA <213> Artificial Sequence <220> <223> PA-VL12.3cys Reverse primer <400> 34 agcatctcga gtgcggacag caccgtaact tta 33 <210> 35 <211> 41 <212> DNA <213> Artificial Sequence <220> <223> FliC(N)-VL12.3cys Forward primer <400> 35 agcggcatat gggtagtcaa ccagtactta cacaaagccc g 41 <210> 36 <211> 35 <212> DNA <213> Artificial Sequence <220> <223> FliC(N)-VL12.3cys Reverse primer <400> 36 attatgcggc cgctcaacgc agtaaagaga ggacg 35 <210> 37 <211> 33 <212> DNA <213> Artificial Sequence <220> <223> truncated FliC(N)-VL12.3cys Forward primer <400> 37 actggtggta ccatgggtag tcaaccagta ctt 33 <210> 38 <211> 32 <212> DNA <213> Artificial Sequence <220> <223> truncated FliC(N)-VL12.3cys Reverse primer <400> 38 agttactcga gacgggcaga agtcaggttg tt 32 <210> 39 <211> 34 <212> DNA <213> Artificial Sequence <220> <223> truncated FliC(C)-VL12.3cys Forward primer <400> 39 ataatccatg ggctttaccg cgaacatcaa aggt 34 <210> 40 <211> 29 <212> DNA <213> Artificial Sequence <220> <223> truncated FliC(C)-VL12.3cys Reverse primer <400> 40 agcatctcga gtgcggacag caccgtaac 29 <210> 41 <211> 34 <212> DNA <213> Artificial Sequence <220> <223> truncated FliC(I)-VL12.3cys Forward primer <400> 41 ataatccatg ggctttaccg cgaacatcaa aggt 34 <210> 42 <211> 32 <212> DNA <213> Artificial Sequence <220> <223> truncated FliC(I)-VL12.3cys Reverse primer <400> 42 agttactcga gacgggcaga agtcaggttg tt 32 <110> THE INDUSTRY & ACADEMIC COOPERATION IN CHUNGNAM NATIONAL UNIVERSITY <120> Nano particle comprising self-assembled ferritin structure conjugated with antigen peptide and adjuvant and use <130> 2018P-01-002 <160> 42 <170> KoPatentIn 3.0 <210> 1 <211> 165 <212> PRT <213> Escherichia coli <400> 1 Met Leu Lys Pro Glu Met Ile Glu Lys Leu Asn Glu Gln Met Asn Leu 1 5 10 15 Glu Leu Tyr Ser Ser Leu Leu Tyr Gln Gln Met Ser Ala Trp Cys Ser 20 25 30 Tyr His Thr Phe Glu Gly Ala Ala Ala Phe Leu Arg Arg His Ala Gln 35 40 45 Glu Glu Met Thr His Met Gln Arg Leu Phe Asp Tyr Leu Thr Asp Thr 50 55 60 Gly Asn Leu Pro Arg Ile Asn Thr Val Glu Ser Pro Phe Ala Glu Tyr 65 70 75 80 Ser Ser Leu Asp Glu Leu Phe Gln Glu Thr Tyr Lys His Glu Gln Leu 85 90 95 Ile Thr Gln Lys Ile Asn Glu Leu Ala His Ala Ala Met Thr Asn Gln 100 105 110 Asp Tyr Pro Thr Phe Asn Phe Leu Gln Trp Tyr Val Ser Glu Gln His 115 120 125 Glu Glu Glu Lys Leu Phe Lys Ser Ile Ile Asp Lys Leu Ser Leu Ala 130 135 140 Gly Lys Ser Gly Glu Gly Leu Tyr Phe Ile Asp Lys Glu Leu Ser Thr 145 150 155 160 Leu Asp Thr Gln Asn 165 <210> 2 <211> 14 <212> PRT <213> Homo sapiens <400> 2 Glu Lys Leu Met Lys Ala Phe Glu Ser Leu Lys Ser Phe Gln 1 5 10 <210> 3 <211> 14 <212> PRT <213> Artificial Sequence <220> <223> HTTcys <400> 3 Glu Lys Leu Met Lys Cys Phe Glu Ser Leu Lys Ser Phe Gln 1 5 10 <210> 4 <211> 115 <212> PRT <213> Artificial Sequence <220> <223> VL12.3 <400> 4 Met Gly Ser Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala 1 5 10 15 Pro Arg Gln Arg Val Thr Ile Ser Val Ser Gly Ser Asn Ser Asn Ile 20 25 30 Gly Ser Asn Thr Val Asn Trp Ile Gln Gln Leu Pro Gly Arg Ala Pro 35 40 45 Glu Leu Leu Met Tyr Asp Asp Asp Leu Leu Ala Pro Gly Val Ser Asp 50 55 60 Arg Phe Ser Gly Ser Arg Ser Gly Thr Ser Ala Ser Leu Thr Ile Ser 65 70 75 80 Gly Leu Gln Ser Glu Asp Glu Ala Asp Tyr Tyr Ala Ala Thr Trp Asp 85 90 95 Asp Ser Leu Asn Gly Trp Val Phe Gly Gly Gly Thr Lys Val Thr Val 100 105 110 Leu ser ala 115 <210> 5 <211> 115 <212> PRT <213> Artificial Sequence <220> <223> VL12.3cys <400> 5 Met Gly Ser Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala 1 5 10 15 Pro Arg Gln Arg Val Thr Ile Ser Val Ser Gly Ser Asn Ser Asn Ile 20 25 30 Gly Ser Asn Thr Val Asn Trp Ile Gln Gln Leu Pro Gly Arg Ala Pro 35 40 45 Glu Leu Leu Met Cys Asp Asp Asp Leu Leu Ala Pro Gly Val Ser Asp 50 55 60 Arg Phe Ser Gly Ser Arg Ser Gly Thr Ser Ala Ser Leu Thr Ile Ser 65 70 75 80 Gly Leu Gln Ser Glu Asp Glu Ala Asp Tyr Tyr Ala Ala Thr Trp Asp 85 90 95 Asp Ser Leu Asn Gly Trp Val Phe Gly Gly Gly Thr Lys Val Thr Val 100 105 110 Leu ser ala 115 <210> 6 <211> 185 <212> PRT <213> Artificial Sequence <220> <223> HTTcys-Ftn <400> 6 Met Gly Glu Lys Leu Met Lys Cys Phe Glu Ser Leu Lys Ser Phe Gln 1 5 10 15 Gly Gly Ser Arg Met Leu Lys Pro Glu Met Ile Glu Lys Leu Asn Glu 20 25 30 Gln Met Asn Leu Glu Leu Tyr Ser Ser Leu Leu Tyr Gln Gln Met Ser 35 40 45 Ala Trp Cys Ser Tyr His Thr Phe Glu Gly Ala Ala Ala Phe Leu Arg 50 55 60 Arg His Ala Gln Glu Glu Met Thr His Met Gln Arg Leu Phe Asp Tyr 65 70 75 80 Leu Thr Asp Thr Gly Asn Leu Pro Arg Ile Asn Thr Val Glu Ser Pro 85 90 95 Phe Ala Glu Tyr Ser Ser Leu Asp Glu Leu Phe Gln Glu Thr Tyr Lys 100 105 110 His Glu Gln Leu Ile Thr Gln Lys Ile Asn Glu Leu Ala His Ala Ala 115 120 125 Met Thr Asn Gln Asp Tyr Pro Thr Phe Asn Phe Leu Gln Trp Tyr Val 130 135 140 Ser Glu Gln His Glu Glu Glu Lys Leu Phe Lys Ser Ile Ile Asp Lys 145 150 155 160 Leu Ser Leu Ala Gly Lys Ser Gly Glu Gly Leu Tyr Phe Ile Asp Lys 165 170 175 Glu Leu Ser Thr Leu Asp Thr Gln Asn 180 185 <210> 7 <211> 558 <212> DNA <213> Artificial Sequence <220> <223> HTTcys-Ftn <400> 7 atgggcgaaa agctgatgaa gtgtttcgag tccctcaagt ccttccaggg tggttctaga 60 atgctgaaac cagaaatgat tgaaaaactt aatgagcaga tgaacctgga actgtactct 120 tcactgcttt atcagcaaat gagcgcctgg tgcagctatc ataccttcga aggtgctgcc 180 gcgttcctgc gccgtcacgc ccaggaagag atgacgcata tgcagcgtct gtttgattac 240 ctgactgata ccggcaattt accgcgtatt aataccgttg aatctccgtt tgctgaatat 300 tcctcacttg atgaattatt ccaggaaacc tataaacacg aacaattaat cacccagaaa 360 attaacgaac tggctcatgc tgcaatgacc aatcaggact acccaacatt taatttcctg 420 cagtggtatg tttctgagca gcatgaagaa gagaaactgt tcaaatcgat tattgataaa 480 ttaagcctgg caggcaaaag cggcgaaggt ctgtatttta tcgacaaaga actctctacc 540 ctcgacacac aaaactaa 558 <210> 8 <211> 513 <212> PRT <213> Influenza A virus <400> 8 Asp Thr Leu Cys Ile Gly Tyr His Ala Asn Asn Ser Thr Asp Thr Val 1 5 10 15 Asp Thr Val Leu Glu Lys Asn Val Thr Val Thr His Ser Val Asn Leu 20 25 30 Leu Glu Asp Lys His Asn Gly Lys Leu Cys Lys Leu Arg Gly Val Ala 35 40 45 Pro Leu His Leu Gly Lys Cys Asn Ile Ala Gly Trp Ile Leu Gly Asn 50 55 60 Pro Glu Cys Glu Ser Leu Ser Thr Ala Ser Ser Trp Ser Tyr Ile Val 65 70 75 80 Glu Thr Pro Ser Ser Asp Asn Gly Thr Cys Tyr Pro Gly Asp Phe Ile 85 90 95 Asp Tyr Glu Glu Leu Arg Glu Gln Leu Ser Ser Val Ser Ser Phe Glu 100 105 110 Arg Phe Glu Ile Phe Pro Lys Thr Ser Ser Trp Pro Asn His Asp Ser 115 120 125 Asn Lys Gly Val Thr Ala Ala Cys Pro His Ala Gly Ala Lys Ser Phe 130 135 140 Tyr Lys Asn Leu Ile Trp Leu Val Lys Lys Gly Asn Ser Tyr Pro Lys 145 150 155 160 Leu Ser Lys Ser Tyr Ile Asn Asp Lys Gly Lys Glu Val Leu Val Leu 165 170 175 Trp Gly Ile His His Pro Ser Thr Ser Ala Asp Gln Gln Ser Leu Tyr 180 185 190 Gln Asn Ala Asp Thr Tyr Val Phe Val Gly Ser Ser Arg Tyr Ser Lys 195 200 205 Lys Phe Lys Pro Glu Ile Ala Ile Arg Pro Lys Val Arg Asp Gln Glu 210 215 220 Gly Arg Met Asn Tyr Tyr Trp Thr Leu Val Glu Pro Gly Asp Lys Ile 225 230 235 240 Thr Phe Glu Ala Thr Gly Asn Leu Val Val Pro Arg Tyr Ala Phe Ala 245 250 255 Met Glu Arg Asn Ala Gly Ser Gly Ile Ile Ile Ser Asp Thr Pro Val 260 265 270 His Asp Cys Asn Thr Thr Cys Gln Thr Pro Lys Gly Ala Ile Asn Thr 275 280 285 Ser Leu Pro Phe Gln Asn Ile His Pro Ile Thr Ile Gly Lys Cys Pro 290 295 300 Lys Tyr Val Lys Ser Thr Lys Leu Arg Leu Ala Thr Gly Leu Arg Asn 305 310 315 320 Ile Pro Ser Ile Gln Ser Arg Gly Leu Phe Gly Ala Ile Ala Gly Phe 325 330 335 Ile Glu Gly Gly Trp Thr Gly Met Val Asp Gly Trp Tyr Gly Tyr His 340 345 350 His Gln Asn Glu Gln Gly Ser Gly Tyr Ala Ala Asp Leu Lys Ser Thr 355 360 365 Gln Asn Ala Ile Asp Glu Ile Thr Asn Lys Val Asn Ser Val Ile Glu 370 375 380 Lys Met Asn Thr Gln Phe Thr Ala Val Gly Lys Glu Phe Asn His Leu 385 390 395 400 Glu Lys Arg Ile Glu Asn Leu Asn Lys Lys Val Asp Asp Gly Phe Leu 405 410 415 Asp Ile Trp Thr Tyr Asn Ala Glu Leu Leu Val Leu Leu Glu Asn Glu 420 425 430 Arg Thr Leu Asp Tyr His Asp Ser Asn Val Lys Asn Leu Tyr Glu Lys 435 440 445 Val Arg Ser Gln Leu Lys Asn Asn Ala Lys Glu Ile Gly Asn Gly Cys 450 455 460 Phe Glu Phe Tyr His Lys Cys Asp Asn Thr Cys Met Glu Ser Val Lys 465 470 475 480 Asn Gly Thr Tyr Asp Tyr Pro Lys Tyr Ser Glu Glu Ala Lys Leu Asn 485 490 495 Arg Glu Glu Ile Asp Gly Val Lys Leu Glu Ser Thr Arg Ile Tyr Gln 500 505 510 Ile <210> 9 <211> 495 <212> PRT <213> Salmonella typhimurium <400> 9 Met Ala Gln Val Ile Asn Thr Asn Ser Leu Ser Leu Leu Thr Gln Asn 1 5 10 15 Asn Leu Asn Lys Ser Gln Ser Ala Leu Gly Thr Ala Ile Glu Arg Leu 20 25 30 Ser Ser Gly Cys Arg Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln 35 40 45 Ala Ile Ala Asn Arg Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala 50 55 60 Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly 65 70 75 80 Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ala 85 90 95 Val Gln Ser Ala Asn Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile 100 105 110 Gln Ala Glu Ile Thr Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly 115 120 125 Gln Thr Gln Phe Asn Gly Val Lys Val Leu Ala Gln Asp Asn Thr Leu 130 135 140 Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile Asp Ile Asp Leu 145 150 155 160 Lys Gln Ile Asn Ser Gln Thr Leu Gly Leu Asp Thr Leu Asn Val Gln 165 170 175 Gln Lys Tyr Lys Val Ser Asp Thr Ala Ala Thr Val Thr Gly Tyr Ala 180 185 190 Asp Thr Thr Ile Ala Leu Asp Asn Ser Thr Phe Lys Ala Ser Ala Thr 195 200 205 Gly Leu Gly Gly Thr Asp Gln Lys Ile Asp Gly Asp Leu Lys Phe Asp 210 215 220 Asp Thr Thr Gly Lys Tyr Tyr Ala Lys Val Thr Val Thr Gly Gly Thr 225 230 235 240 Gly Lys Asp Gly Tyr Tyr Glu Val Ser Val Asp Lys Thr Asn Gly Glu 245 250 255 Val Thr Leu Ala Gly Gly Ala Thr Ser Pro Leu Thr Gly Gly Leu Pro 260 265 270 Ala Thr Ala Thr Glu Asp Val Lys Asn Val Gln Val Ala Asn Ala Asp 275 280 285 Leu Thr Glu Ala Lys Ala Ala Leu Thr Ala Ala Gly Val Thr Gly Thr 290 295 300 Ala Ser Val Val Lys Met Ser Tyr Thr Asp Asn Asn Gly Lys Thr Ile 305 310 315 320 Asp Gly Gly Leu Ala Val Lys Val Gly Asp Asp Tyr Tyr Ser Ala Thr 325 330 335 Gln Asn Lys Asp Gly Ser Ile Ser Ile Asn Thr Thr Lys Tyr Thr Ala 340 345 350 Asp Asp Gly Thr Ser Lys Thr Ala Leu Asn Lys Leu Gly Gly Ala Asp 355 360 365 Gly Lys Thr Glu Val Val Ser Ile Gly Gly Lys Thr Tyr Ala Ala Ser 370 375 380 Lys Ala Glu Gly His Asn Phe Lys Ala Gln Pro Asp Leu Ala Glu Ala 385 390 395 400 Ala Ala Thr Thr Thr Glu Asn Pro Leu Gln Lys Ile Asp Ala Ala Leu 405 410 415 Ala Gln Val Asp Thr Leu Arg Ser Asp Leu Gly Ala Val Gln Asn Arg 420 425 430 Phe Asn Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Asn Asn Leu Thr 435 440 445 Ser Ala Arg Ser Arg Ile Glu Cys Ser Asp Tyr Ala Thr Glu Val Ser 450 455 460 Asn Met Ser Arg Ala Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu 465 470 475 480 Ala Gln Ala Asn Gln Val Pro Gln Asn Val Leu Ser Leu Leu Arg 485 490 495 <210> 10 <211> 442 <212> PRT <213> Artificial Sequence <220> <223> truncated flagellin <400> 10 Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala Ser Arg Asn Ala Asn 1 5 10 15 Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly Ala Leu Asn Glu Ile 20 25 30 Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ala Val Gln Ser Ala Asn 35 40 45 Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile Gln Ala Glu Ile Thr 50 55 60 Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly Gln Thr Gln Phe Asn 65 70 75 80 Gly Val Lys Val Leu Ala Gln Asp Asn Thr Leu Thr Ile Gln Val Gly 85 90 95 Ala Asn Asp Gly Glu Thr Ile Asp Ile Asp Leu Lys Gln Ile Asn Ser 100 105 110 Gln Thr Leu Gly Leu Asp Thr Leu Asn Val Gln Gln Lys Tyr Lys Val 115 120 125 Ser Asp Thr Ala Ala Thr Val Thr Gly Tyr Ala Asp Thr Thr Ile Ala 130 135 140 Leu Asp Asn Ser Thr Phe Lys Ala Ser Ala Thr Gly Leu Gly Gly Thr 145 150 155 160 Asp Gln Lys Ile Asp Gly Asp Leu Lys Phe Asp Asp Thr Thr Gly Lys 165 170 175 Tyr Tyr Ala Lys Val Thr Val Thr Gly Gly Thr Gly Lys Asp Gly Tyr 180 185 190 Tyr Glu Val Ser Val Asp Lys Thr Asn Gly Glu Val Thr Leu Ala Gly 195 200 205 Gly Ala Thr Ser Pro Leu Thr Gly Gly Leu Pro Ala Thr Ala Thr Glu 210 215 220 Asp Val Lys Asn Val Gln Val Ala Asn Ala Asp Leu Thr Glu Ala Lys 225 230 235 240 Ala Ala Leu Thr Ala Ala Gly Val Thr Gly Thr Ala Ser Val Val Lys 245 250 255 Met Ser Tyr Thr Asp Asn Asn Gly Lys Thr Ile Asp Gly Gly Leu Ala 260 265 270 Val Lys Val Gly Asp Asp Tyr Tyr Ser Ala Thr Gln Asn Lys Asp Gly 275 280 285 Ser Ile Ser Ile Asn Thr Thr Lys Tyr Thr Ala Asp Asp Gly Thr Ser 290 295 300 Lys Thr Ala Leu Asn Lys Leu Gly Gly Ala Asp Gly Lys Thr Glu Val 305 310 315 320 Val Ser Ile Gly Gly Lys Thr Tyr Ala Ala Ser Lys Ala Glu Gly His 325 330 335 Asn Phe Lys Ala Gln Pro Asp Leu Ala Glu Ala Ala Ala Thr Thr Thr 340 345 350 Glu Asn Pro Leu Gln Lys Ile Asp Ala Ala Leu Ala Gln Val Asp Thr 355 360 365 Leu Arg Ser Asp Leu Gly Ala Val Gln Asn Arg Phe Asn Ser Ala Ile 370 375 380 Thr Asn Leu Gly Asn Thr Val Asn Asn Leu Thr Ser Ala Arg Ser Arg 385 390 395 400 Ile Glu Cys Ser Asp Tyr Ala Thr Glu Val Ser Asn Met Ser Arg Ala 405 410 415 Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu Ala Gln Ala Asn Gln 420 425 430 Val Pro Gln Asn Val Leu Ser Leu Leu Arg 435 440 <210> 11 <211> 238 <212> PRT <213> Artificial Sequence <220> <223> HTTcys-I3-01 <400> 11 Met His His His His His Gly Gly Ser Gly Gly Ser Glu Lys Leu 1 5 10 15 Met Lys Cys Phe Glu Ser Leu Lys Ser Phe Gln Gly Gly Ser Gly Gly 20 25 30 Ser Met Lys Met Glu Glu Leu Phe Lys Lys His Lys Ile Val Ala Val 35 40 45 Leu Arg Ala Asn Ser Val Glu Glu Ala Lys Lys Lys Ala Leu Ala Val 50 55 60 Phe Leu Gly Gly Val His Leu Ile Glu Ile Thr Phe Thr Val Pro Asp 65 70 75 80 Ala Asp Thr Val Ile Lys Glu Leu Ser Phe Leu Lys Glu Met Gly Ala 85 90 95 Ile Ile Gly Ala Gly Thr Val Thr Ser Val Glu Gln Cys Arg Lys Ala 100 105 110 Val Glu Ser Gly Ala Glu Phe Ile Val Ser Pro His Leu Asp Glu Glu 115 120 125 Ile Ser Gln Phe Cys Lys Glu Lys Gly Val Phe Tyr Met Pro Gly Val 130 135 140 Met Thr Pro Thr Glu Leu Val Lys Ala Met Lys Leu Gly His Thr Ile 145 150 155 160 Leu Lys Leu Phe Pro Gly Glu Val Val Gly Pro Gln Phe Val Lys Ala 165 170 175 Met Lys Gly Pro Phe Pro Asn Val Lys Phe Val Pro Thr Gly Gly Val 180 185 190 Asn Leu Asp Asn Val Cys Glu Trp Phe Lys Ala Gly Val Leu Ala Val 195 200 205 Gly Val Gly Ser Ala Leu Val Lys Gly Thr Pro Val Glu Val Ala Glu 210 215 220 Lys Ala Lys Ala Phe Val Glu Lys Ile Arg Gly Cys Thr Glu 225 230 235 <210> 12 <211> 717 <212> DNA <213> Artificial Sequence <220> <223> HTTcys-I3-01 <400> 12 atgcatcatc atcatcatca cggtggaagc ggtggaagcg aaaagctgat gaagtgtttc 60 gagtccctca agtccttcca gggtggtagc ggcggttcta tgaagatgga agagctgttc 120 aagaaacaca agatcgttgc cgtgctgcgt gccaatagtg tggaagaagc gaaaaagaaa 180 gcgctggcgg ttttcctggg cggcgttcat ctgattgaaa ttacctttac cgtgccggat 240 gcggataccg tgattaagga actgagcttt ctgaaggaaa tgggcgcgat tattggtgcg 300 ggcaccgtga ccagcgtgga gcagtgccgt aaagcggtgg aaagtggcgc cgaattcatt 360 gtgagtccgc acctggacga ggaaattagc caattttgca aggagaaggg tgtgttctat 420 atgccaggcg ttatgacccc gaccgaactg gtgaaagcca tgaaactggg ccataccatc 480 ttaaaactgt ttccgggtga ggtggtgggt ccgcagtttg ttaaagcgat gaaaggtccg 540 tttccgaatg tgaaatttgt gccaaccggc ggtgttaatc tggacaatgt gtgcgaatgg 600 ttcaaagcgg gcgtgctggc cgtgggcgtg ggcagcgcgt tagtgaaagg caccccggtg 660 gaagtggcgg aaaaggccaa ggcgttcgtt gagaagattc gtggctgcac cgaataa 717 <210> 13 <211> 644 <212> PRT <213> Artificial Sequence <220> <223> HA-VL12.3cys <400> 13 Ala Asp Pro Asp Thr Leu Cys Ile Gly Tyr His Ala Asn Asn Ser Thr 1 5 10 15 Asp Thr Val Asp Thr Val Leu Glu Lys Asn Val Thr Val Thr His Ser 20 25 30 Val Asn Leu Leu Glu Asp Lys His Asn Gly Lys Leu Cys Lys Leu Arg 35 40 45 Gly Val Ala Pro Leu His Leu Gly Lys Cys Asn Ile Ala Gly Trp Ile 50 55 60 Leu Gly Asn Pro Glu Cys Glu Ser Leu Ser Thr Ala Ser Ser Trp Ser 65 70 75 80 Tyr Ile Val Glu Thr Pro Ser Ser Asp Asn Gly Thr Cys Tyr Pro Gly 85 90 95 Asp Phe Ile Asp Tyr Glu Glu Leu Arg Glu Gln Leu Ser Ser Val Ser 100 105 110 Ser Phe Glu Arg Phe Glu Ile Phe Pro Lys Thr Ser Ser Trp Pro Asn 115 120 125 His Asp Ser Asn Lys Gly Val Thr Ala Ala Cys Pro His Ala Gly Ala 130 135 140 Lys Ser Phe Tyr Lys Asn Leu Ile Trp Leu Val Lys Lys Gly Asn Ser 145 150 155 160 Tyr Pro Lys Leu Ser Lys Ser Tyr Ile Asn Asp Lys Gly Lys Glu Val 165 170 175 Leu Val Leu Trp Gly Ile His His Pro Ser Thr Ser Ala Asp Gln Gln 180 185 190 Ser Leu Tyr Gln Asn Ala Asp Thr Tyr Val Phe Val Gly Ser Ser Arg 195 200 205 Tyr Ser Lys Lys Phe Lys Pro Glu Ile Ala Ile Arg Pro Lys Val Arg 210 215 220 Asp Gln Glu Gly Arg Met Asn Tyr Tyr Trp Thr Leu Val Glu Pro Gly 225 230 235 240 Asp Lys Ile Thr Phe Glu Ala Thr Gly Asn Leu Val Val Pro Arg Tyr 245 250 255 Ala Phe Ala Met Glu Arg Asn Ala Gly Ser Gly Ile Ile Ile Ser Asp 260 265 270 Thr Pro Val His Asp Cys Asn Thr Thr Cys Gln Thr Pro Lys Gly Ala 275 280 285 Ile Asn Thr Ser Leu Pro Phe Gln Asn Ile His Pro Ile Thr Ile Gly 290 295 300 Lys Cys Pro Lys Tyr Val Lys Ser Thr Lys Leu Arg Leu Ala Thr Gly 305 310 315 320 Leu Arg Asn Ile Pro Ser Ile Gln Ser Arg Gly Leu Phe Gly Ala Ile 325 330 335 Ala Gly Phe Ile Glu Gly Gly Trp Thr Gly Met Val Asp Gly Trp Tyr 340 345 350 Gly Tyr His His Gln Asn Glu Gln Gly Ser Gly Tyr Ala Ala Asp Leu 355 360 365 Lys Ser Thr Gln Asn Ala Ile Asp Glu Ile Thr Asn Lys Val Asn Ser 370 375 380 Val Ile Glu Lys Met Asn Thr Gln Phe Thr Ala Val Gly Lys Glu Phe 385 390 395 400 Asn His Leu Glu Lys Arg Ile Glu Asn Leu Asn Lys Lys Val Asp Asp 405 410 415 Gly Phe Leu Asp Ile Trp Thr Tyr Asn Ala Glu Leu Leu Val Leu Leu 420 425 430 Glu Asn Glu Arg Thr Leu Asp Tyr His Asp Ser Asn Val Lys Asn Leu 435 440 445 Tyr Glu Lys Val Arg Ser Gln Leu Lys Asn Asn Ala Lys Glu Ile Gly 450 455 460 Asn Gly Cys Phe Glu Phe Tyr His Lys Cys Asp Asn Thr Cys Met Glu 465 470 475 480 Ser Val Lys Asn Gly Thr Tyr Asp Tyr Pro Lys Tyr Ser Glu Glu Ala 485 490 495 Lys Leu Asn Arg Glu Glu Ile Asp Gly Val Lys Leu Glu Ser Thr Arg 500 505 510 Ile Tyr Gln Ile Gly Ser Arg Ser Met Gly Ser Gln Pro Val Leu Thr 515 520 525 Gln Ser Pro Ser Val Ser Ala Ala Pro Arg Gln Arg Val Thr Ile Ser 530 535 540 Val Ser Gly Ser Asn Ser Asn Ile Gly Ser Asn Thr Val Asn Trp Ile 545 550 555 560 Gln Gln Leu Pro Gly Arg Ala Pro Glu Leu Leu Met Cys Asp Asp Asp 565 570 575 Leu Leu Ala Pro Gly Val Ser Asp Arg Phe Ser Gly Ser Arg Ser Gly 580 585 590 Thr Ser Ala Ser Leu Thr Ile Ser Gly Leu Gln Ser Glu Asp Glu Ala 595 600 605 Asp Tyr Tyr Ala Ala Thr Trp Asp Asp Ser Leu Asn Gly Trp Val Phe 610 615 620 Gly Gly Gly Thr Lys Val Thr Val Leu Ser Ala Gly Ser Ser His His 625 630 635 640 His His His His <210> 14 <211> 1934 <212> DNA <213> Artificial Sequence <220> <223> HA-VL12.3cys <400> 14 gcggatcccg acacattgtg cattgggtac catgctaata actcaacaga tacagtagat 60 actgtgttgg aaaaaaacgt aacggtaaca cactcagtga acttactaga agacaaacat 120 aatggaaagt tatgtaaact aagaggggtt gccccattac atctgggtaa atgcaatatt 180 gcagggtgga ttctaggaaa cccagagtgt gagtcactat ccactgcatc aagttggtca 240 tacatcgtgg aaactccaag ctcagataat ggcacatgtt atccgggaga ctttatcgat 300 tatgaggaat taagggaaca gttgagcagt gttagctcgt tcgaaagatt cgagatattc 360 cccaagacat caagttggcc aaatcatgac tccaacaaag gagtaacagc ggcatgccct 420 cacgccggag ctaaatcatt ctacaagaac ctgatttggc tagttaagaa aggcaattct 480 tacccaaaac tgtcaaagtc ttatattaat gacaaaggta aagaagtatt ggttctatgg 540 gggatacatc accccagcac aagcgctgac caacagtcac tataccagaa tgccgatact 600 tacgtatttg tggggagtag cagatattct aaaaagttca agccggaaat tgcaattagg 660 ccgaaggtga gagaccaaga aggtagaatg aattactatt ggacattagt agagccgggt 720 gataaaataa catttgaagc aactggaaat ttggtggttc caagatacgc attcgctatg 780 gagagaaacg ccggtagcgg aatcattata agtgatacac cagtccacga ctgtaacaca 840 acctgccaaa ctcccaaggg agcaataaac acgagcctac cgtttcaaaa tattcaccca 900 attacaatag ggaaatgtcc aaaatatgta aaatcaacaa agttgagact ggcaacaggg 960 ctcagaaaca taccctctat tcagtccaga ggtctatttg gggcaattgc cggattcatc 1020 gaggggggat ggacaggtat ggtcgatggc tggtatgggt accaccatca gaacgagcaa 1080 ggatctggtt acgccgcgat ctaaagtcaa cacaaaatgc aattgatgaa atcacaaata 1140 aggtaaattc agtaatagag aagatgaata cacagttcac agcagtaggc aaagaattta 1200 atcacctgga gaaaagaata gaaaacctca ataaaaaggt agacgatggt ttcttagaca 1260 tttggacata caatgcagaa ctcctagtac tactcgaaaa tgaaaggacg ctggactacc 1320 atgactcaaa cgttaaaaat ctatatgaaa aagtaagatc acagttgaaa aataatgcca 1380 aagagatagg aaatggatgc tttgaatttt accataaatg tgacaataca tgtatggaat 1440 cagttaaaaa tgggacttac gattatccaa agtatagcga agaagctaag ctgaatagag 1500 aagaaataga tggggtaaaa ctagaatcaa ctaggattta tcagattggc tctagaagca 1560 tgggtagtca accagtactt acacaaagcc cgtctgtgtc tgccgctcca cgtcagagag 1620 tcaccatctc agttagtggt tctaattcaa atataggatc gaacacagtg aactggattc 1680 agcagttgcc tggccgtgcc ccggagttat taatgtgtga tgatgattta ttagcacccg 1740 gagtatcaga tcgcttttca ggaagccgta gtggcactag tgcgtcctta accattagcg 1800 ggttacagtc tgaagacgaa gcggactatt acgcagctac gtgggatgat agtttaaatg 1860 gctgggtttt tggtggtggt actaaagtta cggtgctgtc cgcaggcagt agccatcatc 1920 atcatcatca ctaa 1934 <210> 15 <211> 269 <212> PRT <213> Artificial Sequence <220> <223> PA-VL12.3cys <400> 15 Met Gly Phe His Tyr Asp Arg Asn Asn Ile Ala Val Gly Ala Asp Glu 1 5 10 15 Ser Val Val Lys Glu Ala His Arg Glu Val Ile Asn Ser Ser Thr Glu 20 25 30 Gly Leu Leu Leu Asn Ile Asp Lys Asp Ile Arg Lys Ile Leu Ser Gly 35 40 45 Tyr Ile Val Glu Ile Glu Asp Thr Glu Gly Leu Lys Glu Val Ile Asn 50 55 60 Asp Arg Tyr Asp Met Leu Asn Ile Ser Ser Leu Arg Gln Asp Gly Lys 65 70 75 80 Thr Phe Ile Asp Phe Lys Lys Tyr Asn Asp Lys Leu Pro Leu Tyr Ile 85 90 95 Ser Asn Pro Asn Tyr Lys Val Asn Val Tyr Ala Val Thr Lys Glu Asn 100 105 110 Thr Ile Ile Asn Pro Ser Glu Asn Gly Asp Thr Ser Thr Asn Gly Ile 115 120 125 Lys Lys Ile Leu Ile Phe Ser Lys Lys Gly Tyr Glu Ile Gly Ser Gly 130 135 140 Gly Ser Met Gly Ser Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser 145 150 155 160 Ala Ala Pro Arg Gln Arg Val Thr Ile Ser Val Ser Gly Ser Asn Ser 165 170 175 Asn Ile Gly Ser Asn Thr Val Asn Trp Ile Gln Gln Leu Pro Gly Arg 180 185 190 Ala Pro Glu Leu Leu Met Cys Asp Asp Asp Leu Leu Ala Pro Gly Val 195 200 205 Ser Asp Arg Phe Ser Gly Ser Arg Ser Gly Thr Ser Ala Ser Leu Thr 210 215 220 Ile Ser Gly Leu Gln Ser Glu Asp Glu Ala Asp Tyr Tyr Ala Ala Thr 225 230 235 240 Trp Asp Asp Ser Leu Asn Gly Trp Val Phe Gly Gly Gly Thr Lys Val 245 250 255 Thr Val Leu Ser Ala Leu Glu His His His His His His His 260 265 <210> 16 <211> 810 <212> DNA <213> Artificial Sequence <220> <223> PA-VL12.3cys <400> 16 atgggctttc attatgatag aaataacata gcagttgggg cggatgagtc agtagttaag 60 gaggctcata gagaagtaat taattcgtca acagagggat tattgttaaa tattgataag 120 gatataagaa aaatattatc aggttatatt gtagaaattg aagatactga agggcttaaa 180 gaagttataa atgacagata tgatatgttg aatatttcta gtttacggca agatggaaaa 240 acatttatag attttaaaaa atataatgat aaattaccgt tatatataag taatcccaat 300 tataaggtaa atgtatatgc tgttactaaa gaaaacacta ttattaatcc tagtgagaat 360 ggggatacta gtaccaacgg gatcaagaaa attttaatct tttctaaaaa aggctatgag 420 ataggatccg gtggtagcat gggtagtcaa ccagtactta cacaaagccc gtctgtgtct 480 gccgctccac gtcagagagt caccatctca gttagtggtt ctaattcaaa tataggatcg 540 aacacagtga actggattca gcagttgcct ggccgtgccc cggagttatt aatgtgtgat 600 gatgatttat tagcacccgg agtatcagat cgcttttcag gaagccgtag tggcactagt 660 gcgtccttaa ccattagcgg gttacagtct gaagacgaag cggactatta cgcagctacg 720 tgggatgata gtttaaatgg ctgggttttt ggtggtggta ctaaagttac ggtgctgtcc 780 gcactcgagc accaccacca ccaccactga 810 <210> 17 <211> 634 <212> PRT <213> Artificial Sequence <220> <223> full-length FliC (N) -VL12.3cys <400> 17 Met Gly Ser Ser His His His His His His Ser Ser Gly Leu Val Pro 1 5 10 15 Arg Gly Ser His Met Gly Ser Gln Pro Val Leu Thr Gln Ser Pro Ser 20 25 30 Val Ser Ala Ala Pro Arg Gln Arg Val Thr Ile Ser Val Ser Gly Ser 35 40 45 Asn Ser Asn Ile Gly Ser Asn Thr Val Asn Trp Ile Gln Gln Leu Pro 50 55 60 Gly Arg Ala Pro Glu Leu Leu Met Cys Asp Asp Asp Leu Leu Ala Pro 65 70 75 80 Gly Val Ser Asp Arg Phe Ser Gly Ser Arg Ser Gly Thr Ser Ala Ser 85 90 95 Leu Thr Ile Ser Gly Leu Gln Ser Glu Asp Glu Ala Asp Tyr Tyr Ala 100 105 110 Ala Thr Trp Asp Asp Ser Leu Asn Gly Trp Val Phe Gly Gly Gly Thr 115 120 125 Lys Val Thr Val Leu Ser Ala Gly Gly Ser Ala Met Ala Gln Val Ile 130 135 140 Asn Thr Asn Ser Leu Ser Leu Leu Thr Gln Asn Asn Leu Asn Lys Ser 145 150 155 160 Gln Ser Ala Leu Gly Thr Ala Ile Glu Arg Leu Ser Ser Gly Cys Arg 165 170 175 Ile Asn Ser Ala Lys Asp Asp Ala Ala Gly Gln Ala Ile Ala Asn Arg 180 185 190 Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala Ser Arg Asn Ala Asn 195 200 205 Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly Ala Leu Asn Glu Ile 210 215 220 Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ala Val Gln Ser Ala Asn 225 230 235 240 Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile Gln Ala Glu Ile Thr 245 250 255 Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly Gln Thr Gln Phe Asn 260 265 270 Gly Val Lys Val Leu Ala Gln Asp Asn Thr Leu Thr Ile Gln Val Gly 275 280 285 Ala Asn Asp Gly Glu Thr Ile Asp Ile Asp Leu Lys Gln Ile Asn Ser 290 295 300 Gln Thr Leu Gly Leu Asp Thr Leu Asn Val Gln Gln Lys Tyr Lys Val 305 310 315 320 Ser Asp Thr Ala Ala Thr Val Thr Gly Tyr Ala Asp Thr Thr Ile Ala 325 330 335 Leu Asp Asn Ser Thr Phe Lys Ala Ser Ala Thr Gly Leu Gly Gly Thr 340 345 350 Asp Gln Lys Ile Asp Gly Asp Leu Lys Phe Asp Asp Thr Thr Gly Lys 355 360 365 Tyr Tyr Ala Lys Val Thr Val Thr Gly Gly Thr Gly Lys Asp Gly Tyr 370 375 380 Tyr Glu Val Ser Val Asp Lys Thr Asn Gly Glu Val Thr Leu Ala Gly 385 390 395 400 Gly Ala Thr Ser Pro Leu Thr Gly Gly Leu Pro Ala Thr Ala Thr Glu 405 410 415 Asp Val Lys Asn Val Gln Val Ala Asn Ala Asp Leu Thr Glu Ala Lys 420 425 430 Ala Ala Leu Thr Ala Ala Gly Val Thr Gly Thr Ala Ser Val Val Lys 435 440 445 Met Ser Tyr Thr Asp Asn Asn Gly Lys Thr Ile Asp Gly Gly Leu Ala 450 455 460 Val Lys Val Gly Asp Asp Tyr Tyr Ser Ala Thr Gln Asn Lys Asp Gly 465 470 475 480 Ser Ile Ser Ile Asn Thr Thr Lys Tyr Thr Ala Asp Asp Gly Thr Ser 485 490 495 Lys Thr Ala Leu Asn Lys Leu Gly Gly Ala Asp Gly Lys Thr Glu Val 500 505 510 Val Ser Ile Gly Gly Lys Thr Tyr Ala Ala Ser Lys Ala Glu Gly His 515 520 525 Asn Phe Lys Ala Gln Pro Asp Leu Ala Glu Ala Ala Ala Thr Thr Thr 530 535 540 Glu Asn Pro Leu Gln Lys Ile Asp Ala Ala Leu Ala Gln Val Asp Thr 545 550 555 560 Leu Arg Ser Asp Leu Gly Ala Val Gln Asn Arg Phe Asn Ser Ala Ile 565 570 575 Thr Asn Leu Gly Asn Thr Val Asn Asn Leu Thr Ser Ala Arg Ser Arg 580 585 590 Ile Glu Cys Ser Asp Tyr Ala Thr Glu Val Ser Asn Met Ser Arg Ala 595 600 605 Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu Ala Gln Ala Asn Gln 610 615 620 Val Pro Gln Asn Val Leu Ser Leu Leu Arg 625 630 <210> 18 <211> 1845 <212> DNA <213> Artificial Sequence <220> <223> full-length FliC (N) -VL12.3cys <400> 18 atgggtagtc aaccagtact tacacaaagc ccgtctgtgt ctgccgctcc acgtcagaga 60 gtcaccatct cagttagtgg ttctaattca aatataggat cgaacacagt gaactggatt 120 cagcagttgc ctggccgtgc cccggagtta ttaatgtgtg atgatgattt attagcaccc 180 ggagtatcag atcgcttttc aggaagccgt agtggcacta gtgcgtcctt aaccattagc 240 gggttacagt ctgaagacga agcggactat tacgcagcta cgtgggatga tagtttaaat 300 ggctgggttt ttggtggtgg tactaaagtt acggtgctgt ccgcaggtgg tagcgccatg 360 gcacaagtca ttaataccaa cagcctgtcg ctgttgaccc agaataacct gaacaaatcc 420 cagtccgctc tgggcaccgc tatcgagcgt ctgtcttcct gcctgcgtat caacagcgcg 480 aaagacgatg cggcaggtca ggcgattgct aaccgtttta ccgcgaacat caaaggtctg 540 actcaggctt cccgtaacgc taacgacggt atctccattg cgcagaccac tgaaggcgcg 600 ctgaacgaaa tcaacaacaa cctgcagcgt gtgcgtgaac tggcggttca gtctgctaac 660 agcaccaact cccagtctga cctcgactcc atccaggctg aaatcaccca gcgcctgaac 720 gaaatcgacc gtgtatccgg ccagactcag ttcaacggcg tgaaagtcct ggcgcaggac 780 aacaccctga ccatccaggt tggtgccaac gacggtgaaa ctatcgatat cgatctgaag 840 cagatcaact ctcagaccct gggtctggat acgctgaatg tgcaacaaaa atataaggtc 900 agcgatacgg ctgcaactgt tacaggatat gccgatacta cgattgcttt agacaatagt 960 acttttaaag cctcggctac tggtcttggt ggtactgacc agaaaattga tggcgattta 1020 aaatttgatg atacgactgg aaaatattac gccaaagtta ccgttacggg gggaactggt 1080 aaagatggct attatgaagt ttccgttgat aagacgaacg gtgaggtgac tcttgctggc 1140 ggtgcgactt ccccgcttac aggtggacta cctgcgacag caactgagga tgtgaaaaat 1200 gtacaagttg caaatgctga tttgacagag gctaaagccg cattgacagc agcaggtgtt 1260 accggcacag catctgttgt taagatgtct tatactgata ataacggtaa aactattgat 1320 ggtggtttag cagttaaggt aggcgatgat tactattctg caactcaaaa taaagatggt 1380 tccataagta ttaatactac gaaatacact gcagatgacg gtacatccaa aactgcacta 1440 aacaaactgg gtggcgcaga cggcaaaacc gaagttgttt ctattggtgg taaaacttac 1500 gctgcaagta aagccgaagg tcacaacttt aaagcacagc ctgatctggc ggaagcggct 1560 gctacaacca ccgaaaaccc gctgcagaaa attgatgctg ctttggcaca ggttgacacg 1620 ttacgttctg acctgggtgc ggtacagaac cgtttcaact ccgctattac caacctgggc 1680 aacaccgtaa acaacctgac ttctgcccgt agccgtatcg aatgctccga ctacgcgacc 1740 gaagtttcca acatgtctcg cgcgcagatt ctgcagcagg ccggtacctc cgttctggcg 1800 caggcgaacc aggttccgca aaacgtcctc tctttactgc gttga 1845 <210> 19 <211> 527 <212> PRT <213> Artificial Sequence <220> <223> truncated FliC (N) -VL12.3cys <400> 19 Met Gly Ser Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala 1 5 10 15 Pro Arg Gln Arg Val Thr Ile Ser Val Ser Gly Ser Asn Ser Asn Ile 20 25 30 Gly Ser Asn Thr Val Asn Trp Ile Gln Gln Leu Pro Gly Arg Ala Pro 35 40 45 Glu Leu Leu Met Cys Asp Asp Asp Leu Leu Ala Pro Gly Val Ser Asp 50 55 60 Arg Phe Ser Gly Ser Arg Ser Gly Thr Ser Ala Ser Leu Thr Ile Ser 65 70 75 80 Gly Leu Gln Ser Glu Asp Glu Ala Asp Tyr Tyr Ala Ala Thr Trp Asp 85 90 95 Asp Ser Leu Asn Gly Trp Val Phe Gly Gly Gly Thr Lys Val Thr Val 100 105 110 Leu Ser Ala Gly Gly Ser Ala Met Gly Phe Thr Ala Asn Ile Lys Gly 115 120 125 Leu Thr Gln Ala Ser Arg Asn Ala Asn Asp Gly Ile Ser Ile Ala Gln 130 135 140 Thr Thr Glu Gly Ala Leu Asn Glu Ile Asn Asn Asn Leu Gln Arg Val 145 150 155 160 Arg Glu Leu Ala Val Gln Ser Ala Asn Ser Thr Asn Ser Gln Ser Asp 165 170 175 Leu Asp Ser Ile Gln Ala Glu Ile Thr Gln Arg Leu Asn Glu Ile Asp 180 185 190 Arg Val Ser Gly Gln Thr Gln Phe Asn Gly Val Lys Val Leu Ala Gln 195 200 205 Asp Asn Thr Leu Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile 210 215 220 Asp Ile Asp Leu Lys Gln Ile Asn Ser Gln Thr Leu Gly Leu Asp Thr 225 230 235 240 Leu Asn Val Gln Gln Lys Tyr Lys Val Ser Asp Thr Ala Ala Thr Val 245 250 255 Thr Gly Tyr Ala Asp Thr Thr Ile Ala Leu Asp Asn Ser Thr Phe Lys 260 265 270 Ala Ser Ala Thr Gly Leu Gly Gly Thr Asp Gln Lys Ile Asp Gly Asp 275 280 285 Leu Lys Phe Asp Asp Thr Thr Gly Lys Tyr Tyr Ala Lys Val Thr Val 290 295 300 Thr Gly Gly Thr Gly Lys Asp Gly Tyr Tyr Glu Val Ser Val Asp Lys 305 310 315 320 Thr Asn Gly Glu Val Thr Leu Ala Gly Gly Ala Thr Ser Pro Leu Thr 325 330 335 Gly Gly Leu Pro Ala Thr Ala Thr Glu Asp Val Lys Asn Val Gln Val 340 345 350 Ala Asn Ala Asp Leu Thr Glu Ala Lys Ala Ala Leu Thr Ala Ala Gly 355 360 365 Val Thr Gly Thr Ala Ser Val Val Lys Met Ser Tyr Thr Asp Asn Asn 370 375 380 Gly Lys Thr Ile Asp Gly Gly Leu Ala Val Lys Val Gly Asp Asp Tyr 385 390 395 400 Tyr Ser Ala Thr Gln Asn Lys Asp Gly Ser Ile Ser Ile Asn Thr Thr 405 410 415 Lys Tyr Thr Ala Asp Asp Gly Thr Ser Lys Thr Ala Leu Asn Lys Leu 420 425 430 Gly Gly Ala Asp Gly Lys Thr Glu Val Val Ser Ile Gly Gly Lys Thr 435 440 445 Tyr Ala Ala Ser Lys Ala Glu Gly His Asn Phe Lys Ala Gln Pro Asp 450 455 460 Leu Ala Glu Ala Ala Ala Thr Thr Thr Thr Glu Asn Pro Leu Gln Lys Ile 465 470 475 480 Asp Ala Ala Leu Ala Gln Val Asp Thr Leu Arg Ser Asp Leu Gly Ala 485 490 495 Val Gln Asn Arg Phe Asn Ser Ala Ile Thr Asn Leu Gly Asn Thr Val 500 505 510 Asn Asn Leu Thr Ser Ala Arg Leu Glu His His His His His His His 515 520 525 <210> 20 <211> 1584 <212> DNA <213> Artificial Sequence <220> <223> truncated FliC (N) -VL12.3cys <400> 20 atgggtagtc aaccagtact tacacaaagc ccgtctgtgt ctgccgctcc acgtcagaga 60 gtcaccatct cagttagtgg ttctaattca aatataggat cgaacacagt gaactggatt 120 cagcagttgc ctggccgtgc cccggagtta ttaatgtgtg atgatgattt attagcaccc 180 ggagtatcag atcgcttttc aggaagccgt agtggcacta gtgcgtcctt aaccattagc 240 gggttacagt ctgaagacga agcggactat tacgcagcta cgtgggatga tagtttaaat 300 ggctgggttt ttggtggtgg tactaaagtt acggtgctgt ccgcaggtgg tagcgccatg 360 ggctttaccg cgaacatcaa aggtctgact caggcttccc gtaacgctaa cgacggtatc 420 tccattgcgc agaccactga aggcgcgctg aacgaaatca acaacaacct gcagcgtgtg 480 cgtgaactgg cggttcagtc tgctaacagc accaactccc agtctgacct cgactccatc 540 caggctgaaa tcacccagcg cctgaacgaa atcgaccgtg tatccggcca gactcagttc 600 aacggcgtga aagtcctggc gcaggacaac accctgacca tccaggttgg tgccaacgac 660 ggtgaaacta tcgatatcga tctgaagcag atcaactctc agaccctggg tctggatacg 720 ctgaatgtgc aacaaaaata taaggtcagc gatacggctg caactgttac aggatatgcc 780 gatactacga ttgctttaga caatagtact tttaaagcct cggctactgg tcttggtggt 840 actgaccaga aaattgatgg cgatttaaaa tttgatgata cgactggaaa atattacgcc 900 aaagttaccg ttacgggggg aactggtaaa gatggctatt atgaagtttc cgttgataag 960 acgaacggtg aggtgactct tgctggcggt gcgacttccc cgcttacagg tggactacct 1020 gcgacagcaa ctgaggatgt gaaaaatgta caagttgcaa atgctgattt gacagaggct 1080 aaagccgcat tgacagcagc aggtgttacc ggcacagcat ctgttgttaa gatgtcttat 1140 actgataata acggtaaaac tattgatggt ggtttagcag ttaaggtagg cgatgattac 1200 tattctgcaa ctcaaaataa agatggttcc ataagtatta atactacgaa atacactgca 1260 gatgacggta catccaaaac tgcactaaac aaactgggtg gcgcagacgg caaaaccgaa 1320 gttgtttcta ttggtggtaa aacttacgct gcaagtaaag ccgaaggtca caactttaaa 1380 gcacagcctg atctggcgga agcggctgct acaaccaccg aaaacccgct gcagaaaatt 1440 gatgctgctt tggcacaggt tgacacgtta cgttctgacc tgggtgcggt acagaaccgt 1500 ttcaactccg ctattaccaa cctgggcaac accgtaaaca acctgacttc tgcccgtctc 1560 gagcaccacc accaccacca ctga 1584 <210> 21 <211> 528 <212> PRT <213> Artificial Sequence <220> <223> truncated FliC (C) -VL12.3cys <400> 21 Met Gly Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala Ser Arg Asn 1 5 10 15 Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly Ala Leu Asn 20 25 30 Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ala Val Gln Ser 35 40 45 Ala Asn Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile Gln Ala Glu 50 55 60 Ile Thr Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly Gln Thr Gln 65 70 75 80 Phe Asn Gly Val Lys Val Leu Ala Gln Asp Asn Thr Leu Thr Ile Gln 85 90 95 Val Gly Ala Asn Asp Gly Glu Thr Ile Asp Ile Asp Leu Lys Gln Ile 100 105 110 Asn Ser Gln Thr Leu Gly Leu Asp Thr Leu Asn Val Gln Gln Lys Tyr 115 120 125 Lys Val Ser Asp Thr Ala Ala Thr Val Thr Gly Tyr Ala Asp Thr Thr 130 135 140 Ile Ala Leu Asp Asn Ser Thr Phe Lys Ala Ser Ala Thr Gly Leu Gly 145 150 155 160 Gly Thr Asp Gln Lys Ile Asp Gly Asp Leu Lys Phe Asp Asp Thr Thr 165 170 175 Gly Lys Tyr Tyr Ala Lys Val Thr Val Thr Gly Gly Thr Gly Lys Asp 180 185 190 Gly Tyr Tyr Glu Val Ser Val Asp Lys Thr Asn Gly Glu Val Thr Leu 195 200 205 Ala Gly Gly Ala Thr Ser Pro Leu Thr Gly Gly Leu Pro Ala Thr Ala 210 215 220 Thr Glu Asp Val Lys Asn Val Gln Val Ala Asn Ala Asp Leu Thr Glu 225 230 235 240 Ala Lys Ala Ala Leu Thr Ala Ala Gly Val Thr Gly Thr Ala Ser Val 245 250 255 Val Lys Met Ser Tyr Thr Asp Asn Asn Gly Lys Thr Ile Asp Gly Gly 260 265 270 Leu Ala Val Lys Val Gly Asp Asp Tyr Tyr Ser Ala Thr Gln Asn Lys 275 280 285 Asp Gly Ser Ile Ser Ile Asn Thr Thr Lys Tyr Thr Ala Asp Asp Gly 290 295 300 Thr Ser Lys Thr Ala Leu Asn Lys Leu Gly Gly Ala Asp Gly Lys Thr 305 310 315 320 Glu Val Val Ser Ile Gly Gly Lys Thr Tyr Ala Ala Ser Lys Ala Glu 325 330 335 Gly His Asn Phe Lys Ala Gln Pro Asp Leu Ala Glu Ala Ala Ala Thr 340 345 350 Thr Thr Glu Asn Pro Leu Gln Lys Ile Asp Ala Ala Leu Ala Gln Val 355 360 365 Asp Thr Leu Arg Ser Asp Leu Gly Ala Val Gln Asn Arg Phe Asn Ser 370 375 380 Ala Ile Thr Asn Leu Gly Asn Thr Val Asn Asn Leu Thr Ser Ala Arg 385 390 395 400 Leu Glu Gly Gly Ser Met Gly Ser Gln Pro Val Leu Thr Gln Ser Pro 405 410 415 Ser Val Ser Ala Ala Pro Arg Gln Arg Val Thr Ile Ser Val Ser Gly 420 425 430 Ser Asn Ser Asn Ile Gly Ser Asn Thr Val Asn Trp Ile Gln Gln Leu 435 440 445 Pro Gly Arg Ala Pro Glu Leu Leu Met Cys Asp Asp Asp Leu Leu Ala 450 455 460 Pro Gly Val Ser Asp Arg Phe Ser Gly Ser Arg Ser Gly Thr Ser Ala 465 470 475 480 Ser Leu Thr Ile Ser Gly Leu Gln Ser Glu Asp Glu Ala Asp Tyr Tyr 485 490 495 Ala Ala Thr Trp Asp Asp Ser Leu Asn Gly Trp Val Phe Gly Gly Gly 500 505 510 Thr Lys Val Thr Val Leu Ser Ala Leu Glu His His His His His His 515 520 525 <210> 22 <211> 1587 <212> DNA <213> Artificial Sequence <220> <223> truncated FliC (C) -VL12.3cys <400> 22 atgggcttta ccgcgaacat caaaggtctg actcaggctt cccgtaacgc taacgacggt 60 atctccattg cgcagaccac tgaaggcgcg ctgaacgaaa tcaacaacaa cctgcagcgt 120 gtgcgtgaac tggcggttca gtctgctaac agcaccaact cccagtctga cctcgactcc 180 atccaggctg aaatcaccca gcgcctgaac gaaatcgacc gtgtatccgg ccagactcag 240 ttcaacggcg tgaaagtcct ggcgcaggac aacaccctga ccatccaggt tggtgccaac 300 gacggtgaaa ctatcgatat cgatctgaag cagatcaact ctcagaccct gggtctggat 360 acgctgaatg tgcaacaaaa atataaggtc agcgatacgg ctgcaactgt tacaggatat 420 gccgatacta cgattgcttt agacaatagt acttttaaag cctcggctac tggtcttggt 480 ggtactgacc agaaaattga tggcgattta aaatttgatg atacgactgg aaaatattac 540 gccaaagtta ccgttacggg gggaactggt aaagatggct attatgaagt ttccgttgat 600 aagacgaacg gtgaggtgac tcttgctggc ggtgcgactt ccccgcttac aggtggacta 660 cctgcgacag caactgagga tgtgaaaaat gtacaagttg caaatgctga tttgacagag 720 gctaaagccg cattgacagc agcaggtgtt accggcacag catctgttgt taagatgtct 780 tatactgata ataacggtaa aactattgat ggtggtttag cagttaaggt aggcgatgat 840 tactattctg caactcaaaa taaagatggt tccataagta ttaatactac gaaatacact 900 gcagatgacg gtacatccaa aactgcacta aacaaactgg gtggcgcaga cggcaaaacc 960 gaagttgttt ctattggtgg taaaacttac gctgcaagta aagccgaagg tcacaacttt 1020 aaagcacagc ctgatctggc ggaagcggct gctacaacca ccgaaaaccc gctgcagaaa 1080 attgatgctg ctttggcaca ggttgacacg ttacgttctg acctgggtgc ggtacagaac 1140 cgtttcaact ccgctattac caacctgggc aacaccgtaa acaacctgac ttctgcccgt 1200 ctcgagggtg gtagcatggg tagtcaacca gtacttacac aaagcccgtc tgtgtctgcc 1260 gctccacgtc agagagtcac catctcagtt agtggttcta attcaaatat aggatcgaac 1320 acagtgaact ggattcagca gttgcctggc cgtgccccgg agttattaat gtgtgatgat 1380 gatttattag cacccggagt atcagatcgc ttttcaggaa gccgtagtgg cactagtgcg 1440 tccttaacca ttagcgggtt acagtctgaa gacgaagcgg actattacgc agctacgtgg 1500 gatgatagtt taaatggctg ggtttttggt ggtggtacta aagttacggt gctgtccgca 1560 ctcgagcacc accaccacca ccactga 1587 <210> 23 <211> 542 <212> PRT <213> Artificial Sequence <220> <223> truncated FliC (I) -VL12.3cys <400> 23 Met Gly Phe Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala Ser Arg Asn 1 5 10 15 Ala Asn Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly Ala Leu Asn 20 25 30 Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ala Val Gln Ser 35 40 45 Ala Asn Ser Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile Gln Ala Glu 50 55 60 Ile Thr Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly Gln Thr Gln 65 70 75 80 Phe Asn Gly Val Lys Val Leu Ala Gln Asp Asn Thr Leu Thr Ile Gln 85 90 95 Val Gly Ala Asn Asp Gly Glu Thr Ile Asp Ile Asp Leu Lys Gln Ile 100 105 110 Asn Ser Gln Thr Leu Gly Leu Asp Thr Leu Asn Val Gln Gln Lys Tyr 115 120 125 Lys Val Ser Asp Thr Ala Ala Thr Val Thr Gly Tyr Ala Asp Thr Thr 130 135 140 Ile Ala Leu Asp Asn Ser Thr Phe Lys Ala Ser Ala Thr Gly Leu Gly 145 150 155 160 Gly Thr Asp Gln Lys Ile Asp Gly Asp Leu Lys Phe Asp Asp Thr Thr 165 170 175 Gly Lys Tyr Tyr Ala Lys Val Thr Val Thr Gly Gly Ser Gly Gly Ser 180 185 190 Met Gly Ser Gln Pro Val Leu Thr Gln Ser Pro Ser Val Ser Ala Ala 195 200 205 Pro Arg Gln Arg Val Thr Ile Ser Val Ser Gly Ser Asn Ser Asn Ile 210 215 220 Gly Ser Asn Thr Val Asn Trp Ile Gln Gln Leu Pro Gly Arg Ala Pro 225 230 235 240 Glu Leu Leu Met Cys Asp Asp Asp Leu Leu Ala Pro Gly Val Ser Asp 245 250 255 Arg Phe Ser Gly Ser Arg Ser Gly Thr Ser Ala Ser Leu Thr Ile Ser 260 265 270 Gly Leu Gln Ser Glu Asp Glu Ala Asp Tyr Tyr Ala Ala Thr Trp Asp 275 280 285 Asp Ser Leu Asn Gly Trp Val Phe Gly Gly Gly Thr Lys Val Thr Val 290 295 300 Leu Ser Ala Gly His Met Leu Val Pro Arg Gly Ser Gly Gly Ser Val 305 310 315 320 Asp Gly Thr Gly Lys Asp Gly Tyr Tyr Glu Val Ser Val Asp Lys Thr 325 330 335 Asn Gly Glu Val Thr Leu Ala Gly Gly Ala Thr Ser Pro Leu Thr Gly 340 345 350 Gly Leu Pro Ala Thr Ala Thr Glu Asp Val Lys Asn Val Gln Val Ala 355 360 365 Asn Ala Asp Leu Thr Glu Ala Lys Ala Ala Leu Thr Ala Ala Gly Val 370 375 380 Thr Gly Thr Ala Ser Val Val Lys Met Ser Tyr Thr Asp Asn Asn Gly 385 390 395 400 Lys Thr Ile Asp Gly Gly Leu Ala Val Lys Val Gly Asp Asp Tyr Tyr 405 410 415 Ser Ala Thr Gln Asn Lys Asp Gly Ser Ile Ser Ile Asn Thr Thr Lys 420 425 430 Tyr Thr Ala Asp Asp Gly Thr Ser Lys Thr Ala Leu Asn Lys Leu Gly 435 440 445 Gly Ala Asp Gly Lys Thr Glu Val Val Ser Ile Gly Gly Lys Thr Tyr 450 455 460 Ala Ala Ser Lys Ala Glu Gly His Asn Phe Lys Ala Gln Pro Asp Leu 465 470 475 480 Ala Glu Ala Ala Ala Thr Thr Thr Glu Asn Pro Leu Gln Lys Ile Asp 485 490 495 Ala Ala Leu Ala Gln Val Asp Thr Leu Arg Ser Asp Leu Gly Ala Val 500 505 510 Gln Asn Arg Phe Asn Ser Ala Ile Thr Asn Leu Gly Asn Thr Val Asn 515 520 525 Asn Leu Thr Ser Ala Arg Leu Glu His His His His His His 530 535 540 <210> 24 <211> 1629 <212> DNA <213> Artificial Sequence <220> <223> truncated FliC (I) -VL12.3cys <400> 24 atgggcttta ccgcgaacat caaaggtctg actcaggctt cccgtaacgc taacgacggt 60 atctccattg cgcagaccac tgaaggcgcg ctgaacgaaa tcaacaacaa cctgcagcgt 120 gtgcgtgaac tggcggttca gtctgctaac agcaccaact cccagtctga cctcgactcc 180 atccaggctg aaatcaccca gcgcctgaac gaaatcgacc gtgtatccgg ccagactcag 240 ttcaacggcg tgaaagtcct ggcgcaggac aacaccctga ccatccaggt tggtgccaac 300 gacggtgaaa ctatcgatat cgatctgaag cagatcaact ctcagaccct gggtctggat 360 acgctgaatg tgcaacaaaa atataaggtc agcgatacgg ctgcaactgt tacaggatat 420 gccgatacta cgattgcttt agacaatagt acttttaaag cctcggctac tggtcttggt 480 ggtactgacc agaaaattga tggcgattta aaatttgatg atacgactgg aaaatattac 540 gccaaagtta ccgttacggg gggatccggt ggtagcatgg gtagtcaacc agtacttaca 600 caaagcccgt ctgtgtctgc cgctccacgt cagagagtca ccatctcagt tagtggttct 660 aattcaaata taggatcgaa cacagtgaac tggattcagc agttgcctgg ccgtgccccg 720 gagttattaa tgtgtgatga tgatttatta gcacccggag tatcagatcg cttttcagga 780 agccgtagtg gcactagtgc gtccttaacc attagcgggt tacagtctga agacgaagcg 840 gactattacg cagctacgtg ggatgatagt ttaaatggct gggtttttgg tggtggtact 900 aaagttacgg tgctgtccgc aggtcatatg ctggtgccgc gcggcagcgg tggtagcgtc 960 gacggaactg gtaaagatgg ctattatgaa gtttccgttg ataagacgaa cggtgaggtg 1020 actcttgctg gcggtgcgac ttccccgctt acaggtggac tacctgcgac agcaactgag 1080 gatgtgaaaa atgtacaagt tgcaaatgct gatttgacag aggctaaagc cgcattgaca 1140 gcagcaggtg ttaccggcac agcatctgtt gttaagatgt cttatactga taataacggt 1200 aaaactattg atggtggttt agcagttaag gtaggcgatg attactattc tgcaactcaa 1260 aataaagatg gttccataag tattaatact acgaaataca ctgcagatga cggtacatcc 1320 aaaactgcac taaacaaact gggtggcgca gacggcaaaa ccgaagttgt ttctattggt 1380 ggtaaaactt acgctgcaag taaagccgaa ggtcacaact ttaaagcaca gcctgatctg 1440 gcggaagcgg ctgctacaac caccgaaaac ccgctgcaga aaattgatgc tgctttggca 1500 caggttgaca cgttacgttc tgacctgggt gcggtacaga accgtttcaa ctccgctatt 1560 accaacctgg gcaacaccgt aaacaacctg acttctgccc gtctcgagca ccaccaccac 1620 caccactga 1629 <210> 25 <211> 34 <212> DNA <213> Artificial Sequence <220> <223> HTTcys Forward primer <400> 25 atcatccatg ggcgaaaagc tgatgaagtg tttc 34 <210> 26 <211> 32 <212> DNA <213> Artificial Sequence <220> <223> HTTcys Reverse primer <400> 26 atcactctag aaccaccctg gaaggacttg ag 32 <210> 27 <211> 35 <212> DNA <213> Artificial Sequence <220> <223> Ftn Forward primer <400> 27 tgcggtctag aatgctgaaa ccagaaatga ttgaa 35 <210> 28 <211> 40 <212> DNA <213> Artificial Sequence <220> <223> Ftn Reverse primer <400> 28 aggccagcca ctcgagacta gttcattagt tttgtgtgtc 40 <210> 29 <211> 47 <212> DNA <213> Artificial Sequence <220> <223> HTTcys-I3-01 Forward primer <400> 29 attatcatat gcatcatcat catcatcacg gtggaagcgg tggaagc 47 <210> 30 <211> 36 <212> DNA <213> Artificial Sequence <220> <223> HTTcys-I3-01 Reverse primer <400> 30 tgcgcctcga gctattattc ggtgcagcca cgaatc 36 <210> 31 <211> 35 <212> DNA <213> Artificial Sequence <220> <223> HA-VL12.3cys Forward primer <400> 31 aggcctctag aagcatgggt agtcaaccag tactt 35 <210> 32 <211> 42 <212> DNA <213> Artificial Sequence <220> <223> HA-VL12.3cys Reverse primer <400> 32 gtgatgatga tgatgatggc tactgcctgc ggacagcacc gt 42 <210> 33 <211> 34 <212> DNA <213> Artificial Sequence <220> <223> PA-VL12.3cys Forward primer <400> 33 aagagccatg ggctttcatt atgatagaaa taac 34 <210> 34 <211> 33 <212> DNA <213> Artificial Sequence <220> <223> PA-VL12.3cys Reverse primer <400> 34 agcatctcga gtgcggacag caccgtaact tta 33 <210> 35 <211> 41 <212> DNA <213> Artificial Sequence <220> <223> FliC (N) -VL12.3cys Forward primer <400> 35 agcggcatat gggtagtcaa ccagtactta cacaaagccc g 41 <210> 36 <211> 35 <212> DNA <213> Artificial Sequence <220> <223> FliC (N) -VL12.3cys Reverse primer <400> 36 attatgcggc cgctcaacgc agtaaagaga ggacg 35 <210> 37 <211> 33 <212> DNA <213> Artificial Sequence <220> <223> truncated FliC (N) -VL12.3cys Forward primer <400> 37 actggtggta ccatgggtag tcaaccagta ctt 33 <210> 38 <211> 32 <212> DNA <213> Artificial Sequence <220> <223> truncated FliC (N) -VL12.3cys Reverse primer <400> 38 agttactcga gacgggcaga agtcaggttg tt 32 <210> 39 <211> 34 <212> DNA <213> Artificial Sequence <220> <223> truncated FliC (C) -VL12.3cys Forward primer <400> 39 ataatccatg ggctttaccg cgaacatcaa aggt 34 <210> 40 <211> 29 <212> DNA <213> Artificial Sequence <220> <223> truncated FliC (C) -VL12.3cys Reverse primer <400> 40 agcatctcga gtgcggacag caccgtaac 29 <210> 41 <211> 34 <212> DNA <213> Artificial Sequence <220> <223> truncated FliC (I) -VL12.3cys Forward primer <400> 41 ataatccatg ggctttaccg cgaacatcaa aggt 34 <210> 42 <211> 32 <212> DNA <213> Artificial Sequence <220> <223> truncated FliC (I) -VL12.3cys Reverse primer <400> 42 agttactcga gacgggcaga agtcaggttg tt 32
Claims (11)
VL12.3cys 펩타이드 및 항원 펩타이드가 융합된 융합 단백질; 및
VL12.3cys 펩타이드 및 면역 증강제(adjuvant)의 융합 분자를 포함하는 나노 입자로서,
상기 항원 펩타이드 및 면역 증강제는 상기 HTTcys 펩타이드와 VL12.3cys 펩타이드 간의 결합에 의해 페리틴 자가조립체와 연결된 것인, 나노 입자.
HTT cys Autoassembles of 24 fusion proteins of peptide and ferritin monomers;
Fusion proteins fused to a VL 12.3 cys peptide and an antigen peptide; And
A nanoparticle comprising a fusion molecule of a V L 12.3 cys peptide and an immunoadjuvant,
The antigenic peptide and immune enhancer are the HTT cys Peptides with V L 12.3 cys Nanoparticles that are linked to the ferritin self-assembly by binding between peptides.
상기 HTTcys 펩타이드는 서열번호 3의 아미노산 서열로 구성된 것인 나노 입자.
The method of claim 1,
The HTT cys Peptide is a nanoparticle consisting of the amino acid sequence of SEQ ID NO: 3.
상기 VL12.3cys 펩타이드는 서열번호 5의 아미노산 서열로 구성된 것인 나노 입자.
The method of claim 1,
V L 12.3 cys Peptide is a nanoparticle consisting of the amino acid sequence of SEQ ID NO: 5.
상기 HTTcys 펩타이드와 VL12.3cys 펩타이드 간의 결합은 항원-항체 결합 및 이황화 결합을 포함하는, 나노 입자.
The method of claim 1,
The HTT cys Peptides with V L 12.3 cys The binding between the peptides comprises antigen-antibody binding and disulfide binding.
상기 면역 증강제는 면역 증강 펩타이드인, 나노 입자.
The method of claim 1,
The immune enhancer is an immune enhancing peptide, nanoparticles.
상기 HTTcys 펩타이드는 페리틴 단량체의 N-말단에 융합된 것인, 나노 입자.
The method of claim 1,
The HTT cys Peptides are fused to the N-terminus of the ferritin monomer, nanoparticles.
상기 VL12.3cys 펩타이드는 항원 펩타이드 또는 면역 증강 펩타이드의 N-말단 또는 C-말단에 융합되거나 내부에 삽입된 것인, 나노 입자.
The method of claim 5,
V L 12.3 cys The peptide is a nanoparticle, which is fused to or inserted into the N-terminus or C-terminus of an antigenic peptide or an immune enhancing peptide.
상기 나노 입자 내의 항원 펩타이드와 면역 증강 펩타이드의 몰비는 0.1~10 : 1인, 나노 입자.
The method of claim 5,
Mole ratio of the antigen peptide and the immune enhancing peptide in the nanoparticles is 0.1 ~ 10: 1, nanoparticles.
A vaccine composition comprising the nanoparticles of any one of claims 1 to 8.
상기 백신은 총 IgG 수치를 증가시키는 것인, 백신 조성물.
The method of claim 9,
Wherein the vaccine increases total IgG levels.
상기 백신은 세포성 면역 및 체액성 면역을 증진시키는 것인, 백신 조성물.The method of claim 9,
Wherein said vaccine promotes cellular and humoral immunity.
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020180038078A KR102112759B1 (en) | 2018-04-02 | 2018-04-02 | Nano particle comprising self-assembled ferritin structure conjugated with antigen peptide and adjuvant and use thereof |
PCT/KR2018/015938 WO2019194393A1 (en) | 2018-04-02 | 2018-12-14 | Nanoparticles in which antigen peptide and adjuvant are bound to ferritin self assembly, and use thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020180038078A KR102112759B1 (en) | 2018-04-02 | 2018-04-02 | Nano particle comprising self-assembled ferritin structure conjugated with antigen peptide and adjuvant and use thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
KR20190115262A true KR20190115262A (en) | 2019-10-11 |
KR102112759B1 KR102112759B1 (en) | 2020-05-19 |
Family
ID=68101053
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020180038078A KR102112759B1 (en) | 2018-04-02 | 2018-04-02 | Nano particle comprising self-assembled ferritin structure conjugated with antigen peptide and adjuvant and use thereof |
Country Status (2)
Country | Link |
---|---|
KR (1) | KR102112759B1 (en) |
WO (1) | WO2019194393A1 (en) |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2021086158A1 (en) * | 2019-11-01 | 2021-05-06 | (주)셀레메디 | Disease antigen-fused protein, and use thereof |
WO2021086159A1 (en) * | 2019-11-01 | 2021-05-06 | (주)셀레메디 | Protein fused with molecule capable of binding to immune checkpoint molecule and use of same |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR101630858B1 (en) * | 2014-01-24 | 2016-06-15 | 울산과학기술원 | Antigen peptide-ferritin fused protein and vaccine composition comprising the same |
KR101831483B1 (en) * | 2014-06-17 | 2018-02-23 | 이화여자대학교 산학협력단 | MHC-ferritin conjugates, a nanoparticle comprising the same and the use thereof |
-
2018
- 2018-04-02 KR KR1020180038078A patent/KR102112759B1/en active IP Right Grant
- 2018-12-14 WO PCT/KR2018/015938 patent/WO2019194393A1/en active Application Filing
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR101630858B1 (en) * | 2014-01-24 | 2016-06-15 | 울산과학기술원 | Antigen peptide-ferritin fused protein and vaccine composition comprising the same |
KR101831483B1 (en) * | 2014-06-17 | 2018-02-23 | 이화여자대학교 산학협력단 | MHC-ferritin conjugates, a nanoparticle comprising the same and the use thereof |
Non-Patent Citations (2)
Title |
---|
PDB: 3LRG_A(2012.10.10.) * |
SCHIEFNER, A. 등, Journal of Molecular Biology, 2011, vol.414, p.337-355 * |
Cited By (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2021086158A1 (en) * | 2019-11-01 | 2021-05-06 | (주)셀레메디 | Disease antigen-fused protein, and use thereof |
WO2021086159A1 (en) * | 2019-11-01 | 2021-05-06 | (주)셀레메디 | Protein fused with molecule capable of binding to immune checkpoint molecule and use of same |
JP2023500841A (en) * | 2019-11-01 | 2023-01-11 | セレメディー カンパニー,リミテッド | Proteins fused with disease antigens and uses thereof |
Also Published As
Publication number | Publication date |
---|---|
KR102112759B1 (en) | 2020-05-19 |
WO2019194393A1 (en) | 2019-10-10 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10137190B2 (en) | Nucleic acid molecules encoding ferritin-hemagglutinin fusion proteins | |
US8846058B2 (en) | Shiga toxoid chimeric proteins | |
JP5942296B2 (en) | Pharmaceutical composition comprising a polypeptide comprising at least one CXXXC motif and a heterologous antigen, and uses thereof | |
EP2716661A1 (en) | Fusion protein comprising diphtheria toxin non-toxic mutant crm197 or fragment thereof | |
AU2018383708B2 (en) | Peptide immunogens of IL-31 and formulations thereof for the treatment and/or prevention of atopic dermatitis | |
JP2010017190A (en) | Mutant form of cholera holotoxin as adjuvant | |
US10576140B2 (en) | Cholera toxin chimera and its use as a staph vaccine | |
Qian et al. | Salmonella flagellin is a potent carrier–adjuvant for peptide conjugate to induce peptide-specific antibody response in mice | |
KR102112759B1 (en) | Nano particle comprising self-assembled ferritin structure conjugated with antigen peptide and adjuvant and use thereof | |
US9267947B2 (en) | Compositions and methods for preventing or treating Burkholderia infection | |
Lee et al. | Attachment of flagellin enhances the immunostimulatory activity of a hemagglutinin-ferritin nano-cage | |
KR20070102429A (en) | Using a reverse genetic engineering platform to produce protein vaccine and protein vaccine of avian influenza virus | |
KR20190110090A (en) | Pneumococcal vaccine combining selected alpha-helix domains and proline-rich domains of pneumococcal surface protein A | |
US9120869B1 (en) | Synthetic antigen based on the ligand domain of the plasmodium vivax duffy binding protein | |
US8911748B2 (en) | Cholera toxin chimera and its use as a staph vaccine | |
KR20200046059A (en) | Immunogenic peptides for group A streptococcus | |
KR102211378B1 (en) | Influenza virus vaccine composition | |
RU2615440C2 (en) | Fusion protein, dna, genetic construct, recombinant cell, fusion protein-based vaccine for tuberculosis prevention and treatment (versions) | |
CN113226348A (en) | IL-6 peptide immunogens for immunotherapy of IL-6 imbalance diseases and formulations thereof | |
KR102394946B1 (en) | Universal canine influenza virus vaccine composition | |
US11357845B2 (en) | Protein antigens for vaccinating against nontypeable Haemophilus influenzae | |
RU2799440C2 (en) | Il-31 peptide immunogens and their compositions for the treatment and/or prevention of adopic dermatitis | |
WO2023020637A1 (en) | Chimeric antigens for the control of coronavirus and compositions containing same | |
JP2020162607A (en) | Influenza virus vaccines and uses thereof | |
WO2020034048A2 (en) | Vaccine against hantavirus cardiopulmonary syndrome |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
A201 | Request for examination | ||
E902 | Notification of reason for refusal | ||
E902 | Notification of reason for refusal | ||
E701 | Decision to grant or registration of patent right | ||
GRNT | Written decision to grant |