KR20190020711A - Peptides for diagnosis of mosquito-borne viruses and uses thereof - Google Patents
Peptides for diagnosis of mosquito-borne viruses and uses thereof Download PDFInfo
- Publication number
- KR20190020711A KR20190020711A KR1020190007756A KR20190007756A KR20190020711A KR 20190020711 A KR20190020711 A KR 20190020711A KR 1020190007756 A KR1020190007756 A KR 1020190007756A KR 20190007756 A KR20190007756 A KR 20190007756A KR 20190020711 A KR20190020711 A KR 20190020711A
- Authority
- KR
- South Korea
- Prior art keywords
- virus
- dengue
- zika
- peptide
- mosquito
- Prior art date
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/558—Immunoassay; Biospecific binding assay; Materials therefor using diffusion or migration of antigen or antibody
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/36011—Togaviridae
- C12N2770/36111—Alphavirus, e.g. Sindbis virus, VEE, EEE, WEE, Semliki
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/08—RNA viruses
- G01N2333/18—Togaviridae; Flaviviridae
- G01N2333/181—Alphaviruses or Group A arboviruses, e.g. sindbis, VEE, EEE, WEE or semliki forest virus
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Virology (AREA)
- Physics & Mathematics (AREA)
- Pathology (AREA)
- Organic Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Biotechnology (AREA)
- Cell Biology (AREA)
- Analytical Chemistry (AREA)
- Microbiology (AREA)
- Food Science & Technology (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Tropical Medicine & Parasitology (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
본 발명은 모기 매개 바이러스 진단시 모기 매개 바이러스 간 교차반응이 나타나지 않는 것을 특징으로 하는, 모기 매개 바이러스 특이적인 진단을 위한 단리된 펩타이드 및 상기 단리된 펩타이드를 포함하는, 모기 매개 바이러스 특이적인 진단을 위한 신속진단키트에 관한 것이다. The present invention is characterized in that the cross-reaction between mosquito-borne viruses does not appear when diagnosing a mosquito-borne virus, an isolated peptide for specific diagnosis of a mosquito-mediated virus, and an isolated peptide for a mosquito-mediated virus-specific diagnosis It is about a rapid diagnosis kit.
뎅기 바이러스는 연간 5천만명에서 1억명이 고통을 받고 있는 세계적인 주요 질환으로서, 년간 25,000명이 사망한다고 알려져 있다. 뎅기(열)은 모기 매개성 질환이며, 감기증상을 보이다가 뎅기출혈열(DHF) 또는 뎅기쇼크증후군(DSS)으로 진행된다. 따라서, 뎅기 바이러스 감염을 차단하기 위해서는 백신의 개발이 무척 중요하나 이 질환의 경우 중복감염(다른 타입의 뎅기 바이러스에 의한 두 번째 감염)이 되면 훨씬 심각한 DHF/DSS 증세를 보이기 때문에 백신 개발에 어려움이 있어, 아직까지는 빠르고 정확한 진단을 통한 환자 증세 완화가 최선의 치료법으로 알려져 있다. Dengue virus is a major global disease that suffers from 50 million to 100 million people per year, and is known to kill 25,000 people per year. Dengue (fever) is a mosquito-borne disease, and after showing symptoms of a cold, it progresses to dengue hemorrhagic fever (DHF) or dengue shock syndrome (DSS). Therefore, in order to block dengue virus infection, the development of a vaccine is very important, but in the case of this disease, it is difficult to develop a vaccine because multiple infections (second infection by another type of dengue virus) show more severe symptoms of DHF/DSS. Therefore, it is still known as the best treatment to relieve patient symptoms through fast and accurate diagnosis.
또한, 지카 바이러스는 황열(Yellow fever), 뎅기(Dengue) 바이러스와 같이 플라비바이러스과(Flaviviridae)에 속하는 것으로서, 지카 바이러스에 감염되면 발열과 피부발진, 결막염, 근육과 관절통증, 두통 등의 가벼운 감기증상이 2~7일 정도 나타난다. 증상이 가벼워 감염 사실을 모르고 지나가는 경우도 있으며 치사율도 낮은 편이다. 하지만 신생아의 소두증이나 신경학적 합병증을 일으킬 가능성이 제기되었고, 브라질에서는 2015년 5월에는 지카 바이러스의 첫 사례가 보고된 이후 2016년 1월까지 200명 이상의 소두증이 확인된 상태이다. 그러나, 현재 적절한 치료제나 백신이 없어 예방할 수 없는 상황이다. In addition, Zika virus belongs to the Flaviviridae family, such as yellow fever and dengue virus, and when infected with Zika virus, mild colds such as fever, skin rash, conjunctivitis, muscle and joint pain, headache, etc. Symptoms appear for 2 to 7 days. The symptoms are mild, so some people pass without knowing the infection, and the mortality rate is low. However, the possibility of causing microcephaly or neurological complications in newborns has been raised, and in Brazil, more than 200 microcephaly have been confirmed by January 2016 after the first case of Zika virus was reported in May 2015. However, there is currently no adequate treatment or vaccine, which cannot be prevented.
또한, 치쿤쿠니아 바이러스에 감염되는 경우 일 내지 12일의 잠복기를 거친 후 약 40도 가까운 고열이 나면서 심한 근육통과 두통, 관절통이 나타납니다. 그러면서 팔, 다리, 목 주변에 땀띠와 유사한 발진이 일어나고 피로, 오심, 구토 등의 증상을 보인다. 뎅기와 임상증상이 유사하여 감별이 어렵다. 현재 적절한 치료제나 백신이 없어 예방할 수 없는 상황이다.In addition, when infected with the chikunkunia virus, after an incubation period of 1 to 12 days, a high fever of about 40 degrees occurs, and severe muscle pain, headache, and joint pain appear. At the same time, a rash similar to a heat rash occurs around the arms, legs, and neck, and symptoms such as fatigue, nausea, and vomiting occur. It is difficult to discriminate because the clinical symptoms are similar to dengue. Currently, the situation cannot be prevented because there is no adequate treatment or vaccine.
일본특허공개 제2012-504955호에는 뎅기 바이러스의 표면항원에 결합할 수 있는 재조합 항체를 포함하는 뎅기 바이러스 진단용 키트가 개시되어 있으며, 한국등록특허 제10-169236호에는 지카바이러스 진단을 위한 프라이머 세트, 이를 포함하는 지카바이러스 진단용 키트, 및 이를 이용한 지카바이러스 진단방법이 개시되어 있다.Japanese Patent Publication No. 2012-504955 discloses a kit for diagnosing dengue virus comprising a recombinant antibody capable of binding to a surface antigen of dengue virus, and Korean Patent No. 10-169236 discloses a primer set for diagnosing Zika virus, A kit for diagnosing Zika virus including the same, and a method for diagnosing Zika virus using the same are disclosed.
그러나, 상기 뎅기, 지카 또는 치쿤쿠니아 바이러스는 동종의 모기에 의해 같은 지역에서 유행하며, 감염증상이 유사하기 때문에 정확하게 구별하기 어렵다. 또한, 서열의 유사성으로 인하여 이들 바이러스들의 감염을 정확하게 구별하여 진단하는 것은 쉽지 않다. 현재 대부분의 항체진단키트는 재조합단백질을 사용하여 감염 후 생성된 항체를 진단하지만 이 경우 유사한 바이러스간의 교차반응이 나타나는 문제점이 있다. However, the dengue, Zika, or chikunkunia virus is prevalent in the same area by the same type of mosquito, and because the infection symptoms are similar, it is difficult to accurately distinguish. In addition, it is difficult to accurately distinguish and diagnose infections of these viruses due to the similarity of the sequence. Currently, most antibody diagnostic kits use recombinant proteins to diagnose antibodies generated after infection, but in this case, there is a problem that cross-reactions between similar viruses appear.
이러한 배경하에, 본 발명자들은 모기 매개 바이러스 진단시 교차반응이 나타나지 않는 방법을 개발하고자 예의 노력한 결과, 서열분석을 통하여 뎅기, 지카 또는 치쿤쿠니아 각각의 바이러스에서 에피토프의 친수성 부분에 결합하는 특이적인 서열에 대한 펩타이드 선정하여 항체진단용 키트에 적용시 높은 민감도로 교차반응 없이 상기 바이러스를 진단할 수 있음을 확인하고, 본 발명을 완성하였다. Under this background, the present inventors have made diligent efforts to develop a method that does not show cross-reaction when diagnosing a mosquito-mediated virus, and as a result of sequencing, specific sequences that bind to the hydrophilic portion of the epitope in each virus of Dengue, Zika or Chikunkunia When a peptide for was selected and applied to an antibody diagnosis kit, it was confirmed that the virus can be diagnosed without cross-reaction with high sensitivity, and the present invention was completed.
본 발명의 주된 목적은 모기 매개 바이러스 진단시 모기 매개 바이러스 간 교차반응이 나타나지 않는 것을 특징으로 하는, 모기 매개 바이러스 특이적인 진단을 위한 단리된 펩타이드를 제공하는 것이다.The main object of the present invention is to provide an isolated peptide for mosquito-mediated virus-specific diagnosis, which is characterized in that no cross-reaction between mosquito-mediated viruses occurs when diagnosing a mosquito-borne virus.
본 발명의 다른 목적은 상기 단리된 펩타이드가 포함된, 모기 매개 바이러스 특이적인 진단을 위한 신속진단키트를 제공하는 것이다. Another object of the present invention is to provide a rapid diagnostic kit for specific diagnosis of a mosquito-mediated virus containing the isolated peptide.
본 발명에서 개시된 각각의 설명 및 실시형태는 각각의 다른 설명 및 실시 형태에도 적용될 수 있다. 즉, 본 발명에서 개시된 다양한 요소들의 모든 조합이 본 발명의 범주에 속한다. 또한, 하기 기술된 구체적인 서술에 의하여 본 발명의 범주가 제한된다고 볼 수 없다.Each description and embodiment disclosed in the present invention can be applied to each other description and embodiment. That is, all combinations of various elements disclosed in the present invention belong to the scope of the present invention. In addition, it cannot be seen that the scope of the present invention is limited by the specific description described below.
상기 목적을 달성하기 위한, 본 발명의 하나의 양태는 모기 매개 바이러스 진단시 모기 매개 바이러스 간 교차반응이 나타나지 않는 것을 특징으로 하는, 모기 매개 바이러스 특이적인 진단을 위한 단리된 펩타이드를 제공한다.In order to achieve the above object, one aspect of the present invention provides an isolated peptide for specific diagnosis of a mosquito-mediated virus, characterized in that no cross-reaction between mosquito-mediated viruses occurs when diagnosing a mosquito-mediated virus.
본 발명자들은 보다 높은 민감도를 갖고 모기 매개 바이러스의 항체를 진단하는 방법을 개발하고자 다양한 연구를 수행하던 중, 뎅기, 지카 또는 치쿤쿠니아 바이러스는 서열의 유사성으로 인하여 이들 바이러스들의 감염을 정확하게 구별하여 진단하는 것은 쉽지 않음을 확인하였고, 진단시 교차반응이 일어나는 문제점을 해결하는 것이 중요함을 인식하였다. While the inventors of the present invention are conducting various studies to develop a method for diagnosing antibodies of mosquito-borne viruses with higher sensitivity, dengue, Zika, or chikunkunia viruses are diagnosed by accurately distinguishing infections of these viruses due to their sequence similarity. It was confirmed that it was not easy to do, and it was recognized that it is important to solve the problem of cross-reaction during diagnosis.
본 발명의 용어 "모기 매개 바이러스(Mosquito-borne viruses)"는 모기를 매개로 하여 전파되어 사람에게 병증을 일으키는 바이러스를 의미한다. 그 종류에는 플라비바이러스과(Flaviviridae)의 일본뇌염바이러스(Japanese encephalitis virus), 뎅기바이러스(Dengue virus), 웨스트나일바이러스(West Nile virus), 황열바이러스(Yellow fever virus)와 토가바이러스과(Togaviridae)의 치쿤구니아바이러스(Chikungunya virus) 등이 있다. 구체적으로 뎅기, 지카 또는 치쿤쿠니아 바이러스는 모기 매개 바이러스로서, 서열의 유사성으로 진단시 구별에 어려움이 있다. 따라서, 본 발명의 목적상 모기 매개 바이러스 진단시 교차반응이 나타나지 않는 펩타이드를 선정하고자 노력하였다. The term "mosquito-borne viruses" of the present invention refers to viruses that are transmitted through mosquitoes and cause disease in humans. The types include Japanese encephalitis virus of Flaviviridae, Dengue virus, West Nile virus, Yellow fever virus and Togaviridae. Chikungunya virus and the like. Specifically, dengue, zika, or chikunkunia virus is a mosquito-borne virus, and it is difficult to distinguish when diagnosed due to similarity in sequence. Therefore, for the purposes of the present invention, efforts were made to select a peptide that does not exhibit cross-reaction when diagnosing a mosquito-borne virus.
상기 모기 매개 바이러스에 속하는 바이러스의 일 예로서, 상기 "플라비바이러스과(Flaviviridae)"는 바이러스의 한 과로서, 인간을 비롯한 포유류 등을 자연숙주로 삼으며, 진드기와 모기 등의 곤충을 매개로 하여 전파되는 특징을 갖는다. 플라비바이러스과에 속하는 바이러스가 일으키는 질병으로는 간염, 출혈 증후군, 유산, 점막병, 출혈열, 뇌염 등이 있으며, 플라비바이러스과에 속하는 바이러스 종은 현재 100종 이상인 것으로 알려져 있으며, 구체적으로는 뎅기바이러스, 지카바이러스 등이 있으며, 이에 제한되지 않는다. As an example of a virus belonging to the mosquito-borne virus, the "Flaviviridae" is a family of viruses, and uses mammals, including humans, as a natural host, and is mediated by insects such as ticks and mosquitoes. It has a propagating feature. Diseases caused by viruses belonging to the flavivirus family include hepatitis, hemorrhagic syndrome, abortion, mucosal disease, hemorrhagic fever, and encephalitis. Zika virus and the like, but are not limited thereto.
본 발명의 용어 "교차반응"은 항체가 다른 항원물질에서 동일한 항원결정기(eptope)가 있으면 그것에 대응할 수 있는 것을 의미하며, 상기 용어는 교차면역 또는 교차방어면역과 혼용되어 사용될 수 있다. 하나의 항원물질에서도 복수인 다수의 항원결정기(epitope)가 존재하는 경우가 대부분이며, 이는 다중 면역반응을 자극한다.The term "cross-reaction" of the present invention means that an antibody can respond to the same epitope in different antigenic substances, and the term may be used interchangeably with cross-immune or cross-protective immunity. In most cases, multiple epitopes exist in one antigenic substance, which stimulates multiple immune responses.
진단 테스트를 포함한 의료 테스트에서 교차 반응은 혼동을 유발하거나 도움이 되는 경우가 있다. 예를 들어, 관심 항원이 아닌 다른 항원과 반응이 일어날 때 양성 반응의 오류를 산출하는 교란을 일으키기도 하며, 다른 항원을 위한 항체를 사용하여 다른 바이러스를 탐지하는데 도움을 주기도 한다. In medical tests, including diagnostic tests, cross-reaction is often confused or helpful. For example, when a reaction occurs with an antigen other than the antigen of interest, it may cause disturbances that yield an error in a positive response, and antibodies for other antigens may be used to help detect other viruses.
본 발명의 목적상 모기 매개 바이러스의 진단시 교차반응은 관심 항원이 아닌 다른 항원과의 반응에 의해 뎅기, 지카 또는 치쿤쿠니아 바이러스 중 어떠한 바이러스에 감염되었는지 확인할 수 없게 되는 것을 의미한다. 즉, 뎅기, 지카 또는 치쿤쿠니아 바이러스는 모기 매개 바이러스에 속하는 것으로 그 서열이 유사하여 진단시 교차반응이 일어날 수 있으며, 양성반응의 오류를 일으킬 수 있다. 따라서, 본 발명자들은 진단시 교차반응을 일으키지 않고 뎅기, 지카 또는 치쿤쿠니아 바이러스에 특이적인 펩타이드를 최초로 규명하였다. For the purposes of the present invention, cross-reaction when diagnosing a mosquito-borne virus means that it is impossible to determine whether a virus has been infected among dengue, zika, or chikunkunia viruses by reaction with an antigen other than the antigen of interest. That is, dengue, zika, or chikunkunia viruses belong to mosquito-borne viruses, and their sequence is similar, so that cross-reaction may occur during diagnosis and may cause an error in positive reaction. Therefore, the present inventors first identified a peptide specific for dengue, zika, or chikunkunia viruses without causing a cross-reaction at the time of diagnosis.
또한, 본 발명의 목적상 뎅기 바이러스 진단시에는 지카 또는 치쿤쿠니아 바아러스와 교차반응이 나타나지 않고, 지카 바이러스 진단시에는 뎅기 또는 치쿤쿠니아 바아러스와 교차반응이 나타나지 않고, 치쿤쿠니아 바이러스 진단시에는 지카 또는 뎅기 바아러스와 교차반응이 나타나지 않는 것을 의미할 수 있다. In addition, for the purposes of the present invention, when diagnosing dengue virus, no cross-reaction with Zika or Chikunkunia virus does not appear, and when diagnosing Zika virus, no cross-reaction with dengue or Chikunkunia virus does not appear, and chikunkunia virus diagnosis Poetry may mean that there is no cross-reaction with Zika or Dengue bacteria.
상기 단리된 펩타이드는 에피토프(epitope)의 친수성 부분 중 모기 매개 바이러스에만 특이적인 서열을 가지는 것을 특징으로 한다. The isolated peptide is characterized by having a sequence specific to a mosquito-mediated virus among the hydrophilic portions of the epitope.
본 발명의 용어 "에피토프(epitope)"란 항원 분자에 존재하는 항원 특이성을 결정하는 부위를 의미하며, 항원결정기 또는 항원결정부위와 혼용되어 사용될 수 있다. 본 발명의 목적상 상기 에피토프는 수용성의 항체와 직접 결합하기 때문에 친수성 잔기가 차지하는 비율이 높은 부분에 존재할 가능성이 높으므로, 모기 매개 바이러스에서 항원결정부위의 친수성(hydrophilicity)을 분석하여 뎅기, 지카 또는 치쿤쿠니아 바이러스에만 특이적인 항원결정부위를 예측하였다. 구체적으로, 상기 바이러스의 에피토프 중에서 각각의 바이러스에만 특이적인 서열부분을 서열분석을 통하여 펩타이드로 선정하였으며, 뎅기, 지카 또는 치쿤쿠니아 바이러스들의 진단시 교차반응이 일어나지 않는 한, 이에 제한되지 않는다. The term "epitope" of the present invention refers to a site that determines antigen specificity present in an antigen molecule, and may be used interchangeably with an epitope or an epitope. For the purposes of the present invention, since the epitope directly binds to a water-soluble antibody, it is highly likely to be present in a portion with a high proportion of hydrophilic residues, so by analyzing the hydrophilicity of the epitope in the mosquito-mediated virus, dengue, zika or An epitope specific to chikunkunia virus was predicted. Specifically, a sequence portion specific to each virus among the epitopes of the virus was selected as a peptide through sequencing analysis, and as long as no cross-reaction occurs during diagnosis of Dengue, Zika, or Chikunkunia viruses, it is not limited thereto.
본 발명의 구체적인 일 실시예에서는, 다중서열분석을 통하여 뎅기, 지카 또는 치쿤쿠니아에 특이적인 서열을 확인하고, 에피토프의 친수성 부분을 분석하여 각 바이러스에만 특이적인 항원결정부위를 예측하였다(도 1). In a specific embodiment of the present invention, a sequence specific to dengue, zika, or chikunkunia was confirmed through multiple sequencing, and the epitope was analyzed to predict an antigenic determinant site specific to each virus (Fig. 1). ).
본 발명의 목적상 상기 단리된 펩타이드는 뎅기 바이러스에 특이적인 경우 서열번호 1 또는 서열번호 2를 포함하는 펩타이드일 수 있으며, 보다 구체적으로는 서열번호 2의 펩타이드 일 수 있으나, 지카 또는 치쿤쿠니아 바이러스와 같은 모기 매개 바이러스에서 진단시 교차반응을 일으키지 않는 뎅기 바이러스 특이적인 펩타이드라면 이에 제한되지 않는다. For the purposes of the present invention, the isolated peptide may be a peptide containing SEQ ID NO: 1 or SEQ ID NO: 2 when specific for dengue virus, and more specifically, may be a peptide of SEQ ID NO: 2, but Zika or Chikunkunia virus It is not limited thereto as long as it is a dengue virus-specific peptide that does not cause a cross-reaction upon diagnosis in a mosquito-borne virus such as.
또한, 지카 바이러스에 특이적인 경우 서열번호 3, 서열번호 4, 또는 서열번호 5를 포함하는 펩타이드 일 수 있으며, 구체적으로는 서열번호 3, 서열번호 4 및/또는 서열번호 5로 구성되는 펩타이드, 서열번호 4 또는 서열번호 5로 구성되는 펩타이드 일 수 있다. 더욱 구체적으로, 서열번호 3, 서열번호 4 및 서열번호 5로 구성되는 펩타이드 일 수 있으나, 뎅기 또는 치쿤쿠니아 바이러스와 같은 모기 매개 바이러스에서 진단시 교차반응을 일으키지 않는 지카 바이러스 특이적인 펩타이드라면 이에 제한되지 않는다. In addition, when specific for Zika virus, it may be a peptide comprising SEQ ID NO: 3, SEQ ID NO: 4, or SEQ ID NO: 5, specifically, a peptide consisting of SEQ ID NO: 3, SEQ ID NO: 4 and/or SEQ ID NO: 5, sequence It may be a peptide consisting of No. 4 or SEQ ID No. 5. More specifically, it may be a peptide consisting of SEQ ID NO: 3, SEQ ID NO: 4, and SEQ ID NO: 5, but if it is a Zika virus-specific peptide that does not cause a cross-reaction during diagnosis in a mosquito-borne virus such as dengue or chikunkunia virus, it is limited thereto. It doesn't work.
또한, 치쿤쿠니아 바이러스에 특이적인 경우 서열번호 6 내지 서열번호 11 중 하나를 포함하는 펩타이드일 수 있으며, 보다 구체적으로는 서열번호 9의 펩타이드일 수 있으나, 지카 또는 뎅기 바이러스와 같은 모기 매개 바이러스에서 진단시 교차반응을 일으키지 않는 지카 바이러스 특이적인 펩타이드라면 이에 제한되지 않는다. In addition, if specific for chikunkunia virus, it may be a peptide comprising one of SEQ ID NO: 6 to SEQ ID NO: 11, and more specifically, it may be a peptide of SEQ ID NO: 9, but in a mosquito-mediated virus such as Zika or Dengue virus. It is not limited thereto as long as it is a Zika virus-specific peptide that does not cause a cross-reaction during diagnosis.
본 발명의 구체적인 일 실시예에서는, 실시예 1-1에서 선정된 뎅기 특이서열 2개 (DenV-P1, DenV-P2), 지카 특이서열 3개 (ZIKA-P1, ZIKA-P2, IKA-P3) 치쿤구니아 특이서열 6개(CKIK-P1, CKIK-P2, CKIK-P3, CKIK-P4, CKIK-P5, CKIK-P6) 펩타이드를 정상 검체 10개와 감염 검체 10개의 혈청을 이용하여 ELISA로 분석하였다. 그 결과, 뎅기는 2번 (DenV-P2) 펩타이드를 사용하였을 때, 지카는 1번(ZIKA-P1), 2번(ZIKA-P2)과 3번(ZIKA-P3) 펩타이드를 함께 사용하였을 때, 치쿤구니아는 4번(CKIK-P4) 펩타이드를 사용하였을 때 효과적으로 감염진단이 가능한 것을 확인할 수 있었다(도 2).In a specific embodiment of the present invention, two dengue specific sequences selected in Example 1-1 (DenV-P1, DenV-P2), three Zika specific sequences (ZIKA-P1, ZIKA-P2, IKA-P3) Six chikungunia specific sequences (CKIK-P1, CKIK-P2, CKIK-P3, CKIK-P4, CKIK-P5, CKIK-P6) peptides were analyzed by ELISA using serum from 10 normal and infected samples. . As a result, when Dengue 2 (DenV-P2) peptide was used, Zika when 1 (ZIKA-P1), 2 (ZIKA-P2) and 3 (ZIKA-P3) peptide were used together, Chikungunia was confirmed to be able to effectively diagnose infection when using the No. 4 (CKIK-P4) peptide (Fig. 2).
상기 결과로부터 다중서열분석을 통해 선정된 뎅기, 지카 또는 치쿤쿠니아 바이러스에 특이적인 펩타이드라도 하더라도, 감염진단에 모두 효과적으로 사용할 수 있는 것은 아니며, 일부 특이적인 서열만 감염진단에 효과적으로 사용될 수 있음을 알 수 있다. From the above results, it was found that even if a peptide specific for dengue, Zika, or chikunkunia virus selected through multi-sequencing analysis, not all can be effectively used for infection diagnosis, only some specific sequences can be effectively used for infection diagnosis. I can.
본 발명의 다른 하나의 양태로서, 상기 단리된 펩타이드를 포함하는, 모기 매개 바이러스 특이적인 진단을 위한 신속진단키트를 제공한다. In another aspect of the present invention, there is provided a rapid diagnostic kit for specific diagnosis of a mosquito-mediated virus, comprising the isolated peptide.
구체적인 실시 양태로서, 상기 신속진단키트는 완충용액을 포함하는 버퍼패드; 축합패드; 검체 패드; 검사선 및 대조선이 고정화된 멤브레인; 및 흡수패드를 포함할 수 있다. As a specific embodiment, the rapid diagnosis kit includes a buffer pad containing a buffer solution; Condensation pad; Specimen pad; A membrane on which the inspection line and the control line are immobilized; And an absorbent pad.
일 예로, 상기 신속진단키트는 (ⅰ) 항-사람 IgG-단클론 항체 또는 항-사람 IgM-단클론 항체가 고정화된 멤브레인; (ⅱ) 단리된 펩타이드가 결합된 금 축합체를 포함하는 축합 패드; (ⅲ) 검체 패드; (ⅳ) 완충용액을 포함하는 버퍼 패드; 및 (ⅴ) 흡수 패드를 포함할 수 있다. 상기와 같은 신속진단키트는 뎅기바이러스를 진단하기 위한 것일 수 있다. For example, the rapid diagnostic kit includes (i) an anti-human IgG-monoclonal antibody or a membrane immobilized with an anti-human IgM-monoclonal antibody; (Ii) a condensation pad comprising a gold condensate to which the isolated peptide is bound; (Iii) specimen pad; (Iv) a buffer pad containing a buffer solution; And (v) an absorbent pad. The rapid diagnosis kit as described above may be for diagnosing dengue virus.
다음으로, 상기 멤브레인은 항-사람 IgG 또는 항-사람 IgM 단클론 항체가 고정화되어 있는 것일 수 있다. 상기 항-사람 IgG 단클론 항체 및 항-사람 IgM 단클론 항체는 키트를 이용한 진단 시에, 검체 내에 포함되어 있을 수 있는 항-바이러스 항체를 항원으로 하여 결합하는 역할을 할 수 있으며, 바이러스의 종류에 따라 항-사람 IgG 단클론 항체(검사선 1) 또는 항-사람 IgM 단클론 항체(검사선 2) 중 하나가 포함될 수 있고, 또는 항-사람 IgG 단클론 항체 및 항-사람 IgM 단클론 항체 둘 모두가 포함될 수도 있다.Next, the membrane may have an anti-human IgG or anti-human IgM monoclonal antibody immobilized thereon. The anti-human IgG monoclonal antibody and anti-human IgM monoclonal antibody may play a role of binding by using an anti-viral antibody that may be contained in a specimen as an antigen at the time of diagnosis using a kit, depending on the type of virus. Either anti-human IgG monoclonal antibody (test line 1) or anti-human IgM monoclonal antibody (test line 2) may be included, or both anti-human IgG monoclonal antibody and anti-human IgM monoclonal antibody may be included. .
구체적으로, 지카 또는 치쿤쿠니아 바이러스의 경우에는 상기 멤브레인에 하나의 항체가 고정화되어 있는 것일 수 있으며, 더욱 구체적으로 항-사람 IgM 단클론 항체가 고정화되어 있는 것일 수 있다. 또한, 뎅기 바이러스의 경우에는 상기 멤브레인에 두 개의 항체가 고정화되어 있는 것일 수 있으며, 더욱 구체적으로, 항-사람 IgG 단클론 항체 및 항-사람 IgM 단클론 항체 둘 모두 고정화 되어 있는 것일 수 있으나, 지카, 치쿤쿠니아 또는 뎅기 바이러스를 더욱더 민감하게 진단할 수 있는 것이라면 이에 제한되지 않는다. Specifically, in the case of Zika or Chikunkunia virus, one antibody may be immobilized on the membrane, and more specifically, an anti-human IgM monoclonal antibody may be immobilized. In addition, in the case of dengue virus, two antibodies may be immobilized on the membrane, and more specifically, both anti-human IgG monoclonal antibody and anti-human IgM monoclonal antibody may be immobilized, but Zika, Chikun It is not limited thereto as long as it can more sensitively diagnose the Kunia or Dengue virus.
일 예로, 상기 각 단클론 항체는 환자의 시료에 뎅기 바이러스에 대한 항체가 존재하는 경우 상기 항체가 IgM 형태인지 아니면 IgG 형태인지를 확인할 수 있어, 뎅기 바이러스에 대한 IgM 형태의 항체인지 아니면 IgG 형태의 항체인지를 확인하는데 사용할 수 있고, 상기 각 단클론 항체를 멤브레인에 고정시킴으로써, 환자의 시료에 뎅기 바이러스에 대한 항체가 존재하는지의 여부를 보다 효과적으로 확인할 수 있다. 상기 진단키트에 포함되는 항-사람 IgG-단클론 항체(검사선 1) 또는 항-사람 IgM-단클론 항체(검사선 2)의 함량은 특별히 이에 제한되지 않으나, 바람직하게는 0.1 내지 5.0 mg/ml의 농도로 상기 멤브레인에 분주하여 고정화시킬 수 있다.As an example, each of the monoclonal antibodies can be used to determine whether the antibody is in the form of IgM or in the form of IgG when an antibody against the dengue virus is present in the patient's sample, so whether it is an antibody in the form of IgM against the dengue virus or an antibody in the form of IgG It can be used to confirm recognition, and by immobilizing each of the monoclonal antibodies to the membrane, it is possible to more effectively confirm whether an antibody against dengue virus is present in a sample of a patient. The content of the anti-human IgG-monoclonal antibody (test line 1) or anti-human IgM-monoclonal antibody (test line 2) included in the diagnostic kit is not particularly limited thereto, but preferably 0.1 to 5.0 mg/ml It can be immobilized by dispensing on the membrane at a concentration.
아울러, 상기 멤브레인은 상기 각 단클론 항체를 결합시키기 위하여 사용되는데, 상기 멤브레인은 특별히 이에 제한되지 않으나, 바람직하게는 항체가 결합될 수 있는 니트로셀룰로오스 멤브레인, PVDF(polyvinylidene fluoride) 멤브레인 등이 될 수 있다.In addition, the membrane is used to bind each of the monoclonal antibodies, and the membrane is not particularly limited thereto, but preferably may be a nitrocellulose membrane to which the antibody can be bound, a polyvinylidene fluoride (PVDF) membrane, or the like.
다음으로, 상기 키트에 포함된 축합 패드는 뎅기, 지카 또는 치쿤쿠니아 바이러스에 특이적인 단리된 펩타이드가 금입자와 결합된 형태의 금 축합체를 포함하도록 구성될 수 있다. Next, the condensation pad included in the kit may be configured to include a gold condensate in a form in which an isolated peptide specific for dengue, zika, or chikunkunia virus is bound to gold particles.
또한, 상기 본 발명의 단리된 펩타이드는, 본 발명의 신속진단키트의 구성 중에서, 축합 패드에 포함될 수 있다. 즉, 상기 축합 패드는 본 발명의 단리된 펩타이드가 고정화되어 있는 것일 수 있다. 또한, 상기 단리된 펩타이드는 금 축합체와 축합된 형태로 축합 패드에 포함되어 있는 것일 수 있다. In addition, the isolated peptide of the present invention may be included in the condensation pad among the constitution of the rapid diagnosis kit of the present invention. That is, the condensation pad may have the isolated peptide of the present invention immobilized thereon. In addition, the isolated peptide may be included in the condensation pad in a condensed form with a gold condensate.
상기 뎅기, 지카 또는 치쿤쿠니아 바이러스에 특이적인 단리된 펩타이드에 결합된 금입자는 상기 뎅기, 지카 또는 치쿤쿠니아 바이러스에 특이적인 단리된 펩타이드의 위치를 표시하는 표지물질로서 사용되며, 본 발명의 키트에서는 최종적으로 시료에 포함된 항체의 존재여부를 확인하기 위한 수단으로서 사용된다. 본 발명에 따른 단리된 펩타이드는 뎅기 바이러스에 특이적인 펩타이드라면 이에 제한되지 않으나, 구체적으로는 서열번호 2의 펩타이드 일 수 있다. 또한, 상기 단리된 펩타이드는 지카 또는 치쿤쿠니아 바이러스에 특이적인 펩타이드라면 이에 제한되지 않으나, 구체적으로는 지카 바이러스 특이적인 펩타이드는 서열번호 4, 5일 수 있으며, 보다 구체적으로는 서열번호 3, 4, 5가 동시에 결합하여 반응하는 것 일 수 있다. 또한, 치쿤쿠니아 바이러스 특이적인 펩타이드는 서열번호 9일 수 있으나, 이에 제한되지 않는다. The gold particles bound to the isolated peptide specific for the dengue, Zika or chikunkunia virus are used as a labeling material for indicating the position of the isolated peptide specific for the dengue, Zika or chikunkunia virus. In the kit, it is finally used as a means to confirm the presence or absence of the antibody contained in the sample. The isolated peptide according to the present invention is not limited thereto as long as it is a peptide specific to the dengue virus, but specifically may be a peptide of SEQ ID NO: 2. In addition, the isolated peptide is not limited thereto as long as it is a Zika or chikunkunia virus-specific peptide, but specifically, the Zika virus-specific peptide may be SEQ ID NOs: 4 and 5, and more specifically, SEQ ID NOs: 3 and 4 And 5 may be reacted by bonding at the same time. In addition, the chikunkunia virus-specific peptide may be SEQ ID NO: 9, but is not limited thereto.
다음으로, 본 발명에 따른 검체 패드는 다공성 재질로 구성되고, 상기 멤브레인과 항원패드의 사이에 위치하도록 구성될 수 있다. 상기 검체 패드는 뎅기 바이러스의 감염이 의심되는 개체로부터 얻어진 시료(혈액, 전혈, 혈장, 혈청 등)가 본 발명의 키트에 직접적으로 투입되는 투입구의 역할을 수행할 뿐만 아니라 다공성 재질로 인하여, 상기 시료에 포함된 혈구들은 상기 검체패드를 통해 여과되고, 상기 시료에 포함된 액상성분만을 상기 멤브레인으로 전달하는 역할을 수행할 수 있다. 이때, 상기 다공성 재질은 특별히 이에 제한되지 않으나, 혈구를 통과시키지 않을 정도의 공극을 포함하는 다공성 알루미나, 다공성 실리케이트, 다공성 합성수지 등이 될 수 있다. 또한, 상기 검체 패드는 혈구를 분리하는 역할을 수행하기 때문에 다공성 재질 이외에도 혈구를 흡착시킬 수 있는 재질로 구성될 수도 있는데, 이러한 혈구를 흡착시킬 수 있는 재질은 특별히 이에 제한되지 않으나, 니트로셀룰로오스 멤브레인, PVDF(polyvinylidene fluoride) 멤브레인 등이 될 수 있다.Next, the specimen pad according to the present invention may be made of a porous material, and may be configured to be positioned between the membrane and the antigen pad. The sample pad not only serves as an inlet through which samples (blood, whole blood, plasma, serum, etc.) obtained from individuals suspected of being infected with dengue virus are injected directly into the kit of the present invention, but also because of the porous material, the sample The blood cells included in the sample may be filtered through the sample pad, and may serve to transfer only liquid components included in the sample to the membrane. In this case, the porous material is not particularly limited thereto, but may be a porous alumina, porous silicate, porous synthetic resin, or the like including pores that do not allow blood cells to pass therethrough. In addition, since the sample pad serves to separate blood cells, it may be made of a material capable of adsorbing blood cells in addition to a porous material. The material capable of adsorbing such blood cells is not particularly limited thereto, but a nitrocellulose membrane, It may be a PVDF (polyvinylidene fluoride) membrane or the like.
다음으로, 본 발명에 따른 버퍼 패드는 본 발명의 키트를 사용할 때, 상기 키트내에서 시료의 전달을 보조하고, 항원-항체 반응을 보조하기 위한 완충용액이 포함된 검체전개액을 포함할 수 있는 다공성 재질로 구성되며, 상기 축합패드와 연결되어 키트의 말단에 위치하도록 구성될 수 있다. 상기 다공성 재질은 상기 검체패드에서 정의한 바와 동일하다.Next, when using the kit of the present invention, the buffer pad according to the present invention may include a sample development solution containing a buffer solution for assisting the delivery of a sample in the kit and assisting the antigen-antibody reaction. It is made of a porous material, and may be configured to be connected to the condensation pad to be located at the end of the kit. The porous material is the same as defined in the sample pad.
상기 검체전개액은 상기 버퍼 패드에 포함된 상태로 존재할 수도 있고, 본 발명의 키트에 시료를 가한 후에 검체전개액을 버퍼 패드에 가할 수도 있는데, 바람직하게는 본 발명의 키트에 시료를 가한 후에 검체전개액을 버퍼 패드에 가할 수 있다. 상기 검체전개액에 포함된 완충용액은 시료전달 및 항원-항체반응을 보조하는 효과를 나타내는 한 특별히 이에 제한되지 않으나, 붕산염 완충용액, 트리스 완충용액, 인산염 완충용액 등이 사용될 수 있다. 또한, 상기 검체전개액은 비특이반응(non-specific reaction)을 억제할 수 있는 Triton X-100, Tween 20, 카제인 등을 포함할 수 있고, 보존제로서 아지드화나트륨 등을 포함할 수 있다.The sample development solution may be present in the state contained in the buffer pad, or the sample development solution may be added to the buffer pad after adding the sample to the kit of the present invention, preferably after adding the sample to the kit of the present invention. The developing solution can be added to the buffer pad. The buffer solution included in the sample development solution is not particularly limited as long as it shows an effect of supporting sample delivery and antigen-antibody reaction, but a borate buffer solution, a Tris buffer solution, a phosphate buffer solution, and the like may be used. In addition, the sample development solution may contain Triton X-100,
끝으로, 본 발명에 따른 흡수 패드는 과량의 검체 또는 완충액을 흡수할 수 있는 재질로 구성되고, 상기 검체 패드의 반대편 방향에서 멤브레인과 연결되며, 버퍼 패드의 반대편 방향의 키트 말단에 위치하도록 구성된다. 상기 흡수패드는 과량의 검체 또는 검체전개액을 흡수하여 제거함으로써, 본 발명에서 제공하는 키트의 검사결과를 교란시키지 않도록 하는 역할을 수행하는데, 상기 흡수 패드의 재질은 특별히 이에 제한되지 않으나, 바람직하게는 면, 액체 흡수성 겔 등을 사용할 수 있다.Finally, the absorbent pad according to the present invention is made of a material capable of absorbing an excess sample or buffer, is connected to the membrane in the direction opposite to the sample pad, and is configured to be located at the end of the kit in the direction opposite to the buffer pad. . The absorbent pad absorbs and removes an excess sample or sample development solution, thereby preventing disturbance of the test result of the kit provided in the present invention, and the material of the absorbent pad is not particularly limited thereto, but preferably Cotton, liquid absorbent gel, or the like can be used.
한편, 본 발명의 진단 키트에 사용하기 위한 검정 시스템은 이에 한정되는 것은 아니나, ELISA 플레이트, 딥-스틱디바이스, 면역크로마토그래피법 및 방사 분할 면역검정 디바이스 및 플로우-쓰로우(flow-through) 디바이스 등을 포함한다. 바람직하게는 면역크로마토그래피법을 이용한 스트립 형태 또는 디바이스 형태의 진단 키트를 이용할 수 있다. 면역크로마토그래피법(immunochromatographic assay: ICA)을 이용한 진단은 그 신속함과 간편함 때문에 래피드 테스트(rapid test)라고도 불리는데, 이는 뎅기 바이러스의 표피단백질 도메인1에 대한 단클론항체가 콜로이드성 금 입자에 축합되어 있고, 이 축합체가 이동하면서 항원 패드에 있는 뎅기 바이러스와 결합을 하게 된다. 이 복합체가 검체(혈액)에 존재하는 뎅기 항체와 반응을 하면서 모세관 현상에 의해 니트로셀룰로오스(nitrocellulose) 멤브레인의 미세구멍(micropore)을 통하여 이동한다. 그 도중에 멤브레인의 미세구멍의 내부 표면에 고정되어 있는 항 사람 IgG 또는 항-사람 IgM-단클론 항체와 결합하여 발색 띠(band)를 형성하게 된다. 이 띠(band)의 발색 정도를 확인함으로서 항체의 존재 여부, 항체의 종류 및 항체의 양을 육안으로 판별할 수 있다.On the other hand, the assay system for use in the diagnostic kit of the present invention is not limited thereto, but an ELISA plate, a deep-stick device, an immunochromatography method and a radiation split immunoassay device and a flow-through device, etc. Includes. Preferably, a diagnostic kit in the form of a strip or device using immunochromatography may be used. Diagnosis using immunochromatographic assay (ICA) is called rapid test because of its speed and simplicity, which is a monoclonal antibody against
본 발명의 상기 진단 키트에서, 항원-항체 복합체는 색채입자결합법으로 검출하며, 색채입자로는 예를 들어 콜로이드성 금 입자 또는 칼라 유리 또는 플라스틱(예: 폴리스티렌, 폴리프로필렌, 라텍스 등) 비드(bead)를 포함한다. 본 발명에서는 바람직하게 금 콜로이드를 이용한다.In the diagnostic kit of the present invention, the antigen-antibody complex is detected by a color particle binding method, and the color particles include, for example, colloidal gold particles or colored glass or plastic (eg, polystyrene, polypropylene, latex, etc.) beads ( bead). In the present invention, gold colloid is preferably used.
본 발명의 키트에 포함된 검체 패드에 뎅기, 지카 또는 치쿤쿠니아 바이러스 감염이 의심되는 개체로부터 유래된 혈장, 혈청, 전혈 등의 혈액시료를 가하고, 검체전개액을 버퍼 패드에 가하면, 검체 패드에서 혈구가 분리된 액상성분으로부터 검체내 항 모기 매개 바이러스(뎅기, 지카 또는 치쿤쿠니아) 항체가 결합하고 상기 검체전개액에 의해 축합 패드로부터 분리된 금 축합체가 추가로 결합하여, 금-단리된 펩타이드(축합 패드)-검체내 항 모기 매개 바이러스(뎅기, 지카 또는 치쿤쿠니아) 항체 복합체를 형성한 다음, 상기 복합체에 포함된 시료로부터 유래된 항체가 검사선 1 또는 2와 결합하고, 결합된 부위에서 금 입자로 인하여 발색반응이 나타난다. When a blood sample such as plasma, serum, whole blood, etc. derived from an individual suspected of having dengue, Zika, or chikunkunia virus infection is added to the sample pad included in the kit of the present invention, and the sample development solution is added to the buffer pad, the sample pad Anti-mosquito-mediated virus (dengue, zika, or chikunkunia) antibody in the sample is bound from the liquid component from which blood cells are separated, and the gold condensate separated from the condensation pad by the sample development solution is further bound, and gold-isolated peptide (Condensation pad)-An anti-mosquito-mediated virus (dengue, Zika, or chikunkunia) antibody complex is formed in the specimen, and then the antibody derived from the sample contained in the complex binds to test
만일, 상기 시료에 뎅기 바이러스에 대한 항체가 존재하지 않으면, 검사선 1 및 2의 어디에서도 금입자로 인한 발색반응이 나타나지 않고; 상기 시료에 뎅기 바이러스에 대한 IgG 유형의 항체가 존재하면, 검사선 1에서 금입자로 인한 발색반응이 나타나며; 상기 시료에 뎅기 바이러스에 대한 IgM 유형의 항체가 존재하면, 검사선 2에서 금입자로 인한 발색반응이 나타나게 된다.If there is no antibody against dengue virus in the sample, a color reaction due to gold particles does not appear anywhere in
또한, 상기 시료에 지카 또는 치쿤쿠니아에 대한 항체가 존재하지 않으면, 검사선 어디에도 금입자로 인한 발색반응이 나타나지 않고; 상기 시료에 지카 또는 치쿤쿠니아 바이러스에 대한 IgM 유형의 항체가 존재하면, 검사선에서 금입자로 인한 발색반응이 나타나게 된다.In addition, if there is no antibody against Zika or Chikunkunia in the sample, a color reaction due to gold particles does not appear anywhere in the test line; When an IgM type antibody against Zika or Chikunkunia virus is present in the sample, a color reaction due to gold particles appears in the test line.
본 발명의 뎅기 바이러스 신속진단키트를 사용하면, 상기 시료에 뎅기 바이러스에 대한 항체가 존재하는지를 확인할 수 있음은 물론, 상기 시료에 뎅기 바이러스에 대한 항체가 존재하면, 상기 항체의 형태가 IgM인지 아니면 IgG인지를 확인할 수 있다. 뎅기의 진단에서는 감염시기를 결정하는 것이 중요하다. 즉, 어떤 종류의 항체(IgG 또는 IgM)가 존재하는지 여부와 함께 양성/음성을 판단하는 것이다. 초기에 채혈한 혈액에서 뎅기에 대한 IgM과 IgG 항체가 양성인 것은, 최근 수주 내에 뎅기 바이러스에 감염이 되었음을 의미한다. IgG는 양성이지만 IgM은 매우 낮거나 음성인 경우, 과거 감염으로 보여준다. 초기에 채혈한 검체와 2-4주 후에 채혈한 검체에서 IgG 항체의 역가가 4배 또는 그 이상 상승한 경우 최근 감염일 가능성이 있다. IgM과 IgG 항체가 음성인 것은 뎅기 감염이 아니며 다른 원인으로 인한 증상일 가능성이 있거나, 또는 항체가 측정하기에는 너무 낮은 경우이다. 따라서 뎅기 감염의 가능성은 아직 남아있으며 이는 바이러스 노출 초기에 측정하여 측정 가능한 수준의 항체를 생성하지 못했기 때문이다.Using the dengue virus rapid diagnostic kit of the present invention, it is possible to check whether an antibody against dengue virus is present in the sample, as well as if an antibody against dengue virus is present in the sample, the form of the antibody is IgM or IgG. You can check whether it is. In the diagnosis of dengue, it is important to determine the timing of infection. In other words, it is to judge the positive/negative as well as whether any kind of antibody (IgG or IgM) is present. The positive IgM and IgG antibodies to dengue in the initially collected blood means that you have been infected with the dengue virus within the last few weeks. If IgG is positive but IgM is very low or negative, it indicates a past infection. If the titer of the IgG antibody in the sample collected at the beginning and the sample collected after 2-4 weeks has risen 4 times or more, it is possible that the infection is recent. Negative IgM and IgG antibodies are not dengue infections and are likely symptoms of other causes, or if the antibodies are too low to measure. Thus, the possibility of dengue infection remains, as it has failed to produce measurable levels of antibodies measured early in viral exposure.
또한, 본 발명의 지카 또는 치쿤쿠니아 바이러스 신속진단키트를 사용하면, 상기 시료에 지카 또는 치쿤쿠니아 바이러스에 대한 항체가 존재하는지를 확인할 수 있다. 지카, 치쿤구니아의 진단은 현증을 진단하는 것이 중요하다. 따라서 지카와 치쿤구니아는 각 바이러스에 대한 IgM 항체 존재 여부를 확인할 수 있다.In addition, by using the Zika or Chikunkunia virus rapid diagnostic kit of the present invention, it can be confirmed whether an antibody against Zika or Chikunkunia virus is present in the sample. It is important to diagnose symptoms of Zika and Chikungunia. Therefore, Zikawa Chikungunia can confirm the presence of IgM antibodies against each virus.
본 발명의 구체적인 일 실시예에서는, 제공된 혈액을 이용하여 본 발명의 키트를 이용한 시험을 수행한 결과, 민감도가 뎅기 IgG 양성 검체에 대해서는 96.7%, 뎅기 IgM 양성 검체에 대해서는 96.5%, 특이도는 뎅기 IgG 양성 검체에 대해서는 100%, 뎅기 IgM 양성 검체에 대해서는 100%임을 확인하였다. 또한, 지카 IgM 양성 검체에 대해서는 민감도가 96.7%, 특이도가 98.7%이며, 치쿤구니아 IgM 양성 검체에 대해서는 민감도가 97.1%, 특이도가 98%인 매우 뛰어난 결과를 확보하였다(표 1).In a specific embodiment of the present invention, as a result of performing a test using the kit of the present invention using the provided blood, the sensitivity was 96.7% for a dengue IgG positive sample, 96.5% for a dengue IgM positive sample, and the specificity was dengue. It was confirmed that it was 100% for the IgG-positive sample and 100% for the dengue IgM-positive sample. In addition, for the Zika IgM-positive sample, the sensitivity was 96.7% and the specificity was 98.7%, and for the Chikungunia IgM-positive sample, the sensitivity was 97.1% and the specificity was 98%.
또한, 타사 제품과의 비교 실험을 수행한 결과, 월등한 민감도를 나타냄을 확인하였다(도 6). In addition, as a result of conducting a comparative experiment with other companies' products, it was confirmed that it exhibited superior sensitivity (FIG. 6).
상기 결과는 본 발명의 단리된 펩타이드가 뎅기, 지카 또는 치쿤쿠니아 바이러스에 특이적인 펩타이드로서 진단시 교차반응없이, 즉, 다른 모기 매개 바이러스를 검출하지 않고 원하는 바이러스만을 특이적으로 높은 민감도로 검출할 수 있음을 시사하는 것이다. The results show that the isolated peptide of the present invention is a peptide specific for dengue, Zika, or chikunkunia virus, without cross-reaction at the time of diagnosis, that is, without detecting other mosquito-mediated viruses, and only the desired virus with specific high sensitivity. It suggests that it can be done.
본 발명의 다른 하나의 양태로서, 상기 신속진단키트를 이용하여 모기 매개 바이러스를 진단하는 방법을 제공한다. As another aspect of the present invention, a method for diagnosing a mosquito-borne virus using the rapid diagnosis kit is provided.
본 발명은 모기 매개 바이러스의 일부 펩타이드 자체를 검체 내의 항체와 결합시켜서 혈액내의 항체를 측정하는 기술로서 기존의 재조합단백질이나 바이러스-유사 입자(VLP, virus-like particle)을 이용하는 것보다 훨씬 더 예민하게 측정할 수 있도록 한다. 또한, 상기 단리된 펩타이드를 사용할 경우, 뎅기, 지카 또는 치쿤쿠니아 바이러스의 감염 진단시 교차반응이 일어나지 않아, 항체 진단키트의 민감도와 정확도를 획기적으로 높이는 데에 특징이 있다.The present invention is a technology for measuring antibodies in blood by binding some peptides of a mosquito-mediated virus with an antibody in a sample. It is much more sensitive than using conventional recombinant proteins or virus-like particles (VLPs). Make it measurable. In addition, when the isolated peptide is used, cross-reaction does not occur when diagnosing infection with dengue, zika, or chikunkunia virus, and thus the sensitivity and accuracy of the antibody diagnostic kit are significantly improved.
도 1은 뎅기 바이러스와 지카 바이러스의 다중서열분석을 통한 특이 서열 선정을 나타내는 것이다
도 2는 뎅기, 지카, 치쿤쿠니아 바이러스 단백질의 서열의 친수성 분석을 통한 펩타이드 서열의 선정을 나타내는 것이다.
도 3은 펩타이드 서열을 이용한 혈청진단 확인 결과를 나타낸 것이다.
도 4는 모기 매개 바이러스 진단용 키트를 도식화한 것이다.
도 5는 뎅기, 지카 또는 치쿤쿠니아의 양성 검체를 이용한 교차반응을 확인한 도이다.
도 6은 타사 제품과의 민감도를 확인한 도이다.Figure 1 shows the selection of a specific sequence through multiple sequencing analysis of dengue virus and Zika virus
Figure 2 shows the selection of a peptide sequence through hydrophilic analysis of the sequence of dengue, Zika, and chikunkunia virus proteins.
3 shows the results of serological diagnosis using a peptide sequence.
4 is a schematic diagram of a kit for diagnosing a mosquito-borne virus.
Figure 5 is a diagram confirming the cross-reaction using a positive sample of dengue, zika or chikunkunia.
6 is a diagram confirming the sensitivity with other companies' products.
이하, 실시예를 통하여 본 발명을 보다 상세히 설명하고자 한다. 이들 실시예는 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 범위가 이들 실시예에 한정되는 것은 아니다.Hereinafter, the present invention will be described in more detail through examples. These examples are for explaining the present invention more specifically, and the scope of the present invention is not limited to these examples.
실시예 1. 뎅기, 지카, 치쿤구니아 바이러스의 서열분석 및 감염 진단용 펩타이드 선정Example 1. Dengue, Zika, Chikungunia Virus Sequence Analysis and Infection Diagnosis Peptide Selection
실시예 1-1. 뎅기, 지카, 치쿤구니아 바이러스의 서열분석Example 1-1. Sequencing of Dengue, Zika and Chikungunia Viruses
미국 국립생물정보센터(www.ncbi.nlm.nih.gov) 로부터 뎅기, 지카 및 치쿤구니아 단백질 서열을 얻었다. 다중서열분석을 통하여 뎅기와 지카에 특이적인 서열을 확인하였다. 구체적으로 항체가 인지하는 항원의 일부분을 항원결정부위(epitope)라 하는데 하나의 항원에는 수많은 항원결정부위가 존재한다. 항원결정부위는 수용성의 항체와 직접 결합하기 때문에 친수성 잔기가 차지하는 비율이 높은 부분에 존재할 가능성이 있으므로, 본 발명자들은 친수성(hydrophilicity) 부분을 분석하여 각 바이러스에만 특이적인 항원결정부위를 예측하였다. Dengue, Zika and Chikungunia protein sequences were obtained from the National Center for Biological Information (www.ncbi.nlm.nih.gov). Dengue and Zika-specific sequences were identified through multiple sequencing analysis. Specifically, a part of the antigen recognized by an antibody is called an epitope, and there are numerous epitopes in one antigen. Since the epitope is directly bound to the water-soluble antibody, there is a possibility that a hydrophilic moiety occupies a high portion. Therefore, the present inventors analyzed the hydrophilicity portion to predict an epitope specific to each virus.
단백질 아미노산의 친수성 부분 중에서 각 바이러스에만 특이적인 서열부분을 펩타이드 항원으로 사용하였으며, 구체적으로, 뎅기 특이서열 2개 (DenV-P1: KGIMQAGKRSLRPQPTELKY (서열번호 1), DenV-P2: LIDGPETAECPNTNRAWNSLEVEDY (서열번호 2))와 지카 특이서열 3개 (ZIKA-P1: SVKNPMWRGPQRLPVPVNELPHGW (서열번호 3), ZIKA-P2: AKTNNSFVVDGDTLKECPLEHR (서열번호 4), ZIKA-P3: YSLECDPAVIGTAVKGREAAHSDLGYWIESEKNDTWR (서열번호 5)) 였다. 치쿤구니아는 단백질 아미노산의 친수성 분석을 통한 항원결정부위 예측결과를 통하여 6개(CKIK-P1: PMFEVEPRQVTSNDHANAR (서열번호 6), CKIK-P2: QEIDPDSTILDIGSAPARRMMS (서열번호 7), CKIK-P3: MRSAEDPERLAN (서열번호 8), CKIK-P4: RKLASAAGKVLDRNISGKIGDL (서열번호 9), CKIK-P5: EVMAVPDTETPTFC (서열번호 10), CKIK-P6: MAGAYPSYSTNWADEQVLK (서열번호 11))의 특이서열을 선정하여, 이하의 실험에서 사용하였다. Among the hydrophilic portions of protein amino acids, a sequence portion specific to each virus was used as a peptide antigen, and specifically, two dengue specific sequences (DenV-P1: KGIMQAGKRSLRPQPTELKY (SEQ ID NO: 1), DenV-P2: LIDGPETAECPNTNRAWNSLEVEDY (SEQ ID NO: 2)) ) And three Zika specific sequences (ZIKA-P1: SVKNPMWRGPQRLPVPVNELPHGW (SEQ ID NO: 3), ZIKA-P2: AKTNNSFVVDGDTLKECPLEHR (SEQ ID NO: 4), ZIKA-P3: YSLECDPAVIGTAVKGREAAHSDLGYWIESEKNDTWR (SEQ ID NO: 5). Chikungunia is 6 (CKIK-P1: PMFEVEPRQVTSNDHANAR (SEQ ID NO: 6), CKIK-P2: QEIDPDSTILDIGSAPARRMMS (SEQ ID NO: 7)), CKIK-P3: MRSAEDPERLAN (SEQ ID NO: 8), CKIK-P4: RKLASAAGKVLDRNISGKIGDL (SEQ ID NO: 9), CKIK-P5: EVMAVPDTETPTFC (SEQ ID NO: 10), CKIK-P6: MAGAYPSYSTNWADEQVLK (SEQ ID NO: 11)).
실시예 1-2. Peptide 항원을 이용한 혈청 진단 (ELISA)Example 1-2. Serum diagnosis using peptide antigen (ELISA)
실시예 1-1에서 준비된 뎅기 특이서열 2개 (DenV-P1, DenV-P2), 지카 특이서열 3개 (ZIKA-P1, ZIKA-P2, IKA-P3) 치쿤구니아 특이서열 6개(CKIK-P1, CKIK-P2, CKIK-P3, CKIK-P4, CKIK-P5, CKIK-P6) 펩타이드(펩트론, 대한민국)를 ELISA로 분석하였다. 구체적으로, 상기 펩타이드 항원은 PBS를 이용하여 5㎍/ml이 되도록 희석하였고, 96 well plate (Nunc, Denmark)의 각 well에 각 종류의 펩타이드를 100μl/well의 농도로 코팅하였다. 2 dengue specific sequences prepared in Example 1-1 (DenV-P1, DenV-P2), 3 Zika specific sequences (ZIKA-P1, ZIKA-P2, IKA-P3) 6 chikungunia specific sequences (CKIK- P1, CKIK-P2, CKIK-P3, CKIK-P4, CKIK-P5, CKIK-P6) peptides (peptron, Korea) were analyzed by ELISA. Specifically, the peptide antigen was diluted to 5 μg/ml using PBS, and each well of a 96 well plate (Nunc, Denmark) was coated with each type of peptide at a concentration of 100 μl/well.
상기 well plate는 4℃에서 하루 동안 보관하였고, PBS-T (1X PBS + 0.1% Tween-20) 300μl로 3번 세척한 후, 5% BSA가 첨가된 PBS로 한 시간 동안 상온에서 차단하였고, PBS-T로 다시 3번 세척하였다.The well plate was stored at 4° C. for one day, washed 3 times with 300 μl of PBS-T (1X PBS + 0.1% Tween-20), and blocked at room temperature for one hour with PBS to which 5% BSA was added, and PBS Washed again 3 times with -T.
진단을 위한 뎅기 시료는 정상 검체 10개와 감염 검체 10개의 혈청을 이용하였다. 이의 혈청을 PBS로 1:50으로 희석하여 100μl/well의 농도로 상온에서 1시간 동안 반응시켰고, PBS-T로 3번 세척하였다. 1:1000으로 희석된 HRP-접합된 염소 항-사람 IgG (Sigma, USA)를 2차 항체로 사용하여 반응시켰다. 2차 항체도 상온에서 1시간 동안 반응시킨 후, PBS-T로 3회 세척하였다. 결합된 2차 항체의 검출은 TMB substrate (BioFX, SurModics, USA)로 10분간 상온에서 반응시킨 후, 1N HCl를 50μl/well로 투여하여 반응을 종료 후에 450nm로 측정하여 반응성을 관찰하였다.The dengue samples for diagnosis were serum from 10 normal and 10 infected samples. The serum was diluted 1:50 with PBS, reacted for 1 hour at room temperature at a concentration of 100 μl/well, and washed three times with PBS-T. HRP-conjugated goat anti-human IgG (Sigma, USA) diluted 1:1000 was used as a secondary antibody to react. The secondary antibody was also reacted at room temperature for 1 hour, and then washed 3 times with PBS-T. For detection of the bound secondary antibody, after reacting at room temperature for 10 minutes with a TMB substrate (BioFX, SurModics, USA), 50 μl/well of 1N HCl was administered to terminate the reaction, and the reaction was measured at 450 nm to observe the reactivity.
그 결과, 뎅기는 2번 (DenV-P2) 펩타이드를 사용하였을 때, 지카는 1번(ZIKA-P1), 2번(ZIKA-P2)과 3번(ZIKA-P3) 펩타이드를 함께 사용하였을 때, 치쿤구니아는 4번(CKIK-P4) 펩타이드를 사용하였을 때 효과적으로 감염진단이 가능한 것을 확인할 수 있다(도 3).As a result, when Dengue 2 (DenV-P2) peptide was used, Zika when 1 (ZIKA-P1), 2 (ZIKA-P2) and 3 (ZIKA-P3) peptide were used together, It can be seen that chikungunia can effectively diagnose infection when using the No. 4 (CKIK-P4) peptide (FIG. 3).
실시예 2: 뎅기, 지카 및 치쿤구니아 바이러스 항체 진단용 신속 면역크로마토그래피 진단 키트의 제조Example 2: Preparation of a rapid immunochromatographic diagnostic kit for diagnosing dengue, Zika, and chikungunia virus antibodies
실시예 2-1. 스트립 제조 및 진단키트의 구성Example 2-1. Composition of strip manufacturing and diagnostic kit
도 4와 같이 스트립의 아래쪽으로부터 완충용액이 처리된 버퍼패드; 뎅기, 지카 또는 치쿤구니아 재조합 항원과 금축합체가 축합된 축합패드; 검체를 주입하는 검체패드; 및 검사선과 대조선이 순서대로 부착/분주되어 있는 멤브레인을 순차적으로 부착시키고 상단에는 흡수패드를 부착시켰다.A buffer pad treated with a buffer solution from the bottom of the strip as shown in FIG. 4; A condensation pad in which a dengue, zika, or chikungunia recombinant antigen and gold condensate are condensed; A sample pad for injecting a sample; And the membranes to which the test line and the control line were attached/dispensed in order were sequentially attached, and an absorbent pad was attached to the top.
상기에서 준비된 스트립을 플라스틱 카세트에 장착하고 조립을 하여 진단키트를 완성하였다. The strip prepared above was mounted on a plastic cassette and assembled to complete a diagnostic kit.
실시예 2-2: 모기 매개 바이러스 진단용 검사선 및 대조선에 항체 분주 Example 2-2: Dispensing of antibodies to test lines and control lines for mosquito-borne virus diagnosis
항-사람 IgG-단클론 항체와 항-사람 IgM-단클론 항체를 준비하여, 니트로셀룰로오스 멤브레인에 0.5 ~ 4.0 mg/㎖의 농도로 검사선 1(항 사람 IgG)과 검사선 2(항 사람 IgM) 부위에 분주를 하였다. 또한, 멤브레인의 대조선 위치에는 산양 항 생쥐 IgG 다클론 항체를 Arista Biologicals Inc.(미국)로부터 구입하여 1.0 mg/㎖의 농도로 PBS로 희석하여 분주하였다.Prepare anti-human IgG-monoclonal antibody and anti-human IgM-monoclonal antibody, and test line 1 (anti-human IgG) and test line 2 (anti-human IgM) sites at a concentration of 0.5 to 4.0 mg/ml on a nitrocellulose membrane. Was dispensed on. In addition, a goat anti-mouse IgG polyclonal antibody was purchased from Arista Biologicals Inc. (USA) at the control line position of the membrane, diluted with PBS at a concentration of 1.0 mg/ml, and dispensed.
실시예 2-3: 모기 매개 바이러스 진단용 금 축합체 및 축합 패드 제조Example 2-3: Preparation of gold condensate and condensation pad for diagnosis of mosquito-borne virus
0.02% HAuCl4 용액을 교반 가열하면서 끓기 시작하면 0.2% Sodium citrate 용액을 첨가하여 용액을 환원시켜 금 입자(gold particle)을 제작하였다. 이렇게 제작된 금 입자에 실시예 1에서 선정된 뎅기, 지카 또는 치쿤쿠니아 특이적인 단리된 펩타이드를 금 입자용액 100 ml당 1 mg을 첨가하여 각각 축합시켰다. 축합된 펩타이드-금 축합체를 10,000 g에서 원심분리하여 침전시키고 0.1% BSA를 함유하는 생리식염수(PBS)로 용해하여 OD450 값이 10이 되도록 제조하였다. 이렇게 제조된 용액을 곧바로 0.05% Tween 20이 전처리된 폴리에스테르나 유리패드에 처리하고 건조시켜서 축합 패드를 완성하였다. When the 0.02% HAuCl 4 solution began to boil while stirring and heating, a 0.2% sodium citrate solution was added to reduce the solution to prepare gold particles. To the gold particles thus prepared, the isolated peptides specific to dengue, zika, or chikunkunia selected in Example 1 were condensed by adding 1 mg per 100 ml of the gold particle solution. The condensed peptide-gold condensate was precipitated by centrifugation at 10,000 g and dissolved in physiological saline (PBS) containing 0.1% BSA to obtain an OD450 value of 10. The prepared solution was immediately treated on a polyester or glass pad pretreated with 0.05
실시예 2-4: 버퍼 패드 및 흡수 패드Example 2-4: Buffer pad and absorbent pad
유리 섬유(glass fiber), 코튼(cotton) 또는 셀룰로오스 재질의 패드에 0.1 M Tris (pH 8.0)을 처리한 후, 건조하여 버퍼 패드로 사용하였다. 흡수 패드는 코튼 재질의 패드를 별도의 처리 없이 잘라서 사용하였다.After treatment with 0.1 M Tris (pH 8.0) on a pad made of glass fiber, cotton or cellulose, it was dried and used as a buffer pad. As for the absorbent pad, a cotton pad was cut and used without any separate treatment.
실시예 3: 모기 매개 바이러스 신속 면역크로마토그래피 진단키트의 검사 방법Example 3: Test method of mosquito-mediated virus rapid immunochromatography diagnostic kit
바이러스 항체가 존재하는 사람의 혈청/혈장 5μl 또는 전형 10μl를 검체주입구에 넣고, 버퍼패드에 반응용액을 3방울(약 100μl) 떨어뜨린다. 그러면, 검액이 혈구분리가 되고, 멤브레인으로 이동하여 반응을 하게 된다. Put 5 μl of human serum/plasma with viral antibody or 10 μl of typical type into the sample inlet, and add 3 drops (about 100 μl) of the reaction solution to the buffer pad. Then, the sample solution separates blood cells and moves to the membrane to react.
진단용 키트는 반응용액이 축합패드로 이동하여 펩타이드-금 축합체를 용해시킨 후, 멤브레인으로 이동하여 "펩타이드-금 축합체-검체내 모기 매개 바이러스(뎅기, 지카 또는 치쿤쿠니아) 항체-항 사람 IgG (또는 항 사람 IgM)"와 같은 형태로 반응을 하게 되어 색 띠를 형성하게 된다. 한편, 반응하지 않은 펩타이드-금 축합체는 대조선 부위에 부착되어 있는 항 생쥐 면역글로블린 G와 반응을 하여 색 띠를 나타나게 된다.The diagnostic kit is a reaction solution that moves to a condensation pad to dissolve the peptide-gold condensate, and then moves to the membrane and "peptide-gold condensate-mosquito-mediated virus (dengue, Zika, or chikunkunia) in the sample) antibody-anti-human It reacts in the form of "IgG (or anti-human IgM)" and forms a colored band. On the other hand, the unreacted peptide-gold condensate reacts with the anti-mouse immunoglobulin G attached to the control line site, resulting in a colored band.
실시예 4: 진단적 효능 시험Example 4: Diagnostic efficacy test
본 발명품의 진단적 효능 시험(민감도 및 특이도)을 위해서 General Hospital Kuala Lumpur (GHKL, 말레이시아)로부터 혈액 660건(뎅기 IgG 양성 320건, 뎅기 IgM 양성 190건 및 뎅기 음성 150건), Hospital Gaffree e Guinle (리오 데 자네이로, 브라질)로부터 혈액 250건(지카 IgM 양성 150건, 치쿤구니아 IgM 양성 100건), 음성 검체 300건은 단국대학교 병원(천안, 한국)으로부터 제공받았다. 이들 검체들은 모두 ELISA 법으로 양성과 음성으로 확인된 것이다.For the diagnostic efficacy test (sensitivity and specificity) of the present invention, 660 blood (dengue IgG positive 320, dengue IgM positive 190 and dengue negative 150) from General Hospital Kuala Lumpur (GHKL, Malaysia), Hospital Gaffree e 250 blood samples (Zika IgM positive 150, Chikungunia IgM positive 100) and 300 negative samples were provided by Dankook University Hospital (Cheonan, Korea) from Guinle (Rio de Janeiro, Brazil). All of these specimens were confirmed as positive and negative by ELISA.
이렇게 제공된 혈액을 이용하여 본 발명의 키트를 이용한 시험을 수행하여 표 1에서와 같이 민감도가 뎅기 IgG 양성 검체에 대해서는 96.7%, 뎅기 IgM 양성 검체에 대해서는 96.5%, 특이도는 뎅기 IgG 양성 검체에 대해서는 100%, 뎅기 IgM 양성 검체에 대해서는 100%임을 확인하였다. 또한, 지카 IgM 양성 검체에 대해서는 민감도가 96.7%, 특이도가 98.7%이며, 치쿤구니아 IgM 양성 검체에 대해서는 민감도가 97.1%, 특이도가 98% 인 매우 뛰어난 결과를 확보하였다(표 1).Using the blood thus provided, a test using the kit of the present invention was performed, and as shown in Table 1, the sensitivity was 96.7% for the Dengue IgG-positive sample, 96.5% for the Dengue IgM-positive sample, and the specificity was for the Dengue IgG-positive sample. It was confirmed that it was 100% and 100% for the dengue IgM positive sample. In addition, for the Zika IgM-positive sample, the sensitivity was 96.7% and the specificity was 98.7%, and for the Chikungunia IgM-positive sample, the sensitivity was 97.1% and the specificity was 98%.
이들 결과는 바이러스 감염간의 교차반응을 보이지 않았으며, 국제적으로 현재까지 보고된 지카 신속진단키트들 중에서 가장 우수한 결과이다.These results showed no cross-reaction between viral infections, and are the best results among the internationally reported Zika rapid diagnostic kits.
실시예 5: 타사 제품과의 민감도 확인 Example 5: Confirmation of sensitivity with other companies' products
본 연구를 통하여 개발한 키트의 민감도를 확인하고자 타사 제품과 비교실험을 수행하였다. 구체적으로 뎅기 IgG/IgM 키트와 타사 제품(SD)을 비교시 동등 이상의 민감도를 나타내었다. 특히 IgM 항체 검출에서 월등한 분석능을 확인할 수 있었다. 치쿤구니아 IgM 키트에서도 타사 제품(CTK, J.Mitra)과 비교 시 동등 이상의 민감도를 나타내었다(도 6).In order to check the sensitivity of the kit developed through this study, a comparative experiment with other companies' products was conducted. Specifically, when comparing the Dengue IgG/IgM kit and other company's product (SD), the sensitivity was equal to or higher than that. In particular, it was possible to confirm the superior analysis ability in the detection of IgM antibodies. Chikungunia IgM kit also showed a sensitivity equal to or higher than that of other companies' products (CTK, J. Mitra) (FIG. 6).
상기 결과는 본 발명의 단리된 펩타이드가 뎅기, 지카 또는 치쿤쿠니아 바이러스에 특이적인 펩타이드로서 진단시 교차반응없이, 즉, 다른 모기 매개 바이러스를 검출하지 않고 원하는 바이러스만을 특이적으로 높은 민감도로 검출할 수 있음을 시사하는 것이다. The results show that the isolated peptide of the present invention is a peptide specific for dengue, Zika, or chikunkunia virus, without cross-reaction at the time of diagnosis, that is, without detecting other mosquito-mediated viruses, and only the desired virus with specific high sensitivity. It suggests that it can be done.
이상의 설명으로부터, 본 발명이 속하는 기술분야의 당업자는 본 발명이 그 기술적 사상이나 필수적 특징을 변경하지 않고서 다른 구체적인 형태로 실시될 수 있다는 것을 이해할 수 있을 것이다. 이와 관련하여, 이상에서 기술한 실시 예들은 모든 면에서 예시적인 것이며 한정적인 것이 아닌 것으로서 이해해야만 한다. 본 발명의 범위는 상기 상세한 설명보다는 후술하는 특허 청구범위의 의미 및 범위 그리고 그 등가 개념으로부터 도출되는 모든 변경 또는 변형된 형태가 본 발명의 범위에 포함되는 것으로 해석되어야 한다.From the above description, those skilled in the art to which the present invention pertains will understand that the present invention can be implemented in other specific forms without changing the technical spirit or essential features thereof. In this regard, the embodiments described above are illustrative in all respects and should be understood as non-limiting. The scope of the present invention should be construed that all changes or modifications derived from the meaning and scope of the claims to be described later rather than the above detailed description and equivalent concepts are included in the scope of the present invention.
<110> GenBody Inc. <120> Peptides for diagnosis of mosquito-borne viruses and uses thereof <130> KPA170715-KR-D2 <160> 11 <170> KoPatentIn 3.0 <210> 1 <211> 20 <212> PRT <213> Artificial Sequence <220> <223> DenV-P1 <400> 1 Lys Gly Ile Met Gln Ala Gly Lys Arg Ser Leu Arg Pro Gln Pro Thr 1 5 10 15 Glu Leu Lys Tyr 20 <210> 2 <211> 25 <212> PRT <213> Artificial Sequence <220> <223> DenV-P2 <400> 2 Leu Ile Asp Gly Pro Glu Thr Ala Glu Cys Pro Asn Thr Asn Arg Ala 1 5 10 15 Trp Asn Ser Leu Glu Val Glu Asp Tyr 20 25 <210> 3 <211> 24 <212> PRT <213> Artificial Sequence <220> <223> ZIKA-P1 <400> 3 Ser Val Lys Asn Pro Met Trp Arg Gly Pro Gln Arg Leu Pro Val Pro 1 5 10 15 Val Asn Glu Leu Pro His Gly Trp 20 <210> 4 <211> 22 <212> PRT <213> Artificial Sequence <220> <223> ZIKA-P2 <400> 4 Ala Lys Thr Asn Asn Ser Phe Val Val Asp Gly Asp Thr Leu Lys Glu 1 5 10 15 Cys Pro Leu Glu His Arg 20 <210> 5 <211> 37 <212> PRT <213> Artificial Sequence <220> <223> ZIKA-P3 <400> 5 Tyr Ser Leu Glu Cys Asp Pro Ala Val Ile Gly Thr Ala Val Lys Gly 1 5 10 15 Arg Glu Ala Ala His Ser Asp Leu Gly Tyr Trp Ile Glu Ser Glu Lys 20 25 30 Asn Asp Thr Trp Arg 35 <210> 6 <211> 19 <212> PRT <213> Artificial Sequence <220> <223> CKIK-P1 <400> 6 Pro Met Phe Glu Val Glu Pro Arg Gln Val Thr Ser Asn Asp His Ala 1 5 10 15 Asn Ala Arg <210> 7 <211> 22 <212> PRT <213> Artificial Sequence <220> <223> CKIK-P2 <400> 7 Gln Glu Ile Asp Pro Asp Ser Thr Ile Leu Asp Ile Gly Ser Ala Pro 1 5 10 15 Ala Arg Arg Met Met Ser 20 <210> 8 <211> 12 <212> PRT <213> Artificial Sequence <220> <223> CKIK-P3 <400> 8 Met Arg Ser Ala Glu Asp Pro Glu Arg Leu Ala Asn 1 5 10 <210> 9 <211> 22 <212> PRT <213> Artificial Sequence <220> <223> CKIK-P4 <400> 9 Arg Lys Leu Ala Ser Ala Ala Gly Lys Val Leu Asp Arg Asn Ile Ser 1 5 10 15 Gly Lys Ile Gly Asp Leu 20 <210> 10 <211> 14 <212> PRT <213> Artificial Sequence <220> <223> CKIK-P5 <400> 10 Glu Val Met Ala Val Pro Asp Thr Glu Thr Pro Thr Phe Cys 1 5 10 <210> 11 <211> 19 <212> PRT <213> Artificial Sequence <220> <223> CKIK-P6 <400> 11 Met Ala Gly Ala Tyr Pro Ser Tyr Ser Thr Asn Trp Ala Asp Glu Gln 1 5 10 15 Val Leu Lys <110> GenBody Inc. <120> Peptides for diagnosis of mosquito-borne viruses and uses thereof <130> KPA170715-KR-D2 <160> 11 <170> KoPatentIn 3.0 <210> 1 <211> 20 <212> PRT <213> Artificial Sequence <220> <223> DenV-P1 <400> 1 Lys Gly Ile Met Gln Ala Gly Lys Arg Ser Leu Arg Pro Gln Pro Thr 1 5 10 15 Glu Leu Lys Tyr 20 <210> 2 <211> 25 <212> PRT <213> Artificial Sequence <220> <223> DenV-P2 <400> 2 Leu Ile Asp Gly Pro Glu Thr Ala Glu Cys Pro Asn Thr Asn Arg Ala 1 5 10 15 Trp Asn Ser Leu Glu Val Glu Asp Tyr 20 25 <210> 3 <211> 24 <212> PRT <213> Artificial Sequence <220> <223> ZIKA-P1 <400> 3 Ser Val Lys Asn Pro Met Trp Arg Gly Pro Gln Arg Leu Pro Val Pro 1 5 10 15 Val Asn Glu Leu Pro His Gly Trp 20 <210> 4 <211> 22 <212> PRT <213> Artificial Sequence <220> <223> ZIKA-P2 <400> 4 Ala Lys Thr Asn Asn Ser Phe Val Val Asp Gly Asp Thr Leu Lys Glu 1 5 10 15 Cys Pro Leu Glu His Arg 20 <210> 5 <211> 37 <212> PRT <213> Artificial Sequence <220> <223> ZIKA-P3 <400> 5 Tyr Ser Leu Glu Cys Asp Pro Ala Val Ile Gly Thr Ala Val Lys Gly 1 5 10 15 Arg Glu Ala Ala His Ser Asp Leu Gly Tyr Trp Ile Glu Ser Glu Lys 20 25 30 Asn Asp Thr Trp Arg 35 <210> 6 <211> 19 <212> PRT <213> Artificial Sequence <220> <223> CKIK-P1 <400> 6 Pro Met Phe Glu Val Glu Pro Arg Gln Val Thr Ser Asn Asp His Ala 1 5 10 15 Asn Ala Arg <210> 7 <211> 22 <212> PRT <213> Artificial Sequence <220> <223> CKIK-P2 <400> 7 Gln Glu Ile Asp Pro Asp Ser Thr Ile Leu Asp Ile Gly Ser Ala Pro 1 5 10 15 Ala Arg Arg Met Met Ser 20 <210> 8 <211> 12 <212> PRT <213> Artificial Sequence <220> <223> CKIK-P3 <400> 8 Met Arg Ser Ala Glu Asp Pro Glu Arg Leu Ala Asn 1 5 10 <210> 9 <211> 22 <212> PRT <213> Artificial Sequence <220> <223> CKIK-P4 <400> 9 Arg Lys Leu Ala Ser Ala Ala Gly Lys Val Leu Asp Arg Asn Ile Ser 1 5 10 15 Gly Lys Ile Gly Asp Leu 20 <210> 10 <211> 14 <212> PRT <213> Artificial Sequence <220> <223> CKIK-P5 <400> 10 Glu Val Met Ala Val Pro Asp Thr Glu Thr Pro Thr Phe Cys 1 5 10 <210> 11 <211> 19 <212> PRT <213> Artificial Sequence <220> <223> CKIK-P6 <400> 11 Met Ala Gly Ala Tyr Pro Ser Tyr Ser Thr Asn Trp Ala Asp Glu Gln 1 5 10 15 Val Leu Lys
Claims (9)
SEQ ID NO: 9, Chikunkunia virus-specific isolated peptide.
A composition for diagnosing Chikunkunia virus infection disease comprising the peptide of claim 1.
A rapid diagnosis kit for diagnosing a virus infectious disease of Chikuncunia comprising the peptide of claim 1 or the composition of claim 2.
상기 신속진단키트는 완충용액을 포함하는 버퍼패드; 축합패드; 검체 패드; 검사선 및 대조선이 고정화된 멤브레인; 및 흡수패드를 포함하는, 신속진단키트.
The method of claim 3,
Wherein the rapid diagnostic kit comprises: a buffer pad comprising a buffer solution; Condensation pad; Sample pad; A membrane on which an inspection line and a reference line are immobilized; And an absorbent pad.
상기 신속진단키트의 축합 패드는 단리된 펩타이드가 포함되어 있는 것인, 신속진단키트.
The method of claim 3,
Wherein the condensation pad of the rapid diagnostic kit comprises an isolated peptide.
상기 단리된 펩타이드는 금 축합체와 축합되어 있는 것인, 신속진단키트.
6. The method of claim 5,
Wherein the isolated peptide is condensed with a gold co-polymer.
상기 멤브레인은 검사선에 항-사람 IgG 또는 항-사람 IgM 단클론 항체가 고정화되어 있는 것인, 신속진단키트.
5. The method of claim 4,
Wherein the membrane is immobilized with an anti-human IgG or anti-human IgM monoclonal antibody on the test line.
상기 신속진단키트는 면역크로마토그래피법을 이용한 스트립 형태인 것인, 신속진단키트.
The method of claim 3,
Wherein the rapid diagnostic kit is in the form of a strip using immunochromatography.
A method for providing information necessary for diagnosis of Chikunkunia virus infectious disease using the rapid diagnosis kit of claim 3.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020190007756A KR102021540B1 (en) | 2019-01-21 | 2019-01-21 | Peptides for diagnosis of mosquito-borne viruses and uses thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020190007756A KR102021540B1 (en) | 2019-01-21 | 2019-01-21 | Peptides for diagnosis of mosquito-borne viruses and uses thereof |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020170105380A Division KR102021538B1 (en) | 2017-08-21 | 2017-08-21 | Peptides for diagnosis of mosquito-borne viruses and uses thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
KR20190020711A true KR20190020711A (en) | 2019-03-04 |
KR102021540B1 KR102021540B1 (en) | 2019-09-16 |
Family
ID=65759916
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020190007756A KR102021540B1 (en) | 2019-01-21 | 2019-01-21 | Peptides for diagnosis of mosquito-borne viruses and uses thereof |
Country Status (1)
Country | Link |
---|---|
KR (1) | KR102021540B1 (en) |
-
2019
- 2019-01-21 KR KR1020190007756A patent/KR102021540B1/en active IP Right Grant
Non-Patent Citations (3)
Title |
---|
미래창조과학부 보도자료 '혈액으로 확인하는 지카바이러스 진단키트 개발' (2016.06.03.) * |
이지후 및 김학용, 한국콘텐츠학회 종합학술대회 논문집, p55-56 (2014.11.) * |
최재원 등, 한국콘텐츠학회 종합학술대회 논문집, p109-110 (2017.05.) * |
Also Published As
Publication number | Publication date |
---|---|
KR102021540B1 (en) | 2019-09-16 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
JP2020060582A (en) | Immunological detection method of mycoplasma pneumoniae, and kit | |
JP6616333B2 (en) | Immunological detection method and kit for Mycoplasma pneumoniae | |
JP2019015736A (en) | Immunological detection method and kit for Mycoplasma pneumoniae | |
WO2005106483A1 (en) | Detection of west nile virus | |
CN112334481A (en) | Antibody pairs for rapid influenza B diagnostic testing | |
KR100593286B1 (en) | Kit for detecting canine distemper virus antibody using immunochromatography | |
KR20120103882A (en) | Antigen for detecting of classical swine fever virus, antibody detecting method and test kit using thereof | |
KR102021540B1 (en) | Peptides for diagnosis of mosquito-borne viruses and uses thereof | |
KR102021539B1 (en) | Peptides for diagnosis of mosquito-borne viruses and uses thereof | |
US20210341475A1 (en) | Antibody pairs for use in a rapid influenza a diagnostic test | |
KR102021538B1 (en) | Peptides for diagnosis of mosquito-borne viruses and uses thereof | |
KR101032956B1 (en) | Rapid diagnostic kit of hemorrhagic fever with renal syndrome detecting specific IgM and IgG using nucleocapsid protein derived from Soochong virus | |
KR102467073B1 (en) | Kit for detecting of antibodies in blood to Coronavirus | |
JP2020026953A (en) | Kit for detecting antibody of severe fever with thrombocytopenia syndrome virus and method for detecting antibody of severe fever with thrombocytopenia syndrome virus | |
CN113072625B (en) | Polypeptide, novel detection test paper and detection kit for coronavirus antibody | |
KR101876535B1 (en) | Antibody for detecting of bovine viral diarrhea virus(bvdv), bvdv antigen detecting method and test kit using thereof | |
RU2808765C2 (en) | KIT FOR DETECTING ANTIBODIES OF CLASSES M AND G AGAINST NUCLEOCAPSID (Nc) AND RECEPTOR-BINDING DOMAIN OF SPIKE PROTEIN OF SARS-CoV-2 CORONAVIRUS | |
KR20220116684A (en) | Kit for detecting of antibodies in blood to Coronavirus | |
KR20220156465A (en) | Novel diagnostic test devices for detecting SARS-CoV-2 antibody | |
JP6824026B2 (en) | Influenza virus H5 subtype immunoassay | |
WO2020185165A2 (en) | A method of identifying a flavivirus infection and related kits, peptides and compositions | |
Bloock | Rubella Virus, Synthetic Peptide and Serology |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
A107 | Divisional application of patent | ||
A201 | Request for examination | ||
E902 | Notification of reason for refusal | ||
E701 | Decision to grant or registration of patent right | ||
GRNT | Written decision to grant |