KR20180041466A - Antibody specifically binding to core fucosylated alpha-fetoprotein and use thereof - Google Patents

Antibody specifically binding to core fucosylated alpha-fetoprotein and use thereof Download PDF

Info

Publication number
KR20180041466A
KR20180041466A KR1020160133665A KR20160133665A KR20180041466A KR 20180041466 A KR20180041466 A KR 20180041466A KR 1020160133665 A KR1020160133665 A KR 1020160133665A KR 20160133665 A KR20160133665 A KR 20160133665A KR 20180041466 A KR20180041466 A KR 20180041466A
Authority
KR
South Korea
Prior art keywords
afp
antibody
gly
antigen
seq
Prior art date
Application number
KR1020160133665A
Other languages
Korean (ko)
Inventor
구미영
우소연
백승한
황규상
Original Assignee
에스케이텔레콤 주식회사
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 에스케이텔레콤 주식회사 filed Critical 에스케이텔레콤 주식회사
Priority to KR1020160133665A priority Critical patent/KR20180041466A/en
Publication of KR20180041466A publication Critical patent/KR20180041466A/en

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/531Production of immunochemical test materials
    • G01N33/532Production of labelled immunochemicals
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57407Specifically defined cancers
    • G01N33/57438Specifically defined cancers of liver, pancreas or kidney
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/46Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from vertebrates

Landscapes

  • Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Urology & Nephrology (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Cell Biology (AREA)
  • Pathology (AREA)
  • Organic Chemistry (AREA)
  • Food Science & Technology (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Biotechnology (AREA)
  • General Physics & Mathematics (AREA)
  • Hospice & Palliative Care (AREA)
  • Oncology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The present invention relates to an antibody which specifically binds to core-fucosylated alpha-fetoprotein L3 and uses thereof, and more particularly to an antibody and an antibody-based quantification method of core-fucosylated alpha-fetoprotein for early diagnosis of liver cancer. The antibody of the present invention can be selectively bound to AFP-L3 by distinguishing AFP-L3 from AFP which is not core-fucosylated.

Description

코어-푸코실화된 알파-페토프로테인에 특이적으로 결합하는 항체 및 그의 용도{Antibody specifically binding to core fucosylated alpha-fetoprotein and use thereof}Antibodies specifically binding to core-fucosylated alpha-fetoprotein and uses thereof < RTI ID = 0.0 >

본 발명은 코어-푸코실화된 알파-페토프로테인(core fucosylated alpha-fetoprotein, AFP)에 특이적으로 결합하는 항체 및 그의 용도 에 관한 것으로서, 더욱 자세하게는 간암 조기 진단을 위한 코어-푸코실화된 AFP의 항체 및 항체 기반 정량방법에 관한 것이다. The present invention relates to an antibody that specifically binds to core-fucosylated alpha-fetoprotein (AFP) and its use, and more particularly to an antibody that binds to core-fucosylated alpha-fetoprotein Antibody and antibody-based assays.

종합적인 암 관리를 통한 암 발생, 암 사망의 최소화로 암 부담의 획기적 감소를 위한 방법은 암의 조기검진이다. 암의 스크리닝(screening) 및 모니터링(monitoring)의 개념에서 다수 의 사람을 빠르게 암을 진단할 수 있는 방법을 개발하기 위하여 간암 진단 스크리닝 및 모니터링을 위한 알파-페토프로테인(Alpha FetoProtein, AFP) 모노클로날 항체들의 개발이 요구되고 있다. It is the early screening of cancer to reduce the cancer burden by minimizing the cancer occurrence and the cancer death through comprehensive cancer management. Alpha-Fetoprotein (AFP) for the screening and monitoring of liver cancer to develop methods for rapidly diagnosing cancer in a large number of people in the concept of screening and monitoring of cancer Monoclonal Development of antibodies is required.

AFP는 당단백질의 일종으로 간세포 암종(Hepatocellular carcinoma,HCC)의 종양 표지자이다. AFP은 구조상 알부민과 상동성이 높으며, 태생 간기 및 난황에서 생성되어 태령 13-14주에 최고치에 달하며 생후 감소하기 시작하여 12개월이 지나면 성인치(<10ug/L)까지 감소한다. 산부인과 질환에서 임신부의 혈중 및 양수 중 AFP 증가는 무뇌아, 척추파열, 수두증 등 선천성 이상의 지표로 활용되기도 한다.AFP is a glycoprotein that is a tumor marker for hepatocellular carcinoma (HCC). AFP is highly structurally homologous to albumin and is produced in the liver and yolk of the embryo, reaching its peak at 13-14 weeks of gestation. It begins to decrease after birth and decreases to sex inches (<10ug / L) after 12 months. Increased AFP in the maternal blood and amniotic fluid of pregnant women may be used as an indicator of congenital abnormalities such as brain abscess, rupture of spine, and hydrocephalus.

대부분의 종양 표지자와는 달리 AFP는 선별검사에 매우 유용하며, 한국을 비롯한 중국, 일본, 알라스카 및 아프리카 등의 간세포암 유병율이 높은 지역에서 간세포암의 고위험군을 선별하는데 이용되고 있다. 종양표지자가 감소하면 성공적인 치료를 의미하고 반대로 상승하면 재발이나 전이를 의미하므로 종양 표지자는 종양의 예후 및 크기와 밀접한 관련이 있다.Unlike most tumor markers, AFP is very useful for screening and is being used to screen high risk patients for hepatocellular carcinoma in areas with high prevalence of hepatocellular carcinoma such as Korea, China, Japan, Alaska and Africa. A decrease in tumor markers indicates successful treatment, while an increase in tumor markers indicates recurrence or metastasis, so tumor markers are closely related to the prognosis and size of the tumor.

AFP는 당쇄 구조 및 렉틴 중의 하나인 Lens culinaris agglutinin(LCA) 에 대한 결합 친화도에 따라, L1, L2 및 L3의 3가지 이소타입으로 구분될 수 있다. AFP-L3는 푸코실화된 AFP 또는 렉틴-반응성 AFP라고도 불리우며, 간세포암의 선별검사에 이용되는 물질이다. AFP-L1는 주로 양성 간질환에서 발현되며 푸코실화되지 않은 당을 가지고 있는 형태이며, AFP-L2가 주로 임산부에서 발현되며 AFP-L2도 코어-푸코실화된 형태의 AFP이나 당의 형태는 AFP-L3와는 다르다. AFP can be divided into three isotypes, L1, L2 and L3, depending on the sugar chain structure and the binding affinity for one of the lectins, Lens culinaris agglutinin (LCA). AFP-L3 is also called fucosylated AFP or lectin-reactive AFP, and is a substance used for screening for hepatocellular carcinoma. AFP-L1 is mainly expressed in benign liver disease and has a non-fucosylated sugar. AFP-L2 is mainly expressed in pregnant women. AFP-L2 is also a core-fucosylated form of AFP, and its form is AFP-L3 .

2005년, FDA는 AFP-L3를 원발성 간암의 바이오마커 하나로 정식으로 허가하였다. AFP-L3는 간암의 조기진단, 치료 효과 평가 및 예후 감시 등의 면에서 활용되어 기존의 AFP를 이용한 진단에 비해 진단의 정확성을 높이기 위해 사용되고 있다.In 2005, the FDA formally approved AFP-L3 as a biomarker for primary liver cancer. AFP-L3 has been used for early diagnosis of liver cancer, evaluation of therapeutic effect, and prognosis monitoring, and it is used to improve the accuracy of diagnosis compared to conventional diagnosis using AFP.

푸코스는 메틸화된 육탄당이며 조직 및 혈청의 몇 개의 당단백질 당쇄 존재해, 단백질 결합 푸코스(protein-bound fucose)라고 칭해진다. AFP 탄수화물 체인에 푸코스 잔기를 가지며, 이러한 변이체가 푸코스화 AFP(FucAFP) 라고 칭해져 AFP 총량에 차지하는 백분율이 푸코스화 지수(Fucosylation Index, Fuol) 라고 칭해진다. 푸코스화 지수는 중요한 이론적 의의 및 임상 응용적인 의의를 가지며, 간암 진단 및 예후 응용에 중요한 지표라고 해도 좋다.Fucose is a methylated hexose sugar and is present in several tissues and serogroups of glycoproteins called protein-bound fucose. The percentage of the AFP carbohydrate chain which has a fucose residue and which is referred to as fucose AFP (FucAFP) in the total amount of AFP is called a fucosylation index (Fuol). The fucose index has important theoretical significance and clinical application significance and may be an important index for the diagnosis and prognosis of liver cancer.

간암 및 간 질환 진단을 위해 사용된 마커 중의 하나인 AFP의 낮은 진단 민감도 부분을 개선하기 위해, wako 사에서는 AFP의 서브타입 중의 하나인 AFP-L3 를 진단 마커로 이용하여 AFP-L3%를 계산하여 간 질환 진단을 위한 도구로 활용하고 있다. To improve the low diagnostic sensitivity of AFP, one of the markers used to diagnose liver cancer and liver disease, wako calculated AFP-L3% using AFP-L3, which is one of subtypes of AFP, as a diagnostic marker It is used as a tool to diagnose liver disease.

구체적으로 Wako가 개발한 검사방법은 혈청 중에서 총 AFP의 렉틴 반응성에 의한 분획비(AFP-L3 %)를 측정하는 것이다. Wako 기술에 의하면, 간경변이나 만성 B형 바이러스 감염에서 AFP-L3% 수치가 10% 이상이면 간암 가능성이 매우 높다는 것을 의미하며, 뿐만 아니라 간암에서 AFP-L3%가 양성이라면 암의 진행속도가 빠르고 종양 크기는 상대적으로 크고 간문맥 정맥이 침범, 다른 장기로 전이와도 관련이 있다는 보고가 많아 예후를 추정하는 데 중요한 수단이 될 수 있음을 설명하고 있다. Specifically, the test method developed by Wako is to measure the fractional fraction (AFP-L3%) of the total AFP by the lectin reactivity in the serum. According to the Wako technique, AFP-L3% levels above 10% in patients with cirrhosis or chronic hepatitis B virus infection indicate that liver cancer is very likely, and if AFP-L3% is positive in liver cancer, The size of the lesion is relatively large and the portal vein is invaded, and it is associated with metastasis to other organs, which may be an important tool for estimating the prognosis.

Wako 사의 기기(u-TASWAKO i30)는 항체기반의 AFP-L3 단백질의 정량법이 아닌 렉틴이라고 하는 당 친화단백질의 성질을 이용하여 형광 신호를 측청하는 방법으로, AFP 단백질 전체를 인지하는 포획 항체(capture antibody)를 이용하여 먼저 혈액 내 AFP를 분리한 다음, 렉틴 단백질이 포함된 아가로스 겔에 전기영동을 하여 렉틴과 반응을 하는 AFP-L3 타입을 분리하여 전체 AFP 형광값 중에 렉틴과 반응하는 구간의 형광값을 %화 하여 AFP-L3 %를 측정하는 방식의 진단법을 이용한다. 그러나, 본 원리로 AFP-L3%를 측정하는 경우, 렉틴 단백질의 당친화도가 비특이 반응이 있어 AFP-L3 %를 정량하는 정확도가 감소하게 된다. 또한 Wako 사의 별도의 장비가 필요하게 되어 기존 병원에서 많이 사용되는 core-lab 장비들과의 multiple maker를 이용한 동시 진단 알고리즘 적용 및 비교가 불가능하며, 하나의 분석당 비용 및 시료의 양이 다량 필요하여 많이 활용되지 못하였다.Wako's device (u-TASWAKO i30) is a method for quantifying the fluorescence signal using the property of the glycoprotein called lectin, not the antibody-based AFP-L3 protein assay, The AFP-L3 type, which reacts with lectin by electrophoresis on an agarose gel containing a lectin protein, is first separated from the blood by using an antibody, The fluorescence value is converted into% and AFP-L3% is measured. However, when AFP-L3% is measured by this principle, the accuracy of quantifying AFP-L3% is decreased due to the non-specificity of the sugar affinity of the lectin protein. In addition, since Wako's separate equipment is needed, it is impossible to apply and compare the simultaneous diagnosis algorithm using multiple makers with core-lab equipment used in existing hospitals. It was not used much.

이에, 본 발명자들은 AFP-L3을 혈청 내에서 특이적으로 인지할 수 있는 항체와 이를 이용한 AFP-L3 탐지 및 정량방법이 필요한 실정이다. 질병 진단의 유용한 표지자인 AFP-L3에 특이적으로 결합할 뿐만 아니라, AFP의 코어-푸코실화의 유무를 구별하는 항체의 개발이 간암 진단의 정확도를 높이기 위한 진단법의 활용 및 보급화를 위해 필요한 실정이다.Therefore, the present inventors need an antibody capable of specifically recognizing AFP-L3 in serum and AFP-L3 detection and quantification method using the same. The development of an antibody that specifically binds to AFP-L3, a useful marker for disease diagnosis, as well as the presence or absence of core-fucosylation of AFP is necessary for the utilization and dissemination of diagnostic methods to improve the accuracy of diagnosis of liver cancer .

본 발명은 간암 진단의 유용한 표지자인 코어-푸코실화된 알파-페토프로테인(core fucosylated alpha-fetoprotein, AFP), 예컨대 AFP-L3에 특이적으로 결합할 뿐만 아니라, 코어-푸코실화되지 않은 AFP인 AFP-1과 구별하여 AFP-L3에만 선택적으로 결합할 수 은 항체를 제공하는 것이다. The present invention is based on the finding that AFP, which not only specifically binds to core fucosylated alpha-fetoprotein (AFP), such as AFP-L3, which is a useful marker of liver cancer diagnosis, -1 &lt; / RTI &gt; to selectively bind to AFP-L3 alone.

본 발명의 또 다른 일예는, AFP-L1와 구별하여 AFP-L3 만을 특이적으로 인지하는 항체를 제공하는 것이다. Another embodiment of the present invention is to provide an antibody that specifically recognizes only AFP-L3, distinct from AFP-L1.

본 발명의 또 다른 일예는, AFP-L3에 대한 선택적 인지 성능으로 간암의 조기 진단 및 예후, 모니터링을 상기 항체를 이용하여 항원-항체 반응을 이용한 질병 진단 또는 질병 진단에 필요한 정보를 제공하는 방법에 관한 것이다. Another embodiment of the present invention relates to a method for providing early detection, prognosis, and monitoring of liver cancer by selectively recognizing AFP-L3 to provide information necessary for diagnosis of disease or diagnosis of disease using an antigen-antibody reaction using the antibody .

본 발명은 AFP-L3에 특이적으로 결합할 뿐만 아니라, 코어-푸코실화되지 않은 AFP와 구별하여 AFP-L3에 선택적으로 결합할 수 있은 항체, 상기 항체를 이용한 AFP-L3 탐지 또는 정량방법, 및 상기 항체를 이용한 간암 등의 질병을 진단 또는 진단에 필요한 정보를 제공하는 방법에 관한 것이다. The present invention relates to an antibody which specifically binds to AFP-L3 but which is capable of selectively binding to AFP-L3 differently from AFP which is not core-fucosylated, AFP-L3 detection or quantification method using said antibody, and And a method for providing information necessary for diagnosing or diagnosing a disease such as liver cancer using the antibody.

본 명세서에서 용어, "중쇄(heavy chain)"는 항원에 특이성을 부여하기 위해 충분한 가변 영역 서열을 갖는 아미노산 서열을 포함하는 가변 영역 도메인 VH 및 3개의 불변 영역 도메인 CH1, CH2 및 CH3과 힌지(hinge)를 포함하는 전장 중쇄 및 이의 단편을 모두 포함하는 의미로 해석된다. 또한, 용어 "경쇄(light chain)"는 항원에 특이성을 부여하기 위한 충분한 가변영역 서열을 갖는 아미노산 서열을 포함하는 가변 영역 도메인 VL 및 불변 영역 도메인 CL을 포함하는 전장 경쇄 및 이의 단편을 모두 포함하는 의미로 해석된다.As used herein, the term "heavy chain" refers to a variable region domain VH comprising an amino acid sequence having a sufficient variable region sequence sufficient to confer antigen specificity, and three constant region domains CHl, CH2 and CH3 and a hinge ), And fragments thereof. The term " full-length heavy chain " In addition, the term "light chain" includes both a light chain light chain comprising a variable region domain VL comprising an amino acid sequence having a sufficient variable region sequence for imparting specificity to an antigen and a constant region domain CL and fragments thereof It is interpreted as meaning.

본 명세서에서 용어, "CDR(complementarity determining region)"은 면역글로불린의 중쇄 및 경쇄의 고가변 영역(hypervariable region)의 아미노산 서열을 의미한다. 중쇄 및 경쇄는 각각 3개의 CDR을 포함할 수 있다(CDRH1, CDRH2, CDRH3 및 CDRL1, CDRL2, CDRL3). 상기 CDR은 항체가 항원 또는 에피토프에 결합하는 데 있어서 주요한 접촉 잔기를 제공할 수 있다. As used herein, the term "CDR (complementarity determining region)" refers to the amino acid sequence of the heavy chain of the immunoglobulin and the hypervariable region of the light chain. The heavy and light chains may each contain three CDRs (CDRH1, CDRH2, CDRH3 and CDRL1, CDRL2, CDRL3). The CDRs may provide the major contact residues for binding of the antibody to the antigen or epitope.

한편, 본 명세서에 있어서, 용어, "특이적으로 결합" 또는 "특이적으로 인식"은 당업자에게 통상적으로 공지되어 있는 의미와 동일한 것으로서, 항원 및 항체가 특이적으로 상호작용하여 면역학적 반응을 하는 것을 의미한다.In the present specification, the terms "specifically binding" or "specifically recognizing" are the same as those conventionally known to those skilled in the art, and the antigen and the antibody specifically interact to effect an immunological reaction .

본 발명의 일 예는, AFP-L3를 특이적으로 인지하는 항체에 관한 것이다. 본 발명의 일 예에서, 상기 항체는 푸코실화되지 않은 AFP인 AFP-L1에 비해 높은 친화력으로 선택적으로 AFP-L3에 결합하는 항체이다. 본 발명에 따른 항-AFP-L3 항체는 푸코스(fucose)가 없는 AFP에는 낮은 친화도 및 선택도를 보인다. 본 발명에 따른 항체가 인지하는 코어-푸코실화된 AFP의 구조는 도 1에 나타냈다. 도 1은 AFP의 당 구조 및 개발 항체 인지 성능 정도의 모식도를 나타낸다. AFP-L1에 비해 상대적으로 AFP-L3에 대한 높은 특이도 및 선택도로 인식하는 항체는 AFP 단백질의 구조가 현재 명확히 규명되지 않으며, 또한 두 단백질이 동일한 염기서열을 가지면서 당의 구조상 푸코스 존재 유무의 차이만을 가지고 있기 때문에, AFP-L1에서 푸코스 만을 추가로 가진 AFP-L3 단백질을 특이적으로 인지하는 항체의 개발의 난이도가 매우 높아 개발하기 어려웠다.One example of the present invention relates to an antibody that specifically recognizes AFP-L3. In one embodiment of the invention, the antibody is an antibody that selectively binds AFP-L3 with a higher affinity than AFP-L1, which is a non-fucosylated AFP. The anti-AFP-L3 antibody according to the present invention shows low affinity and selectivity for AFP without fucose. The structure of the core-fucosylated AFP recognized by the antibody according to the present invention is shown in Fig. Brief Description of the Drawings Fig. 1 is a schematic diagram showing the sugar structure of AFP and the developed antibody recognition performance. The high specificity and selectivity of antibodies to AFP-L3 relative to AFP-L1 suggests that the structure of the AFP protein is not currently clear, and that the two proteins have the same base sequence, It was difficult to develop an antibody specifically recognizing AFP-L3 protein having only fucose in AFP-L1 because of its difference.

Wako 사의 u-TASWAKO i30 장비를 이용한 AFP-L3의 측정법에 사용하는 렉틴, 특히 LCA 단백질에 비해, 본 발명에 따른 항체는 코어-푸코실화된 AFP-L3를 특이적으로 인지하여 결합함으로 렉틴을 이용한 측정법에 대해서 측정의 정확성이 높으며, 기존 AFP-L3 진단 장비에 비해 AFP-L3을 정확히 정량할 수 있어 이에 기반한 간암의 진단 및 예후의 판단이 가능하다.Compared to lectins, especially LCA proteins, used in the AFP-L3 assay using the u-TASWAKO i30 instrument from Wako, the antibodies according to the present invention specifically recognize core-fucosylated AFP-L3 and bind it with lectin AFP-L3 can be accurately quantified compared to existing AFP-L3 diagnostic equipment, and diagnosis and prognosis of liver cancer based on this can be made.

본 발명에 따른 AFP-L3 항체는 기존에 암 진단을 위한 단백질의 유무 및 정량 측정법을 위한 기기에 바로 적용이 가능하여 빠르고 간편할 뿐만 아니라, 멀티마커를 이용한 진단의 정확도를 높이기 위해 적용하는 멀티마커 알고리즘에도 AFP-L3 항체수치를 적용가능하며 이를 통해 간암의 조기 진단의 정확도를 더 높일 수 있는 진단 기준을 제시 가능하다. The AFP-L3 antibody according to the present invention can be applied directly to devices for the presence or absence of a protein for the diagnosis of cancer and a method for quantitative determination of the protein, so that it is not only quick and simple, but also a multi- The AFP-L3 antibody level can be applied to the algorithm, which can provide diagnostic criteria to further improve the accuracy of early diagnosis of liver cancer.

본 발명의 일 예에 있어서, 항-AFP-L3 항체 또는 이의 항원 결합 단편이 제공된다. 상기 코어-푸코실화된 AFP, 예컨대 AFP-L3에 대한 항체는, 인간 AFP (Accession #NP001125.1)중 251번째 아스파라진 아미노산을 포함하는 2개 내지 20개, 2개 내지 15개, 2개 내지 10개, 또는 2개 내지 5개의 아미노산을 포함하는 펩타이드를 에피토프(항원결정부위)로서 인식 및/또는 특이적으로 결합하는 것일 수 있다.In one example of the invention, an anti-AFP-L3 antibody or antigen-binding fragment thereof is provided. The antibody against the core-fucosylated AFP, such as AFP-L3, may comprise from 2 to 20, from 2 to 15, from 2 to 20, 10, or 2 to 5 amino acids, as an epitope (antigenic determinant site), and / or specifically binds.

따라서, 본 발명의 항 AFP-L3 항체 또는 이의 항원 결합 단편은 앞서 설명한 에피토프를 인식 및/또는 특이적으로 결합하는 항체 또는 항원 결합, 및 이와 경쟁적으로 AFP-L3 에 결합하는 항체 또는 이의 항원 결합 단편으로 이루어진 군에서 선택된 1종 이상일 수 있다.Thus, the anti-AFP-L3 antibody or antigen-binding fragment thereof of the present invention may comprise an antibody or antigen binding that recognizes and / or specifically binds to the epitope described above, and an antibody or antigen binding fragment thereof competitively binding to AFP- May be at least one selected from the group consisting of

본 발명의 일 예에서, 샌드위치 ELISA 분석(Sandwich ELISA assay)을 기반으로 AFP-L3에 대한 분석을 수행함에 있어, 상기 항체를 포획(capture) 항체로 사용하고, 각 웰에 있는 천연 AFP-L1와 천연 AFP-L3 단백질에 모두 반응하여 AFP 전체를 인지하는 항체를 탐지(Detector)항체로 측정하게 되면, 천연 AFP-L1 및 AFP-L3의 농도가 각각 50ng/ml 이상의 구간에서 AFP-L1에 대한 AFP-L3의 O.D 값의 비율이 1.5배 이상, 예를 들면 1.6배 이상, 1.7배 이상, 1.8배 이상, 1.9배 이상 또는 2.0배 이상의 값을 가지는 것이 바람직하다. In one example of the present invention, in performing an assay on AFP-L3 based on a sandwich ELISA assay, the antibody is used as a capture antibody and natural AFP-L1 and When AFP-L1 and AFP-L3 were detected as antibodies to all AFP-L3 proteins, AFP-L1 was detected at a concentration of 50 ng / ml or more, It is preferable that the ratio of the OD value of -L3 is 1.5 times or more, for example, 1.6 times or more, 1.7 times or more, 1.8 times or more, 1.9 times or more, or 2.0 times or more.

또한, 본 발명에 따른 항체는 AFP-L3의 농도가 50ng/ml 이상, 70 ng/ml 이상, 100 ng/ml이상, 200ng/ml 이상의 농도에서 AFP-L1에 대한 AFP-L3의 구별능이 더욱 바람직하다.In addition, the antibody according to the present invention is more preferably capable of discriminating AFP-L3 against AFP-L1 at a concentration of AFP-L3 of 50 ng / ml, 70 ng / ml, 100 ng / ml, Do.

본 발명의 일 예에서, 상기 항 AFP-L3 항체 또는 이의 항원 결합 단편은 중쇄(Heavy chain)의 상보성 결정 부위(complementarity determining region, CDR)로서, 일반식 1(서열번호 1)의 아미노산 서열을 갖는 폴리펩타이드(CDR-H1), 일반식 2(서열번호 2)의 아미노산 서열을 갖는 폴리펩타이드(CDR-H2), 및 일반식 3(서열번호 3)의 아미노산 서열을 갖는 폴리펩타이드(CDR-H3) 로 이루어진 군에서 선택된 하나 이상을 포함하는 것일 수 있다.In one example of the present invention, the anti-AFP-L3 antibody or antigen-binding fragment thereof is a complementarity determining region (CDR) of a heavy chain and has an amino acid sequence of the general formula 1 (SEQ ID NO: 1) A polypeptide having the amino acid sequence of the general formula 2 (CDR-H2), a polypeptide having the amino acid sequence of the general formula 3 (SEQ ID NO: 3) (CDR-H3) , And the like.

[일반식 1][Formula 1]

GX1X2X3X4X5X6GX7GGX 1 X 2 X 3 X 4 X 5 X 6 GX 7 G

상기 식에서, X1는 F, S, Y, I, 또는 L이고, X2는 S, P, F, 또는 Y이고, X3는 F, S, I, 또는 L이고, X4는 S, T, G, 또는 R이고, X5는 D, N, G, 또는 V이고, X6는 H, 또는 R이고, X7는 L, M, V, 또는 I이고,Wherein X 1 is F, S, Y, I, or L, X 2 is S, P, F, or Y, X 3 is F, S, I, or L, X 4 is S, T , and G, or R a, X 5 is D, N, G, or V and, X 6 is H, or R, X 7 is L, M, V, or I,

[일반식 2][Formula 2]

SX8TX9GGX10X11TWX12X13X14X15X16X17X18X19X20X21X22 SX 8 TX 9 GGX 10 X 11 TWX 12 X 13 X 14 X 15 X 16 X 17 X 18 X 19 X 20 X 21 X 22

상기 식에서, X8은 I 또는 T이고, X9은 S, 또는 N이고, X10은 S, G 또는 R 이고, X11은 G 또는 I이고, X12는 Y 또는 N이고, X13은 A, S 또는 T이고, X14는 P 또는 S이고, X15는 A 또는 T이고, X16은 V 또는 M이고, X17은 K, R 또는 E이고, X18은 G, 또는 V이고, X19는 R 또는 P이고, X20은 A 또는 T이고, X21은 T 또는 S이고, X22는 I 또는 F이고, Wherein X8 is I or T, X9 is S or N, X10 is S, G or R, X11 is G or I, X12 is Y or N, X13 is A, S or T, X14 is P or S, X15 is A or T, X16 is V or M, X17 is K, R or E, X18 is G or V, X19 is R or P, X20 is A or T X21 is T or S, X22 is I or F,

[일반식 3][Formula 3]

SAX23GGWIX24X25DX26X27X28 SAX 23 GGWIX 24 X 25 DX 26 X 27 X 28

상기 식에서, X23은 Y 또는 V이고, X24는 A 또는 V이고, X25는 D, G, S 또는 E이고, X26은 I, V 또는 T이고, X27은 D, V 또는 N이고, X28은 A, V, S 또는 T이다.Wherein X 23 is Y or V, X 24 is A or V, X 25 is D, G, S or E, X 26 is I, V or T, X 27 is D, V or N , And X 28 is A, V, S, or T.

더욱 자세하게는, 상기 항 AFP-L3 항체 또는 이의 항원 결합 단편은 중쇄(Heavy chain)의 상보성 결정 부위(complementarity determining region, CDR)로서, More specifically, the anti-AFP-L3 antibody or antigen-binding fragment thereof is a complementarity determining region (CDR) of a heavy chain,

서열번호 7 내지 서열번호 11로 이루어진 군에서 선택된 아미노산 서열을 갖는 폴리펩타이드(CDR-H1), A polypeptide (CDR-H1) having an amino acid sequence selected from the group consisting of SEQ ID NOS: 7 to 11,

서열번호 12 내지 서열번호 14로 이루어진 군에서 선택된 아미노산 서열을 갖는 폴리펩타이드(CDR-H2), 및 A polypeptide (CDR-H2) having an amino acid sequence selected from the group consisting of SEQ ID NO: 12 to SEQ ID NO: 14, and

서열번호 15 내지 서열번호 18로 이루어진 군에서 선택된 아미노산 서열을 갖는 폴리펩타이드 (CDR-H3)A polypeptide (CDR-H3) having an amino acid sequence selected from the group consisting of SEQ ID NO: 15 to SEQ ID NO: 18,

로 이루어진 군에서 선택된 하나 이상을 포함하는 것일 수 있다., And the like.

항AFP-L3 항체 또는 이의 항원 결합 단편은 경쇄(Light chain)의 상보성 결정 부위로서, 일반식 4(서열번호 4)의 아미노산 서열을 갖는 폴리펩타이드(CDR-L1), 일반식 5(서열번호 5)의 아미노산 서열을 갖는 폴리펩타이드(CDR-L2), 및 일반식 6(서열번호 6)의 아미노산 서열을 갖는 폴리펩타이드(CDR-L3) 로 이루어진 군에서 선택된 하나 이상을 포함하는 것일 수 있다.The anti-AFP-L3 antibody or antigen-binding fragment thereof is a complementary crystal region of a light chain, and comprises a polypeptide (CDR-L1) having the amino acid sequence of the general formula 4 (SEQ ID NO: 4), a polypeptide represented by the general formula 5 (CDR-L2) having an amino acid sequence of SEQ ID NO: 6 (CDR-L3), and a polypeptide having an amino acid sequence of the general formula 6 (SEQ ID NO: 6) (CDR-L3).

[일반식 4][Formula 4]

SGGX29X30X31GSGGX 29 X 30 X 31 G

상기 식에서, X29은 S 또는 R, X30는 G, D, 또는 S, X31는 Y, C, 또는 H이고,Wherein X29 is S or R, X30 is G, D, or S, X31 is Y, C, or H,

[일반식 5][Formula 5]

YX32X33X34X35RX36X37 YX 32 X 33 X 34 X 35 RX 36 X 37

상기 식에서, X32는 E 또는 D이고, X33은 S, C 또는 N이고, X34는 N, S, Y, D, T 또는 H이고, X35는 K, R 또는 H이고, X36은 P 또는 L이고, X37은 S, T, P 또는 L이고, Wherein X32 is E or D, X33 is S, C or N, X34 is N, S, Y, D, T or H, X35 is K, R or H, X36 is P or L, X37 is S, T, P or L,

[일반식 6][Formula 6]

GGX38X39SX40X41X42PGX43FGAGGX 38 X 39 SX 40 X 41 X 42 PGX 43 FGA

상기 식에서, X38은 W 또는 R이고, X39는 E 또는 G이고, X40은 S, N, G, Y 또는 V이고, X41은 S 또는 N이고, X42는 I, T, 또는 V이고, X43은 A 또는 T이다.Wherein X38 is S or N, X42 is I, T, or V, X43 is A or G, X40 is S, N, G, Y or V, Or T.

더욱 자세하게는, 항 AFP-L3 항체 또는 이의 항원 결합 단편은 경쇄(Light chain)의 상보성 결정 부위로서,More specifically, the anti-AFP-L3 antibody or antigen-binding fragment thereof is a complementary crystal region of a light chain,

서열번호 19 내지 서열번호 21으로 이루어진 군에서 선택된 아미노산 서열을 갖는 폴리펩타이드(CDR-L1), A polypeptide (CDR-L1) having an amino acid sequence selected from the group consisting of SEQ ID NO: 19 to SEQ ID NO: 21,

서열번호 22 내지 서열번호 27으로 이루어진 군에서 선택된 아미노산 서열을 갖는 폴리펩타이드(CDR-L2), 및 A polypeptide (CDR-L2) having an amino acid sequence selected from the group consisting of SEQ ID NO: 22 to SEQ ID NO: 27, and

서열번호 28 내지 서열번호 32으로 이루어진 군에서 선택된 아미노산 서열을 갖는 폴리펩타이드(CDR-L3)A polypeptide (CDR-L3) having an amino acid sequence selected from the group consisting of SEQ ID NOS: 28 to 32,

로 이루어진 군에서 선택된 하나 이상을 포함하는 것일 수 있다:: &Lt; / RTI &gt; &lt; RTI ID = 0.0 &gt;

구체예에서, 항 AFP-L3 항체 또는 이의 항원 결합 단편은 상기한 중쇄 상보성 결정 부위, 경쇄 상보성 결정 부위, 또는 이들의 조합을 포함하는 것일 수 있다.In an embodiment, the anti-AFP-L3 antibody or antigen-binding fragment thereof may comprise a heavy chain complementarity determining region, a light chain complementarity determining region, or a combination thereof.

구체적으로, 항 AFP-L3항체 또는 이의 항원 결합 단편은 Specifically, the anti-AFP-L3 antibody or antigen-binding fragment thereof

서열번호 1의 아미노산 서열을 갖는 폴리펩타이드(CDR-H1), 서열번호 2의 아미노산 서열을 갖는 폴리펩타이드(CDR-H2), 및 서열번호 3의 아미노산 서열을 갖는 폴리펩타이드 (CDR-H3)로 이루어진 군에서 선택된 하나 이상의 중쇄 상보성 결정 부위, 또는 상기 하나 이상의 중쇄 상보성 결정 부위를 포함하는 중쇄 가변 영역; 및(CDR-H1) having the amino acid sequence of SEQ ID NO: 1, a polypeptide having the amino acid sequence of SEQ ID NO: 2 (CDR-H2), and a polypeptide having the amino acid sequence of SEQ ID NO: 3 A heavy chain variable region comprising at least one heavy chain complementarity determining region selected from the group consisting of the heavy chain complementarity determining region or the at least one heavy chain complementarity determining region; And

서열번호 4의 아미노산 서열을 갖는 폴리펩타이드(CDR-L1), 서열번호 5의 아미노산 서열을 갖는 폴리펩타이드(CDR-L2), 및 서열번호 6의 아미노산 서열을 갖는 폴리펩타이드 (CDR-L3)로 이루어진 군에서 선택된 하나 이상의 경쇄 상보성 결정 부위, 또는 상기 하나 이상의 경쇄 상보성 결정 부위를 포함하는 경쇄 가변 영역;(CDR-L3) having the amino acid sequence of SEQ ID NO: 4, a polypeptide having the amino acid sequence of SEQ ID NO: 5 (CDR-L2) and the polypeptide having the amino acid sequence of SEQ ID NO: 6 A light chain variable region comprising at least one light chain complementarity determining region selected from the group consisting of the light chain complementarity determining region or the light chain complementarity determining region;

상기 중쇄 상보성 결정 부위와 경쇄 상보성 결정 부위의 조합; 또는A combination of the heavy chain complementarity determining region and the light chain complementarity determining region; or

상기 중쇄 가변 영역과 경쇄 가변 영역의 조합The combination of the heavy chain variable region and the light chain variable region

을 포함하는 것일 수 있다.. &Lt; / RTI &gt;

보다 구체적으로, 항 AFP-L3 항체 또는 이의 항원 결합 단편은More specifically, the anti-AFP-L3 antibody or antigen-binding fragment thereof

서열번호 7 내지 서열번호 27 로 이루어진 군에서 선택된 아미노산 서열을 갖는 폴리펩타이드(CDR-H1), 서열번호 28 내지 서열번호 48 로 이루어진 군에서 선택된 아미노산 서열을 갖는 폴리펩타이드(CDR-H2), 및 서열번호 49 내지 서열번호 61 로 이루어진 군에서 선택된 아미노산 서열을 갖는 폴리펩타이드 (CDR-H3)로 이루어진 군에서 선택된 하나 이상의 중쇄 상보성 결정 부위, 또는 상기 하나 이상의 중쇄 상보성 결정 부위를 포함하는 중쇄 가변 영역; A polypeptide (CDR-H1) having an amino acid sequence selected from the group consisting of SEQ ID NOS: 7 to 27, a polypeptide having an amino acid sequence selected from the group consisting of SEQ ID NOS: 28 to 48, A heavy chain variable region comprising at least one heavy chain complementarity determining region selected from the group consisting of SEQ ID NO: 49 to SEQ ID NO: 61, or a polypeptide having the amino acid sequence selected from the group consisting of SEQ ID NO: 61 (CDR-H3);

서열번호 62 내지 서열번호 68 로 이루어진 군에서 선택된 아미노산 서열을 갖는 폴리펩타이드(CDR-L1), 서열번호 69 내지 서열번호 85 로 이루어진 군에서 선택된 아미노산 서열을 갖는 폴리펩타이드(CDR-L2), 및 서열번호 86 내지 서열번호 98 로 이루어진 군에서 선택된 아미노산 서열을 갖는 폴리펩타이드(CDR-L3)로 이루어진 군에서 선택된 하나 이상의 경쇄 상보성 결정 부위, 또는 상기 하나 이상의 경쇄 상보성 결정 부위를 포함하는 경쇄 가변 영역; A polypeptide (CDR-L1) having an amino acid sequence selected from the group consisting of SEQ ID NOS: 62 to 68, a polypeptide having an amino acid sequence selected from the group consisting of SEQ ID NOS: 69 to 85, A light chain variable region comprising at least one light chain complementarity determining region selected from the group consisting of SEQ ID NO: 86 to SEQ ID NO: 98, or a polypeptide having the amino acid sequence selected from the group consisting of SEQ ID NO: 98 (CDR-L3), or at least one light chain complementarity determining region;

상기 중쇄 상보성 결정 부위와 경쇄 상보성 결정 부위의 조합; 또는A combination of the heavy chain complementarity determining region and the light chain complementarity determining region; or

상기 중쇄 가변 영역과 경쇄 가변 영역의 조합The combination of the heavy chain variable region and the light chain variable region

을 포함하는 것일 수 있다.. &Lt; / RTI &gt;

구체적으로, 항 AFP-L3 항체의 중쇄 CDR은 예컨대 다음의 표 1의 아미노산 서열을 갖는 것일 수 있다. Specifically, the heavy chain CDR of the anti-AFP-L3 antibody may be, for example, having the amino acid sequence shown in Table 1 below.

CDR-H1CDR-H1 서열번호SEQ ID NO: CDR-H2CDR-H2 서열번호SEQ ID NO: CDR-H3CDR-H3 서열번호SEQ ID NO: GFSFSDHGMGGFSFSDHGMG 77 SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI 2828 SAYGGWIADDIDASAYGGWIADDIDA 4949 GFYFSDHGMGGFYFSDHGMG 88 SITSGGRGTWYAPAVKGRATISITSGGRGTWYAPAVKGRATI 2929 SAYGGWIAEDIDASAYGGWIAEDIDA 5050 GFSFSVHGMGGFSFSVHGMG 99 SITSGGSGTWYAPAVKVRATISITSGGSGTWYAPAVKVRATI 3030 SVYGGWIADDIDASVYGGWIADDIDA 5151 GFSFSDRGMG GFSFSDRGMG 1010 SITNGGSGTWYAPAVKGRATISITNGGSGTWYAPAVKGRATI 3131 SAYGGWIADDVDASAYGGWIADDVDA 5252 GSSFSDHGMG GSSFSDHGMG 1111 SITSGGGGTWYAPAVKGRATISITSGGGGTWYAPAVKGRATI 3232 SAYGGWIASDIDASAYGGWIASDIDA 5353 GFSFSDHGLG GFSFSDHGLG 1212 SITSGGSGIWYAPAVKGRATISITSGGSGIWYAPAVKGRATI 3333 SAYGGWIADDIDSSAYGGWIADDIDS 5454 GFSLGDHGMG GFSLGDHGMG 1313 SITSGGSGTWYAPAVKGRTTISITSGGSGTWYAPAVKGRTTI 3434 SAYGGWIADDIDVSAYGGWIADDIDV 5555 GISFSDHGMG GISFSDHGMG 1414 SITGGGSGTWYAPAVKGRATISITGGGSGTWYAPAVKGRATI 3535 SAYGGWIADDTDASAYGGWIADDTDA 5656 GFSFGDHGMG GFSFGDHGMG 1515 SITSGGSGTWYTPAVRGRATISITSGGSGTWYTPAVRGRATI 3636 SAYGGWIADDIVASAYGGWIADDIVA 5757 GFFFSDHGMG GFFFSDHGMG 1616 SITSGGSGTWYAPAVKGRATFSITSGGSGTWYAPAVKGRATF 3737 SAYGGWIADDIDTSAYGGWIADDIDT 5858 GFPFSDHGMG GFPFSDHGMG 1717 SITSGGSGTWYAPAMKGRATISITSGGSGTWYAPAMKGRATI 3838 SAYGGWIADDINASAYGGWIADDINA 5959 GYSFSDHGMG GYSFSDHGMG 1818 SITSGGSGTWYSPAVKGRATISITSGGSGTWYSPAVKGRATI 3939 SAYGGWIVDDIDASAYGGWIVDDIDA 6060 GFSFSDHGIG GFSFSDHGIG 1919 STTSGGSGTWYAPAVKGRATISTTSGGSGTWYAPAVKGRATI 4040 SAYGGWIAGDINASAYGGWIAGDINA 6161 GFSFSNHGMG GFSFSNHGMG 2020 SITSGGGGIWYAPAVKGRATISITSGGGGIWYAPAVKGRATI 4141 GLSFSVHGMG GLSFSVHGMG 2121 SITSGGSGTWYAPAVKGRVTISITSGGSGTWYAPAVKGRVTI 4242 GFSFSDHGVG GFSFSDHGVG 2222 SITSGGSGTWYAPAVEGRATISITSGGSGTWYAPAVEGRATI 4343 GFSFSGHGMG GFSFSGHGMG 2323 SITSGGSGTWNAPAVKGRATISITSGGSGTWNAPAVKGRATI 4444 GFSFTDHGMGGFSFTDHGMG 2424 SITSGGSGTWYAPAVKGRASISITSGGSGTWYAPAVKGRASI 4545 GFSISDHGMGGFSISDHGMG 2525 SITSGGSGTWYAPTVKGRATISITSGGSGTWYAPTVKGRATI 4646 GFPFRDHGMGGFPFRDHGMG 2626 SITSGGSGTWYASTVKGRATISITSGGSGTWYASTVKGRATI 4747 GFSSSVHGMGGFSSSVHGMG 2727 SITSGGSGTWYAPAVKGRAIISITSGGSGTWYAPAVKGRAII 4848

구체적으로, 항 AFP-L3 항체의 경쇄 CDR은 예컨대 다음의 표 2의 아미노산 서열을 갖는 것일 수 있다. Specifically, the light chain CDR of the anti-AFP-L3 antibody may be, for example, having the amino acid sequence shown in Table 2 below.

CDR-L1CDR-L1 서열번호SEQ ID NO: CDR-L2CDR-L2 서열번호SEQ ID NO: CDR-L3CDR-L3 서열번호SEQ ID NO: SGGSGYGSGGSGYG 6262 YESNKRPSYESNKRPS 6969 GGWESSSNPGIFGAGGWESSSNPGIFGA 8686 SGGSDYGSGGSDYG 6363 YESDKRPSYESDKRPS 7070 GGRESSSNPGIFGAGGRESSSNPGIFGA 8787 SGGSSYGSGGSSYG 6464 YESTKRPSYESTKRPS 7171 GGWESNSNPGIFGAGGWESNSNPGIFGA 8888 SGGSGCGSGGSGCG 6565 YESSKRPSYESSKRPS 7272 GGWGSSSNPGIFGAGGWGSSSNPGIFGA 8989 SGGRSYGSGGRSYG 6666 YESNMRPSYESNMRPS 7373 GGWESNSNPGTFGAGGWESNSNPGTFGA 9090 SGGSGHGSGGSGHG 6767 YESNRRPSYESNRRPS 7474 GGWESSSNPGVFGAGGWESSSNPGVFGA 9191 SGGRGYGSGGRGYG 6868 YESTKRPPYESTKRPP 7575 GGWESGSNPGIFGAGGWESGSNPGIFGA 9292 YENNKRPSYENNKRPS 7676 GGWESSSNPGIFGTGGWESSSNPGIFGT 9393 YESHKRPSYESHKRPS 7777 GGWESYSNPGIFGAGGWESYSNPGIFGA 9494 YESNKRPPYESNKRPP 7878 GGWESVSNPGIFGAGGWESVSNPGIFGA 9595 YESNKRPTYESNKRPT 7979 GGWESSSSPGIFGAGGWESSSSPGIFGA 9696 YESNKRLSYESNKRLS 8080 GGWESSNNPGIFGAGGWESSNNPGIFGA 9797 YESNKRPLYESNKRPL 8181 GGWESSSKPGIFGAGGWESSSKPGIFGA 9898 YDSNKRPSYDSNKRPS 8282 YDSDKRPSYDSDKRPS 8383 YECNKRPSYECNKRPS 8484 YESYKRPSYESYKRPS 8585

본 발명에 따른 항체의 일예는, 하기 표 11에 나타낸 상기 중쇄 상보성 결정 부위와 경쇄 상보성 결정 부위의 조합을 갖는 항체일 수 있다. An example of an antibody according to the present invention may be an antibody having a combination of the light chain complementarity determining region and the light chain complementarity determining region shown in Table 11 below.

본 명세서에서 용어, "항원 결합 단편"은 면역글로불린 전체 구조에 대한 그의 단편으로, 항원이 결합할 수 있는 부분을 포함하는 폴리펩타이드의 일부를 의미한다. 예를 들어, scFv, (scFv)2, Fab, Fab' 또는 F(ab')2일 수 있으나, 이에 한정되지 않는다. 상기 항원 결합 단편 중 Fab는 경쇄 및 중쇄의 가변영역과 경쇄의 불변 영역 및 중쇄의 첫 번째 불변 영역(CH1)을 가지는 구조로 1개의 항원 결합 부위를 가진다.As used herein, the term "antigen binding fragment" refers to that fragment of the immunoglobulin whole structure, which refers to a portion of a polypeptide comprising a moiety capable of binding an antigen. But are not limited to, for example, scFv, (scFv) 2 , Fab, Fab 'or F (ab') 2 . Fab among the antigen-binding fragments has one antigen-binding site in a structure having a variable region of a light chain and a heavy chain, a constant region of a light chain and a first constant region (CH1) of a heavy chain.

항 AFP-L3 항체는 단클론 항체 또는 다클론 항체일 수 있다. 단클론 항체는 당 업계에 널리 알려진 방법대로 제조될 수 있다. 예컨대, phage display 기법을 이용해서 제조될 수 있다. 또는, 항 AFP-L3 항체는 마우스 유래의 단클론 항체로 제조될 수 있다. 최종 선택된 항체들은 항원결합부를 제외한 나머지 부분이 인간의 면역글로블린 항체화된 항체뿐만 아니라, 인간화 항체로서 제조하여 사용할 수 있다. 인간화 항체의 제조방법은 당업계에 잘 알려져 있다.The anti-AFP-L3 antibody may be a monoclonal antibody or a polyclonal antibody. Monoclonal antibodies can be prepared by methods well known in the art. For example, it can be produced using a phage display technique. Alternatively, the anti-AFP-L3 antibody can be produced with a monoclonal antibody derived from a mouse. The finally selected antibodies can be used as humanized antibodies as well as human immunoglobulin antibodies except for the antigen binding portion. Methods for making humanized antibodies are well known in the art.

다른 예는 상기 항체를 생산하는 하이브리도마를 제공한다.Another example provides a hybridoma that produces the antibody.

한편, 상기 항 AFP-L3 항체 또는 이의 항원 결합 단편은 AFP-L3에 특이적으로 결합하므로, 이를 이용하여 AFP-L3와 관련된 질병의 진단용 조성물을 제공한다. 상기 AFP-L3 종양 표지자와 관련된 질병이 간암 또는 간 관련 질병인 것일 수 있다.On the other hand, the anti-AFP-L3 antibody or antigen-binding fragment thereof specifically binds to AFP-L3, and thus provides a composition for the diagnosis of diseases related to AFP-L3. The disease associated with the AFP-L3 tumor marker may be liver cancer or liver related disease.

또 다른 예에서, 환자로부터 얻어진 생물 시료에 상기 항 AFP-L3 항체 또는 이의 항원 결합 단편을 처리하는 단계; 항원-항체 반응 여부를 확인하는 단계; 및 항원-항체 반응이 탐지되는 경우 상기 환자를 AFP-L3 관련 질병을 갖는 것으로 판단하는 단계를 포함하는, 진단 방법 또는 진단에 정보를 제공하는 방법을 제공한다. In another example, the method comprises treating the biological sample obtained from the patient with the anti-AFP-L3 antibody or antigen-binding fragment thereof; Confirming whether an antigen-antibody reaction has occurred; And determining that the patient has an AFP-L3 related disease when an antigen-antibody reaction is detected.

상기 항원-항체 반응 여부를 확인하는 단계는 당업계에 공지된 다양한 방법을 통하여 수행할 수 있다. 예컨대, 통상적인 효소 반응, 형광, 발광 및/또는 방사선 검출을 통하여 하여 측정될 수 있으며, 구체적으로, 면역크로마토그래피(Immunochromatography), 면역조직화학염색(Immunohistochemistry), 효소결합 면역흡착 분석(enzyme linked immunosorbent assay: ELISA), 방사선 면역측정법(radioimmunoassay: RIA), 효소 면역분석(enzyme immunoassay: EIA), 형광면역분석(Floresence immunoassay: FIA), 발광면역분석(luminescence immunoassay: LIA), 웨스턴블라팅(Western blotting) 등으로 이루어진 군으로부터 선택된 방법에 의하여 측정될 수 있으나, 이에 제한되는 것은 아니다. The step of confirming whether the antigen-antibody reaction is confirmed can be carried out through various methods known in the art. For example, it can be measured by a conventional enzyme reaction, fluorescence, luminescence and / or radiation detection, and specifically, immunochromatography, immunohistochemistry, enzyme linked immunosorbent assay (ELISA), radioimmunoassay (RIA), enzyme immunoassay (EIA), fluorescence immunoassay (FIA), luminescence immunoassay (LIA), Western blotting ), And the like, but the present invention is not limited thereto.

상기 진단 대상 환자는 인간, 원숭이 등을 포함하는 영장류, 마우스, 래트 등을 포함하는 설치류 등을 포함하는 포유류일 수 있다. The subject to be diagnosed may be a mammal including a primate including a human, a monkey, etc., a rodent including a mouse, a rat, and the like.

상기 생물 시료는 환자로부터 얻어진 세포, 조직, 체액, 혈장 또는 혈액 등일 수 있다.The biological sample may be a cell, tissue, body fluid, plasma or blood obtained from a patient.

다른 예에서, 앞서 설명한 항 AFP-L3 항체의 중쇄 상보성 결정 부위, 경쇄 상보성 결정 부위, 또는 이들의 조합; 또는 중쇄 가변 영역, 경쇄 가변 영역, 또는 이들의 조합을 포함하는 폴리펩타이드를 암호화하는 폴리뉴클레오타이드 분자가 제공된다. In another example, the heavy chain complementarity determining region, the light chain complementarity determining region, or a combination thereof of the aforementioned anti-AFP-L3 antibody; Or a polynucleotide molecule encoding a polypeptide comprising a heavy chain variable region, a light chain variable region, or a combination thereof.

항원과 항체의 결합을 화학발광반응(chemiluminescence)를 이용하여 측정하는 원리를 활용한 화학발광 면역측정법(chemiluminescence immunoassay)를 최근 사용한다. 화학발광 반응이란 화학발광 물질이 저에너지 상태에서 고에너지 상태로 여기되었다가 기저 상태로 돌아오면서 빛을 내는 현상으로 분자를 여기시키는 에너지가 빛이 아닌 화학반응이라는 점에서 형광과 다르며, 효소를 이용한 면역분석법에 비해 높은 민감도를 보인다. Recently, a chemiluminescence immunoassay using the principle of measuring the binding between an antigen and an antibody using a chemiluminescence reaction has been recently used. Chemiluminescence is a phenomenon in which a chemiluminescent substance is excited from a low energy state to a high energy state and then returns to a ground state, thereby emitting light. This is different from fluorescence in that the energy that excites a molecule is not a light but a chemical reaction. The sensitivity is higher than the analytical method.

본 발명에 따른 항체는 코어-푸코실화된 AFP (AFP-L3)에 특이적으로 결합할 뿐만 아니라, 코어-푸코실화되지 않은 AFP와 선별하여 AFP-L3에 선택적으로 결합할 수 있어, 상기 항체를 이용한 간암 등의 질병을 진단 또는 진단에 필요한 정보를 제공할 수 있다.The antibody according to the present invention not only specifically binds to the core-fucosylated AFP (AFP-L3) but also can selectively bind to AFP-L3 selectively from the non-core-fucosylated AFP, It is possible to provide information necessary for diagnosis or diagnosis of diseases such as liver cancer.

도 1은 AFP의 이소타입(isotype)에 따른 AFP의 당 구조 및 코어-푸코실화된 AFP의 당 구조와 이에 따른 개발 항체 인지 성능 정도의 모식도이다.
도 2는 Lectin(LCA)을 이용한 기존 AFP-L3에 대한 측정원리 및 방법 AFP-L3에 관한 설명하는 도면이다.
도 3은 WAKO 사의 경쟁적 면역 분석 (WAKO i30) Schematic diagram of i30 operation principle을 나타낸다.
도 4는 실시예 1-2에 따라, 표준 물질인 단백질의 Lectin Electrophoresis 를 이용하여 fucosylation된 정도를 WAKO의 표준물질(calibrator)와 비교하여 확인한 결과를 나타내는 도면이다.
도 5은 실시예 1-3 에 따라, 표준 AFP 단백질의 당분석 결과를 나타내는 것으로서, MALDI-TOF MS 분석결과이다.
도 6은 실시예 4-2에 따라, 샌드위치 ELISA 분석법을 이용하여, 본 발명에 따른 항체의 표준 물질에 대한 구별 성능 확인한 결과를 나타낸다.
FIG. 1 is a schematic diagram of the sugar structure of AFP and the sugar structure of core-fucosylated AFP according to the isotype of AFP and thus the developed antibody cognitive performance.
FIG. 2 is a view for explaining the principle and method of measurement AFP-L3 for existing AFP-L3 using Lectin (LCA).
Figure 3 shows the competitive immunoassay (WAKO i30) Schematic diagram of the i30 operation principle of WAKO.
FIG. 4 is a graph showing the results obtained by comparing the degree of fucosylation using Lectin Electrophoresis of a protein as a reference material with a WAKO standard calibrator according to Example 1-2. FIG.
Fig. 5 shows the result of the sugar analysis of the standard AFP protein according to Example 1-3, which is the result of MALDI-TOF MS analysis. Fig.
Fig. 6 shows the results of confirming the discrimination performance of the antibody according to the present invention for the standard substance, using the sandwich ELISA assay according to Example 4-2. Fig.

본 발명은 하기 실시예를 들어 더욱 자세히 설명할 것이나, 하기 실시예는 예시적인 목적으로 제공될 뿐 본 발명의 보호범위가 하기 실시예로 한정되는 의도는 아니다.The present invention will be described in more detail with reference to the following examples. However, the following examples are provided for illustrative purposes only and are not intended to limit the scope of the present invention.

실시예Example 1: 천연 AFP- 1: natural AFP- L1L1 및 AFP- And AFP- L3L3 단백질 준비 Protein preparation

1-1: 천연 AFP-1-1: Natural AFP- L1L1 및 AFP- And AFP- L3L3 단백질 준비 Protein preparation

천연 AFP-L1은 cord blood originated AFP protein 구매하고, 천연 AFP-L3는 liver cancer cell originated AFP protein 정제하여 얻었다. 천연 AFP-L3 단백질 정제 방법은 다음과 같은 방법으로 수행하였다. Natural AFP-L1 was obtained from cord blood originated AFP protein and natural AFP-L3 was obtained by purification of liver cancer cell originated AFP protein. The natural AFP-L3 protein purification method was carried out as follows.

간세포암(Hepatocellular carcinoma cell)유래의 세포주인Huh7 세포를 10% FBS(Fetal Bovine Serum, 우태아 혈청)(Welgene,한국)가 들어있는 DMEM media(Welgene,한국)에 37℃, 5% CO2 인큐베이터에서 세포를 배양하였다. 배양 세포가 전체 150π dish에 2.5x106 개 이상으로 세포가 자랐을 때, dish에 남은 DMEM media를 세포에 닫지 않게 흡입하여 media를 완전히 제거한다. Media가 제거된 dish에 1X PBS buffer(인산 완충 용액)로 25ml씩 2번 세포가 자란 dish를 세척한 후, FBS가 없는 DMEM media로 72 시간 동안 37℃, 5% CO2 인큐베이터에서 세포를 배양하였다. 이렇게 배양이 완료된 media를 모아 1000rpm, 3분동안 원심 분리하여 가라앉은 세포의 부스러기(cell debris)를 제거하고 상층액을 얻었다. 얻어진 상층액을 천연 AFP-L3 정제 용액으로 사용하였다.HCC (Hepatocellular carcinoma cell) a of the cell lines derived from Huh7 cells, 10% FBS (Fetal Bovine Serum, FBS) (Welgene, Korea), the example DMEM media (Welgene, Korea) for 37 ℃, 5% CO 2 incubator Lt; / RTI &gt; cells. When the cultured cells were grown to a total of more than 2.5 × 10 6 cells in a 150 π dish, the media was completely removed by aspirating the remaining DMEM media into the cells without closing them. The dish was washed with 1X PBS buffer (phosphate buffer solution) and the cells were grown in DMEM media without FBS for 72 hours at 37 ° C in a 5% CO 2 incubator . The cultured medium was collected and centrifuged at 1000 rpm for 3 minutes to remove cell debris from the settled cells and obtain supernatant. The obtained supernatant was used as a purified AFP-L3 natural solution.

상기 용액을 AFP 마우스 유래 항체(Boditechmed, 한국)가 컨쥬케이션 되어 있는 protein G bead(GE Healthcare Life Science,미국)에 20X PBS stock(바이오세상,한국)을 위의 얻어진 천연 AFP-L3 정제용액의 전체 양의 1/20을 넣어 1X PBS 조성이 되게 만든다. 이를 protein G bead가 들어있는 컬럼에 천천히 흘려주었다. 모든 천연 AFP-L3 정제용액이 컬럼을 다 통과하여 흘러내린 후, 1X PBS로 bead 양에 10배 이상의 1X PBS를 흘려 내려, 비드에 붙지 않은 단백질을 제거하기 위해 비드의 세척단계를 진행하였다. 이후 protein IgG elution buffer (Thermo, 미국)를 이용하여 AFP 항체에 붙은 천연 AFP-L3 단백질을 elution 한 후, 1M Tris-HCl(PH 9.5)용액을 넣어 정제하여 얻어진 천연 AFP-L3가 포함되어 있는 용액의 산도를 중화시켰다. 모아진 단백질을 1X PBS solution을 투석카세트 밖에 다량 담아, 투석카세트에 있는 버퍼를 1X PBS 버퍼로 교체하기 위한 투석 단계를 진행하였다. 투석이 완료되면 단백질을 BCA 단백질 정량 키트(Thermo, 미국)를 이용하여 단백질을 정량하여 냉동 보관하였다.The above solution was added to 20X PBS stock (BioWorld, Korea) in a protein G bead (GE Healthcare Life Science, USA) in which AFP mouse-derived antibody (Boditechmed, Korea) was conjugated to the whole of the obtained purified natural AFP- Put 1/20 of the volume to make 1X PBS composition. This was slowly poured into the column containing the protein G bead. All of the natural AFP-L3 purified solution was passed through the column, washed with 1X PBS at a rate of 10 times or more of 1X PBS in a bead volume, and the washing step of the beads was carried out to remove proteins not attached to the beads. Later, the native AFP-L3 protein attached to the AFP antibody was eluted with a protein IgG elution buffer (Thermo, USA), and then purified with a 1 M Tris-HCl (pH 9.5) solution to obtain a solution containing the natural AFP- Lt; / RTI &gt; The collected protein was loaded with a 1X PBS solution in excess of the dialysis cassette, and a dialysis step was performed to replace the buffer in the dialysis cassette with 1X PBS buffer. After completion of the dialysis, the proteins were quantified by using BCA protein quantification kit (Thermo, USA) and stored frozen.

실시예Example 1-2: 렉틴  1-2: Lectin 면역블랏법에In the immunoblotting method 대한 렉틴 전기영동 Electrophoresis

실시예 1-1에서 확보한 표준물질 AFP-L1 및 AFP-L3가 고순도이며, 렉틴 면역블랏법 시험결과를 통해, Wako 표준물질의 AFP-L1 및 AFP-L3 밴드 위치와 자체 확보 표준물질의 밴드의 위치가 유사하게 나타나는 것을 확인하였다. 렉틴 면역블랏 시험 결과를 통해, Wako 표준물질의 AFP-L1 및 AFP-L3 밴드 위치와 자체 확보 표준물질의 당분석을 통해 Wako 표준물질 AFP-L3이 AFP-L1에 비해 다량의 AFP-L3 특이적인 당을 보유하고 있음을 확인하였다. The reference materials AFP-L1 and AFP-L3 obtained in Example 1-1 were high purity and the results of the lectin immunoblotting test showed that the AFP-L1 and AFP-L3 band positions of the Wako reference material and the band Were similar to each other. The results of the lectin immunoblot test show that the AAC-L1 and AFP-L3 band positions of the Wako reference material and the sugar assays of the self-assured reference material allow the Wako reference material AFP-L3 to have a large amount of AFP-L3 specific Which is the most abundant.

구체적인 렉틴 면역블랏 시험방법은 LCA(vectorlab,미국)를 0.2mg/ml의 농도로 섞어 1% agarose gel을 만들고 단백질 sample을 gel에 loading 하였다. Loading 하는 샘플은 실시예 1-1에서 정제하여 확보한 AFP-L3 단백질을 농도별로, Wako사에서 판매하는 AFP-L3 표준물질을 종류별로 loading 하여 겔을 120volt에서 1시간 전기영동을 수행하였다. 내린 gel을 NC membrane에 transfer 하기 위해 TE77 ECL SemiDry Transfer Unit(Amersham Biosciences, 영국)를 이용하여 40 mA에서 1시간 작동시켰다. 전이가 완료된 NC 멤브레인을 1시간 동안 블라킹한 후, AFP에 대한 단클론 항체 (1G7)항체(Merck Millipore, 미국)룰 4 ℃ 보관상태에서 O/N으로 반응시킨 후 PBST 용액으로 3번 세척하였다. Anti-mouse Fc HRP antibody(Thermo, 미국)가 섞인 용액을 실온에서 1시간동안 반응시켰다. 이 후 PBST 용액으로 3번 세척 한 후, Substrate를 넣어 ChemiDoc(Bio-Rad, 미국)로 이미지를 얻었다.A specific lectin immunoblot test was performed by adding LCA (vectorlab, USA) at a concentration of 0.2 mg / ml to prepare a 1% agarose gel and loading a protein sample onto the gel. Samples to be loaded were AFP-L3 protein purified by Example 1-1 and AFP-L3 standard material sold by Wako Co., Ltd. for each concentration, and the gel was electrophoresed at 120 volts for 1 hour. The red gel was run for 1 hour at 40 mA using a TE77 ECL SemiDry Transfer Unit (Amersham Biosciences, UK) to transfer to the NC membrane. After transferring the NC membrane, the membrane was blocked for 1 hour, and reacted with O / N in the presence of a monoclonal antibody (1G7) antibody (Merck Millipore, USA) at 4 ° C for AFP and washed three times with PBST solution. Anti-mouse Fc HRP antibody (Thermo, USA) was reacted at room temperature for 1 hour. After washing 3 times with PBST solution, Substrate was added and images were obtained with ChemiDoc (Bio-Rad, USA).

도 4는 실시예 1-2에 따라, control 단백질의 Lectin Electrophoresis 를 이용하여 푸코실화된 정도를 WAKO의 표준물질과 비교하여 확인한 결과를 나타내는 도면이다.FIG. 4 is a graph showing the results of checking the degree of fucosylation using Lectin Electrophoresis of the control protein, compared with the standard substance of WAKO, according to Example 1-2. FIG.

실시예Example 1-3: 정제 AFP 단백질의 당 분석 1-3: Glycoprotein analysis of purified AFP protein

실시예 1-1에서 정제된 천연 AFP-L1, 천연 AFP-L3 단백질에서 당쇄를 분리하기 위해 N-glycosidase(PNGase F) 효소를 인산화 버퍼와 반응하였다. 잘려진 당쇄를 Girarad’s reagent P(GP)룰 레이블링하기 위해 GP solution을 실온에서 4시간 반응시켰다. GP 레이블된 당쇄를 dihydroxybenzoic acid(DHB)와 섞고, 이를 이용하여 MALDI-TOF MS를 이용하여 GP-라벨링 된 당쇄를 정량한다. MALDI spectra는 Bruker Daltonics Microflex LRF MALDI-TOF MS(Bruker, 독일)을 이용하여 확보하였다. 관련 세부 방법은 참고논문(Biotechnology Letters,October 2015, Volume 37, Issue 10, pp 2019-2025) 과 동일하게 수행하였다. The N-glycosidase (PNGase F) enzyme was reacted with the phosphorylated buffer to separate the sugar chain from the purified natural AFP-L1, natural AFP-L3 protein purified in Example 1-1. The GP solution was reacted at room temperature for 4 hours to label the cleaved sugar chain with Girarad's reagent P (GP). GP-labeled sugar chains are mixed with dihydroxybenzoic acid (DHB), and GP-labeled sugar chains are quantified using MALDI-TOF MS. MALDI spectra were obtained using Bruker Daltonics Microflex LRF MALDI-TOF MS (Bruker, Germany). The detailed procedure was the same as that of the reference (Biotechnology Letters, October 2015, Volume 37, Issue 10, pp 2019-2025).

상기 실험결과를 도 5에 나타냈으며, MALDI-TOF MS analysis--표준물질의 당분석을 통해 표준물질 정제 AFP-L3이 정제 AFP-L1에 비해 다량의 AFP-L3 특이적인 당을 보유하고 있음을 확인하였다. The results of the above experiment are shown in FIG. 5, and it is confirmed through the sugar analysis of MALDI-TOF MS analysis-standard material that AFP-L3 has a larger amount of AFP-L3 specific sugar than the purified AFP-L1 Respectively.

실시예Example 2: 천연 AFP- 2: Natural AFP- L3L3 항체 후보 선정 및 성능 확인 Antibody Candidate Selection and Performance Verification

실시예Example 2-1: 항체 제조 2-1: Preparation of antibodies

항체 제조를 위하여, 실시예 1-1에서 본 발명에서 control 물질로 사용하기 위해 정제한 AFP-L3 단백질과 구매한 control물질인 AFP-L1을 구별하는 항체를 선별하기 위해 phage display 기술을 이용하여 항체 라이브러리를 제작하였다. For the preparation of antibodies, the antibody that distinguishes the AFP-L3 protein purified from the purified AFP-L3 protein for use as a control substance in the present invention in Example 1-1 was screened using phage display technology The library was constructed.

제작한 항체 라이브러리는 ScFv form의 항체를 발현하는 형태로 제작되었으며, 1x1010의 complexity를 지닌다. 전체 라이브러리 중에서 control물질인 AFP-L3는 선택적으로 인지하고 AFP-L1은 인지하지 않는 항체를 선별하기 위하여, 항체 pool을 panning 방법을 통해 선별하였다. Panning방법은 AFP-L3 단백질을 마그네틱 비드에 컨쥬게이션한 것을 사용하였으며, AFP-L3 단백질에 붙는 항체를 선별하기 위해 비드에 binding 시 AFP-L1 control 단백질을 다량 함께 넣어, AFP-L3 control단백질에 더 잘 붙는 항체 pool을 선별하였다. 선별된 항체 Pool 에서 항체를 발현하는 phage clone 각각을 phage displayed 항체의 형태로 발현하였으며, 이의 스크리닝은 ELISA test를 기반으로 진행하였다. The prepared antibody library was constructed in the form of expressing antibody of ScFv form and has a complexity of 1 × 10 10 . Antibody pools were screened by panning method to selectively detect AFP-L3, a control substance, and antibodies not recognizing AFP-L1 in the entire library. Panning was performed by conjugating AFP-L3 protein to magnetic beads. In order to select antibodies to AFP-L3 protein, a large amount of AFP-L1 control protein was added to the beads to bind the AFP-L3 protein A pool of well-matched antibodies was screened. Each phage clone expressing the antibody in the selected antibody pool was expressed in the form of phage displayed antibody. Screening of the phage clone was performed based on ELISA test.

실시예Example 2-2: 면역 및 cDNA 라이브러리 제작 2-2: Immunization and cDNA library production

AFP-L3(Ag)에 특이적으로 결합하는 항체를 선별하기 위하여, 동물 면역 항체 라이브러리를 구축하였다. 상기 라이브러리는 동물에 항원을 면역한 면역세포로부터 mRNA를 얻은 후 항체 유전자의 프라이머 조합을 이용하여 PCR을 통해 항체 유전자를 증폭시키고 파아지 디스플레이를 위한 벡터 내로 클로닝하는 방식으로 수행되었다. To select antibodies specifically binding to AFP-L3 (Ag), an animal immunocyte library was constructed. The library was obtained by obtaining mRNA from immune cells immunizing an animal with an antigen, amplifying the antibody gene through PCR using a primer combination of the antibody gene, and cloning into a vector for phage display.

구체적으로, 화이트 레그혼종의 닭에 코어-푸코실화된 AFP(AFP-L3)(Ag)를 완전 프로인트 보강제(complete Freund's adjuvant) 및 불완전 프로인트 보강제(Sigma, 미국)와 혼합하여 3주 간격으로 5회 피하 주사하였다. 면역한 동물의 혈청을 얻은 후, PBSB(3% 태아혈청알부민(bovine serum albumin)을 포함하는 인산완충용액)를 이용하여 1:100, 1:500, 1:2500 및 1:12500의 농도로 희석하여 보관한 후, 결합여부를 효소면역측정법으로 확인하였다. Specifically, core-fucosylated AFP (AFP-L3) (Ag) was mixed with complete Freund's adjuvant and incomplete Freund's adjuvant (Sigma, USA) 5 times. The serum of the immunized animals was diluted to a concentration of 1: 100, 1: 500, 1: 2500 and 1: 12500 using PBSB (phosphate buffer containing 3% fetal bovine serum albumin) After storage, binding was confirmed by enzyme immunoassay.

구체적인 효소면역측정법은, ELISA 플레이트에 Ag 1ug/ml을 4 ℃에서 밤새 코팅한 후, 상기에서 희석한 혈청을 넣고 2시간 동안 반응시켰다. PBST(0.1% tween-20을 포함하는 PBS)로 3회 세척한 후, 항-닭 면역글로블린-HRP(horse radish peroxidase)(1:3000)를 넣고 1시간 동안 반응시켰다. PBST로 3회 세척한 후 ABTS(Thermo, 미국)을 넣고 20분 동안 발색시킨 후 405 nm에서의 흡광도를 마이크로플레이트 리더(microplate reader)로 측정하였다. 면역 전 혈청은 Ag과 결합하지 않았으며, Ag에 강하게 결합하는 혈청을 생산하는 동물을 선별하였다. In the specific enzyme immunoassay, Ag 1 ug / ml was coated overnight at 4 캜 on an ELISA plate, and diluted serum was added thereto, followed by reaction for 2 hours. After washing three times with PBST (PBS containing 0.1% tween-20), anti-chicken immunoglobulin-HRP (horse radish peroxidase) (1: 3000) was added and reacted for 1 hour. After washing three times with PBST, ABTS (Thermo, USA) was added and developed for 20 minutes. Absorbance at 405 nm was measured with a microplate reader. Preimmune serum was not bound to Ag, and animals producing sera that bind strongly to Ag were selected.

마지막 주사 후 5일 후에 선별된 닭의 골수, 지라 및 파브리시우스낭 조직을 채취하였다. 상기 채취된 조직을 10ml TRI 시약(Molecular research center, 미국)과 혼합하여 호모게나이저로 분쇄한 후 20ml TRI 시약을 추가한 후 원심분리하여 상층액을 얻었다. 여기에 1-브로모-3-클로로프로판(1-bromo-3-chloropropane, BCP) 3ml을 넣고 원심 분리하여 상층액을 얻었다. 이소프로판올 15ml로 전체 RNA를 침전시켜 얻었다. 랜덤 헥사머(random hexamer)를 프라이머로 이용하여 수퍼스크립트 전사 시스템(Invitrogen, 미국)을 이용하여 역전사 반응(65?에서 5분; 4℃에서 5분; 50?에서 50분; 85?에서 5분; 및 4℃)을 수행하였다. 역전사 반응의 결과물인 cDNA를 포함하는 반응액 5μl를 1% 아가로스 젤에 로딩하여 전기영동 후 다양한 길이의 cDNA 밴드를 확인하였다. 상기 랜덤 헥사머 프라이머는 일반식 [d(N)6]로 표현되며, N은 뉴클레오타이드 서열 4종인 A(아데닌),T(티아민),G(구아닌),C(싸이토신)이 모두 포함된 것이다.Five days after the last injection, selected chicken marrow, spleen, and Fabry cysts tissues were harvested. The collected tissues were mixed with 10 ml of TRI reagent (Molecular research center, USA), and homogenized with a homogenizer. Then, 20 ml of TRI reagent was added and centrifuged to obtain supernatant. 3 ml of 1-bromo-3-chloropropane (BCP) was added thereto, and the mixture was centrifuged to obtain a supernatant. And total RNA was precipitated with 15 ml of isopropanol. (5 min at 65 ° C; 5 min at 4 ° C; 50 min at 50 ° C; 5 min at 85 ° C) using a superscript transcription system (Invitrogen, USA) using a random hexamer as primer ; And 4 &lt; 0 &gt; C). 5 μl of the reaction solution containing the resultant cDNA of the reverse transcription reaction was loaded on 1% agarose gel and electrophoresis was performed to identify cDNA bands of various lengths. The random hexamer primer is represented by the general formula [d (N) 6 ], and N includes all of four nucleotide sequences A (adenine), T (thiamine), G (guanine) and C .

실시예Example 2-3: 항체 라이브러리 제작 2-3: Preparation of antibody library

(1)면역 항체 유전자 증폭(1) Immuno-antibody gene amplification

닭 항체의 중쇄와 경쇄의 가변영역인 VH와 VL 도메인을 증폭하기 위하여 다음과 같이 PCR 반응을 수행하였다. The variable regions of heavy and light chains of chicken antibodies, V H and V L To amplify the domain, PCR reaction was performed as follows.

PCR 반응은 실시예 2-1에서 제조한 cDNA를 주형으로 하여, 중쇄 가변영역, 경쇄 가변영역 및 이를 연결한 scFV(single chain Fv) 영역에 맞게 고안된 하기 표 3의 프라이머 조합을 이용하였다. VH 및 VL 각각의 cDNA 라이브러리 0.5 마이크로리터, 30 pmole 순방향 프라이머, 30 pmole 역방향 프라이머, 10x PCR 버퍼, 200 uM dNTPs 및 0.5 ul Taq DNA 폴리머라제를 혼합하여 최종 50 ul를 맞추어 준 후, 94℃에서 5분 반응시킨 후, 94 ℃에서 15초, 56 ℃에서 30초 및 72 ℃에서 90초간 반응시키는 과정을 30 사이클 반복하였다. The PCR reaction was carried out using the primer combination shown in Table 3, which was designed for the heavy chain variable region, the light chain variable region and the scFv (single chain Fv) region linked thereto, using the cDNA prepared in Example 2-1 as a template. V H and V L cDNA libraries 0.5 microliters, 30 pmole forward primer, 30 pmole reverse primer, 10x PCR buffer, 200 uM dNTPs, and 0.5 μl Taq DNA polymerase were mixed and the final 50 μl was mixed, For 5 minutes, followed by 30 cycles of reaction at 94 ° C for 15 seconds, at 56 ° C for 30 seconds, and at 72 ° C for 90 seconds.

구분division 프라이머primer 서열 (5'-->3')Sequences (5 '-> 3') 서열번호SEQ ID NO: VH V H 정방향Forward GGTCAGTCCTCTAGATCTTCCGGCGGTGGTGGCAGCTCCGGTGGTGGCGGTTCCGCCGTGACGTTGGACGAG&Lt; RTI ID = 9999 역방향Reverse CTGGCCGGCCTGGCCACTAGTGGAGGAGACGATGACTTCGGTCCCTGGCCGGCCTGGCCACTAGTGGAGGAGACGATGACTTCGGTCC 100100 VL V L 정방향Forward GTGGCCCAGGCGGCCCTGACTCAGCCGTCCTCGGTGTCGTGGCCCAGGCGGCCCTGACTCAGCCGTCCTCGGTGTC 101101 역방향Reverse GGAAGATCTAGAGGACTGACCTAGGACGGTCAGGGGAAGATCTAGAGGACTGACCTAGGACGGTCAGG 102102 scFVscFV 정방향Forward GAGGAGGAGGAGGAGGAGGTGGCCCAGGCGGCCCTGACTCAGGAGGAGGAGGAGGAGGAGGTGGCCCAGGCGGCCCTGACTCAG 103103 역방향Reverse GAGGAGGAGGAGGAGGAGGAGCTGGCCGGCCTGGCCACTAGTGGAGGGAGGAGGAGGAGGAGGAGGAGCTGGCCGGCCTGGCCACTAGTGGAGG 104104

PCR 증폭된 항체 DNA를 1% 아가로스 젤에 전기 영동하여 각각의 증폭된 DNA를 크기에 따라 분리하고, 겔 추출 키트(Gel extraction kit, Qiagen, 미국)를 이용하여 정제하였다. The PCR amplified antibody DNA was electrophoresed on 1% agarose gel, and each amplified DNA was separated according to the size and purified using a gel extraction kit (Qiagen, USA).

scFv DNA를 얻기 위해, 정제된 VH 50ng, VL 50ng DNA를 주형으로 하여 30 pmole 순방향 프라이머, 30 pmole 역방향 프라이머, 10x PCR 버퍼, 200 uM dNTPs 및 0.5 ul Taq DNA 폴리머라제를 혼합하여 최종 50 ul를 맞추어 준 후, 94℃에서 5분 반응시키고, 94℃에서 30초, 56℃에서 30초 및 72℃에서 2분간 반응시키는 과정을 20 사이클 반복하여 PCR을 수행하였다. 상기 PCR을 통해 증폭된 DNA를 1% 아가로스 젤에 전기 영동하여 각각의 증폭된 DNA를 크기에 따라 분리하고, 겔 추출 키트(Gel extraction kit, Qiagen, 미국)를 이용하여 정제하였다. To obtain scFv DNA, 30 pmole forward primer, 30 pmole reverse primer, 10x PCR buffer, 200 uM dNTPs, and 0.5 uL Taq DNA polymerase were mixed with 50 ng of purified V H , V L 50 ng DNA as a template, Followed by reaction at 94 ° C for 5 minutes, and reaction at 94 ° C for 30 seconds, 56 ° C for 30 seconds, and 72 ° C for 2 minutes. The DNA amplified by the PCR was electrophoresed on 1% agarose gel, and the amplified DNAs were separated according to their sizes and purified using a gel extraction kit (Qiagen, USA).

(2)항체 DNA의 제한효소 절단(2) restriction enzyme cleavage of antibody DNA

상기에서 제조된 scFv와 파지미드 벡터인 pComb3X(the Scripps Research Institute, CA, 미국)를 제한효소 SfiI (Roche, 미국)로 절단하였다. The scFv prepared above and pComb3X (the Scripps Research Institute, CA, USA), a phagemid vector, were digested with restriction enzyme SfiI (Roche, USA).

scFv를 코딩하는 PCR 절편 10ug, 360 units SfiI (Roche, 미국), 20ul 10x 버퍼를 넣고 최종 볼륨이 200ul가 되게 하여 50 ℃에서 밤샘 반응시켰다. 10 ug of the PCR fragment encoding the scFv, 360 units of SfiI (Roche, USA), 20 ul of 10x buffer, and reacted overnight at 50 캜 with a final volume of 200 ul.

또한, pComb3X 벡터 20ug, 120 units SfiI 및 20ul 10x buffer를 넣고 최종 볼륨이 200ul가 되게 하여 50℃에서 밤샘 반응시켰다. 상기 제한효소로 절단한 각각의 절편을 아가로스 젤에 전기영동한 후 겔 추출 키트(Qiagen, 미국)를 이용하여 정제하였다.In addition, 20 ug of the pComb3X vector, 120 units of SfiI and 20 μl of 10 × buffer were added and reacted at 50 ° C. overnight to a final volume of 200 μl. Each of the sections cut with the restriction enzyme was electrophoresed on an agarose gel and then purified using a gel extraction kit (Qiagen, USA).

(3)항체 DNA의 (3) Antibody DNA 라이게이션Ligation 및 라이브러리의 제조 &Lt; / RTI &gt;

scFv 절편을 pComb3X 벡터에 삽입하기 위하여, 제한효소 SfiI를 이용하여 절단한 scFv를 코딩하는 PCR 절편 700ng 및 pComb3X 1.4ug을 혼합하고, T4 DNA 라이게이즈(Invitrogen, 미국)를 첨가하여 16℃에서 밤새 반응시켰다. 상기 라이게이션 혼합물을 에탄올 침강법으로 정제하고, 대장균 ER2738(New England Biolab, 미국)에 전기 천공법(electroporation)으로 형질전환시켜 46ug/ml 카베니실린 및 70ug/ml 카나마이신 하에서 배양하여 1X1010 complexity를 가진 라이브러리를 제작하여 이용하였다.In order to insert the scFv fragment into the pComb3X vector, 700 ng of the PCR fragment encoding the scFv cleaved with restriction enzyme SfiI and 1.4 p of pComb3X were mixed and added with T4 DNA ligase (Invitrogen, USA) Lt; / RTI &gt; Purifying the ligation mixture by ethanol precipitation method, E. coli ER2738 (New England Biolab, USA), electroporation (electroporation) into transformed by culturing under 46ug / ml carbenicillin and 70ug / ml kanamycin to 1X10 10 complexity in Was constructed and used.

실시예Example 2-4: 항- 2-4: anti- AgAg scFVscFV 를 포함하는 파지 클론의 선별Screening of phage clones

수득한 scFv의 형태로 랜덤화된 중쇄와 경쇄를 갖는 라이브러리로부터 Ag에 결합하는 항체를 고체에 지지된 Ag을 이용하여 선별하였다.Antibodies binding to Ag from libraries with heavy and light chains randomized in the form of scFv obtained were selected using Ag supported on solid.

결합하는 항체 선별하고자, 먼저 마그네틱 비드에 Ag 10마이크로그램을 각각 컨쥬게이션시켰다. 수득한 scFv 형태의 항체를 파아지의 코트 단백질 PIII와 융합하여 디스플레이할 수 있게 만들어진 항체 라이브러리 DNA를 대장균 ER2738(New England Biolab)에 전기천공법으로 형질전환시키고, 37℃에서 배양 후 VCSM13 헬퍼 파지(Stratagene, 미국)를 넣은 후 46ug/ml 카베니실린과 70ug/ml 카나마이신을 넣고 SB 배지(30g/L 트립톤, 20g/L 효모 추출물 및 10g/L MOPS, pH 7.0)에서 밤새 배양하였다. Antibody binding To select, first 10 micrograms of Ag were conjugated to the magnetic beads, respectively. Antibody library DNA made to display the resultant fused scFv-type antibody with the phage coat protein PIII was transformed into E. coli ER2738 (New England Biolab) by electroporation, incubated at 37 DEG C, and then transformed into VCSM13 helper phage , USA), and then 46 ug / ml carbenicillin and 70 ug / ml kanamycin were added and cultured overnight in SB medium (30 g / L tryptone, 20 g / L yeast extract and 10 g / L MOPS, pH 7.0).

상기 수득한 대장균과 파아지를 포함하는 배양액을 원심분리하여 침전된 대장균을 제거하였다. 상등액만을 회수한 후, 40mg/ml 폴리에틸렌글리콜 8000과 30mg/ml NaCl을 첨가하고 원심 분리하여 PEG에 의해 침전된 파아지를 모아 PBS로 재현탁하였다. The culture solution containing the Escherichia coli and the phage obtained above was centrifuged to remove the precipitated E. coli. After recovering only the supernatant, 40 mg / ml polyethylene glycol 8000 and 30 mg / ml NaCl were added and centrifuged to collect the phage precipitated by PEG and resuspended in PBS.

마그네틱 비드에 컨쥬게이션된 Ag와 파아지를 상온에서 2시간 동안 반응시킴으로써 Ag 에 친화력을 가진 파아지를 결합시킨 후, 이를 0.5% Tween 20을 포함하는 PBS로 세척하고, 0.1M 글리신(pH 2.2)용액으로 용출하고 2M 트리스 용액으로 중화시켰다. 용출된 파아지는 다음 라운드 패닝(panning)을 위해 대장균 ER2738에 감염시켜 밤새 배양하여 증식시켰다. 이러한 과정을 4차례 반복하며 패닝(panning)을 진행하였다. 패닝 횟수가 증가할수록 세척 횟수가 증가하여 결합력이 높은 파아지를 축적하였다. Ag-phage affinity Ag was bound to the magnetic beads by reacting the Ag and the phage at room temperature for 2 hours, then washed with PBS containing 0.5% Tween 20, and immersed in 0.1 M glycine (pH 2.2) solution Eluted and neutralized with 2M Tris solution. The eluted phages were infected with E. coli ER2738 for subsequent round panning and cultured overnight to proliferate. This process was repeated four times and panning was performed. As the number of panning increases, the number of washing increases and the phages with high binding force accumulate.

4차 패닝 결과물의 플레이트로부터 선별된 개별 클론을 96 딥웰(deep well) 플레이트에서 100ug/ml 카베니실린, 70ug/ml 카나마이신 및 VCSM13 헬퍼 파아지(1:1000)를 넣고 37℃에서 밤새 배양하여 항체가 발현된 파아지의 증식을 유도하였다.Individual clones selected from the plates of the fourth pan result were incubated overnight at 37 ° C with 100 ug / ml carbenicillin, 70 ug / ml kanamycin and VCSM13 helper phage (1: 1000) in a 96 well deep well plate, The proliferation of the expressed phage was induced.

상기에서 수득한 배양액을 원심분리를 이용해 파아지를 포함한 배지 상등액을 얻고 Ag이 코팅되어 있는 ELISA 플레이트에 준비한 파아지를 넣고 37 ℃에서 2시간 동안 배양하였으며, HRP가 컨쥬게이션되어 있는 항-M13 항체를 이차항체로 이용하여 결합하는 항체를 ELISA로 확인하였다. The medium obtained above was centrifuged to obtain a supernatant containing the phage. The phage prepared in the EL-coated plate coated with Ag was incubated at 37 ° C for 2 hours. The anti-M13 antibody conjugated with HRP was incubated with secondary Antibodies used as antibodies were identified by ELISA.

실시예Example 2-5: 선별된 항체의 서열분석 2-5: Sequence analysis of selected antibodies

상기 실시예 2-4에서 선별조건에서 양성 반응을 나타내는 클론을 가지고 있는 ER2738을 SB 배지로 밤새 배양한 후 원심분리하여 대장균을 얻었다. DNA 미니 프렙 키트(진올, 한국)를 이용하여 플라스미드 DNA를 얻어 염기서열을 분석하였다. 염기서열 결정을 위해 하기 표 4에 나타낸 바와 같은 시퀀싱 프라이머 서열번호 (정방향) 및 (역방향)의 프라이머를 이용하여 분석하였다.In Example 2-4, ER2738 having a clone showing a positive reaction under selection conditions was cultured overnight in SB medium, followed by centrifugation to obtain E. coli. Plasmid DNA was obtained using a DNA mini prep kit (Jinol, Korea) and the nucleotide sequences thereof were analyzed. Sequencing primers were sequenced using sequencing primer sequence numbers (forward) and (reverse) primers as shown in Table 4 below.

정방향(서열번호 105)(SEQ ID NO: 105) ACACTTTATGCTTCCGGCTCACACTTTATGCTTCCGGCTC 역방향(서열번호 106)Reverse (SEQ ID NO: 106) CAAAATCACCGGAACCAGAGCAAAATCACCGGAACCAGAG

실시예Example 2-6: 항체 선별을 위한 ELISA test 2-6: ELISA test for antibody selection

ELISA plate에 HA tag을 인지하는 monoclonal HA antibody(Abcam, 영국)를 코팅하고 각 well을 BSA solution으로 블라킹을 37℃ 1시간 반응하였다. 이 후, 앞선 panning 작업으로 선택된 pool 중 각 clone을 phage displayed scFv 로 발현된 E.coli culture media를 37℃ 2시간 추가 반응시켰다. 3번의 PBST 용액으로 세척 후, 정제된 Control AFP-L3, Control AFP-L1 단백질(10ug/ml)을 항체가 코팅된 플레이트에 37℃ 2시간 반응시켰다. 이후 3번의 PBST용액으로 세척한 후, AFP를 인지하는 탐지항체를 Biotinylation시켜 둔 항체를 37℃에서 2시간 반응시켰다. 3번의 PBST 용액으로 세척 후, avidin-HRP항체를 37℃에서 1시간 반응 시켰다. 3번의 PBST 용액으로 재 세척 후, ABTS solution 으로 발색하여 실온에서 30분 반응 시킨 후, OD=450nM 에서 각 well의 OD 값을 측정한다. 상기 탐지항체는 AFP-L1, AFP-L3를 구별하지 않고 AFP를 모두 인식하는 항체로서 Milipore사, ST1673, Anti-AFP Mouse mAb(1G7)를 탐지항체로 선택하여 사용하였다. A monoclonal HA antibody (Abcam, UK) was coated on the ELISA plate to recognize HA tag, and each well was reacted with BSA solution for 1 hour at 37 ° C. Each clone of the pool selected by the preceding panning operation was further reacted with E. coli culture media expressed by phage displayed scFv for 2 hours at 37 ° C. After washing with 3 PBST solutions, the purified Control AFP-L3 and Control AFP-L1 protein (10 ug / ml) were reacted at 37 ° C for 2 hours on an antibody-coated plate. After washing with PBST solution three times, the antibodies that had been biotinylated with AFP-recognizing antibody were reacted at 37 ° C for 2 hours. After washing with 3 PBST solutions, avidin-HRP antibody was reacted at 37 ° C for 1 hour. After washing again with 3 PBST solutions, the cells are developed with ABTS solution, reacted at room temperature for 30 minutes, and then the OD value of each well is measured at OD = 450 nM. Milipore, ST1673, and Anti-AFP Mouse mAb (1G7) were used as the detection antibody, which did not discriminate between AFP-L1 and AFP-L3.

위의 테스트에 사용한 후보 E.coli 발현 항체는 총 5종으로 항체의 이름은 L3-1 A4, L3P2-D5, 1-1 H1, L3-2 C10, 2-1 B8 총 5종 중 2종(L3-2 C10, 2-1 B8)이 선별되었다. 3회 반복의 실험의 평균값이다. Screening 시 후보항체를 capture 항체로 적용하여 실험 진행하였다. The candidate E. coli-expressing antibodies used in the above test were 5 species, and the antibodies were named L3-1 A4, L3P2-D5, 1-1 H1, L3-2 C10, 2-1 B8 L3-2 C10, 2-1 B8) were selected. It is the average value of the experiment of 3 repetitions. During the screening, the candidate antibody was applied as capture antibody.

구분division BSABSA AFP-L1AFP-L1 AFP-L3AFP-L3 L3-1 A4L3-1 A4 0.140.14 0.130.13 0.130.13 L3P2-D5L3P2-D5 0.150.15 0.230.23 0.310.31 1-1 H11-1 H1 0.140.14 0.230.23 0.250.25 L3-2 C10L3-2 C10 0.130.13 1.161.16 3.463.46 2-1 B82-1 B8 0.160.16 0.180.18 0.630.63

E.coli 발현된 항체를 sandwich ELISA 기법으로 screening 하여, 표준물질AFP-L3를 친화적으로 인지하는 최종 2개의후보 항체(L3-2 C10, 2-1 B8)을 선별하였다. E. coli expressed antibodies were screened by sandwich ELISA to select the final two candidate antibodies (L3-2 C10, 2-1 B8) that recognize the reference AFP-L3 as affinity.

실시예Example 3: 샌드위치  3: Sandwich ELISA 를ELISA 이용한 항체의 AFP- AFP- L3L3 구별성능 확인 및 선별 Identifying and Selecting Distinctive Performance

Sandwich ELISA를 이용한 AFP-L3의 당의 존재 유무에 따른 항체의 결합 영향 평가하고자 하였다. To evaluate the binding affinity of the AFP-L3 antibody to the presence or absence of the sugar using the sandwich ELISA.

실시예 2에서와 유사하게 항체의 선별은 monoclonal HA항체를 플레이트에 코팅 시키고, BSA 용액을 37℃에서 1시간 반응하여 블라킹을 진행하였다. 이후 phage displayed scFv(C10, B8) 항체를 해당 well에서 37℃에서 2시간 반응시켰다. 이후 control AFP-L1, control AFP-L3와 함께 N-glycosidase PNGase 효소(NEB,미국)를 처리하여 단백질의 당이 제거된 형태의 AFP-L1, AFP-L3를 10ug/ml 농도로 37℃에서 2시간 반응을 시행하였고, 이후의 과정은 앞의 실시예 2-6의 방법과 동일하게 수행하였으며 3회 반복 실험의 평균값을 나타냈다.Similar to Example 2, the antibody was screened by coating a monoclonal HA antibody on the plate, and the BSA solution was reacted at 37 ° C for 1 hour to perform blocking. The phage displayed scFv (C10, B8) antibody was then reacted in the wells at 37 ° C for 2 hours. AFP-L1 and AFP-L3, in the form of protein-free sugars, were treated with N-glycosidase PNGase enzyme (NEB, USA) with control AFP-L1 and control AFP- The reaction was carried out in the same manner as in Example 2-6, and the average values of the triplicate experiments were shown.

선별 항체가 당을 제거하지 않은 단백질보다 AFP-L3의 당을 제거한 표준물질에 더 약하게 결합하는 것을 확인하였다. 선별항체가 당을 인지하고(epitope이 AFP-L3 당 부분 포함) AFP-L3 표준 물질에 친화적으로 결합함을 확인하였다. 상기 항체 IgG O.D 값을 하기 표 6에 나타냈다.It was confirmed that the selective antibody binds weakly to the standard substance from which the sugar of AFP-L3 was removed than the protein which did not remove the sugar. It was confirmed that the screening antibody recognizes the sugar (including the epitope AFP-L3 part) and binds affinity to the AFP-L3 reference material. The antibody IgG O.D values are shown in Table 6 below.

항원antigen L3-2 C10항체L3-2 C10 antibody L2-1 B8항체L2-1 B8 antibody AFP-L1AFP-L1 0.610.61 0.230.23 AFP-L1(당제거)AFP-L1 (sugar removal) 0.300.30 0.180.18 AFP-L3AFP-L3 2.082.08 1.231.23 AFP-L3(당제거)AFP-L3 (sugar removal) 1.661.66 0.610.61

선별 항체 C10 및 B8 은 AFP-L3 의 당을 제거한 표준물질에는 당을 제거하지 않은 단백질보다 약하게 binding하는 것을 확인하였다. 이를 통해 선별항체가 당을 인지하고(epitope이 AFP-L3 당 부분 포함) AFP-L3 표준 물질에 친화적으로 binding 함을 확인하였다. The screening antibodies C10 and B8 were found to weakly bind to AFP-L3-depleted standards than to proteins that did not remove sugars. This confirms that the selective antibody recognizes the sugar (including the epitope AFP-L3 part) and binds affinity to the AFP-L3 reference material.

실시예Example 4: 천연 AFP- 4: Natural AFP- L3L3 항체 후보 선정 및 성능 확인(정제된 동물세포 이용 발현항체 적용( Selection of antibody candidates and performance confirmation (application of antibody expressing purified animal cells IgGIgG ))))

실시예Example 4-1: 정제된 동물세포 이용 발현 항체 적용 4-1: Application of expressing antibody using purified animal cells

실시예 2에서 수득한 항체의 친화도 측정 및 활성 분석을 위하여 면역글로불린(IgG) 단백질을 생산하였다. 구체적으로, scFv를 포함하는 pComb3x로부터 중쇄 및 경쇄의 가변영역과 불변영역의 절편을 하기 표 7의 프라이머 조합을 이용해서 실시예 2와 같은 조건의 PCR을 통해 수득하였다. Immunoglobulin (IgG) protein was produced for the determination of the affinity of the antibody obtained in Example 2 and the activity analysis. Specifically, fragments of the variable region and the constant region of the heavy chain and light chain from pComb3x containing scFv were obtained through PCR under the same conditions as in Example 2 using the primer combination shown in Table 7 below.

즉, 각 가변영역과 불변영역(CH 및 Ck)을 하기 표 7의 HC 및 LC 프라이머 조합을 이용하여 PCR로 각각 중쇄와 경쇄를 얻어냈고, pcDNATM3.3-TOPO® 클로닝 키트 및 pOptiTMVEC-TOPO®A 클로닝 키트(Invitrogen, 미국)를 이용하여 포유류 세포 발현 플라스미드로 옮겼다. 각 벡터(pcDNATM3.3-TOPO®벡터와 pOptiTM VEC-TOPO®벡터) 1ul와 절편을 200 mM NaCl 및 10 mM MgCl2이 포함된 완충액에 총 6ul가 되게 첨가하여 상온에서 5분 동안 반응시켰다. DH 5a 대장균 competent cell에 열충격을 가하여 형질전환하여 콜로니를 얻은 후 대량 배양하여 플라스미드를 얻었다. That is, each variable region and constant region (CH and Ck) were subjected to PCR using HC and LC primer combinations shown in Table 7 below to obtain heavy and light chains, respectively. The pcDNAATM3.3-TOPO.RTM. Cloning kit and pOptiTMVEC- And transferred to mammalian cell expression plasmids using a kit (Invitrogen, USA). 1 μl of each vector (pcDNATM3.3-TOPO® vector and pOptiTM VEC-TOPO® vector) and a slice were added to a buffer solution containing 200 mM NaCl and 10 mM MgCl 2 in a total volume of 6 μl, and reacted at room temperature for 5 minutes. DH 5a Escherichia coli competent cells were transformed with heat shock to obtain colonies, followed by mass culture to obtain plasmids.

구분division 프라이머primer 서열(5'->3')Sequences (5 '-> 3') 서열번호SEQ ID NO: VH V H 정방향Forward GCTAGCCGCCACCATGGGCGCTAGCCGCCACCATGGGC 107107 역방향Reverse AGGGGCCCTTGGTGGAGGCCTGGCCGGCCTGGCCACTAGGGGCCCTTGGTGGAGGCCTGGCCGGCCTGGCCACT 108108 CH C H 정방향Forward GCCTCCACCAAGGGCCCCTCGCCTCCACCAAGGGCCCCTC 109109 역방향Reverse CGGGATCCCTTGCCGGCCGTCGGGATCCCTTGCCGGCCGT 110110 HCHC 정방향Forward GCTAGCCGCCACCATGGGCGCTAGCCGCCACCATGGGC 111111 역방향Reverse CGGGATCCCTTGCCGGCCGTCGGGATCCCTTGCCGGCCGT 112112 VL V L 정방향Forward AAGCTTGCCGCCACCATGAAGCTTGCCGCCACCATG 113113 역방향Reverse AGGGGGCGGCCACGGTCCGGGAAGATCTAGAGGACTGAGGGGGCGGCCACGGTCCGGGAAGATCTAGAGGACTG 114114 Ck C k 정방향Forward CGGACCGTGGCCGCCCCCTCCGGACCGTGGCCGCCCCCTC 115115 역방향Reverse GCTCTAGACTAGCACTCGCGCTCTAGACTAGCACTCGC 116116 LCLC 정방향Forward AAGCTTGCCGCCACCATGAAGCTTGCCGCCACCATG 117117 역방향Reverse GCTCTAGACTAGCACTCGCGCTCTAGACTAGCACTCGC 118118

상기 플라스미드를 이용하여 HEK293F 세포(Invitrogen, 미국)에 형질감염시킨 후, 7일 동안 배양하여 수득한 항체를 단백질 A 컬럼 (GE, 미국)을 사용하여 정제하였다. 배양액을 컬럼에 로딩하여 배양액 중에 있는 항체(IgG)를 단백질 A와 결합시키고 20mM 구연산 나트륨 버퍼 (pH3.0)로 용출하였다. 도 6에 나타낸 바와 같이, SDS-PAGE를 통해 경쇄와 중쇄의 SDS-PAGE를 통해 경쇄(25kDa)와 중쇄(50kDa)의 이론적 계산치와 일치하는 분자량과 높은 순도를 확인하였다. The plasmid was used to transfect HEK293F cells (Invitrogen, USA), and incubated for 7 days. The obtained antibody was purified using protein A column (GE, USA). The culture was loaded on the column, and the antibody (IgG) in the culture broth was bound to Protein A and eluted with 20 mM sodium citrate buffer (pH 3.0). As shown in FIG. 6, molecular weight and high purity were confirmed by SDS-PAGE of light and heavy chains in accordance with the theoretical calculated values of light chain (25 kDa) and heavy chain (50 kDa).

실시예Example 4-2: control 기준 물질에 대한 항체의 구별 성능 확인 4-2: Identification of Antibody Separation Performance against Control Reference Substance

선별용 Sandwich ELISA 방법은, AFP-L3 단백질을 선택적으로 인지하는 후보 항체를 IgG 형태로 발현하여 정제 후 이를 5ug/ml의 농도로 ELISA plate에 coating하였다. 각 well을 BSA solution으로 블라킹하고, 실시예 1에서 정제된 Control AFP-L3 및 Control AFP-L1 단백질(10ug/ml)을 항체가 코팅된 플레이트에 37℃에서 2시간 반응시켰다. 이 후 3번의 PBST용액으로 세척 후, 탐지항체를 37℃에서 2시간 반응 후, 이후 3번의 PBST용액으로 재 세척 후, Biotin과 반응하는 avidin에 HRP 효소가 표지되어 있는 2차 항체를 37℃에서 1시간 반응시켰다. 3번의 PBST용액으로 세척 후, ABTS solution 으로 발색하여 실온에서 30분 반응시킨 후, OD=450nM 에서 각 well의 OD 값을 측정한다. 3반복 실험의 평균값이다. 시험결과를 하기 표 8 및 도 7에 나타냈다. 상기 탐지항체는 AFP-L1, AFP-L3를 구별하지 않고 AFP를 모두 인식하는 항체로서 Milipore사, ST1673, Anti-AFP Mouse mAb(1G7)를 탐지항체로 선택하여 사용하였다. The selective sandwich ELISA method was performed by expressing a candidate antibody selectively recognizing AFP-L3 protein in an IgG form and then coating it on an ELISA plate at a concentration of 5 ug / ml. Each well was blotted with BSA solution, and the Control AFP-L3 and Control AFP-L1 protein (10 ug / ml) purified in Example 1 were reacted at 37 ° C for 2 hours on an antibody-coated plate. After washing three times with PBST solution, the detection antibody was reacted at 37 ° C for 2 hours, and then re-washed with PBST solution three times. Then, secondary antibody labeled with HRP enzyme in avidin reacted with Biotin was incubated at 37 ° C And reacted for 1 hour. After washing with 3 PBST solutions, the cells are developed with ABTS solution, reacted at room temperature for 30 minutes, and OD value of each well is measured at OD = 450 nM. 3 is the mean value of the repeated experiments. The test results are shown in Table 8 and FIG. Milipore, ST1673, and Anti-AFP Mouse mAb (1G7) were used as the detection antibody, which did not discriminate between AFP-L1 and AFP-L3.

항원antigen L3-2 C10항체L3-2 C10 antibody L2-1 B8항체L2-1 B8 antibody AFP-L1 50 ng/mlAFP-L1 50 ng / ml 0.230.23 No dataNo data AFP-L1 100 ng/mlAFP-L1 100 ng / ml 0.160.16 0.410.41 AFP-L1 1000 ng/mlAFP-L1 1000 ng / ml 0.630.63 0.130.13 AFP-L3 50 ng/mlAFP-L3 50 ng / ml 0.370.37 No dataNo data AFP-L3 100 ng/mlAFP-L3 100 ng / ml 0.340.34 0.330.33 AFP-L3 1000 ng/mlAFP-L3 1000 ng / ml 1.971.97 0.890.89

표 8 및 도 6의 실험 결과에 나타낸 바와 같이, IgG 형태 선별 항체 중 하나인 L3-2 C10 항체가 표준물질 AFP-L3에 대해 AFP-L1 보다 높은 친화도를 가지고 구별함을 확인하였고, L3-2 C10 항체가 50ng/ml 라는 상대적으로 낮은 농도에서 구별 성능을 보였다.As shown in the results of Table 8 and FIG. 6, it was confirmed that the L3-2C10 antibody, one of the IgG type selection antibodies, had a higher affinity for AFP-L3 than the AFP-L3, and L3- 2 &lt; / RTI &gt; C10 antibody showed a discriminative performance at a relatively low concentration of 50 ng / ml.

실시예Example 4-3: Wako calibrator 에 대한 항체의 구별 성능 확인 4-3: Identification of antibodies to Wako calibrator

실시예 2에서 얻은 AFP-L3을 선택적으로 인지하는 항체를 IgG 형태로 발현하여 정제 후 이를 5ug/ml의 농도로 ELISA plate에 coating하였다. 각 well을 BSA solution으로 블라킹하고, Wako calibrator AFP-L3(100ng/ml), Wako Calibrator AFP-L1 단백질(100ng/ml)을 항체가 코팅된 플레이트에 37℃ 2시간 반응시켰다. 이 후 3번의 PBST용액으로 세척 후, 탐지항체를 37 ℃에서 2시간 반응 후, 이후 3번의 PBST용액으로 세척 후, Biotin과 반응하는 avidin에 HRP 효소가 label되어 있는 2차 항체를 37℃에서 1시간 반응시켰다. 3번의 PBST 용액으로 세척 후, ABTS solution 으로 발색하여 실온에서 30분 반응시킨 후, OD=450nM 에서 각 well의 OD 값을 측정한다. 3회 반복 실험의 평균값이다. 상기 탐지항체는 AFP-L1, AFP-L3를 구별하지 않고 AFP를 모두 인식하는 항체로서 Milipore사, ST1673, Anti-AFP Mouse mAb(1G7)를 탐지항체로 선택하여 사용하였다.An antibody selectively recognizing AFP-L3 obtained in Example 2 was expressed in the form of IgG, purified, and then coated on an ELISA plate at a concentration of 5 ug / ml. Each well was blotted with BSA solution, and Wako calibrator AFP-L3 (100 ng / ml) and Wako Calibrator AFP-L1 protein (100 ng / ml) were reacted at 37 ° C for 2 hours on an antibody-coated plate. After washing with 3 PBST solutions, the detection antibody was reacted at 37 ° C for 2 hours, then washed with 3 PBST solutions, and then the secondary antibody labeled with HRP enzyme in avidin reacted with Biotin was incubated at 37 ° C for 1 hour Lt; / RTI &gt; After washing with 3 PBST solutions, the cells are developed with ABTS solution, reacted at room temperature for 30 minutes, and OD value of each well is measured at OD = 450 nM. It is the average value of 3 repeated experiments. Milipore, ST1673, and Anti-AFP Mouse mAb (1G7) were used as the detection antibody, which did not discriminate between AFP-L1 and AFP-L3.

항원antigen L3-2 C10항체L3-2 C10 antibody Wako AFP-L1(100 ng/ml)Wako AFP-L1 (100 ng / ml) 0.210.21 Wako AFP-L3(100 ng/ml)Wako AFP-L3 (100 ng / ml) 0.320.32

선별 항체 L3-2 C10의 경우, Wako 사 판매 AFP-L1 및 AFP-L3에 대해 100ng/ml의 농도 구간에서 AFP-L1과 AFP-L3를 구별하는 성능을 보임을 확인하였다. In the case of the screening antibody L3-2 C10, it was confirmed that AFP-L1 and AFP-L3, which were sold by Wako, were distinguished from AFP-L1 and AFP-L3 at a concentration range of 100 ng / ml.

즉, 본 발명에 따른 선별 항체 L3-2 C10를 이용한 면역 분석법을 사용하여, 대상 탐지 항원을 두 가지로 구분하여 실험을 수행한 결과, 실시예 1에서 정제하여 확보한 control AFP-L1 및 AFP-L3단백질을 대상으로 측정한 결과와, Wako 사 판매표준 물질인 AFP-L1 및 AFP-L3 단백질을 대상으로 측정한 결과 모두 유의하게 AFP-L1과 AFP-L3를 구별하는 성능을 확인하였다.That is, by performing immunoassay using the screening antibody L3-2 C10 according to the present invention, the target detection antigens were divided into two groups, and as a result, the control AFP-L1 and AFP- L3 protein, and AFP-L1 and AFP-L3 proteins, which are sales standard products of Wako Co., respectively. As a result, AFP-L1 and AFP-L3 were distinguished from each other.

실시예Example 5: ELISA를 이용한 Wako system과 비교 분석 5: Comparison with Wako system using ELISA

5-1: 시료 제조5-1: Preparation of sample

Sandwich ELISA 측정 방법으로서, 실시예 1에서 정제하여 확보한 control AFP-L1, AFP-L3단백질을 이용하여 전체 단백질 농도가 200ng/ml이 되도록 혼합하며, 이 때 혼합의 기본 버퍼 조건은 구매한 AFP depleted serum을 이용하여 혼합된 AFP 단백질 용액을 제조하였다. As a sandwich ELISA assay, control AFP-L1 and AFP-L3 proteins purified and purified in Example 1 were mixed so that the total protein concentration was 200 ng / ml. At this time, the basic buffer conditions of the mixture were AFP depleted serum was used to prepare mixed AFP protein solution.

5-2: 5-2: ELSIAELSIA 방법으로 분석Analysis by method

실시예 1에서 정제하여 확보한 control AFP-L1, AFP-L3단백질을 이용하여 본 발명에 따른 항체를 이용한 ELISA 분석방법으로 분석하였다. The control AFP-L1 and AFP-L3 proteins purified and obtained in Example 1 were analyzed and analyzed by an ELISA analysis method using an antibody according to the present invention.

구체적으로, 상기 5-1에서 제조한 시료에 대해서, 상기 실시예 2-6의 방법에 따라 ELISA 분석을 수행하였고, 이러한 분석결과를 하기 표 10에 나타내었다.Specifically, the ELISA analysis was carried out on the sample prepared in 5-1 above according to the method of Example 2-6, and the results of the analysis are shown in Table 10 below.

5-3: WAKO 분석기계로 분석5-3: Analysis by WAKO analysis machine

실시예 1에서 정제하여 확보한 control AFP-L1, AFP-L3단백질을 이용하여 Wako사의 uTas i30기기를 이용한 ELISA 분석방법으로 분석하였다. The control AFP-L1 and AFP-L3 proteins purified and purified in Example 1 were analyzed by ELISA analysis using a uTas i30 instrument from Wako.

이를 Wako사의 uTas i30기기로 측정하여 AFP-L3(%) 값을 구하고, 또한 본 개발에서 확보한 L3-2 C10 항체의 IgG 를 코팅하여 각 샘플을 Sandwich ELISA를 통해 각 샘플을 AFP 인지할 수 있는 항체 pair 및 L3-2 C10를 이용한 코어-푸코실화된 AFP(AFP-L3)인지를 위한 항체 pair를 적용하여 Sandwich ELISA test 를 수행하였다.The value of AFP-L3 (%) was obtained by measuring with a Wako uTas i30 instrument, and the IgG of the L3-2 C10 antibody obtained in the present invention was coated, and each sample was identified as AFP through a sandwich ELISA Sandwich ELISA test was performed by applying an antibody pair for recognition of core-fucosylated AFP (AFP-L3) using antibody pair and L3-2 C10.

이 때 그려지는 Standard curve를 적용하여 계산되는 전체 AFP 단백질의 양 및 L3-2 C10을 이용하여 측정된 코어-푸코실화된 AFP의 양을 구한 후, 이를 % 수치화 하여 Wako에서 측정된 수치와의 연관관계 확인을 위해 피어슨 상관계수 값을 계산하였다.The amount of total AFP protein calculated by applying the standard curve drawn at this time and the amount of core-fucosylated AFP measured using L3-2 C10 were determined, and the result was expressed as% Pearson correlation coefficients were calculated to confirm the relationship.

구분division 전체 AFP 단백질 농도(ng/mL)Total AFP protein concentration (ng / mL) AFP-L1 단백질 (ng/mL)AFP-L1 protein (ng / mL) AFP-L3 단백질 (ng/mL)AFP-L3 protein (ng / mL) AFP-L3(%)-wako uTas 측정치AFP-L3 (%) - wako uTas measurement value AFP-L3(%)-개발항체 ELISA 측정치AFP-L3 (%) - developed antibody ELISA measurement value 시료1Sample 1 200200 2020 180180 33.633.6 11,611,6 시료2Sample 2 200200 100100 100100 55.455.4 16.216.2 시료3Sample 3 200200 180180 2020 81.481.4 33.233.2

uTas 측정수치와 개발 항체 측정 수치간의 Correlation score는 0.96이었다.동일 분석 시료인 실시예 1에서 정제하여 확보한 control AFP-L1 및 AFP-L3단백질을 대상으로 측정한 AFP-L3%의 측정치 면에서, 본 발명에 따른 개발항체를 이용한 면역 분석법과 WAKO사의 uTas 기기를 이용한 분석법 사이에 높은 상관관계가 있음을 확인할 수 있었다.The correlation score between the uTas measurement value and the developed antibody measurement value was 0.96. From the measured values of AFP-L3% measured for the control AFP-L1 and AFP-L3 proteins purified in Example 1, which is the same assay sample, It can be confirmed that there is a high correlation between the immunoassay using the developed antibody according to the present invention and the assay using the uTas instrument of WAKO.

실시예Example 6: 다양한 항체 제조 및 활성 확인 6: Various antibody production and activity confirmation

6-1: 항체 제조6-1: Antibody production

항체 선별을 위한 선별항체의 random mutagenesis를 통한 선별 항체 라이브러리 제작 및 후보항체 선별하였다.A screening antibody library was prepared by random mutagenesis of the screening antibody for screening of antibodies and a candidate antibody was screened.

상기 선별된 C10 항체의 scFv 서열을 주형으로 항체의 유전자를 서열번호 103,104에 제시된 프라이머를 이용하여 항체를 PCR 반응을 시켰다. 항체를 증폭 시 항체의 염기서열에 random mutagenesis를 도입하기 위하여 random mutagenesis kit(Jenabioscience, 독일)을 이용하여 키트에 작성된 방법대로 항체 유전자에 random mutagesis를 도입하였다. 위의 키트를 통해 증폭된 항체의 유전자를 항체 DNA의 제한효소 절단부터의 실험과정은 실시예 2-3: 항체 라이브러리 제작에서 작성된 것과 동일하게 진행하여 C10 random mutagenesis된 항체 라이브러리를 제작하여 5*109 complexity를 갖는 항체를 확보하였다. The scFv sequence of the selected C10 antibody was used as a template and the antibody gene was subjected to PCR using the primers shown in SEQ ID NOS: 103 and 104. In order to introduce random mutagenesis into the base sequence of the antibody upon amplification of the antibody, random mutagenesis was introduced into the antibody gene using the random mutagenesis kit (Jenabioscience, Germany) as described in the kit. The antibody gene amplified by the above kit was subjected to restriction enzyme digestion in the same manner as described in Example 2-3: Preparation of Antibody Library, and a C10 random mutagenized antibody library was prepared. 9 complexity.

수득한 scFv의 형태로 랜덤화된 중쇄와 경쇄를 갖는 라이브러리로부터 Ag에 결합하는 항체를 고체에 지지된 Ag을 이용하여 선별하였다.Antibodies binding to Ag from libraries with heavy and light chains randomized in the form of scFv obtained were selected using Ag supported on solid.

6-2: 결합하는 항체 선별6-2: Antibody screening

먼저, 마그네틱 비드에 Ag 10마이크로그램을 각각 컨쥬게이션시켰다. First, 10 micrograms of Ag were conjugated to the magnetic beads, respectively.

수득한 scFv 형태의 항체를 파아지의 코트 단백질 PIII와 융합하여 디스플레이할 수 있게 만들어진 항체 라이브러리 DNA를 대장균 ER2738(New England Biolab)에 전기천공법으로 형질전환시키고, 37℃에서 배양 후 VCSM13 헬퍼 파지(Stratagene, 미국)를 넣은 후 46ug/ml 카베니실린과 70ug/ml 카나마이신을 넣고 SB 배지(30g/L 트립톤, 20g/L 효모 추출물 및 10g/L MOPS, pH 7.0)에서 밤새 배양하였다. Antibody library DNA made to display the resultant fused scFv-type antibody with the phage coat protein PIII was transformed into E. coli ER2738 (New England Biolab) by electroporation, incubated at 37 DEG C, and then transformed into VCSM13 helper phage , USA), and then 46 ug / ml carbenicillin and 70 ug / ml kanamycin were added and cultured overnight in SB medium (30 g / L tryptone, 20 g / L yeast extract and 10 g / L MOPS, pH 7.0).

상기에서 수득한 대장균과 파아지를 포함하는 배양액을 원심분리하여 침전된 대장균을 제거하였다. 상등액만을 회수한 후, 40mg/ml 폴리에틸렌글리콜 8000과 30mg/ml NaCl을 첨가하고 원심 분리하여 PEG에 의해 침전된 파아지를 모아 PBS로 재현탁하였다. The culture solution containing the Escherichia coli and the phage obtained above was centrifuged to remove the precipitated E. coli. After recovering only the supernatant, 40 mg / ml polyethylene glycol 8000 and 30 mg / ml NaCl were added and centrifuged to collect the phage precipitated by PEG and resuspended in PBS.

마그네틱 비드에 컨쥬게이션된 Ag와 파아지를 상온에서 2시간 동안 반응시킴으로써 Ag 에 친화력을 가진 파아지를 결합시킨 후, 이를 0.5% Tween 20을 포함하는 PBS로 세척하고, 0.1M 글리신(pH 2.2)용액으로 용출하고 2M 트리스 용액으로 중화시켰다. 용출된 파아지는 다음 라운드 패닝(panning)을 위해 대장균 ER2738에 감염시켜 밤새 배양하여 증식시켰다. 이러한 과정을 4차례 반복하며 패닝(panning)을 진행하였다. 패닝 횟수가 증가할수록 세척 횟수가 증가하여 결합력이 높은 파아지를 축적하였다. Ag-phage affinity Ag was bound to the magnetic beads by reacting the Ag and the phage at room temperature for 2 hours, then washed with PBS containing 0.5% Tween 20, and immersed in 0.1 M glycine (pH 2.2) solution Eluted and neutralized with 2M Tris solution. The eluted phages were infected with E. coli ER2738 for subsequent round panning and cultured overnight to proliferate. This process was repeated four times and panning was performed. As the number of panning increases, the number of washing increases and the phages with high binding force accumulate.

4차 패닝 결과물의 플레이트로부터 선별된 개별 클론을 96 딥웰(deep well) 플레이트에서 100ug/ml 카베니실린, 70ug/ml 카나마이신 및 VCSM13 헬퍼 파아지(1:1000)를 넣고 37℃에서 밤새 배양하여 항체가 발현된 파아지의 증식을 유도하였다.Individual clones selected from the plates of the fourth pan result were incubated overnight at 37 ° C with 100 ug / ml carbenicillin, 70 ug / ml kanamycin and VCSM13 helper phage (1: 1000) in a 96 well deep well plate, The proliferation of the expressed phage was induced.

6-3: 활성 확인시험6-3: Activity confirmation test

항체의 활성 확인 및 선별은 실시예 2-6에서와 유사하게 monoclonal HA항체를 플레이트에 코팅시키고, BSA 용액을 37℃에서 1시간 반응하여 블라킹을 진행하였다. 실시예 1에서 얻은 control AFP-L1, control AFP-L3를 1ug/ml농도로 처리하여 37 ℃에서 2시간 반응을 수행하였고, PBST 용액으로 3번 세척을 진행하였다. Monoclonal HA antibody was coated on the plate and the BSA solution was reacted at 37 DEG C for 1 hour in order to identify and select the activity of the antibody similarly to Example 2-6. Control AFP-L1 and control AFP-L3 obtained in Example 1 were treated at a concentration of 1 ug / ml at 37 ° C for 2 hours, and washed three times with PBST solution.

상기 수득한 파아지 항체 배양액 각각을 처리하여 37 ℃에서 2시간 반응을 시행하고 난 후, PBST 용액으로 3번 세척을 진행한 후, 탐지항체를 Biotinylation시켜 둔 항체를 37℃에서 2시간 반응시켰다. 상기 탐지항체는 AFP-L1, AFP-L3를 구별하지 않고 AFP를 모두 인식하는 항체로서 Milipore사, ST1673, Anti-AFP Mouse mAb(1G7)를 탐지항체로 선택하여 사용하였다. 3번의 PBST 용액으로 세척 후, avidin-HRP항체를 37℃에서 1시간 반응시켰다. 3번의 PBST 용액으로 재세척 후, ABTS solution 으로 발색하여 실온에서 30분 반응시킨 후, OD=450nM 에서 각 well의 OD 값을 측정하였다. 이후 항체의 유전자 분석은 실시예 2-5와 동일한 방법으로 진행하여, C10과 유사한 성능을 보이면서 C10과 CDR의 서열이 다른 항체를 선별하였다. Each of the obtained phage antibody cultures was treated and reacted at 37 ° C for 2 hours. Then, PBST solution was washed three times, and the antibody that had been biotinylated was reacted at 37 ° C for 2 hours. Milipore, ST1673, and Anti-AFP Mouse mAb (1G7) were used as the detection antibody, which did not discriminate between AFP-L1 and AFP-L3. After washing with 3 PBST solutions, avidin-HRP antibody was reacted at 37 ° C for 1 hour. After washing again with 3 PBST solutions, the cells were developed with ABTS solution, reacted at room temperature for 30 minutes, and the OD value of each well was measured at OD = 450 nM. Thereafter, the gene analysis of the antibody proceeded in the same manner as in Example 2-5, and antibodies having different C10 and CDR sequences were selected with similar performance to C10.

표 11에 기재된 항체는 AFP-L3 O.D값을 AFP-L1 O.D 값을 나눈 O.D값의 비율(ratio)가 1.5 이상이면서 각각의 CDR의 서열이 다른 항체를 선별하여 기재하였다. Antibodies listed in Table 11 were screened for antibodies having different ratios of CDRs with a ratio of O.D value of AFP-L3 O.D divided by AFP-L1 O.D value of 1.5 or more.

NONO CDR-L1CDR-L1 CDR-L3CDR-L3 CDR-L3CDR-L3 CDR-H1CDR-H1 CDR-H2CDR-H2 CDR-H3CDR-H3 O.D.(Ratio)O.D. (Ratio) 1One SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  3.393.39 22 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGRESSSNPGIFGAGGRESSSNPGIFGA GFYFSDHGMGGFYFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIAEDIDASAYGGWIAEDIDA  2.572.57 33 SGGSGYGSGGSGYG YESDKRPSYESDKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA 2.35
2.35
44 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESNSNPGIFGAGGWESNSNPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGRGTWYAPAVKGRATISITSGGRGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.192.19 55 SGGSGYGSGGSGYG YESTKRPSYESTKRPS GGRESSSNPGIFGAGGRESSSNPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.212.21 66 SGGSGYGSGGSGYG YESSKRPSYESSKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.042.04 77 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPAVKVRATISITSGGSGTWYAPAVKVRATI SAYGGWIADDIDASAYGGWIADDIDA  2.892.89 88 SGGSGYGSGGSGYG YESNMRPSYESNMRPS GGWGSSSNPGIFGAGGWGSSSNPGIFGA GFSFSDHGMGGFSFSDHGMG SITNGGSGTWYAPAVKGRATISITNGGSGTWYAPAVKGRATI SVYGGWIADDIDASVYGGWIADDIDA  2.682.68 99 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSVHGMGGFSFSVHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.682.68 1010 SGGSGYGSGGSGYG YESNRRPSYESNRRPS GGWESNSNPGTFGAGGWESNSNPGTFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDVDASAYGGWIADDVDA  2.692.69 1111 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESNSNPGIFGAGGWESNSNPGIFGA GFSFSDRGMG GFSFSDRGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.572.57 1212 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GSSFSDHGMG GSSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIASDIDASAYGGWIASDIDA  2.902.90 1313 SGGSGYGSGGSGYG YESSKRPSYESSKRPS GGWESSSNPGVFGAGGWESSSNPGVFGA GFSFSDHGLG GFSFSDHGLG SITSGGGGTWYAPAVKGRATISITSGGGGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.232.23 1414 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGRESSSNPGIFGAGGRESSSNPGIFGA GFSLGDHGMG GFSLGDHGMG SITSGGSGIWYAPAVKGRATISITSGGSGIWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.892.89 1515 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GISFSDHGMG GISFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDSSAYGGWIADDIDS  2.892.89 1616 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMG GFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDVSAYGGWIADDIDV  2.112.11 1717 SGGSGYGSGGSGYG YESTKRPPYESTKRPP GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMG GFSFSDHGMG SITSGGSGTWYAPAVKGRTTISITSGGSGTWYAPAVKGRTTI SAYGGWIADDIDASAYGGWIADDIDA  2.222.22 1818 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMG GFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDTDASAYGGWIADDTDA  3.583.58 1919 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMG GFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIVASAYGGWIADDIVA  2.062.06 2020 SGGSGYGSGGSGYG YENNKRPSYENNKRPS GGWESGSNPGIFGAGGWESGSNPGIFGA GFSFGDHGMG GFSFGDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.152.15 2121 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMG GFSFSDHGMG SITSGGGGTWYAPAVKGRATISITSGGGGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.182.18 2222 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESNSNPGIFGAGGWESNSNPGIFGA GFSFSDHGMG GFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.192.19 2323 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMG GFSFSDHGMG SITGGGSGTWYAPAVKGRATISITGGGSGTWYAPAVKGRATI SAYGGWIADDIDSSAYGGWIADDIDS  2.162.16 2424 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDRGMG GFSFSDRGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  1.821.82 2525 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFFFSDHGMG GFFFSDHGMG SITSGGSGTWYTPAVRGRATISITSGGSGTWYTPAVRGRATI SAYGGWIADDIDASAYGGWIADDIDA  3.163.16 2626 SGGSGYGSGGSGYG YESHKRPSYESHKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMG GFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.172.17 2727 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFPFSDHGMG GFPFSDHGMG SITSGGSGTWYAPAVKGRATFSITSGGSGTWYAPAVKGRATF SAYGGWIADDIDASAYGGWIADDIDA  3.073.07 2828 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGRESSSNPGIFGAGGRESSSNPGIFGA GYSFSDHGMG GYSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDVDASAYGGWIADDVDA  2.732.73 2929 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGIG GFSFSDHGIG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.022.02 3030 SGGSGYGSGGSGYG YESNKRPPYESNKRPP GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMG GFSFSDHGMG SITSGGSGTWYAPAMKGRATISITSGGSGTWYAPAMKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.012.01 3131 SGGSGYGSGGSGYG YESNKRPTYESNKRPT GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMG GFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.302.30 3232 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSNHGMG GFSFSNHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDTSAYGGWIADDIDT  2.392.39 3333 SGGSGYGSGGSGYG YENNKRPSYENNKRPS GGWESNSNPGIFGAGGWESNSNPGIFGA GFSFSVHGMG GFSFSVHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIVASAYGGWIADDIVA  2.452.45 3434 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMG GFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIAEDIDASAYGGWIAEDIDA  2.042.04 3535 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GLSFSVHGMG GLSFSVHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.222.22 3636 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESGSNPGIFGAGGWESGSNPGIFGA GFSFSDHGMG GFSFSDHGMG SITSGGSGTWYAPAVKGRTTISITSGGSGTWYAPAVKGRTTI SAYGGWIADDINASAYGGWIADDINA  2.292.29 3737 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGTGGWESSSNPGIFGT GFSFSDHGMG GFSFSDHGMG SITSGGSGTWYSPAVKGRATISITSGGSGTWYSPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.362.36 3838 SGGSGYGSGGSGYG YESSKRPSYESSKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMG GFSFSDHGMG STTSGGSGTWYAPAVKGRATISTTSGGSGTWYAPAVKGRATI SAYGGWIADDIDTSAYGGWIADDIDT  2.122.12 3939 SGGSGYGSGGSGYG YESNKRLSYESNKRLS GGWGSSSNPGIFGAGGWGSSSNPGIFGA GFSFSDHGMG GFSFSDHGMG SITSGGGGIWYAPAVKGRATISITSGGGGIWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.122.12 4040 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGVG GFSFSDHGVG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.152.15 4141 SGGSDYGSGGSDYG YESNKRPLYESNKRPL GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMG GFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDINASAYGGWIADDINA  3.043.04 4242 SGGSGYGSGGSGYG YESNKRPTYESNKRPT GGRESSSNPGIFGAGGRESSSNPGIFGA GFSFSDHGMG GFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.642.64 4343 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGVFGAGGWESSSNPGVFGA GFSFSGHGMG GFSFSGHGMG SITSGGSGTWYAPAVKGRTTISITSGGSGTWYAPAVKGRTTI SAYGGWIADDIDASAYGGWIADDIDA  2.242.24 4444 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMG GFSFSDHGMG SITSGGSGTWYAPAVKGRVTISITSGGSGTWYAPAVKGRVTI SAYGGWIADDIDASAYGGWIADDIDA  2.652.65 4545 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGRESSSNPGIFGAGGRESSSNPGIFGA GFSFSDHGMG GFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.242.24 4646 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESYSNPGIFGAGGWESYSNPGIFGA GFSFSDHGMG GFSFSDHGMG SITSGGSGTWYAPAVKGRASISITSGGSGTWYAPAVKGRASI SAYGGWIADDIDASAYGGWIADDIDA  1.671.67 4747 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESYSNPGIFGAGGWESYSNPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPAVEGRATISITSGGSGTWYAPAVEGRATI SAYGGWIADDIDASAYGGWIADDIDA  1.701.70 4848 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGVGGFSFSDHGVG SITSGGSGTWYAPAVKGRTTISITSGGSGTWYAPAVKGRTTI SAYGGWIADDIDASAYGGWIADDIDA  1.661.66 4949 SGGSGYGSGGSGYG YDSNKRPSYDSNKRPS GGRESSSNPGIFGAGGRESSSNPGIFGA GFSFSDRGMGGFSFSDRGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  1.811.81 5050 SGGSGYGSGGSGYG YESNKRPTYESNKRPT GGRESSSNPGIFGAGGRESSSNPGIFGA GFSFTDHGMGGFSFTDHGMG SITSGGSGTWNAPAVKGRATISITSGGSGTWNAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.282.28 5151 SGGSGYGSGGSGYG YESNRRPSYESNRRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.092.09 5252 SGGSGYGSGGSGYG YDSDKRPSYDSDKRPS GGRESSSNPGIFGAGGRESSSNPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  1.931.93 5353 SGGSSYGSGGSSYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIVDDIDASAYGGWIVDDIDA  2.622.62 5454 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESVSNPGIFGAGGWESVSNPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  1.671.67 5555 SGGSGCGSGGSGCG YECNKRPSYECNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSISDHGMGGFSISDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIVASAYGGWIADDIVA  2.122.12 5656 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESNSNPGIFGAGGWESNSNPGIFGA GFPFRDHGMGGFPFRDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDTSAYGGWIADDIDT  2.312.31 5757 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGVFGAGGWESSSNPGVFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  1.801.80 5858 SGGSGYGSGGSGYG YENNKRPSYENNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPTVKGRATISITSGGSGTWYAPTVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  1.761.76 5959 SGGSGYGSGGSGYG YESYKRPSYESYKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYASTVKGRATISITSGGSGTWYASTVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  1.661.66 6060 SGGSGYGSGGSGYG YESNKRPLYESNKRPL GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  1.711.71 6161 SGGRSYGSGGRSYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  1.671.67 6262 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPAVKGRAIISITSGGSGTWYAPAVKGRAII SAYGGWIADDIDASAYGGWIADDIDA  2.052.05 6363 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSSPGIFGAGGWESSSSPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.002.00 6464 SGGSGYGSGGSGYG YENNKRPSYENNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDVDASAYGGWIADDVDA  2.312.31 6565 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSSSVHGMGGFSSSVHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.002.00 6666 SGGSGYGSGGSGYG YESYKRPSYESYKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.152.15 6767 SGGSGHGSGGSGHG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGLGGFSFSDHGLG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIAGDINASAYGGWIAGDINA  2.032.03 6868 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSLGDHGMGGFSLGDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.862.86 6969 SGGSGYGSGGSGYG YESNKRPSYESNKRPS GGWESSNNPGIFGAGGWESSNNPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.092.09 7070 SGGSGYGSGGSGYG YESNKRPTYESNKRPT GGWESSSKPGIFGAGGWESSSKPGIFGA GFSFSDHGLGGFSFSDHGLG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDVDASAYGGWIADDVDA  2.962.96 7171 SGGSGYGSGGSGYG YESNKRPPYESNKRPP GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDRGMGGFSFSDRGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.442.44 7272 SGGRGYGSGGRGYG YESNKRPSYESNKRPS GGWESSSNPGIFGAGGWESSSNPGIFGA GFSFSDHGMGGFSFSDHGMG SITSGGSGTWYAPAVKGRATISITSGGSGTWYAPAVKGRATI SAYGGWIADDIDASAYGGWIADDIDA  2.362.36

표 12는 표 11에 기재된 항체 중 대표적인 항체 5종의 실제 ELISA 분석법을 이용한 O.D 측정치를 표시하여 나타내었으며 실험방법은 실시예 2-6과 동일하게 수행하였다.Table 12 shows the OD values measured by the actual ELISA analysis of five representative antibodies among the antibodies listed in Table 11, and the experiment was carried out in the same manner as in Example 2-6.

NONO AFP-L1(O.D)AFP-L1 (O.D.) AFP-L3 (O.D)AFP-L3 (O.D.) 1010 1.50361.5036 3.04113.0411 3535 1.0651.065 2.36482.3648 3737 0.99620.9962 2.34722.3472 5555 1.08141.0814 2.28792.2879 6161 1.40431.4043 2.33912.3391

<110> SK TELECOM CO., LTD. <120> Antibody specifically binding to core fucosylated alpha-fetoprotein and use thereof <130> DPP20161737KR <160> 118 <170> KopatentIn 1.71 <210> 1 <211> 10 <212> PRT <213> polypeptide(CDR-H1) <220> <221> UNSURE <222> (2) <223> X is F, S, Y, I or L <220> <221> UNSURE <222> (3) <223> X is S, P, F or Y <220> <221> UNSURE <222> (4) <223> X is F, S, I or L <220> <221> UNSURE <222> (5) <223> X is S, T, G, or R <220> <221> UNSURE <222> (6) <223> X is D, N, G, or V <220> <221> UNSURE <222> (7) <223> X is H or R <220> <221> UNSURE <222> (9) <223> X is L, M, V, or I <400> 1 Gly Xaa Xaa Xaa Xaa Xaa Xaa Gly Xaa Gly 1 5 10 <210> 2 <211> 21 <212> PRT <213> polypeptide(CDR-H2) <220> <221> UNSURE <222> (2) <223> X is I or T <220> <221> UNSURE <222> (4) <223> X is S, or N <220> <221> UNSURE <222> (7) <223> X is S, G or R <220> <221> UNSURE <222> (8) <223> X is G or I <220> <221> UNSURE <222> (11) <223> X is Y or N <220> <221> UNSURE <222> (12) <223> X is A, S or T <220> <221> UNSURE <222> (13) <223> X is P or S <220> <221> UNSURE <222> (14) <223> X is A or T <220> <221> UNSURE <222> (15) <223> X is V or M <220> <221> UNSURE <222> (16) <223> X is K, R or E <220> <221> UNSURE <222> (17) <223> X is G, or V <220> <221> UNSURE <222> (18) <223> X is R or P <220> <221> UNSURE <222> (19) <223> X is A or T <220> <221> UNSURE <222> (20) <223> X is T or S <220> <221> UNSURE <222> (21) <223> X is I or F <400> 2 Ser Xaa Thr Xaa Gly Gly Xaa Xaa Thr Trp Xaa Xaa Xaa Xaa Xaa Xaa 1 5 10 15 Xaa Xaa Xaa Xaa Xaa 20 <210> 3 <211> 13 <212> PRT <213> polypeptide(CDR-H3) <220> <221> UNSURE <222> (3) <223> X is Y or V <220> <221> UNSURE <222> (8) <223> X is A or V <220> <221> UNSURE <222> (9) <223> X is D, G, S or E <220> <221> UNSURE <222> (11) <223> X is I, V or T <220> <221> UNSURE <222> (12) <223> X is D, V or N <220> <221> UNSURE <222> (13) <223> X is A, V, S or T <400> 3 Ser Ala Xaa Gly Gly Trp Ile Xaa Xaa Asp Xaa Xaa Xaa 1 5 10 <210> 4 <211> 7 <212> PRT <213> polypeptide(CDR-L1) <220> <221> UNSURE <222> (4) <223> X is S or R <220> <221> UNSURE <222> (5) <223> X is G, D, or S <220> <221> UNSURE <222> (6) <223> X is Y, C, or H <400> 4 Ser Gly Gly Xaa Xaa Xaa Gly 1 5 <210> 5 <211> 8 <212> PRT <213> polypeptide(CDR-L2) <220> <221> UNSURE <222> (2) <223> X is E or D <220> <221> UNSURE <222> (3) <223> X is S, C or N <220> <221> UNSURE <222> (4) <223> X is N, S, Y, D, T or H <220> <221> UNSURE <222> (5) <223> X is K, R or H <220> <221> UNSURE <222> (7) <223> X is P or L <220> <221> UNSURE <222> (8) <223> X is S, T, P or L <400> 5 Tyr Xaa Xaa Xaa Xaa Arg Xaa Xaa 1 5 <210> 6 <211> 14 <212> PRT <213> polypeptide(CDR-L3) <220> <221> UNSURE <222> (3) <223> X is W or R <220> <221> UNSURE <222> (4) <223> X is E or G <220> <221> UNSURE <222> (6) <223> X is S, N, G, Y or V <220> <221> UNSURE <222> (7) <223> X is S or N <220> <221> UNSURE <222> (8) <223> X is I, T, or V <220> <221> UNSURE <222> (11) <223> X is A or T <400> 6 Gly Gly Xaa Xaa Ser Xaa Xaa Xaa Pro Gly Xaa Phe Gly Ala 1 5 10 <210> 7 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 7 Gly Phe Ser Phe Ser Asp His Gly Met Gly 1 5 10 <210> 8 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 8 Gly Phe Tyr Phe Ser Asp His Gly Met Gly 1 5 10 <210> 9 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 9 Gly Phe Ser Phe Ser Val His Gly Met Gly 1 5 10 <210> 10 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 10 Gly Phe Ser Phe Ser Asp Arg Gly Met Gly 1 5 10 <210> 11 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 11 Gly Ser Ser Phe Ser Asp His Gly Met Gly 1 5 10 <210> 12 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 12 Gly Phe Ser Phe Ser Asp His Gly Leu Gly 1 5 10 <210> 13 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 13 Gly Phe Ser Leu Gly Asp His Gly Met Gly 1 5 10 <210> 14 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 14 Gly Ile Ser Phe Ser Asp His Gly Met Gly 1 5 10 <210> 15 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 15 Gly Phe Ser Phe Gly Asp His Gly Met Gly 1 5 10 <210> 16 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 16 Gly Phe Phe Phe Ser Asp His Gly Met Gly 1 5 10 <210> 17 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 17 Gly Phe Pro Phe Ser Asp His Gly Met Gly 1 5 10 <210> 18 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 18 Gly Tyr Ser Phe Ser Asp His Gly Met Gly 1 5 10 <210> 19 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 19 Gly Phe Ser Phe Ser Asp His Gly Ile Gly 1 5 10 <210> 20 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 20 Gly Phe Ser Phe Ser Asn His Gly Met Gly 1 5 10 <210> 21 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 21 Gly Leu Ser Phe Ser Val His Gly Met Gly 1 5 10 <210> 22 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 22 Gly Phe Ser Phe Ser Asp His Gly Val Gly 1 5 10 <210> 23 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 23 Gly Phe Ser Phe Ser Gly His Gly Met Gly 1 5 10 <210> 24 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 24 Gly Phe Ser Phe Thr Asp His Gly Met Gly 1 5 10 <210> 25 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 25 Gly Phe Ser Ile Ser Asp His Gly Met Gly 1 5 10 <210> 26 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 26 Gly Phe Pro Phe Arg Asp His Gly Met Gly 1 5 10 <210> 27 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 27 Gly Phe Ser Ser Ser Val His Gly Met Gly 1 5 10 <210> 28 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 28 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Lys 1 5 10 15 Gly Arg Ala Thr Ile 20 <210> 29 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 29 Ser Ile Thr Ser Gly Gly Arg Gly Thr Trp Tyr Ala Pro Ala Val Lys 1 5 10 15 Gly Arg Ala Thr Ile 20 <210> 30 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 30 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Lys 1 5 10 15 Val Arg Ala Thr Ile 20 <210> 31 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 31 Ser Ile Thr Asn Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Lys 1 5 10 15 Gly Arg Ala Thr Ile 20 <210> 32 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 32 Ser Ile Thr Ser Gly Gly Gly Gly Thr Trp Tyr Ala Pro Ala Val Lys 1 5 10 15 Gly Arg Ala Thr Ile 20 <210> 33 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 33 Ser Ile Thr Ser Gly Gly Ser Gly Ile Trp Tyr Ala Pro Ala Val Lys 1 5 10 15 Gly Arg Ala Thr Ile 20 <210> 34 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 34 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Lys 1 5 10 15 Gly Arg Thr Thr Ile 20 <210> 35 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 35 Ser Ile Thr Gly Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Lys 1 5 10 15 Gly Arg Ala Thr Ile 20 <210> 36 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 36 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Thr Pro Ala Val Arg 1 5 10 15 Gly Arg Ala Thr Ile 20 <210> 37 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 37 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Lys 1 5 10 15 Gly Arg Ala Thr Phe 20 <210> 38 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 38 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Met Lys 1 5 10 15 Gly Arg Ala Thr Ile 20 <210> 39 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 39 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ser Pro Ala Val Lys 1 5 10 15 Gly Arg Ala Thr Ile 20 <210> 40 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 40 Ser Thr Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Lys 1 5 10 15 Gly Arg Ala Thr Ile 20 <210> 41 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 41 Ser Ile Thr Ser Gly Gly Gly Gly Ile Trp Tyr Ala Pro Ala Val Lys 1 5 10 15 Gly Arg Ala Thr Ile 20 <210> 42 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 42 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Lys 1 5 10 15 Gly Arg Val Thr Ile 20 <210> 43 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 43 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Glu 1 5 10 15 Gly Arg Ala Thr Ile 20 <210> 44 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 44 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Asn Ala Pro Ala Val Lys 1 5 10 15 Gly Arg Ala Thr Ile 20 <210> 45 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 45 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Lys 1 5 10 15 Gly Arg Ala Ser Ile 20 <210> 46 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 46 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Thr Val Lys 1 5 10 15 Gly Arg Ala Thr Ile 20 <210> 47 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 47 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Ser Thr Val Lys 1 5 10 15 Gly Arg Ala Thr Ile 20 <210> 48 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 48 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Lys 1 5 10 15 Gly Arg Ala Ile Ile 20 <210> 49 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 49 Ser Ala Tyr Gly Gly Trp Ile Ala Asp Asp Ile Asp Ala 1 5 10 <210> 50 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 50 Ser Ala Tyr Gly Gly Trp Ile Ala Glu Asp Ile Asp Ala 1 5 10 <210> 51 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 51 Ser Val Tyr Gly Gly Trp Ile Ala Asp Asp Ile Asp Ala 1 5 10 <210> 52 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 52 Ser Ala Tyr Gly Gly Trp Ile Ala Asp Asp Val Asp Ala 1 5 10 <210> 53 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 53 Ser Ala Tyr Gly Gly Trp Ile Ala Ser Asp Ile Asp Ala 1 5 10 <210> 54 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 54 Ser Ala Tyr Gly Gly Trp Ile Ala Asp Asp Ile Asp Ser 1 5 10 <210> 55 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 55 Ser Ala Tyr Gly Gly Trp Ile Ala Asp Asp Ile Asp Val 1 5 10 <210> 56 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 56 Ser Ala Tyr Gly Gly Trp Ile Ala Asp Asp Thr Asp Ala 1 5 10 <210> 57 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 57 Ser Ala Tyr Gly Gly Trp Ile Ala Asp Asp Ile Val Ala 1 5 10 <210> 58 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 58 Ser Ala Tyr Gly Gly Trp Ile Ala Asp Asp Ile Asp Thr 1 5 10 <210> 59 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 59 Ser Ala Tyr Gly Gly Trp Ile Ala Asp Asp Ile Asn Ala 1 5 10 <210> 60 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 60 Ser Ala Tyr Gly Gly Trp Ile Val Asp Asp Ile Asp Ala 1 5 10 <210> 61 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 61 Ser Ala Tyr Gly Gly Trp Ile Ala Gly Asp Ile Asn Ala 1 5 10 <210> 62 <211> 7 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L1 <400> 62 Ser Gly Gly Ser Gly Tyr Gly 1 5 <210> 63 <211> 7 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L1 <400> 63 Ser Gly Gly Ser Asp Tyr Gly 1 5 <210> 64 <211> 7 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L1 <400> 64 Ser Gly Gly Ser Ser Tyr Gly 1 5 <210> 65 <211> 7 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L1 <400> 65 Ser Gly Gly Ser Gly Cys Gly 1 5 <210> 66 <211> 7 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L1 <400> 66 Ser Gly Gly Arg Ser Tyr Gly 1 5 <210> 67 <211> 7 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L1 <400> 67 Ser Gly Gly Ser Gly His Gly 1 5 <210> 68 <211> 7 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L1 <400> 68 Ser Gly Gly Arg Gly Tyr Gly 1 5 <210> 69 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 69 Tyr Glu Ser Asn Lys Arg Pro Ser 1 5 <210> 70 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 70 Tyr Glu Ser Asp Lys Arg Pro Ser 1 5 <210> 71 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 71 Tyr Glu Ser Thr Lys Arg Pro Ser 1 5 <210> 72 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 72 Tyr Glu Ser Ser Lys Arg Pro Ser 1 5 <210> 73 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 73 Tyr Glu Ser Asn Met Arg Pro Ser 1 5 <210> 74 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 74 Tyr Glu Ser Asn Arg Arg Pro Ser 1 5 <210> 75 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 75 Tyr Glu Ser Thr Lys Arg Pro Pro 1 5 <210> 76 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 76 Tyr Glu Asn Asn Lys Arg Pro Ser 1 5 <210> 77 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 77 Tyr Glu Ser His Lys Arg Pro Ser 1 5 <210> 78 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 78 Tyr Glu Ser Asn Lys Arg Pro Pro 1 5 <210> 79 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 79 Tyr Glu Ser Asn Lys Arg Pro Thr 1 5 <210> 80 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 80 Tyr Glu Ser Asn Lys Arg Leu Ser 1 5 <210> 81 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 81 Tyr Glu Ser Asn Lys Arg Pro Leu 1 5 <210> 82 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 82 Tyr Asp Ser Asn Lys Arg Pro Ser 1 5 <210> 83 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 83 Tyr Asp Ser Asp Lys Arg Pro Ser 1 5 <210> 84 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 84 Tyr Glu Cys Asn Lys Arg Pro Ser 1 5 <210> 85 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 85 Tyr Glu Ser Tyr Lys Arg Pro Ser 1 5 <210> 86 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 86 Gly Gly Trp Glu Ser Ser Ser Asn Pro Gly Ile Phe Gly Ala 1 5 10 <210> 87 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 87 Gly Gly Arg Glu Ser Ser Ser Asn Pro Gly Ile Phe Gly Ala 1 5 10 <210> 88 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 88 Gly Gly Trp Glu Ser Asn Ser Asn Pro Gly Ile Phe Gly Ala 1 5 10 <210> 89 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 89 Gly Gly Trp Gly Ser Ser Ser Asn Pro Gly Ile Phe Gly Ala 1 5 10 <210> 90 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 90 Gly Gly Trp Glu Ser Asn Ser Asn Pro Gly Thr Phe Gly Ala 1 5 10 <210> 91 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 91 Gly Gly Trp Glu Ser Ser Ser Asn Pro Gly Val Phe Gly Ala 1 5 10 <210> 92 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 92 Gly Gly Trp Glu Ser Gly Ser Asn Pro Gly Ile Phe Gly Ala 1 5 10 <210> 93 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 93 Gly Gly Trp Glu Ser Ser Ser Asn Pro Gly Ile Phe Gly Thr 1 5 10 <210> 94 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 94 Gly Gly Trp Glu Ser Tyr Ser Asn Pro Gly Ile Phe Gly Ala 1 5 10 <210> 95 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 95 Gly Gly Trp Glu Ser Val Ser Asn Pro Gly Ile Phe Gly Ala 1 5 10 <210> 96 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 96 Gly Gly Trp Glu Ser Ser Ser Ser Pro Gly Ile Phe Gly Ala 1 5 10 <210> 97 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 97 Gly Gly Trp Glu Ser Ser Asn Asn Pro Gly Ile Phe Gly Ala 1 5 10 <210> 98 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 98 Gly Gly Trp Glu Ser Ser Ser Lys Pro Gly Ile Phe Gly Ala 1 5 10 <210> 99 <211> 72 <212> DNA <213> VH forward primer <400> 99 ggtcagtcct ctagatcttc cggcggtggt ggcagctccg gtggtggcgg ttccgccgtg 60 acgttggacg ag 72 <210> 100 <211> 44 <212> DNA <213> VH reverse primer <400> 100 ctggccggcc tggccactag tggaggagac gatgacttcg gtcc 44 <210> 101 <211> 38 <212> DNA <213> VL forward primer <400> 101 gtggcccagg cggccctgac tcagccgtcc tcggtgtc 38 <210> 102 <211> 34 <212> DNA <213> VL reverse primer <400> 102 ggaagatcta gaggactgac ctaggacggt cagg 34 <210> 103 <211> 42 <212> DNA <213> scFV forward primer <400> 103 gaggaggagg aggaggaggt ggcccaggcg gccctgactc ag 42 <210> 104 <211> 47 <212> DNA <213> scFV reverse primer <400> 104 gaggaggagg aggaggagga gctggccggc ctggccacta gtggagg 47 <210> 105 <211> 20 <212> DNA <213> Seqeuncing primer(forward) <400> 105 acactttatg cttccggctc 20 <210> 106 <211> 20 <212> DNA <213> Seqeuncing primer(reverse) <400> 106 caaaatcacc ggaaccagag 20 <210> 107 <211> 19 <212> DNA <213> VH primer (forward) <400> 107 gctagccgcc accatgggc 19 <210> 108 <211> 37 <212> DNA <213> VH primer (reverse) <400> 108 aggggccctt ggtggaggcc tggccggcct ggccact 37 <210> 109 <211> 20 <212> DNA <213> CH primer (forward) <400> 109 gcctccacca agggcccctc 20 <210> 110 <211> 20 <212> DNA <213> CH primer (reverse) <400> 110 cgggatccct tgccggccgt 20 <210> 111 <211> 19 <212> DNA <213> HC primer(forward) <400> 111 gctagccgcc accatgggc 19 <210> 112 <211> 20 <212> DNA <213> HC primer (reverse) <400> 112 cgggatccct tgccggccgt 20 <210> 113 <211> 18 <212> DNA <213> VL primer (forward) <400> 113 aagcttgccg ccaccatg 18 <210> 114 <211> 37 <212> PRT <213> VL primer (reverse) <400> 114 Ala Gly Gly Gly Gly Gly Cys Gly Gly Cys Cys Ala Cys Gly Gly Thr 1 5 10 15 Cys Cys Gly Gly Gly Ala Ala Gly Ala Thr Cys Thr Ala Gly Ala Gly 20 25 30 Gly Ala Cys Thr Gly 35 <210> 115 <211> 20 <212> DNA <213> Ck primer (forward) <400> 115 cggaccgtgg ccgccccctc 20 <210> 116 <211> 19 <212> DNA <213> Ck primer (reverse) <400> 116 gctctagact agcactcgc 19 <210> 117 <211> 18 <212> DNA <213> LC primer (forward) <400> 117 aagcttgccg ccaccatg 18 <210> 118 <211> 19 <212> DNA <213> LC primer (reverse) <400> 118 gctctagact agcactcgc 19 <110> SK TELECOM CO., LTD. <120> Antibody specifically binding to core fucosylated          alpha-fetoprotein and use thereof <130> DPP20161737 <160> 118 <170> Kopatentin 1.71 <210> 1 <211> 10 <212> PRT &Lt; 213 > polypeptide (CDR-H1) <220> <221> UNSURE <222> (2) <223> X is F, S, Y, I or L <220> <221> UNSURE <222> (3) <223> X is S, P, F or Y <220> <221> UNSURE <222> (4) <223> X is F, S, I or L <220> <221> UNSURE <222> (5) <223> X is S, T, G, or R <220> <221> UNSURE <222> (6) <223> X is D, N, G, or V <220> <221> UNSURE <222> (7) <223> X is H or R <220> <221> UNSURE <222> (9) <223> X is L, M, V, or I <400> 1 Gly Xaa Xaa Xaa Xaa Xaa Xaa Gly Xaa Gly   1 5 10 <210> 2 <211> 21 <212> PRT &Lt; 213 > polypeptide (CDR-H2) <220> <221> UNSURE <222> (2) <223> X is I or T <220> <221> UNSURE <222> (4) <223> X is S, or N <220> <221> UNSURE <222> (7) <223> X is S, G or R <220> <221> UNSURE <222> (8) <223> X is G or I <220> <221> UNSURE <222> (11) <223> X is Y or N <220> <221> UNSURE <12> <223> X is A, S or T <220> <221> UNSURE <222> (13) <223> X is P or S <220> <221> UNSURE <222> (14) <223> X is A or T <220> <221> UNSURE &Lt; 222 > (15) <223> X is V or M <220> <221> UNSURE <222> (16) <223> X is K, R or E <220> <221> UNSURE <222> (17) <223> X is G, or V <220> <221> UNSURE <222> (18) <223> X is R or P <220> <221> UNSURE <222> (19) <223> X is A or T <220> <221> UNSURE <20> <223> X is T or S <220> <221> UNSURE <222> (21) <223> X is I or F <400> 2 Ser Xaa Thr Xaa Gly Gly Xaa Xaa Thr Trp Xaa Xaa Xaa Xaa Xaa Xaa   1 5 10 15 Xaa Xaa Xaa Xaa Xaa              20 <210> 3 <211> 13 <212> PRT &Lt; 213 > polypeptide (CDR-H3) <220> <221> UNSURE <222> (3) <223> X is Y or V <220> <221> UNSURE <222> (8) <223> X is A or V <220> <221> UNSURE <222> (9) <223> X is D, G, S or E <220> <221> UNSURE <222> (11) <223> X is I, V or T <220> <221> UNSURE <12> <223> X is D, V or N <220> <221> UNSURE <222> (13) <223> X is A, V, S or T <400> 3 Ser Ala Xaa Gly Gly Trp Ile Xaa Xaa Asp Xaa Xaa Xaa   1 5 10 <210> 4 <211> 7 <212> PRT &Lt; 213 > polypeptide (CDR-L1) <220> <221> UNSURE <222> (4) <223> X is S or R <220> <221> UNSURE <222> (5) <223> X is G, D, or S <220> <221> UNSURE <222> (6) <223> X is Y, C, or H <400> 4 Ser Gly Gly Xaa Xaa Xaa Gly   1 5 <210> 5 <211> 8 <212> PRT &Lt; 213 > polypeptide (CDR-L2) <220> <221> UNSURE <222> (2) <223> X is E or D <220> <221> UNSURE <222> (3) <223> X is S, C or N <220> <221> UNSURE <222> (4) <223> X is N, S, Y, D, T or H <220> <221> UNSURE <222> (5) <223> X is K, R or H <220> <221> UNSURE <222> (7) <223> X is P or L <220> <221> UNSURE <222> (8) <223> X is S, T, P or L <400> 5 Tyr Xaa Xaa Xaa Xaa Arg Xaa Xaa   1 5 <210> 6 <211> 14 <212> PRT &Lt; 213 > polypeptide (CDR-L3) <220> <221> UNSURE <222> (3) <223> X is W or R <220> <221> UNSURE <222> (4) <223> X is E or G <220> <221> UNSURE <222> (6) <223> X is S, N, G, Y or V <220> <221> UNSURE <222> (7) <223> X is S or N <220> <221> UNSURE <222> (8) <223> X is I, T, or V <220> <221> UNSURE <222> (11) <223> X is A or T <400> 6 Gly Gly Xaa Xaa Ser Xaa Xaa Xaa Pro Gly Xaa Phe Gly Ala   1 5 10 <210> 7 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 7 Gly Phe Ser Phe Ser Asp His Gly Met Gly   1 5 10 <210> 8 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 8 Gly Phe Tyr Phe Ser Asp His Gly Met Gly   1 5 10 <210> 9 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 9 Gly Phe Ser Phe Ser Val His Gly Met Gly   1 5 10 <210> 10 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 10 Gly Phe Ser Phe Ser Asp Arg Gly Met Gly   1 5 10 <210> 11 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 11 Gly Ser Ser Phe Ser Asp His Gly Met Gly   1 5 10 <210> 12 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 12 Gly Phe Ser Phe Ser Asp His Gly Leu Gly   1 5 10 <210> 13 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 13 Gly Phe Ser Leu Gly Asp His Gly Met Gly   1 5 10 <210> 14 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 14 Gly Ile Ser Phe Ser Asp His Gly Met Gly   1 5 10 <210> 15 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 15 Gly Phe Ser Phe Gly Asp His Gly Met Gly   1 5 10 <210> 16 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 16 Gly Phe Phe Phe Ser Asp His Gly Met Gly   1 5 10 <210> 17 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 17 Gly Phe Pro Phe Ser Asp His Gly Met Gly   1 5 10 <210> 18 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 18 Gly Tyr Ser Phe Ser Asp His Gly Met Gly   1 5 10 <210> 19 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 19 Gly Phe Ser Phe Ser Asp His Gly Ile Gly   1 5 10 <210> 20 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 20 Gly Phe Ser Phe Ser Asn His Gly Met Gly   1 5 10 <210> 21 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 21 Gly Leu Ser Phe Ser Val His Gly Met Gly   1 5 10 <210> 22 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 22 Gly Phe Ser Phe Ser Asp His Gly Val Gly   1 5 10 <210> 23 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 23 Gly Phe Ser Phe Ser Gly His Gly Met Gly   1 5 10 <210> 24 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 24 Gly Phe Ser Phe Thr Asp His Gly Met Gly   1 5 10 <210> 25 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 25 Gly Phe Ser Ile Ser Asp His Gly Met Gly   1 5 10 <210> 26 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 26 Gly Phe Pro Phe Arg Asp His Gly Met Gly   1 5 10 <210> 27 <211> 10 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H1 <400> 27 Gly Phe Ser Ser Ser Val His Gly Met Gly   1 5 10 <210> 28 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 28 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Lys   1 5 10 15 Gly Arg Ala Thr Ile              20 <210> 29 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 29 Ser Ile Thr Ser Gly Gly Arg Gly Thr Trp Tyr Ala Pro Ala Val Lys   1 5 10 15 Gly Arg Ala Thr Ile              20 <210> 30 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 30 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Lys   1 5 10 15 Val Arg Ala Thr Ile              20 <210> 31 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 31 Ser Ile Thr Asn Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Lys   1 5 10 15 Gly Arg Ala Thr Ile              20 <210> 32 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 32 Ser Ile Thr Ser Gly Gly Gly Gly Thr Trp Tyr Ala Pro Ala Val Lys   1 5 10 15 Gly Arg Ala Thr Ile              20 <210> 33 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 33 Ser Ile Thr Ser Gly Gly Ser Gly Ile Trp Tyr Ala Pro Ala Val Lys   1 5 10 15 Gly Arg Ala Thr Ile              20 <210> 34 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 34 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Lys   1 5 10 15 Gly Arg Thr Thr Ile              20 <210> 35 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 35 Ser Ile Thr Gly Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Lys   1 5 10 15 Gly Arg Ala Thr Ile              20 <210> 36 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 36 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Thr Pro Ala Val Arg   1 5 10 15 Gly Arg Ala Thr Ile              20 <210> 37 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 37 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Lys   1 5 10 15 Gly Arg Ala Thr Phe              20 <210> 38 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 38 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Met Lys   1 5 10 15 Gly Arg Ala Thr Ile              20 <210> 39 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 39 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ser Pro Ala Val Lys   1 5 10 15 Gly Arg Ala Thr Ile              20 <210> 40 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 40 Ser Thr Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Lys   1 5 10 15 Gly Arg Ala Thr Ile              20 <210> 41 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 41 Ser Ile Thr Ser Gly Gly Gly Gly Ile Trp Tyr Ala Pro Ala Val Lys   1 5 10 15 Gly Arg Ala Thr Ile              20 <210> 42 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 42 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Lys   1 5 10 15 Gly Arg Val Thr Ile              20 <210> 43 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 43 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Glu   1 5 10 15 Gly Arg Ala Thr Ile              20 <210> 44 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 44 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Asn Ala Pro Ala Val Lys   1 5 10 15 Gly Arg Ala Thr Ile              20 <210> 45 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 45 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Lys   1 5 10 15 Gly Arg Ala Ser Ile              20 <210> 46 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 46 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Thr Val Lys   1 5 10 15 Gly Arg Ala Thr Ile              20 <210> 47 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 47 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Ser Thr Val Lys   1 5 10 15 Gly Arg Ala Thr Ile              20 <210> 48 <211> 21 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H2 <400> 48 Ser Ile Thr Ser Gly Gly Ser Gly Thr Trp Tyr Ala Pro Ala Val Lys   1 5 10 15 Gly Arg Ala Ile Ile              20 <210> 49 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 49 Ser Ala Tyr Gly Gly Trp Ile Ala Asp Asp Ile Asp Ala   1 5 10 <210> 50 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 50 Ser Ala Tyr Gly Gly Trp Ile Ala Glu Asp Ile Asp Ala   1 5 10 <210> 51 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 51 Ser Val Tyr Gly Gly Trp Ile Ala Asp Asp Ile Asp Ala   1 5 10 <210> 52 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 52 Ser Ala Tyr Gly Gly Trp Ile Ala Asp Asp Val Asp Ala   1 5 10 <210> 53 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 53 Ser Ala Tyr Gly Gly Trp Ile Ala Ser Asp Ile Asp Ala   1 5 10 <210> 54 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 54 Ser Ala Tyr Gly Gly Trp Ile Ala Asp Asp Ile Asp Ser   1 5 10 <210> 55 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 55 Ser Ala Tyr Gly Gly Trp Ile Ala Asp Asp Ile Asp Val   1 5 10 <210> 56 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 56 Ser Ala Tyr Gly Gly Trp Ile Ala Asp Asp Thr Asp Ala   1 5 10 <210> 57 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 57 Ser Ala Tyr Gly Gly Trp Ile Ala Asp Asp Ile Val Ala   1 5 10 <210> 58 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 58 Ser Ala Tyr Gly Gly Trp Ile Ala Asp Asp Ile Asp Thr   1 5 10 <210> 59 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 59 Ser Ala Tyr Gly Gly Trp Ile Ala Asp Asp Ile Asn Ala   1 5 10 <210> 60 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 60 Ser Ala Tyr Gly Gly Trp Ile Val Asp Asp Ile Asp Ala   1 5 10 <210> 61 <211> 13 <212> PRT <213> Anti-AFP-L3 antibody heavy chain CDR-H3 <400> 61 Ser Ala Tyr Gly Gly Trp Ile Ala Gly Asp Ile Asn Ala   1 5 10 <210> 62 <211> 7 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L1 <400> 62 Ser Gly Gly Ser Gly Tyr Gly   1 5 <210> 63 <211> 7 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L1 <400> 63 Ser Gly Gly Ser Asp Tyr Gly   1 5 <210> 64 <211> 7 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L1 <400> 64 Ser Gly Gly Ser Ser Tyr Gly   1 5 <210> 65 <211> 7 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L1 <400> 65 Ser Gly Gly Ser Gly Cys Gly   1 5 <210> 66 <211> 7 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L1 <400> 66 Ser Gly Gly Arg Ser Tyr Gly   1 5 <210> 67 <211> 7 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L1 <400> 67 Ser Gly Gly Ser Gly His Gly   1 5 <210> 68 <211> 7 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L1 <400> 68 Ser Gly Gly Arg Gly Tyr Gly   1 5 <210> 69 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 69 Tyr Glu Ser Asn Lys Arg Pro Ser   1 5 <210> 70 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 70 Tyr Glu Ser Asp Lys Arg Pro Ser   1 5 <210> 71 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 71 Tyr Glu Ser Thr Lys Arg Pro Ser   1 5 <210> 72 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 72 Tyr Glu Ser Ser Lys Arg Pro Ser   1 5 <210> 73 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 73 Tyr Glu Ser Asn Met Arg Pro Ser   1 5 <210> 74 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 74 Tyr Glu Ser Asn Arg Arg Pro Ser   1 5 <210> 75 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 75 Tyr Glu Ser Thr Lys Arg Pro Pro   1 5 <210> 76 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 76 Tyr Glu Asn Asn Lys Arg Pro Ser   1 5 <210> 77 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 77 Tyr Glu Ser His Lys Arg Pro Ser   1 5 <210> 78 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 78 Tyr Glu Ser Asn Lys Arg Pro Pro   1 5 <210> 79 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 79 Tyr Glu Ser Asn Lys Arg Pro Thr   1 5 <210> 80 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 80 Tyr Glu Ser Asn Lys Arg Leu Ser   1 5 <210> 81 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 81 Tyr Glu Ser Asn Lys Arg Pro Leu   1 5 <210> 82 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 82 Tyr Asp Ser Asn Lys Arg Pro Ser   1 5 <210> 83 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 83 Tyr Asp Ser Asp Lys Arg Pro Ser   1 5 <210> 84 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 84 Tyr Glu Cys Asn Lys Arg Pro Ser   1 5 <210> 85 <211> 8 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L2 <400> 85 Tyr Glu Ser Tyr Lys Arg Pro Ser   1 5 <210> 86 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 86 Gly Gly Trp Glu Ser Ser Ser Asn Pro Gly Ile Phe Gly Ala   1 5 10 <210> 87 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 87 Gly Gly Arg Glu Ser Ser Ser Asn Pro Gly Ile Phe Gly Ala   1 5 10 <210> 88 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 88 Gly Gly Trp Glu Ser Asn Ser Asn Pro Gly Ile Phe Gly Ala   1 5 10 <210> 89 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 89 Gly Gly Trp Gly Ser Ser Ser Asn Pro Gly Ile Phe Gly Ala   1 5 10 <210> 90 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 90 Gly Gly Trp Glu Ser Asn Ser Asn Pro Gly Thr Phe Gly Ala   1 5 10 <210> 91 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 91 Gly Gly Trp Glu Ser Ser Asn Pro Gly Val Phe Gly Ala   1 5 10 <210> 92 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 92 Gly Gly Trp Glu Ser Gly Ser Asn Pro Gly Ile Phe Gly Ala   1 5 10 <210> 93 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 93 Gly Gly Trp Glu Ser Ser Ser Asn Pro Gly Ile Phe Gly Thr   1 5 10 <210> 94 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 94 Gly Gly Trp Glu Ser Tyr Ser Asn Pro Gly Ile Phe Gly Ala   1 5 10 <210> 95 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 95 Gly Gly Trp Glu Ser Val Ser Asn Pro Gly Ile Phe Gly Ala   1 5 10 <210> 96 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 96 Gly Gly Trp Glu Ser Ser Ser Ser Pro Gly Ile Phe Gly Ala   1 5 10 <210> 97 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 97 Gly Gly Trp Glu Ser Ser Asn Asn Pro Gly Ile Phe Gly Ala   1 5 10 <210> 98 <211> 14 <212> PRT <213> Anti-AFP-L3 antibody light chain CDR-L3 <400> 98 Gly Gly Trp Glu Ser Ser Ser Lys Pro Gly Ile Phe Gly Ala   1 5 10 <210> 99 <211> 72 <212> DNA <213> VH forward primer <400> 99 ggtcagtcct ctagatcttc cggcggtggt ggcagctccg gtggtggcgg ttccgccgtg 60 acgttggacg ag 72 <210> 100 <211> 44 <212> DNA <213> VH reverse primer <400> 100 ctggccggcc tggccactag tggaggagac gatgacttcg gtcc 44 <210> 101 <211> 38 <212> DNA <213> VL forward primer <400> 101 gtggcccagg cggccctgac tcagccgtcc tcggtgtc 38 <210> 102 <211> 34 <212> DNA <213> VL reverse primer <400> 102 ggaagatcta gaggactgac ctaggacggt cagg 34 <210> 103 <211> 42 <212> DNA <213> scFV forward primer <400> 103 gaggaggagg aggaggaggt ggcccaggcg gccctgactc ag 42 <210> 104 <211> 47 <212> DNA <213> scFV reverse primer <400> 104 gaggaggagg aggaggagga gctggccggc ctggccacta gtggagg 47 <210> 105 <211> 20 <212> DNA <213> Seqeuncing primer (forward) <400> 105 acactttatg cttccggctc 20 <210> 106 <211> 20 <212> DNA <213> Seqeuncing primer (reverse) <400> 106 caaaatcacc ggaaccagag 20 <210> 107 <211> 19 <212> DNA <213> VH primer (forward) <400> 107 gctagccgcc accatgggc 19 <210> 108 <211> 37 <212> DNA <213> VH primer (reverse) <400> 108 aggggccctt ggtggaggcc tggccggcct ggccact 37 <210> 109 <211> 20 <212> DNA <213> CH primer (forward) <400> 109 gcctccacca agggcccctc 20 <210> 110 <211> 20 <212> DNA <213> CH primer (reverse) <400> 110 cgggatccct tgccggccgt 20 <210> 111 <211> 19 <212> DNA <213> HC primer (forward) <400> 111 gctagccgcc accatgggc 19 <210> 112 <211> 20 <212> DNA <213> HC primer (reverse) <400> 112 cgggatccct tgccggccgt 20 <210> 113 <211> 18 <212> DNA <213> VL primer (forward) <400> 113 aagcttgccg ccaccatg 18 <210> 114 <211> 37 <212> PRT <213> VL primer (reverse) <400> 114 Ala Gly Gly Gly Gly Gly Cys Gly Gly Cys Cys Ala Cys Gly Gly Thr   1 5 10 15 Cys Cys Gly Gly Aly Gly Aly Gly Aly Thr Cys Thr Ala Gly Aly Gly              20 25 30 Gly Ala Cys Thr Gly          35 <210> 115 <211> 20 <212> DNA <213> Ck primer (forward) <400> 115 cggaccgtgg ccgccccctc 20 <210> 116 <211> 19 <212> DNA <213> Ck primer (reverse) <400> 116 gctctagact agcactcgc 19 <210> 117 <211> 18 <212> DNA <213> LC primer (forward) <400> 117 aagcttgccg ccaccatg 18 <210> 118 <211> 19 <212> DNA <213> LC primer (reverse) <400> 118 gctctagact agcactcgc 19

Claims (17)

서열번호 1, 서열번호 2 및 서열번호 3의 아미노산 서열로 각각 이루어지는 중쇄 가변영역 상보적 결합 부위(CDR)로 구성된 군에서 선택된 적어도 하나의 중쇄 가변영역 상보적 결합 부위와, 서열번호 4, 서열번호 5 및 서열번호 6의 아미노산 서열로 각각 이루어지는 경쇄 가변영역 상보적 결합 부위(CDR)로 구성된 군에서 선택된 적어도 하나의 경쇄 가변영역 상보적 결합 부위를 포함하며, 알파-페토프로테인 L3에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편.At least one heavy chain variable region complementary binding site selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3, and a heavy chain variable region complementary binding region (CDR) And at least one light chain variable region complementary binding site selected from the group consisting of light chain variable region complementary binding regions (CDRs) each consisting of the amino acid sequence of SEQ ID NO: 5 and SEQ ID NO: 6, and specifically binding to alpha-fetoprotein L3 Or an antigen-binding fragment thereof. 제 1 항에 있어서, 상기 항체는 서열번호 1, 서열번호 2 및 서열번호 3의 아미노산 서열로 각각 이루어지는 중쇄 가변영역 상보적 결합 부위(CDR)와 서열번호 4, 서열번호 5 및 서열번호 6의 아미노산 서열로 각각 이루어지는 경쇄 가변영역 상보적 결합 부위(CDR)를 포함하는, 알파-페토프로테인 L3에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편.The antibody of claim 1, wherein the antibody comprises a heavy chain variable region complementary binding region (CDR) comprising the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3, Wherein the antibody or antigen-binding fragment thereof specifically binds to alpha-fetoprotein L3, wherein the antibody or antigen-binding fragment thereof comprises a light chain variable region complementary binding site (CDR). 제 1 항에 있어서, 상기 항체 또는 이의 항원 결합 단편은, AFP-L1와 구별하여 AFP-L3에 특이적으로 결합하는 것인, 항체 또는 이의 항원 결합 단편.The antibody or an antigen-binding fragment thereof according to claim 1, wherein the antibody or antigen-binding fragment thereof specifically binds to AFP-L3 in a manner distinct from AFP-L1. 제 1 항에 있어서, 상기 항체 또는 이의 항원 결합 단편은, AFP-L1에 대한 AFP-L3의 O.D 값의 비율이 1.5이상의 값을 갖는 것인, 항 AFP-L3 항체 또는 이의 항원 결합 단편.The anti-AFP-L3 antibody or antigen-binding fragment thereof according to claim 1, wherein the antibody or antigen-binding fragment thereof has a ratio of the AFP-L3 O.D value to AFP-L1 of 1.5 or more. 제 1 항에 있어서, 상기 AFP-L3의 농도가 50ng/ml 이상으로 포함하는 시료인것인 항체 또는 이의 항원 결합 단편.The antibody or its antigen-binding fragment thereof according to claim 1, wherein the concentration of AFP-L3 is 50 ng / ml or more. 제 1 항에 있어서, 상기 중쇄 가변영역 상보적 결합 부위는 서열번호 7 내지 27의 아미노산 서열로 이루어지는 군에서 선택된 CDR-H1, 서열번호 28 내지 48의 아미노산 서열로 이루어지는 군에서 선택된 CDR-H2, 및 서열번호 49 내지 61의 아미노산 서열로 이루어지는 군에서 선택된 CDR-H3을 포함하는 항 AFP-L3 항체 또는 이의 항원 결합 단편.The method of claim 1, wherein the heavy chain variable region complementary binding site comprises CDR-H1 selected from the group consisting of the amino acid sequences of SEQ ID NOS: 7 to 27, CDR-H2 selected from the group consisting of amino acid sequences of SEQ ID NOS: 28 to 48, An anti-AFP-L3 antibody comprising CDR-H3 selected from the group consisting of the amino acid sequences of SEQ ID NOS: 49 to 61, or an antigen-binding fragment thereof. 제 1 항에 있어서, 상기 경쇄 가변영역 상보적 결합 부위는 서열번호 62 내지 68의 아미노산 서열로 이루어지는 군에서 선택된 CDR-L1, 서열번호 69 내지 85의 아미노산 서열로 이루어지는 군에서 선택된 CDR-L2, 및 서열번호 86 내지 98의 아미노산 서열로 이루어지는 군에서 선택된 CDR-L3을 포함하는 항 AFP-L3 항체 또는 이의 항원 결합 단편.The light chain variable region complementary binding site according to claim 1, wherein the light chain variable region complementary binding site comprises CDR-L1 selected from the group consisting of the amino acid sequences of SEQ ID NOS: 62 to 68, CDR-L2 selected from the group consisting of amino acid sequences of SEQ ID NOS: 69 to 85, An anti-AFP-L3 antibody comprising CDR-L3 selected from the group consisting of the amino acid sequences of SEQ ID NOS: 86-98, or an antigen-binding fragment thereof. 제 1 항에 있어서, 상기 항 AFP-L3 항체는 단클론 항체인, 항 AFP-L3 항체 또는 이의 항원 결합 단편.The anti-AFP-L3 antibody or antigen-binding fragment thereof according to claim 1, wherein said anti-AFP-L3 antibody is a monoclonal antibody. 제 1 항에 있어서, 상기 항 AFP-L3 항체는 마우스 유래 항체, 마우스-인간 키메릭 항체, 인간화 항체, 또는 인간 항체인, 항 AFP-L3 항체 또는 이의 항원 결합 단편.The anti-AFP-L3 antibody or antigen-binding fragment thereof according to claim 1, wherein said anti-AFP-L3 antibody is a mouse-derived antibody, mouse-human chimeric antibody, humanized antibody or human antibody. 제 1 항에 있어서, 상기 항원 결합 단편은 상기 항 AFP-L3 항체의 scFv, (scFv)2, Fab, Fab' 및 F(ab')2로 이루어진 군에서 선택되는 것인, 항 AFP-L3 항체 또는 이의 항원 결합 단편.The anti-AFP-L3 antibody of claim 1, wherein said antigen binding fragment is selected from the group consisting of scFv, (scFv) 2 , Fab, Fab 'and F (ab') 2 of said anti-AFP- Or an antigen-binding fragment thereof. 제1항 내지 제10항중 어느 한 항에 따른 항 AFP-L3 항체 또는 이의 항원 결합 단편을 포함하는, AFP-L3 관련 질병의 진단용 조성물. A composition for the diagnosis of an AFP-L3 related disease, comprising the anti-AFP-L3 antibody according to any one of claims 1 to 10 or an antigen-binding fragment thereof. 제11항에 있어서, 상기 조성물은 코어-푸코실화된 AFP에 대한 항체와 항체 결합자리가 상이한 항-AFP항체를 추가로 포함하는 것인 조성물. 12. The composition of claim 11, wherein the composition further comprises an anti-AFP antibody that differs in antibody-binding site from the antibody to core-fucosylated AFP. 제11항에 있어서, 상기 항-AFP 항체에 직접 또는 링커를 통해 결합된 표지자를 추가로 포함하는 조성물. 12. The composition of claim 11, further comprising a marker conjugated directly or via a linker to the anti-AFP antibody. 제 11 항에 있어서, 상기 질병은 간암인, 진단용 조성물. 12. The diagnostic composition of claim 11, wherein the disease is liver cancer. 제1항 내지 제10항중 어느 한 항에 따른 항 AFP-L3 항체 또는 이의 항원 결합 단편을 시료와 접촉시키는 단계, 및 상기 항 AFP-L3 항체와 항원의 결합반응을 탐지하는 단계를 포함하는, AFP-L3를 검출하는 면역분석 방법. 11. A method for detecting AFP-L3 antibodies comprising contacting an anti-AFP-L3 antibody or antigen-binding fragment thereof according to any one of claims 1 to 10 with a sample, and detecting the binding reaction of the anti- -L3. &Lt; / RTI &gt; 제 15 항에 있어서, 상기 방법은 ELISA, 방사선 면역측정법(radioimmunoassay: RIA), 효소 면역분석(enzyme immunoassay: EIA), 형광면역분석(Floresence immunoassay: FIA) 또는 발광면역분석(luminescence immunoassay: LIA))인 방법. 16. The method of claim 15, wherein the method comprises the steps of: ELISA, radioimmunoassay (RIA), enzyme immunoassay (EIA), fluorescence immunoassay (FIA) or luminescence immunoassay (LIA) / RTI &gt; 포획 항체(capture antibody)로서 제1항 내지 제10항중 어느 한 항에 따른 항 AFP-L3 항체 또는 이의 항원 결합 단편, 탐지 항체(detector antibody)로서 항 코어-푸코실화된 AFP항체와 결합자리가 상이한 항-AFP 항체, 및 상기 탐지 항체에 직접 또는 링커를 통해 결합된 표지자를 포함하는 면역 분석용 키트.The anti-AFP-L3 antibody or antigen-binding fragment thereof according to any one of claims 1 to 10 as a capture antibody, which is different from the anti-core-fucosylated AFP antibody as a detection antibody An anti-AFP antibody, and a marker conjugated to the detection antibody directly or via a linker.
KR1020160133665A 2016-10-14 2016-10-14 Antibody specifically binding to core fucosylated alpha-fetoprotein and use thereof KR20180041466A (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
KR1020160133665A KR20180041466A (en) 2016-10-14 2016-10-14 Antibody specifically binding to core fucosylated alpha-fetoprotein and use thereof

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
KR1020160133665A KR20180041466A (en) 2016-10-14 2016-10-14 Antibody specifically binding to core fucosylated alpha-fetoprotein and use thereof

Publications (1)

Publication Number Publication Date
KR20180041466A true KR20180041466A (en) 2018-04-24

Family

ID=62084849

Family Applications (1)

Application Number Title Priority Date Filing Date
KR1020160133665A KR20180041466A (en) 2016-10-14 2016-10-14 Antibody specifically binding to core fucosylated alpha-fetoprotein and use thereof

Country Status (1)

Country Link
KR (1) KR20180041466A (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20220142621A (en) * 2021-04-15 2022-10-24 한국과학기술원 Method for predicting drug resistance of cancer cells based on protein glycosylation

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20220142621A (en) * 2021-04-15 2022-10-24 한국과학기술원 Method for predicting drug resistance of cancer cells based on protein glycosylation

Similar Documents

Publication Publication Date Title
CA2769427C (en) Anti-cmet antibody and its use for the detection and the diagnosis of cancer
IL223874A (en) Antibody for the diagnosis and/or prognosis of cancer
AU2017204683B2 (en) Compositions and methods for assessing the risk of cancer occurrence
AU2018242152B2 (en) Compositions and methods for detecting prostate cancer
KR20180041467A (en) Immunoassay using antibody specifically binding to core fucosylated alpha-fetoprotein
JP6977105B2 (en) IGF-1R antibody and its use for the diagnosis of cancer
AU2018246368B2 (en) Compositions and methods for detecting lung cancer
KR20180041466A (en) Antibody specifically binding to core fucosylated alpha-fetoprotein and use thereof
CN111303289B (en) Anti-human Tn-type glycosylated MUC1 antibody and application thereof
CN107709362B (en) IGF-1R antibodies and uses thereof for cancer diagnosis
JP6407990B2 (en) Augrin immunoassay
KR20200002190A (en) Anti-Sphingosine-1-Phosphate agent, production method, and uses thereof
KR20160093503A (en) anti-CRS monoclonal antibody and uses thereof
KR20160093502A (en) anti-EPRS monoclonal antibody and uses thereof
CN118667000A (en) Anti-HSA monoclonal antibody and application thereof
JP4803943B2 (en) Antibodies against hepatocyte growth factor activator inhibitor-1 and uses thereof